WO2017059397A1 - Labeling of antibodies - Google Patents
Labeling of antibodies Download PDFInfo
- Publication number
- WO2017059397A1 WO2017059397A1 PCT/US2016/055074 US2016055074W WO2017059397A1 WO 2017059397 A1 WO2017059397 A1 WO 2017059397A1 US 2016055074 W US2016055074 W US 2016055074W WO 2017059397 A1 WO2017059397 A1 WO 2017059397A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- sortase
- single domain
- domain antibody
- binding protein
- kda
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
- 0 Cc1nnc(-c2ccc(CNC(CON=Cc3ccc(*)cc3)=O)cc2)nn1 Chemical compound Cc1nnc(-c2ccc(CNC(CON=Cc3ccc(*)cc3)=O)cc2)nn1 0.000 description 7
- LWDUGATUDNIVEU-UHFFFAOYSA-N C=C1CC=CC1 Chemical compound C=C1CC=CC1 LWDUGATUDNIVEU-UHFFFAOYSA-N 0.000 description 1
- ZWKQKWLZKSZYAT-UHFFFAOYSA-N Cc1nnc(-c2ccc(CN)cc2)nn1 Chemical compound Cc1nnc(-c2ccc(CN)cc2)nn1 ZWKQKWLZKSZYAT-UHFFFAOYSA-N 0.000 description 1
- USQPJCOCOJEHRN-UHFFFAOYSA-N Cc1nnc(-c2ccc(CNC(c(cc3)ccc3F)=O)cc2)nn1 Chemical compound Cc1nnc(-c2ccc(CNC(c(cc3)ccc3F)=O)cc2)nn1 USQPJCOCOJEHRN-UHFFFAOYSA-N 0.000 description 1
- LSSQMISUDUUZCC-UHFFFAOYSA-N O=C(c(cc1)ccc1F)ON(C(CC1)=O)C1=O Chemical compound O=C(c(cc1)ccc1F)ON(C(CC1)=O)C1=O LSSQMISUDUUZCC-UHFFFAOYSA-N 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K51/00—Preparations containing radioactive substances for use in therapy or testing in vivo
- A61K51/02—Preparations containing radioactive substances for use in therapy or testing in vivo characterised by the carrier, i.e. characterised by the agent or material covalently linked or complexing the radioactive nucleus
- A61K51/04—Organic compounds
- A61K51/08—Peptides, e.g. proteins, carriers being peptides, polyamino acids, proteins
- A61K51/10—Antibodies or immunoglobulins; Fragments thereof, the carrier being an antibody, an immunoglobulin or a fragment thereof, e.g. a camelised human single domain antibody or the Fc fragment of an antibody
- A61K51/1093—Antibodies or immunoglobulins; Fragments thereof, the carrier being an antibody, an immunoglobulin or a fragment thereof, e.g. a camelised human single domain antibody or the Fc fragment of an antibody conjugates with carriers being antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K51/00—Preparations containing radioactive substances for use in therapy or testing in vivo
- A61K51/02—Preparations containing radioactive substances for use in therapy or testing in vivo characterised by the carrier, i.e. characterised by the agent or material covalently linked or complexing the radioactive nucleus
- A61K51/04—Organic compounds
- A61K51/08—Peptides, e.g. proteins, carriers being peptides, polyamino acids, proteins
- A61K51/10—Antibodies or immunoglobulins; Fragments thereof, the carrier being an antibody, an immunoglobulin or a fragment thereof, e.g. a camelised human single domain antibody or the Fc fragment of an antibody
- A61K51/1021—Antibodies or immunoglobulins; Fragments thereof, the carrier being an antibody, an immunoglobulin or a fragment thereof, e.g. a camelised human single domain antibody or the Fc fragment of an antibody against cytokines, e.g. growth factors, VEGF, TNF, lymphokines or interferons
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K51/00—Preparations containing radioactive substances for use in therapy or testing in vivo
- A61K51/02—Preparations containing radioactive substances for use in therapy or testing in vivo characterised by the carrier, i.e. characterised by the agent or material covalently linked or complexing the radioactive nucleus
- A61K51/04—Organic compounds
- A61K51/08—Peptides, e.g. proteins, carriers being peptides, polyamino acids, proteins
- A61K51/10—Antibodies or immunoglobulins; Fragments thereof, the carrier being an antibody, an immunoglobulin or a fragment thereof, e.g. a camelised human single domain antibody or the Fc fragment of an antibody
- A61K51/1027—Antibodies or immunoglobulins; Fragments thereof, the carrier being an antibody, an immunoglobulin or a fragment thereof, e.g. a camelised human single domain antibody or the Fc fragment of an antibody against receptors, cell-surface antigens or cell-surface determinants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/24—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
- C07K16/244—Interleukins [IL]
- C07K16/247—IL-4
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2833—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against MHC-molecules, e.g. HLA-molecules
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2839—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the integrin superfamily
- C07K16/2845—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the integrin superfamily against integrin beta2-subunit-containing molecules, e.g. CD11, CD18
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
- C12P21/00—Preparation of peptides or proteins
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y304/00—Hydrolases acting on peptide bonds, i.e. peptidases (3.4)
- C12Y304/22—Cysteine endopeptidases (3.4.22)
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/58—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving labelled substances
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/22—Immunoglobulins specific features characterized by taxonomic origin from camelids, e.g. camel, llama or dromedary
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/35—Valency
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/569—Single domain, e.g. dAb, sdAb, VHH, VNAR or nanobody®
Definitions
- PET Positron emission tomography
- Some aspects of the disclosure are based on the recognition that antibody binding fragments, and in particular the single domain antibody fragment VHH, show an improved ability to detect antigens in vivo when site specifically conjugated to a hydrophilic polymer (e.g., PEG) and a radiolabel (e.g. Zr).
- a hydrophilic polymer e.g., PEG
- a radiolabel e.g. Zr
- Such antibodies are useful for inter alia detecting tumors and lymphocyte infiltration into tumors in vivo.
- the present disclosure provides antibodies that are site specifically labeled with a hydrophilic polymer and/or a radiolabel, as well as methods of making and using such antibodies.
- immunotherapies such as the administration of monoclonal antibodies against immune checkpoint inhibitors (e.g., CTLA4, PD-1 on T cells, and PD-Ll) warrants the development of new methods, systems, and compositions for assessing whether an immunotherapy would be beneficial for treating patients.
- macrophages can affect tumor growth by establishing either a detrimental or favorable microenvironment.
- the ability to image the present of myeloid cells is of diagnostic and therpaeutic relevance and, compared to tumor- specific markers [1] , may be a more generally applicable approach for detection of tumor cells [2 ' 3] .
- Immune cells often invade or surround solid tumors [1] .
- immunotherapies such as the administration of monoclonal antibodies against immune checkpoint inhibitors (e.g., CTLA4, PD-1 on T cells, and PD-Ll) may be assessed by imaging the presence and/or distribution of immune cells (e.g., myeloid and/or lymphoid cells) in a subject, for example, in a tumor of the subject. Accordingly, new methods and compositions to explore and assess the microenvironment of tumors non- invasively are needed.
- immune checkpoint inhibitors e.g., CTLA4, PD-1 on T cells, and PD-Ll
- VHHs Camelid-derived single domain antibody fragments
- VHHs Both PEGylated and bivalent VHHs stained lymphoid organs and stained them more efficiently than their monovalent non-PEGylated counterparts.
- modified VHHs detected engrafted melanoma and pancreatic tumors -as small as ⁇ 1 mm in size- by virtue of their association with myeloid cells. Modified VHHs showed significant improvement in fluorescence imaging, especially for the PEGylated VHHs.
- VHHs were produced through application of sortase-mediated enzymatic
- VHHs transformations in combination with click chemistry.
- Mono- and bivalent VHHs were compared in in vitro (FACS) experiments, by two-photon microscopy on lymph nodes and spleen excised from mice injected with VHHs, and by non-invasive in vivo immuno-PET imaging.
- FDG-PET F-2-fluoro-2- deoxy-D-glucose positron emission tomography
- VHHs camelid single domain antibody fragments
- bivalent single domain antibodies based on their monovalent equivalents could address issues of avidity, while retaining desirable properties such as small size.
- the bivalent derivatives of single domain antibodies maybe small enough to penetrate tissues, be rapidly cleared from the circulation, yet benefit from increased avidity.
- tuning circulatory half-life could improve the staining efficiency of the targets by VHHs.
- Attachment of small PEG groups (e.g., PEGylation) or other hydrophilic polymers could be used as a tool to tune persistence of a VHH in the circulation.
- PEGylation can decrease the immunogenicity of VHHs, which is important in cases when repeated administration is required but in rare cases even the PEG functionality itself may be immunogenic 1121 .
- a method for introducing site specific hydrophilic polymer (e.g., PEG) and radiolabel (e.g., Zr)modifications onto single domain antibodies e.g., VHHs
- single domain antibodies e.g., VHHs
- the single domain antibodies provided herein are site specifically modified with PEG and a Zr.
- additional hydrophilic polymers and other radiolabels may be used to modify the antibodies (e.g., single domain antibodies) provided herein.
- Figures 1A-1B show site-specific labeling of single domain antibodies (VHHs) using sortase and design ( Figure 1A) as well as ( Figure IB) structures of the substrates.
- LPETG-GH 6 is SEQ ID NO: 5; GGH 6 is SEQ ID NO: 6; LPET is SEQ ID NO: 7; LPET-G3 is SEQ ID NO: 8.
- Figures 2A-2F show synthesis of VHH-derivatives ( Figure 2A and Figure 2B). Characterizations were performed on all the products ( Figure 2C and Figure 2D). Here is shown the LC-MS and SDS-PAGE analysis for DC 13. Numbers indicate the followings: #1 : marker, #2: DC 13, #3: DC13-DBCO, #4: DC13-azide-Texas Red, #5: DC 13-dimer-Texas Red, #6: DC13-azide-Alexa647, #7: DC13-dimer-Alexa647. ( Figures 2E-2F) PEGylation of VHHs and characterization.
- LPETG-XX is SEQ ID NO: 9; LPET-G3 is SEQ ID NO: 8; LPET-G 3 -Cys is SEQ ID NO: 10.
- Figures 3A-3D show dimers that are able to stain their targets with increased efficiency compared to their corresponding monomers; for Figure 3 A: cells were stained in vitro with the indicated concentrations of Alexa647-labeled VHH monomers or dimers; for Figure 3B: equal amount of DC8 monomer and DC8-dimer is injected IV. 2 h p.L, the mice are euthanized and spleens are excised for two-photon imaging. ( Figure 3C) Equal amount of DC8 with or without PEG, both equipped with Texas Red is injected IV. 3 h p.L, the mice are euthanized and spleens are excised for two-photon imaging.
- Figures 4A-4I show synthesis of F-Tetrazine.
- Figure 4B F- labeling of VHH-dimers, monomers or PEG- VHHs.
- Figure 4C radio-TLC analysis of the
- mice 2 h p.i. of F-DC8 dimer mice 2 h p.i. of F-DC8 dimer; letters indicate: CV: cervical lymph nodes; BM: bone marrow; GB: gallbladder; LV: liver; KD: kidneys; Ints: intestines; BL: bladder; SP: spinal cord.
- Figures 4F-4G PET images of WT ( Figure 4F) and CD l ib-/-
- Figures 5A-5D show postmortem biodistribution of F-VHHs in
- VHH monomer can block binding of F -VHH dimer onto the lymphoid organs.
- WT mice were
- Figures 6A-6H show LC-MS analysis of VHHs, their corresponding sortagged products and dimers. DC8 and its derivatives ( Figures 6A-6H).
- Figures 7A-7H show LC-MS analysis of VHHs, their corresponding sortagged products and dimers. DC13 and its derivatives ( Figures 7A-7H).
- Figure 8 Shows a table of radiochemical yield (non-decay corrected) and a radio HPLC chromatogram.
- the column was luna 5u C18 100 A 250 x 4.6 mm, the mobile phase was 60% CH3CN, 40% 0.1 M NH4 HC02(aq), and the flow rate was lmL/min.
- Figure 9 Shows a schematic of the GE TRACERlabTM FXFN radiosynthesis
- Figure 10 shows a semi-preparative HPLC trace of a typical radiosynthesis of [ F]- 5.
- Figure 11 shows the PD-10 cartridge was eluted with PBS (10 x 500 ⁇ ), and each fragment was collected into a new 1.5 mL tube.
- the desired product [ 18 F]-VHHs usually eluted at tubes #4-7.
- Characterization using [ 18 F]-DC8-dimer as an example: rTLC chromatography (left panel[18F]-Tz 5; right panel[ 18 F]-DC8-dimer; at 20 min).
- Figures 13A-13B show NMR spectra of [ 19 F]tetrazine 5 : ⁇ -NMR ( Figure 13 A) and 13 C-NMR ( Figure 13B).
- Figures 14A-14B show a schematic of a camelid heavy chain only antibody and a conventional IgG. A VHH portion is shown within the circle indicated by the arrow ( Figure 14A).
- Figure 14B is a schematic representation of site-specific labeling of VHHs using sortase.
- LPETG-XX is SEQ ID NO: 9.
- Figures 15A-15B shows the structure of the synthesized bi-orthogonal sortase substrate ( Figure 15A).
- the azide functionality allows installment of PEG groups, and DFO chelator is used to install radiometal 89 Zr allowing PET imaging.
- Figure 15B is a schematic representation of preparing PEGylated 89 Zr-labeled VHHs for PET imaging.
- Figures 16A-16B shows that Zr-PEGylated-VHH7 detects secondary lymphoid organs and B 16 tumor in a wild-type B6 mouse injected with B 16 tumor cells ( Figure 16A), and Zr-PEGylated-VHH7 detects secondary lymphoid organs a wild-type B6 mouse not injected with B 16 tumor cells ( Figure 16B).
- Antibodies are currently the fastest growing class of therapeutics. Although naked antibodies have proven their value as successful pharmaceuticals, they suffer from some limitations such as low tissue penetration and a long circulatory half-life. They have been conjugated to toxic payloads, PEGs or other polymers, or radioisotopes to increase and optimize their therapeutic efficacy. Although non-specific conjugation is suitable for most in vitro applications, for in vivo applications, site- specifically modified antibodies may have advantages. Provided herein is a novel approach in which an antibody fragment is tagged with two handles: one is used for the introduction of a fluorophore or radio-isotope, and the second one is used to further modify the fragment with functionalities including a PEG moiety or a second antibody fragment.
- Such modifications may improve desired properties (e.g., circulatory half-life or avidity).
- exemplary antibodies e.g., single domain antibodies
- epitopes such as Class II MHC, and CD1 lb
- a hydrophilic polymer e.g., PEG
- fluorophore e.g., PEG
- antibody refers to a protein belonging to the
- immunoglobulin superfamily The terms antibody and immunoglobulin are used.
- antibody encompasses not only intact (e.g., full-length) polyclonal or monoclonal antibodies, but also antigen-binding fragments thereof (such as Fab, Fab', F(ab')2, Fv), single chain (scFv), mutants thereof, fusion proteins comprising an antibody portion, humanized antibodies, chimeric antibodies, diabodies, linear antibodies, single chain antibodies, multispecific antibodies (e.g., bispecific antibodies) and any other modified configuration of the immunoglobulin molecule that comprises an antigen recognition site of the required specificity, including glycosylation variants of antibodies, amino acid sequence variants of antibodies, and covalently modified antibodies.
- mammalian antibodies are typically made of basic structural units each with two large heavy chains and two small light chains.
- antibody heavy chains There are several different types of antibody heavy chains, and several different kinds of antibodies, which are grouped into different isotypes based on which heavy chain they possess.
- Five different antibody isotypes are known in mammals, IgG, IgA, IgE, IgD, and IgM, which perform different roles, and help direct the appropriate immune response for each different type of foreign object they encounter.
- an antibody is an IgG antibody, e.g., an antibody of the IgGl, 2, 3, or 4 human subclass.
- Antibodies from mammalian species are within the scope of the term, as are antibodies from non-mammalian species (e.g., from birds, reptiles, amphibia) are also within the scope of the term, e.g., IgY antibodies.
- Suitable antibodies and antibody fragments for use in the context of some embodiments of the present invention include, for example, human antibodies, humanized antibodies, domain antibodies, F(ab'), F(ab') 2 , Fab, Fv, Fc, and Fd fragments, antibodies in which the Fc and/or FR and/or CDR1 and/or CDR2 and/or light chain CDR3 regions have been replaced by homologous human or non-human sequences; antibodies in which the FR and/or CDR1 and/or CDR2 and/or light chain CDR3 regions have been replaced by homologous human or non-human sequences; antibodies in which the FR and/or CDR1 and/or CDR2 and/or light chain CDR3 regions have been replaced by homologous human or non-human sequences; and antibodies in which the FR and/or CDR1 and/or CDR2 regions have been replaced by homologous human or non-human sequences.
- so-called single chain antibodies e.g., ScFv
- single domain antibodies camelid and camelized antibodies and fragments thereof, for example, VHH domains, or nanobodies, such as those described in patents and published patent applications of Ablynx NV and Domantis are also encompassed in the term antibody.
- chimeric antibodies e.g., antibodies comprising two antigen-binding domains that bind to different antigens, are also suitable for use in the context of some embodiments of the present invention.
- antibody may also refer to "antibody mimetics,” which are organic compounds the can specifically bind antigens, but are not structurally related to antibodies.
- antibody mimetics known as “affibodies,” or “affibody molecules,” are small proteins engineered to bind e.g., target proteins or peptides with affinities comparable to monoclonal antibodies.
- an affibody includes a protein scaffold based on the Z domain (the immunoglobulin G binding domain) of protein A, and in contrast to antibodies, affibody molecules are composed of alpha helices and lack disulfide bridges.
- antigen-binding antibody fragment refers to a fragment of an antibody that comprises the paratope, or a fragment of the antibody that binds to the antigen the antibody binds to, with similar specificity and affinity as the intact antibody.
- Antibodies e.g., fully human monoclonal antibodies, may be identified using phage display (or other display methods such as yeast display, ribosome display, bacterial display).
- Display libraries e.g., phage display libraries, are available (and/or can be generated by one of ordinary skill in the art) that can be screened to identify an antibody that binds to an antigen of interest, e.g., using panning.
- single domain antibody refers to an antibody, in which the complementarity determining regions (CDRs) are part of a single domain polypeptide, that is, the complementarity determining regions are all on a single polypeptide chain.
- single domain antibodies include, but are not limited to, heavy chain antibodies, antibodies naturally devoid of light chains, single domain antibodies derived from
- Single domain antibodies may be any of those known in the art, or any future single domain antibodies. Methods for making single domain antibodies and VHHs are known in the art and would be apparent to the skilled artisan. For example methods for making single domain antibodies and VHHs are provided in U.S. patent publication No.: US 2006/0034845, published on February 16, 2006, the entire contents of which are incorporated by reference herein. Single domain antibodies may be derived from any species including, but not limited to, mouse, rat, human, camel, llama, goat, rabbit, and bovine.
- a single domain antibody as used herein is a naturally occurring single domain antibody known as a heavy chain antibody devoid of light chains.
- Such single domain antibodies are disclosed in published international PCT application, WO 2013/024059, the entire contents of which are incorporated by reference herein.
- the variable domain derived from a heavy chain antibody naturally devoid of light chain is known as a VHH or nanobody to distinguish it from the conventional VH of four chain immunoglobulins.
- VHH molecule can be derived from antibodies raised in Camelidae species, for example, camel, dromedary, llama, vicuna, alpaca, and guanaco. Other species besides Camelidae may produce heavy chain antibodies naturally devoid of light chain; such VHHs are within the scope of the invention.
- a VHH or nanobody to distinguish it from the conventional VH of four chain immunoglobulins.
- a VHH molecule can be derived from antibodies raised in Camelidae species, for example, camel,
- VHH refers to the variable region of a heavy chain antibody, for example the heavy chain antibody from a camelid.
- VHHs useful in the present invention and as known to the skilled artisan, may be heavy chain variable domains derived from immunoglobulins naturally devoid of light chains such as those derived from Camelidae as described in published international PCT Applciation, WO 2013/024059, published on February 21, 2013 (and referred to hereinafter as VHH domains or nanobodies).
- VHH molecules are about lOx smaller than IgG molecules.
- VHH molecules are between lOkDa and 50kDa.
- VHH molecules are between lOkDa and 25kDa.
- VHH molecules are between 12 kDa and 16 kDa in size.
- VHHs lend themselves to sortase-catalyzed enzymatic transformations for a variety of purposes, including the installation of radioisotopes and/or PEG modifications for administration to a subject and imaging (e.g., PET imaging). They are single
- VHHs are stable, resisting extreme pH and temperature conditions. They have the advantage of specificity, small size, and rapid circulatory clearance ( ⁇ 30 min).
- the VHHs provided herein may be modified (e.g., with a polymer, such as PEG, and/or a detectable label) to yield improved properties for efficient detection of one or more molecules, proteins, or cells, for example, in vivo.
- VHHs are resistant to the action of proteases which is not the case for conventional antibodies.
- in vitro expression of VHHs produces properly folded functional VHHs in high yield.
- antibodies generated in Camelids will recognize epitopes other than those recognized by antibodies generated in vitro through the use of antibody libraries or via immunization of mammals other than Camelids (in published international PCT Applciation,WO
- VHHs are known to bind 'unusual' epitopes such as cavities or grooves (WO 2006/079372), the affinity of such VHHs may be more suitable for diagnostic purposes.
- Single domain antibodies useful in the present invention may be produced my any method known in the art.
- binding agent refers to any molecule that binds another molecule with high affinity. In some embodiments, a binding agent binds its binding partner with high specificity. Examples for binding agents include, without limitation, antibodies, antibody fragments, nucleic acid molecules, receptors, ligands, aptamers, and adnectins.
- click chemistry refers to a chemical philosophy introduced by K. Barry Sharpless of The Scripps Research Institute, describing chemistry tailored to generate covalent bonds quickly and reliably by joining small units comprising reactive groups together (see H. C. Kolb, M. G. Finn and K. B. Sharpless (2001). Click Chemistry: Diverse Chemical Function from a Few Good Reactions. Angewandte Chemie International Edition 40 (11): 2004-2021. Click chemistry does not refer to a specific reaction, but to a concept including, but not limited to, reactions that mimic reactions found in nature.
- click chemistry reactions are modular, wide in scope, give high chemical yields, generate inoffensive byproducts, are stereo specific, exhibit a large thermodynamic driving force to favor a reaction with a single reaction product, and/or can be carried out under physiological conditions.
- a click chemistry reaction exhibits high atom economy, can be carried out under simple reaction conditions, use readily available starting materials and reagents, uses no toxic solvents or uses a solvent that is benign or easily removed (preferably water), and/or provides simple product isolation by non-chromatographic methods (crystallisation or distillation).
- the click chemistry reaction is a [2+3] dipolar cyclo addition.
- the click chemistry reaction is a Diels-Alder cycloaddition.
- click chemistry handle refers to a reactant, or a reactive group, that can partake in a click chemistry reaction.
- exemplary click chemistry handles are demonstrated in U.S. Patent Publication 20130266512, which is incorporated by reference herein.
- a strained alkyne e.g., a cyclooctyne
- click chemistry handle since it can partake in a strain-promoted cycloaddition (see, e.g., Table 1).
- click chemistry reactions require at least two molecules comprising click chemistry handles that can react with each other.
- click chemistry handle pairs that are reactive with each other are sometimes referred to herein as partner click chemistry handles.
- an azide is a partner click chemistry handle to a cyclooctyne or any other alkyne.
- Exemplary click chemistry handles suitable for use according to some aspects of this invention are described herein, for example, in Tables 1 and 2.
- the click chemistry partners are a conjugated diene and an optionally substituted alkene
- the click chemistry partners are an optionally substituted tetrazine and an optionally substituted trans- cyclooctene (TCO).
- the click chemistry partners are optionally substituted tetrazine (Tz) and optionally substituted trans-cyclooctene (TCO).
- Tz and TCO react with each other in a reverse-electron demand Diels-Alder cycloaddition reaction (See e.g., Example 2, Figure 4; Blackman et ah, "The Tetrazine Ligation: Fast Bioconjugation based on Inverse-electron-demand Diels-Alder Reactivity.” J. Am. Chem. Soc. 2008; 130, 13518-13519).
- the click chemistry partners are an optionally substituted alkyne and an optionally substituted azide.
- a difluorinated cyclooctyne, a dibenzocyclooctyne, a biarylazacyclooctynone, or a cyclopropyl-fused bicyclononyne can be paired with an azide as a click chemistry pair.
- the click chemistry partners are reactive dienes and suitable tetrazine dienophiles.
- TCO, norbornene, or biscyclononene can be paired with a suitable tetrazine dienophile as a click chemistry pair.
- tetrazoles can act as latent sources of nitrile imines, which can pair with unactivated alkenes in the presence of ultraviolet light to create a click chemistry pair, termed a "photo-click" chemistry pair.
- the click chemistry pair may also be a cysteine and a maleimide.
- the cysteine from a peptide e.g., GGGC (SEQ ID NO: 12)
- a maleimide e.g., NOTA
- click chemistry handles are known to those of skill in the art (See, e.g., Table 1; Spicer et ah, "Selective chemical protein modification.” Nature Communications. 2014; 5:4740).
- the click chemistry handles of the molecules have to be reactive with each other, for example, in that the reactive moiety of one of the click chemistry handles can react with the reactive moiety of the second click chemistry handle to form a covalent bond.
- Such reactive pairs of click chemistry handles are well known to those of skill in the art and include, but are not limited to, those described in Table 1.
- Table 1 Exemplary click chemistry handles and reactions.
- Each of R , R , and R is indpendently hydrogen, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, optionally substituted heteroaryl, or optionally substituted heterocyclyl.
- at least one of R 41 , R 42 , and R 43 independently comprises a sortase recognition motif.
- one of R 41 , R 42 , and R 43 independently comprises a sortase recognition motif.
- two of R 41 , R 42 , and R 43 independently comprise a sortase recognition motif.
- each of R 41 , R 42 , and R 43 independently comprises a sortase recognition motif.
- R 41 , R 42 , and R 43 is independently R R -LPXT-[X] y - (SEQ ID NO: 22), wherein each occurrence of X independently represents any amino acid residue; each occurrence of y is an integer between 0 and 10, inclusive; and each occurrence of R R independently represents a protein or an agent (e.g., a protein, peptide, a detectable label, a binding agent, a small molecule), and, optionally, a linker.
- Each instance of R 3 is independently H, substituted or unsubstituted alkyl (e.g., -CH 3 ), or substituted or unsubstituted aryl.
- click chemistry handles used can react to form covalent bonds in the absence of a metal catalyst.
- click chemistry handles are well known to those of skill in the art and include the click chemistry handles described in Becer,
- N 2 is the only by-product
- conjugated refers to an association of two molecules, for example, two proteins or a protein and an agent, e.g. , a small molecule, with one another in a way that they are linked by a direct or indirect covalent or non-covalent interaction.
- agent e.g. , a small molecule
- the association is covalent, and the entities are said to be “conjugated” to one another.
- a protein is post-translationally conjugated to another molecule, for example, a second protein, a small molecule, a detectable label, a click chemistry handle, or a binding agent, by forming a covalent bond between the protein and the other molecule after the protein has been formed, and, in some embodiments, after the protein has been isolated.
- two molecules are conjugated via a linker connecting both molecules.
- the two proteins may be conjugated via a polypeptide linker, e.g. , an amino acid sequence connecting the C-terminus of one protein to the N-terminus of the other protein.
- two proteins are conjugated at their respective C-termini, generating a C-C conjugated chimeric protein. In some embodiments, two proteins are conjugated at their respective N-termini, generating an N-N conjugated chimeric protein. In some embodiments, conjugation of a protein to a peptide is achieved by transpeptidation using a sortase. See, e.g., Ploegh et al., International PCT Patent Application, PCT/US2010/000274, filed February 1, 2010, published as
- conjugation of a protein to a peptide or other moiety may be achieved using other enzymes known in the art, for example, formylglycine generating enzyme, sialyltransferase, phosphopantetheinyltransferase, transglutaminase, farnesyltransferase, biotin ligase, lipoic acid ligase, or N-myristoyl transferase.
- formylglycine generating enzyme sialyltransferase, phosphopantetheinyltransferase, transglutaminase, farnesyltransferase, biotin ligase, lipoic acid ligase, or N-myristoyl transferase.
- sialyltransferase sialyltransferase
- phosphopantetheinyltransferase phosphopantetheinyltransferase
- transglutaminase transgluta
- a “detectable label” refers to a moiety that has at least one element, isotope, or functional group incorporated into the moiety which enables detection of the molecule, e.g., a protein or polypeptide, or other entity, to which the label is attached.
- Labels can be directly attached (i.e., via a bond) or can be attached by a tether (such as, for example, an optionally substituted alkylene; an optionally substituted alkenylene; an optionally substituted alkynylene; an optionally substituted heteroalkylene; an optionally substituted heteroalkenylene; an optionally substituted hetero alkynylene; an optionally substituted arylene; an optionally substituted heteroarylene; or an optionally substituted acylene, or any combination thereof, which can make up a tether).
- a tether such as, for example, an optionally substituted alkylene; an optionally substituted alkenylene; an optionally substituted alkynylene; an optionally substituted heteroalkylene; an optionally substituted heteroalkenylene; an optionally substituted hetero alkynylene; an optionally substituted arylene; an optionally substituted heteroarylene; or an optionally substituted acylene, or any combination thereof, which can make up
- a label can fall into any one (or more) of five classes: a) a label which contains isotopic moieties, which may be radioactive or heavy isotopes, including, but not limited to, 2 H, 3 ⁇ 4 13 C, 14 C, 15 N, 18 F, 31 P, 32 P, 35 S, 67 Ga, 76 Br, 99m Tc (Tc-99m), m In, 123 I, 125 I, 131 I, 153 Gd, 169 Yb, and 186 Re; b) a label which contains an immune moiety, which may be antibodies or antigens, which may be bound to enzymes (e.g., such as horseradish
- a label which is a colored, luminescent, phosphorescent, or fluorescent moieties (e.g., such as the fluorescent label fluoresceinisothiocyanat (FITC); d) a label which has one or more photo affinity moieties; and e) a label which is a ligand for one or more known binding partners (e.g. , biotin-streptavidin, FK506-FKBP).
- a label comprises a radioactive isotope, preferably an isotope which emits detectable particles, such as ⁇ particles.
- the label comprises a fluorescent moiety.
- the label comprises a fluorophore.
- the label is the fluorescent label fluoresceinisothiocyanat (FITC).
- the label comprises a ligand moiety with one or more known binding partners.
- the label comprises biotin.
- a label is a fluorescent polypeptide (e.g. , GFP or a derivative thereof such as enhanced GFP (EGFP)) or a luciferase (e.g., a firefly, Renilla, or Gaussia luciferase).
- a label may react with a suitable substrate (e.g., a luciferin) to generate a detectable signal.
- suitable substrate e.g., a luciferin
- fluorescent proteins include GFP and derivatives thereof, proteins comprising chromophores that emit light of different colors such as red, yellow, and cyan fluorescent proteins, etc.
- Exemplary fluorescent proteins include, e.g., Sirius, Azurite, EBFP2, TagBFP, mTurquoise, ECFP, Cerulean, TagCFP, mTFPl, mUkGl, mAGl, AcGFPl, TagGFP2, EGFP, mWasabi, EmGFP, TagYPF, EYFP, Topaz, SYFP2, Venus, Citrine, mKO, mK02, mOrange, mOrange2, TagRFP, TagRFP-T, mStrawberry, mRuby, mCherry, mRaspberry, mKate2, mPlum, mNeptune, T- Sapphire, mAmetrine, mKeima.
- a label comprises a dark quencher, e.g., a substance that absorbs excitation energy from a fluorophore and dissipates the energy as heat.
- any of the antibodies (e.g. single domain antibodies) and/or methods of making said antibodies provided herein comprise a radionuclide.
- the radionuclide is 2 H, 3 H, U C, 13 C, 14 C, 61 Cu, 62 Cu, 13 N, 15 N, 15 0, 18 F, 31 P, 32 P, 35 S, 67 Ga, 68 Ga, 76 Br, 99m Tc (Tc-99m), m In, 123 1, 124 I, 125 I, 131 I, 153 Gd, 89 Zr, 86 Y, 169 Yb, 82 Rb, or 186 Re.
- the radionuclide is not 18 F. In other embodiments, the radionuclide is not Zr.
- linker refers to a chemical group or molecule covalently linked to a molecule, for example, a protein, and a chemical group or moiety, for example, a click chemistry handle.
- the linker is positioned between, or flanked by, two groups, molecules, or moieties and connected to each one via a covalent bond, thus connecting the two.
- the linker comprises one or more atoms.
- the linker comprises between 1 and 500 atoms.
- the linker comprises between 1 and 10, 1 and 15, 1 and 20, 1 and 50, 1 and 100, 1 and 150, 1 and 200, 1 and 250, 1 and 300, 1 and 350, 1 and 400, and 1 and 450 atoms.
- the linker is an amino acid or a plurality of amino acids.
- the linker comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or more than 20 amino acids.
- the linker comprises a poly- glycine sequence.
- the linker comprises a non-protein structure.
- the linker is an organic molecule, group, polymer, or chemical moiety (e.g., poylethylene, polyethylene glycol).
- sortase refers to an enzyme able to carry out a transpeptidation reaction conjugating the C-terminus of a protein or peptide to the N-terminus of a protein or peptide via transamidation. Sortases are also referred to as transamidases, and typically exhibit both a protease and a transpeptidation activity. Various sortases from prokaryotic organisms have been identified. For example, some sortases from Gram-positive bacteria cleave and translocate proteins to proteoglycan moieties in intact cell walls.
- a transamidase used in accordance with the present invention is sortase A, e.g., from S. aureus, also referred to herein as SrtA aureus .
- a transamidase is a sortase B, e.g., from S. aureus, also referred to herein as SrtB au reus-
- Sortases have been classified into four classes, designated A , B, C, and D, designated sortase A, sortase B, sortase C, and sortase D, respectively, based on sequence alignment and phylogenetic analysis of 61 sortases from Gram-positive bacterial genomes (Dramsi S, Trieu-Cuot P, Bierne H, Sorting sortases: a nomenclature proposal for the various sortases of Gram-positive bacteria. Res Microbiol.156(3):289-97, 2005; the entire contents of which are incorporated herein by reference). These classes correspond to the following subfamilies, into which sortases have also been classified by Comfort and Clubb (Comfort D, Clubb RT.
- sortase A is used herein to refer to a class A sortase, usually named SrtA in any particular bacterial species, e.g., SrtA from S. aureus.
- sortase B is used herein to refer to a class B sortase, usually named SrtB in any particular bacterial species, e.g., SrtB from S. aureus.
- the invention encompasses embodiments relating to a sortase A from any bacterial species or strain.
- the invention encompasses embodiments relating to a sortase B from any bacterial species or strain.
- the invention encompasses embodiments relating to a class C sortase from any bacterial species or strain.
- the invention encompasses embodiments relating to a class D sortase from any bacterial species or strain.
- amino acid sequences of Srt A and Srt B and the nucleotide sequences that encode them are known to those of skill in the art and are disclosed in a number of references cited herein, the entire contents of all of which are incorporated herein by reference.
- the amino acid sequence of a sortase-transamidase from Staphylococcus aureus also has substantial homology with sequences of enzymes from other Gram-positive bacteria, and such transamidases can be utilized in the ligation processes described herein. For example, for SrtA there is about a 31 % sequence identity (and about 44% sequence similarity) with best alignment over the entire sequenced region of the S. pyogenes open reading frame.
- a transamidase bearing 18% or more sequence identity, 20% or more sequence identity, 30% or more sequence identity, 40% or more sequence identity, or 50% or more sequence identity with an S. pyogenes, A. naeslundii, S. mutans, E. faecalis or B. subtilis open reading frame encoding a sortase can be screened, and enzymes having transamidase activity comparable to Srt A or Srt B from S. aureas can be utilized (e.g., comparable activity sometimes is 10% of Srt A or Srt B activity or more).
- the sortase is a sortase A (SrtA).
- SrtA recognizes the motif (e.g., the sortase recognition motif) LPXTX (wherein each occurrence of X represents independently any amino acid residue) (SEQ ID NO: 15), with common recognition motifs being, e.g., LPKTG (SEQ ID NO: 23), LPATG (SEQ ID NO: 24), LPNTG (SEQ ID NO: 25).
- LPETG SEQ ID NO: 11
- motifs falling outside this consensus may also be recognized.
- the motif comprises an 'A' rather than a ' at position 4, e.g., LPXAG (SEQ ID NO: 17), e.g., LPNAG (SEQ ID NO: 26).
- the motif comprises an 'A' rather than a 'G' at position 5, e.g., LPXTA (SEQ ID NO: 27), e.g., LPNTA (SEQ ID NO: 28), e.g., LPETA (SEQ ID NO: 29).
- the motif comprises a 'G' rather than 'P' at position 2, e.g., LGXTG (SEQ ID NO: 30), e.g., LGATG (SEQ ID NO: 31).
- the motif comprises an T rather than 'L' at position 1, e.g., IPXTG (SEQ ID NO: 32), e.g., IPNTG (SEQ ID NO:33) or IPETG (SEQ ID NO: 34).
- IPXTG SEQ ID NO: 32
- IPNTG SEQ ID NO:33
- IPETG SEQ ID NO: 34
- the sortase is a sortase B (SrtB), e.g., a sortase B of S. aureus, B. anthracis, or L. monocytogenes.
- Motifs recognized by sortases (sortase recognition motifs) of the B class (SrtB) often fall within the consensus sequences NPXTX (SEQ ID NO: 16), e.g., NP[Q/K]-[T/s]-[N/G/s] (SEQ ID NO: 35), such as NPQTN (SEQ ID NO: 36) or NPKTG (SEQ ID NO: 37).
- anthracis cleaves the NPQTN (SEQ ID NO:36) or NPKTG (SEQ ID NO:37) motif of IsdC in the respective bacteria (see, e.g., Marraffini, L. and Schneewind, O., Journal of Bacteriology, 189(17), p. 6425-6436, 2007).
- Other recognition motifs found in putative substrates of class B sortases are NSKTA (SEQ ID NO: 38), NPQTG (SEQ ID NO: 39), NAKTN (SEQ ID NO:40), and NPQSS (SEQ ID NO: 41).
- SrtB from L.
- monocytogenes recognizes certain motifs lacking P at position 2 and/or lacking Q or K at position 3, such as NAKTN (SEQ ID NO: 40) and NPQSS (SEQ ID NO:41) (Mariscotti JF, Garcia-Del Portillo F, Pucciarelli MG.
- NAKTN SEQ ID NO: 40
- NPQSS SEQ ID NO:41
- the listeria monocytogenes sortase-B recognizes varied amino acids at position two of the sorting motif. J Biol Chem. 2009 Jan 7.
- the sortase is a sortase C (Srt C).
- Sortase C may utilize LPXTX (SEQ ID NO: 15) as a recognition motif, with each occurrence of X independently representing any amino acid residue.
- the sortase is a sortase D (Srt D).
- Sortases in this class are predicted to recognize motifs with a consensus sequence NA-[E/A/S/H]-TG (SEQ ID NO: 42) (Comfort D, supra). Sortase D has been found, e.g., in Streptomyces spp.,
- LPXTA SEQ ID NO: 43
- LAXTG SEQ ID NO:44
- sortase D e.g., of subfamilies 4 and 5, respectively subfamily-4 and subfamily- 5 enzymes process the motifs LPXTA (SEQ ID NO: 27) and LAXTG (SEQ ID NO: 44), respectively).
- B. anthracis Sortase C has been shown to specifically cleave the LPNTA (SEQ ID NO: 28) motif in B. anthracis Basl and BasH (see Marrafini, supra).
- sortases that recognizes QVPTGV (SEQ ID NO: 45) motif
- QVPTGV SEQ ID NO: 45
- Additional sortases including, but not limited to, sortases and sortase variants recognizing additional sortase recognition motifs are also suitable for use in some embodiments of this invention. For example, sortases described in Chen I.
- a variant of a naturally occurring sortase may be used. Such variants may be produced through processes such as directed evolution, site-specific modification, etc.
- sortase enzymes e.g., sortase A enzymes
- NMR or crystal structures of SrtA alone or bound to a sortase recognition sequence see, e.g., Zong Y, et al. J. Biol Chem. 2004, 279, 31383- 31389).
- Three dimensional structure information is also available for other sortases, e.g., S. pyogenes SrtA (Race, PR, et al., J Biol Chem.
- S. aureus SrtA comprises His at position 120, Cys at position 184, and Arg at position 197, wherein Cys at position 184 is located within a TLXTC (SEQ ID NO: 46) motif.
- a sortase variant comprises a sequence at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a wild type sortase A sequence or catalytic domain thereof, e.g., at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to amino acids 60- 206 of SEQ ID NO: 47 or SEQ ID NO: 48, or at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to amino acids 26-206 of SEQ ID NO: 47 or SEQ ID NO: 48.
- a sortase variant comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 amino acid substitutions relative to amino acids 60 - 206 of SEQ ID NO: 47 or relative to amino acids 26 - 206 of SEQ ID NO: 47 or SEQ ID NO: 48.
- a transamidase having higher transamidase activity than a naturally occurring sortase may be used.
- the activity of the transamidase is at least about 10, 15, 20, 40, 60, 80, 100, 120, 140, 160, 180, or 200 times as high as that of S. aureus sortase A.
- the activity is between about 10 and 50 times as high as that of S. aureus sortase A, e.g., between about 10 and 20 times as high, between about 20 and 30 times as high, between about 30 and 50 times as high.
- the activity is between about 50 and about 150 times as high as that of S.
- aureus sortase A e.g., between about 50 and 75 times as high, between about 75 and 100 times as high, between about 100 - 125 times as high, or between about 125 and 150 times as high.
- S. aureus sortase A with up to a 140-fold increase in LPETG- coupling (SEQ ID NO: 11) activity compared with the starting wild-type enzyme have been identified (Chen, I., et al., PNAS 108(28): 11399-11404, 2011).
- a sortase variant is used in a composition or method of the invention.
- a sortase variant comprises any one or more of the following substitutions relative to a wild type S. aureus SrtA: P94S or P94R, D160N, D165A, K190E, and K196T mutations.
- substitutions utilize standard notation of the form X 1 NX 2, in which Xi and X 2i represent amino acids and N represents an amino acid position, Xi represents an amino acid present in a first sequence (e.g., a wild type S. aureus SrtA sequence), and X 2 represents an amino acid that is substituted for Xi at position N, resulting in a second sequence that has X 2 at position N instead of Xi.
- a first sequence e.g., a wild type S. aureus SrtA sequence
- X 2 represents an amino acid that is substituted for Xi at position N, resulting in a second sequence that has X 2 at position N instead of Xi.
- the present disclosure is not intended to be limited in any way by the identity of the original amino acid residue Xi that is present at a particular position N in a wild type SrtA sequence used to generate a SrtA variant and is replaced by X 2 in the variant. Any substitution which results in the specified amino acid residue at a position specified herein is contemplated by the disclosure. Thus a substitution may be defined by the position and the identity of X 2 , whereas Xi may vary depending, e.g., on the particular bacterial species or strain from which a particular SrtA originates.
- a sortase A variant comprises any one or more of the following: an S residue at position 94 (S94) or an R residue at position 94 (R94), an N residue at position 160 (N160), an A residue at position 165 (A165) , an E residue at position 190 (E190), a T residue at position 196 (T196) (numbered according to the numbering of a wild type SrtA, e.g., SEQ ID NO: 47).
- a sortase A variant comprises two, three, four, or five of the afore-mentioned mutations relative to a wild type S. aureus SrtA (e.g., SEQ ID NO: 47).
- a sortase A variant comprises an S residue at position 94 (S94) or an R residue at position 94 (R94), and also an N residue at position 160 (N160), an A residue at position 165 (A 165) , and a T residue at position 196 (T196).
- a sortase A variant comprises P94S or P94R, and also D160N, D165A, and K196T.
- a sortase A variant comprises an S residue at position 94 (S94) or an R residue at position 94 (R94) and also an N residue at position 160 (N160), A residue at position 165 (A165), a E residue at position 190, and a T residue at position 196.
- a sortase A variant comprises P94S or P94R, and also D160N, D165A, K190E, and K196T.
- a sortase A variant comprises an R residue at position 94 (R94), an N residue at position 160 (N160), a A residue at position 165 (A165), E residue at position 190, and a T residue at position 196.
- a sortase comprises P94R, D160N, D165A, K190E, and K196T.
- wild-type sequences of sortase A may vary, e.g., SrtA from various species may have gaps, insertions, and/or may vary in length relative to the amino acid sequence of exemplary wild-type S. aureus SrtA.
- positions described herein in regard to substitutions or other alterations pertain to the sequence of exemplary wild type S. aureus SrtA, unless otherwise indicated, and that such positions may be adjusted when making corresponding substitutions in different bacterial SrtA sequences in order to account for such gaps, insertions, and/or length differences.
- certain sortase variants comprise a substitution at amino acid position 94 (e.g., the amino acid is changed to an S residue).
- the amino acid at position 94 in S. aureus SrtA may correspond to an amino acid at a different position (e.g., position Z) in SrtA from a second bacterial species when the sequences are aligned.
- position 94 based on the wild type S. aureus SrtA sequence numbering
- any original wild-type sortase A sequence to be used for generating a SrtA variant with an exemplary wild-type S. aureus sortase A sequence for purposes of determining the positions in the original wild-type sortase A sequence that correspond to the exemplary wild-type S. aureus sortase A sequence when taking into account gaps and/or insertions in the alignment of the two sequences.
- amino acids at position 94, 160, 165, 190, and/or 196 are altered in a variant as compared with the amino acids present at those positions in a wild type
- S. aureus SrtA and the other amino acids of the variant are identical to those present at the corresponding positions in a wild type SrtA, e.g., a wild type S. aureus SrtA.
- one or more of the other amino acids of a variant e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 of the other amino acids differ from those present at corresponding position(s) in a wild type SrtA, e.g., a wild type S. aureus SrtA.
- a variant may have any of the properties or degrees of sequence identity specified in the definition of "variants" above.
- RefSeq Acc. No. YP_187332.1; GenBank Acc. No. AAD48437) has a K residue at position
- Either or both of these amino acids may be present in or introduced into any SrtA sequence, e.g., any S. aureus SrtA sequence, whether naturally occurring or generated by man.
- any sortase sequence may further comprise a tag (e.g., 6XHis), a spacer, or both.
- the N- or C-terminus may be extended to encompass a tag, optionally separated from the rest of the sequence by a spacer,
- a sortase variant comprising the following sequence may be used, in which amino acid substitutions relative to a wild type S. aureus SrtA of SEQ ID NO: 47 or SEQ ID NO: 48 are shown in underlined bold letters: MQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATREQLNRGVSFAEENESLDDQNISI AGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRNVKPTAVEVLDEQK GKDKQLTLITCDDYNEETGVWETRKIFVATEVK (SEQ ID NO: 49).
- amino acids 2-148 of the above sequence correspond to amino acids 60-206 of the full length S. aureus SrtA sequence (the catalytic domain).
- the "R" residue at position 36 of SEQ ID NO: 49 corresponds to the "P" residue at position 94 in SEQ ID NO: 47 or 48.
- sortase variants that have other substitutions at one or more of positions 94, 160, 165, 190, and 196 (numbered according to the numbering of SEQ ID NO: 47 or 48), e.g., wherein such substitutions utilize an amino acid that would be a conservative substitution at the relevant position as compared with the sequence of SEQ ID NO: 49.
- sortases found in any gram-positive organism such as those mentioned herein and/or in the references (including databases) cited herein is contemplated in the context of some embodiments of this invention.
- sortases found in gram negative bacteria e.g., Colwellia psychrerythraea, Microbulbifer degradans, Bradyrhizobium japonicum, Shewanella oneidensis, and Shewanella putrefaciens .
- sortases recognize sequence motifs outside the LPXTX (SEQ ID NO: 15) consensus, for example, LP[Q/K]T[A/S]T (SEQ ID NO: 50).
- a sequence motif LPXT[A/S] (SEQ ID NO: 51), e.g., LPXTA (SEQ ID NO:27) or LPSTS (SEQ ID NO: 52) may be used.
- the sortase recognition motif is selected from: LPKTG (SEQ ID NO: 23), LPITG (SEQ ID NO: 53), LPDTA (SEQ ID NO: 54), SPKTG (SEQ ID NO:55), LAETG (SEQ ID NO: 56), LAATG (SEQ ID NO: 57), LAHTG (SEQ ID NO: 58), LASTG (SEQ ID NO: 59), LPLTG (SEQ ID NO: 60), LSRTG (SEQ ID NO: 61), LPETG (SEQ ID NO: 11), VPDTG (SEQ ID NO: 62), IPQTG (SEQ ID NO: 63), YPRRG (SEQ ID NO: 64), LPMTG (SEQ ID NO:65), LAFTG (SEQ ID NO: 66), LPQTS (SEQ ID NO: 23), LPITG (SEQ ID NO: 53), LPDTA (SEQ ID NO: 54), SPKTG (SEQ ID NO:55), LAETG (SEQ ID NO: 56), LAATG
- the sequence used may be LPXT (SEQ ID NO: 22), LAXT (SEQ ID NO: 68), LPXA (SEQ ID NO: 69), LGXT (SEQ ID NO: 70), IPXT (SEQ ID NO: 71), NPXT (SEQ ID NO: 72), NPQS (SEQ ID NO: 73), LPST (SEQ ID NO: 74), NSKT (SEQ ID NO: 75), NPQT (SEQ ID NO: 76), NAKT (SEQ ID NO: 77), LPIT (SEQ ID NO: 78), LAET (SEQ ID NO: 79), or NPQS (SEQ ID NO: 80).
- the invention encompasses embodiments in which 'X' in any sortase recognition motif disclosed herein or known in the art is amino acid, for example, any naturally occurring or any non-naturally occurring amino acid.
- X is selected from the 20 standard amino acids found most commonly in proteins found in living organisms.
- the recognition motif is LPXTG (SEQ ID NO: 81) or LPXT (SEQ ID NO: 22)
- X is D, E, A, N, Q, K, or R.
- X in a particular recognition motif is selected from those amino acids that occur naturally at position 3 in a naturally occurring sortase substrate.
- X is selected from K, E, N, Q, A in an LPXTG (SEQ ID NO: 81) or LPXT (SEQ ID NO: 22)motif where the sortase is a sortase A.
- X is selected from K, S, E, L, A, N in an LPXTG (SEQ ID NO: 81) or LPXT (SEQ ID NO: 22) motif and a class C sortase is used.
- a sortase recognition sequence further comprises one or more additional amino acids, e.g. , at the N- or C-terminus.
- additional amino acids e.g., at the N- or C-terminus.
- amino acids e.g., up to five amino acids
- Such additional amino acids may provide context that improves the recognition of the recognition motif.
- sortase recognition motif refers to any molecule that is recognized by a sortase, for example, any molecule that can partake in a sortase-mediated transpeptidation reaction.
- sortase recognition motif and sortase recognition sequence are used interchangeably.
- a typical sortase-mediated transpeptidation reaction involves a substrate comprising a C-terminal sortase recognition motif, e.g., an LPXTX (SEQ ID NO: 15) motif, and a second substrate, referred to herein as a "sortase substrate.”
- a sortase substrate is a chemical moiety that can partake in a sortase-mediated transpeptidation reaction with a sortase recognition motif.
- the sortase substrate is a polyglycine or polyalanine.
- the sortase substrate comprises an alkylamine group.
- the sortase substrate is N-terminal.
- the sortase substrate is C-terminal
- a sortase substrate, or substrate recognition motif though described as being "C-terminal” or N- terminal is not required to be at the immediate C- or N-terminus.
- other amino acids for example a tag (e.g. , a 6xHis-tag), are found at the immediate C-terminus of a protein comprising a C-terminal sortase recognition motif, and the C-terminal sortase recognition motif is adjacent (e.g. , within 5, 10, 15 or 20 amino acids) thereto.
- a sortase recognition motif may be a peptide or a protein, for example, a peptide comprising a sortase recognition motif such as an LPXTX (SEQ ID NO: 15).
- a sortase substrate is a polyglycine a polyalanine, or an alkylamine group wherein the peptide is conjugated to an agent, e.g., a radiolabeled compound or small molecule. Accordingly, both proteins and non-protein molecules can be sortase substrates. Some examples of sortase substrates are described in more detail elsewhere herein and additional suitable sortase substrates will be apparent to the skilled artisan. The invention is not limited in this respect.
- sortagging refers to the process of adding a tag or agent, e.g., a moiety or molecule, for example, a radiolabeled compound or small molecule, onto a target molecule, for example, a target protein for use in PET applications via a sortase- mediated transpeptidation reaction.
- tags include, but are not limited to, amino acids, nucleic acids, polynucleotides, sugars, carbohydrates, polymers, lipids, fatty acids, and small molecules.
- Other suitable tags will be apparent to those of skill in the art and the invention is not limited in this aspect.
- a tag comprises a sequence useful for purifying, expressing, solubilizing, and/or detecting a polypeptide.
- a tag can serve multiple functions.
- a tag comprises an HA, TAP, Myc, 6xHis, Flag, streptavidin, biotin, or GST tag, to name a few examples.
- a tag is cleavable, so that it can be removed, e.g., by a protease. In some embodiments, this is achieved by including a protease cleavage site in the tag, e.g., adjacent or linked to a functional portion of the tag.
- Exemplary proteases include, e.g., thrombin, TEV protease, Factor Xa, PreScission protease, etc.
- a "self-cleaving" tag is used. See, e.g., Wood et ah, International PCT Application PCT/US2005/05763, filed on February 24, 2005, and published as
- subject includes, but is not limited to, vertebrates, more specifically a mammal ⁇ e.g., a human, horse, pig, rabbit, dog, sheep, goat, non-human primate, cow, cat, guinea pig or rodent), a fish, a bird or a reptile or an amphibian.
- the subject is a human subject.
- patient refers to a subject afflicted with a disease or disorder.
- patient includes human and veterinary subjects of any sex or stage of development.
- target protein refers to a protein that is modified by the conjugation of an agent, for example a radioactive agent that renders the protein suitable for diagnostic and/or therapeutic applications, such as PET imaging.
- agent for example a radioactive agent that renders the protein suitable for diagnostic and/or therapeutic applications, such as PET imaging.
- target protein may refer to a wild type or naturally occurring form of the respective protein, or to an engineered form, for example, to a recombinant protein variant comprising a sortase recognition motif not contained in a wild-type form of the protein.
- modifying a target protein refers to a process of altering a target protein comprising a sortase recognition motif via a sortase-mediated transpeptidation reaction.
- the modification leads to the target protein being conjugated to an agent, for example, a peptide, protein, detectable label, or small molecule.
- the modification provides radiolabeled proteins.
- Some aspects of the disclosure provide antibodies (e.g., single domain antibodies) comprising a hydrophilic polymer and a detectable label. Other aspects of the disclosure provide methods for conjugating hydrophilic polymers and/or detectable labels to antibodies (e.g., single domain antibodies). In some embodiments, such antibodies are useful for imaging, for example a tumor, a tissue, or an organ in a subject. It should be appreciated that any of the antibodies provided herein may bind to a particular antigen. In some
- any of the antibodies provided herein may be produced, for example, by immunizing a subject (e.g., research animal) with an antigen, or using other methods, such as phage display.
- an antibody is said to bind to an antigen if it is capable of binding to said antigen with an affinity better than 10 ⁇ 6 M.
- an antibody is said to bind to an antigen if it is capable of binding to said antigen with an affinity better than 10 "6 M, 10 "7 M, 10 "8 M, 10 "9 M, 10 "10 M, or 10 "11 M.
- any of the antibodies may be humanized.
- Methods of humanizing antibodies are known in the art and would be apparent to the skilled artisan.
- Technology to humanize camelid VHHs has been developed (see e.g., Vincke et al., J. Biol. Chem. 2009, 284, 3273-3284; which is incorporated herein by reference), and several VHHs have been used already in a number of phase I and phase II clinical trials for therapeutic applications (see, e.g., De Meyer et al., Trends Biotechnol. 2014, 32, 263-270; which is incorporated herein by reference). Accordingly, in some
- methods for using VHHs are provided.
- the methods include detecting an epitope in a subject.
- the methods include detecting a lymphocyte, e.g., in a tumor of a subject.
- the methods include determining whether a subject will respond to a therapeutic agent.
- any of the antibodies provided herein bind to any immune cell.
- immune cells include T-cells, B-cells, plasma cells, macrophages, dendritic cells, neutrophils, eosinophils, or mast cells.
- the antibody binds to a marker of inflammation.
- the antibody useful in diagnostic applications involving PET is referred to as immunoPET (See, e.g., Knowles et al., "Advances in immuno-positron emission tomography: antibodies for molecular imaging in oncology.” Clin Oncol. 2012; 30:3884-3892; the entire contents of which are hereby incorporated by reference).
- immunoPET See, e.g., Knowles et al., "Advances in immuno-positron emission tomography: antibodies for molecular imaging in oncology.” Clin Oncol. 2012; 30:3884-3892; the entire contents of which are hereby incorporated by reference).
- Such antibodies include monoclonal antibodies known to target or bind cancerous cells or tissues in a subject's body. For example, a non-limiting list of antibodies approved by the U.S.
- CD3J At « ⁇ * iSysfoiii MA f'Safc siftjw.A, HjiffKWiiEsNi 3 ⁇ 4g «S5 C052 i.ooi 239 i
- any of the antibodies, or fragments thereof, disclosed in Table 3 of Salsano and Treglia can be labeled according to the methods provided herein.
- Other antibodies amenable to labeling as described herein include, but are not limited to, those described in Wright and Lapi, "Designing the magic bullet? The advancement of immuno-PET into clinical use.” . Nucl. Med. 2013 Aug;54(8): 1171-4; the entire contents of which are hereby incorporated by reference.
- These antibodies were successfully labeled with isotopes and were used in PET based diagnostic and/or therapeutic applications.
- the antibodies were labeled via chemical means that are not always amenable to quickly generating labeled antibodies with isotopes having a short half-life.
- Antibodies disclosed by Wright and Lapi include:
- the antibody could be administered via intravenous administration or hepatic arterial infusion (HAI), with HAI giving no detectable advantage over intravenous injection.
- HAI hepatic arterial infusion
- Radretumab (L19SIP), which targets an epitope contained in the extra-domain B of fibronectin, was labeled with 124 I and used to establish provisional doses of 131 I-labeled radretumab in 6 patients with brain metastasis (Poli et al., "Radretumab radioimmunotherapy in patients with brain metastasis: a 124 I-L19SIP dosimetric PET study. Cancer Immunol Res. 2013:OF1-OF10; the entire contents of which are hereby incorporated by reference).
- Girentuximab (cG250), a chimeric antibody that binds carbonic anhydrase IX
- CAIX clear cell renal carcinoma
- Panitumumab a fully humanized antibody that binds epidermal growth factor
- EGFR epidermal growth factor receptor
- any of the antibodies provided herein binds to a tumor antigen.
- a tumor antigen can be any antigenic substance produced by a tumor cell (e.g., tumorigenic cells, or in some embodiments tumor stromal cells, e.g. , tumor-associated cells such as cancer-associated fibroblasts).
- a tumor antigen is a molecule (or portion thereof) that is differentially expressed by tumor cells as compared with non-tumor cells.
- a tumor antigen is expressed on the surface of the cell.
- Tumor antigens may include, e.g., proteins that are normally produced in very small quantities and are expressed in larger quantities by tumor cells, proteins that are normally produced only in certain stages of development, proteins whose structure (e.g. , sequence or post-translational modification(s)) is modified due to a mutation in tumor cells, or normal proteins that are (under normal conditions) sequestered from the immune system.
- Tumor antigens may be useful in, e.g. , identifying or detecting tumor cells (e.g., for purposes of diagnosis and/or for purposes of monitoring subjects who have received treatment for a tumor, e.g., to test for recurrence) and/or for purposes of targeting various agents (e.g., therapeutic agents) to tumor cells.
- a radiolabeled antibody comprising an antibody or antibody fragment that binds a tumor antigen, thereby allowing detection of the tumor in vivo, e.g. , using PET.
- a tumor antigen is an expression product of a mutated gene, e.g. , an oncogene or mutated tumor suppressor gene, an overexpressed or aberrantly expressed cellular protein, an antigen encoded by an oncogenic virus (e.g., HBV; HCV; herpesvirus family members such as EBV, KSV; papilloma virus, etc.), or an oncofetal antigen.
- an oncogenic virus e.g., HBV; HCV; herpesvirus family members such as EBV, KSV; papilloma virus, etc.
- Oncofetal antigens are normally produced in the early stages of embryonic development and largely or completely disappear by the time the immune system is fully developed. Examples are alphafetoprotein (AFP, found, e.g., in germ cell tumors and hepatocellular carcinoma) and carcinoembryonic antigen (CEA, found, e.g. , in bowel cancers and occasionally in lung and breast cancers). Tyrosinase is an example of a protein normally produced in very low quantities but whose production is greatly increased in certain tumor cells (e.g. , melanoma cells). Other exemplary tumor antigens include, e.g.
- a tumor antigen is at least in part exposed at the cell surface of tumor cells.
- a tumor antigen comprises an abnormally modified polypeptide or lipid, e.g., an aberrantly modified cell surface glycolipid or glycoprotein.
- a tumor antigen may be expressed by a subset of tumors of a particular type and/or by a subset of cells in a tumor. Additional exemplary tumor antigens are known in the art and are within the scope of this disclosure. For example exemplary tumor antigens are described in WO 2014/183066 and US 20160122707, the entire contents of each are incorporated by reference herein.
- exemplary therapeutic/diagnostic antibodies, or fragments thereof, that are useful in the production of radiolabeled antibodies or proteins according to the methods provided herein include, but are not limited to, the following antibodies, or fragments thereof (the target of the antibody is listed in parentheses together with exemplary non-limiting therapeutic indications):
- Abciximab (glycoprotein Ilb/IIIa; cardiovascular disease), Adalimumab (TNF-a, various auto-immune disorders, e.g., rheumatoid arthritis), Alemtuzumab (CD52; chronic lymphocytic leukemia), Basiliximab (IL-2Ra receptor (CD25); transplant rejection),
- Bevacizumab vascular endothelial growth factor A; various cancers, e.g. , colorectal cancer, non-small cell lung cancer, glioblastoma, kidney cancer; wet age-related macular
- Catumaxomab CD3 and EpCAM, malignant ascites
- Cetuximab EGF receptor, various cancers, e.g., colorectal cancer, head and neck cancer
- Certolizumab e.g., Certolizumab pegol
- TNF alpha Crohn' s disease, rheumatoid arthritis
- Daclizumab IL- 2Ra receptor (CD25); transplant rejection
- Eculizumab complement protein C5; paroxysmal nocturnal hemoglobinuria
- Efalizumab CDl la; psoriasis
- Gemtuzumab CD33; acute myelogenous leukemia (e.g., conjugated to calicheamicin)), Ibritumomab tiuxetan (CD20; Non-Hodgkin lymphoma (e.g.
- Infliximab TNF alpha; various autoimmune disorders, e.g., rheumatoid arthritis)
- Muromonab-CD3 T Cell CD3 receptor; transplant rejection
- Natalizumab alpha-4 (a4) integrin; multiple sclerosis, Crohn's disease
- Omalizumab IgE; allergy-related asthma
- Palivizumab epipe of RSV F protein; Respiratory Syncytial Virus infection
- Panitumumab EGF receptor
- cancer e.g.
- any of the antibodies, or fragments thereof, (e.g., radiolabeled and/or PEGylated), described herein, may be used to image an immune response.
- inflammatory markers include, but are not limited to, cytokines, tumor necrosis factor (TNF)-a, IL-6, IL-1 beta, IL-8, IL-10, IL-12, IL-16, IL-18, monocyte chemoattractant protein- 1 (MCP-1), GRO-a (Growth Related Oncogene-a), matrix metalloproteinase-8 (MMP-8), CSFs (colony- stimulating factors), epithelial cell-derived neutrophil-activating peptide-78 (ENA-78), regulated on activation normal T cell expressed and secreted (RANTES) CCL5, CXCL6 (granulocyte chemotactic protein-2), CXCL9 MIG, CXCL9 MIG, CXCL
- adrenocorticotropin Urocortin, estriol, MMP-1, MMP-2, TIMP-2, MMP-3, MMP-7, MMP-9, arachidonate lipoxygenase metabolites, prostaglandins, prostacyclins, thromboxanes, leukotrienes, Catalase, Caspase-1 (NALP3 inflammasome), leptin, adiponectin, resistin, visfatin, Retinol binding protein 4 (RBP4), endotoxin, Epidermal growth factor (EGF), insulin-like growth factor binding protein- 1 (IGFBP-1), neutrophil elastase, leukocyte elastase (ELA2, neutrophil), SLPI (secretory leukocyte protease inhibitor), S 100 calcium binding protein B, Heat shock protein, Endothel in-1, -2, Angiopoietin-2, Calcium-binding protein, Soluble Triggering receptor expressed on myeloid cells 1
- any of the antibodies, or fragments thereof, e.g., any of the antibodies, or fragments thereof, (e.g., one of the antibodies, or fragments thereof, (e.g., one of the antibodies, or fragments thereof, (e.g., one of the antibodies, or fragments thereof, (e.g., one of the antibodies, or fragments thereof, (e.g., one of the antibodies, or fragments thereof, (e.g., amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids
- radiolabeled and/or PEGylated may be used to image immune cells independent of an immune response. This may be done using antibodies that detect specific immune cell markers that are not indicative of an active immune response.
- naive T cells may be imaged using any of the radiolabelled antibodies or antibody fragments, described herein, that bind to the naive T cell markers CD3, CD4, CD45RA, CD45RB, CD197, or CD62L. Further information on varous immune cell types may be found in, e.g., Zhu, J., et al., Differentiation of effector CD4 T cell populations. Annu. Rev. Immunol., 28 (2010), pp. 445-489; S.
- any of the antibodies, or fragments thereof, e.g., any of the antibodies, or fragments thereof, (e.g., one of the antibodies, or fragments thereof, (e.g., one of the antibodies, or fragments thereof, (e.g., one of the antibodies, or fragments thereof, (e.g., one of the antibodies, or fragments thereof, (e.g., one of the antibodies, or fragments thereof, (e.g., amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids
- radiolabeled and/or PEGylated may be used to non-invasively image tumor and/or T cell markers.
- any of the antibodies, or fragments thereof, (e.g., radiolabeled and/or PEGylated), described herein may be used to non-invasively image a tumor cell and/or a T cell.
- the radiolabeled antibodies or antibody fragments detect markers including, but not limited to PD-L1, PD-1, PD-2, CTLA-4, CD3, CD4, CD8, and CD28.
- any of the antibodies, or fragments thereof, e.g., any of the antibodies, or fragments thereof, (e.g., one of the antibodies, or fragments thereof, (e.g., one of the antibodies, or fragments thereof, (e.g., one of the antibodies, or fragments thereof, (e.g., one of the antibodies, or fragments thereof, (e.g., one of the antibodies, or fragments thereof, (e.g., amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids
- immune checkpoint pathways or “immune checkpoints” are naturally existing inhibitory pathways of the immune system that play important roles in maintaining self-tolerance and modulating the duration and level of effector output (e.g., in the case of T cells, the levels of cytokine production, proliferation or target killing potential) of T cells.
- immune checkpoint pathways include, but are not limited to the PD- 1 pathway and the CTLA-4 pathway and the TIM3 pathway.
- Tumors frequently co-opt certain immune-checkpoint pathways as a major mechanism of immune resistance, e.g., against T cells that are specific for tumor antigens.
- chronic antigen exposure such as occurs in cancer, can lead to high levels of expression of immune checkpoint proteins (e.g., PD1, PD-L1, PD-L2) by immune cells, which can induce a state of T cell exhaustion or anergy.
- Certain immune checkpoint proteins such as CTLA4 and PD1 are highly expressed on T regulatory (TR eg ) cells and may enhance their proliferation. Many tumours are highly infiltrated with TR eg cells that likely suppress effector immune responses, Thus, blockade of the PD1 pathway and/or the CTLA4 pathway may enhance antitumour immune responses by diminishing the number and/or suppressive activity of intratumoral TR eg cells.
- Certain aspects of the invention utilize the radiolabeled proteins (e.g., radiolabeled antibodies or antibody fragments) for diagnosing or monitoring a disease or condition (e.g., cancer) or the response of a disease or condition (e.g., cancer) to therapy.
- the radiolebeled antibodies or antibody fragments may be used to detect whether a tumor expresses an immune checkpoint marker (e.g., an immune checkpoint protein) and/or to detect whether a tumor contains immune cells that express an immune checkpoint marker (e.g., an immune checkpoint protein).
- an immune checkpoint marker e.g., an immune checkpoint protein
- the inventive radiolabeled proteins e.g., radiolabeled antibodies or antibody fragments
- the immune checkpoint modulator is an immune checkpoint inhibitor.
- Immunune checkpoint inhibitor refers to any agent that inhibits (suppresses, reduces activity of) an immune checkpoint pathway.
- the immune checkpoint modulator is an immune checkpoint activator.
- Immun immune checkpoint activator refers to any agent that activates (stimulates, increases activity of) an immune checkpoint pathway.
- Immune checkpoint inhibitors e.g., monoclonal antibodies that bind to immune checkpoint proteins such as CTLA4, PD1, PD-L1 have shown notable efficacy in treating a variety of different cancers, including cancers that are advanced, have failed to respond to conventional chemotherapeutic agents, and/or have a poor prognosis, such as metastatic melanoma (see, e.g., Pardoll, DM, The blockade of immune checkpoints in cancer immunotherapy, Nat Rev Cancer. 2012; 12(4):252-64). However, not all subjects with tumors of a particular type may experience benefit from treatment with a given immune checkpoint inhibitor.
- a benefit could be, e.g., stable disease rather than progressive disease, eventual reduced number and/or volume of tumor lesions, increased mean survival, etc.
- Detection of immune checkpoint markers using any of the methods ,described herein may be used to determine whether or not to administer a therapeutic and/or to select a therapeutic (e.g., from among multiple different therapeutic options).
- a radiolabeled antibody or antibody fragment that binds PD-L1 can be used to detect whether a tumor within a patient expresses PD-L1.
- Patients having a PD-L1 positive tumor may then be administered a therapeutic that targets the PD1 pathway, e.g., a therapeutic (such as an antibody) that targets PD1 or PD-L1.
- a therapeutic such as an antibody
- a radiolabeled protein e.g., radiolabeled antibody or antibody fragment
- a radiolabeled protein that binds PD1 can be used to detect whether a tumor within a patient is positive for PD1 (e.g., due to the presence of immune cells that express high levels of PD1).
- Patients having a PD1 positive tumor may then be administered a therapeutic agent that targets the PD1 pathway
- a radiolabeled protein e.g., radiolabeled antibody or antibody fragment
- binds TIM3 can be used to detect whether a tumor within a patient is positive for TIM3 (e.g., due to the presence of immune cells that express high levels of TIM3).
- Patients having a TIM3 positive tumor may then be administered a therapeutic that targets the TTM3 pathway,e.g., a therapeutic (such as an antibody) that targets TTM3.
- a radiolabeled protein that binds CTLA4 can be used to detect whether a tumor within a patient is positive for CTLA4 (e.g., due to the presence of immune cells that express high levels of CTLA4).
- Patients having a CTLA4 positive tumor may then be administered a therapeutic that targets the CTLA4 pathway, e.g., a therapeutic (such as an antibody) that targets CTLA4.
- a subject with a tumor may be imaged with two, three, or more radiolabeled proteins (e.g., antibodies, antibody fragments) that bind to different immune checkpoint proteins (e.g., proteins involved in different immune checkpoint pathways).
- One or more immune checkpoint pathways that are positive in the tumor are identified.
- the patient is then treated with one or more agent(s) that target those immune checkpoint pathways for which a tumor (or one or more tumor(s)) in the subject is positive.
- an alternative treatment may be administered instead of an immune checkpoint inhibitor that would target that immune checkpoint pathway or immune checkpoint protein.
- Other aspects of the invention utilize the radiolabeled antibodies or antibody fragments for monitoring the response to a therapeutic or monitoring expression of a protein, such as an immune checkpoint inhibitor protein.
- a radiolabeled antibody or antibody fragmenat may be used to detect whether an immune response has been generated or enhanced or suppressed at a site of interest, such as at the site of a tumor or a site of infection, or whether the tumor expresses an immune checkpoint protein (e.g., PD-L1).
- an immune checkpoint protein e.g., PD-L1
- a radiolabeled protein that binds to an immune cell e.g., a T cell
- images may be compared from before and after treatment to assess the effect of the treatment on the immune response.
- the inventive radiolabeled proteins may be used to monitor the response to a therapeutic at least every 1 day, at least every 5 days, at least everylO days, at least every 15 days, at least every 30 days, at least every 45 days, at least every 60 days, at least every 120 days, at least every 180 days, at least every 240 days or at least every year.
- a subject may be monitored for, e.g., up to 3, 6, 9 months, up to 1, 2, 5, years, or more.
- a therapeutic agent that targets an immune checkpoint inhibitor pathway is a monoclonal antibody.
- the monoclonal antibody is a chimeric, humanized, or human monoclonal antibody.
- the antibody is an IgG antibody, e.g., an IgGl or IgG4 antibody.
- a therapeutic agent that targets the CTLA4 pathway is a monoclonal antibody that binds to CTLA4, such as ipilimumab (Yervoy) or tremilimumab.
- a therapeutic agent that targets the PDl pathway is a monoclonal antibody that binds to PDl, such as nivolumab (a fully human IgG4 monoclonal antibody), pidilizumab (also known as CT-011, a humanized IgGl monoclonal antibody), or pembrolizumab (Keytruda, formerly lambrolizumab; also known as MK-3475), a humanized IgG4 monoclonal antibody), or MEDI0680 (AMP-514, a humanized IgG4mAb against PD-1).
- nivolumab a fully human IgG4 monoclonal antibody
- pidilizumab also known as CT-011, a humanized IgGl monoclonal antibody
- pembrolizumab Keytruda, formerly lambrolizumab; also known as MK-3475
- MEDI0680 AMP-514, a humanized IgG4mAb against
- a therapeutic agent that targets the PDl pathway is a monoclonal antibody that binds to PD-L1 such as BMS-936559 (a fully human IgG4 monoclonal antibody), MPDL3280A (human monoclonal, Genentech), MSB0010718C (Merck Serono), or MEDI4736.
- a therapeutic agent that targets the PDl pathway is a monoclonal antibody that binds to PD-L2.
- a therapeutic agent that targets the PDl pathway is a recombinant fusion protein comprising extracellular domain of PD-L2 such as AMP-224.
- PDl pathway inhibitors e.g., antibodies that bind to PD-1, PD-L1, or PD-L2 are described in U.S. Pat. Pub. No. 20040213795, 20110195068, 20120039906, 20120114649, 20130095098, 20130108651, 20130109843, 20130237580, and 20130291136, all of which are incorporated by reference herein.
- the subject suffers from a solid tumor.
- the subject suffers from melanoma, renal cell carcinoma, non- small-cell lung cancer, ovarian cancer, brain cancer (e.g., glioblastoma), lymphoma (e.g., Non-Hodgkin lymphoma), hepatocellular, esophageal, breast (e.g., triple negative breast cancer), multiple myeloma, or pancreatic cancer.
- the subject has a metastatic cancer, stage III cancer, or stage IV cancer.
- the immune checkpoint inhibitor could be administered as a single agent or in combination with one or more other anti-tumor agents.
- any of the antibodies, or fragments thereof, e.g., any of the antibodies, or fragments thereof, (e.g., one of the antibodies, or fragments thereof, (e.g., one of the antibodies, or fragments thereof, (e.g., one of the antibodies, or fragments thereof, (e.g., one of the antibodies, or fragments thereof, (e.g., one of the antibodies, or fragments thereof, (e.g., amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids
- radiolabeled and/or PEGylated are capable of reaching their targets and are cleared quickly from the circulation.
- Whole antibodies and their fragments have different characteristics that determine their targeting properties, such as how quickly they reach the target antigen and clear from the blood, which organ clears the antibody from the blood, penetration into the tumor and amount of the injected radiolabeled antibody or antibody fragment binding to the target.
- Once antibodies target their respective antigens they generally bind with high avidity, which in turn determines their tumor residence time, whereas the unbound antibody is processed by various organs in the body and eventually degraded and excreted.
- Whole IgG which is the principal antibody form used, clears very slowly from the blood, requiring several days before a sufficient amount leaves the circulation to allow the specific concentration taken into the tumor to be distinguished from blood and adjacent tissue radioactivity. Its slow clearance is in part owing to its large size (approximately 150,000 Da) that impedes its extravasation, resulting in a slow tumor accretion. As the molecular size of an antibody is reduced from a divalent F(ab')2 fragment (approximately 100,000 Da) to the monovalent binding Fab fragment (approximately 50,000 Da), there is a progressively faster clearance from the blood.
- any of the antibodies, or fragments thereof, (e.g., radiolabeled and/or PEGylated), described herein, have a molecular weight of less than 60kDa, less than 55 kDa, less than 50 kDa, less than 45 kDa, less than 40kDa, less than 35 kDa, less than 30 kDa, less than 25 kDa less than 20 kDa, less than 15 kDa, less than lOkDa, or less than 5 kDa.
- the radiolabeled proteins e.g., antibodies or antibody fragments
- any of the antibodies, or fragments thereof, (e.g., radiolabeled and/or PEGylated), described herein, are expediently cleared from the circulation following injection into a patient.
- at least 95% of the radiolabeled proteins are cleared from the blood within 20 minutes, within 30 minutes, within 40 minutes, within 60 minutes, within 80 minutes, within 30 minutes, within 40 minutes, within 60 minutes, within 90 minutes, within 2 hours, whithin 3 hours, within 4 hours, within 6 hours, within 8 hours, within 10 hours or within 12 hours.
- radiolabeled proteins e.g., antibodies or antibody fragments
- the radiolabeled proteins are cleared from the body within 20 minutes, within 30 minutes, within 40 minutes, within 60 minutes, within 80 minutes, within 30 minutes, within 40 minutes, within 60 minutes, within 90 minutes, within 2 hours, whithin 3 hours, within 4 hours, within 6 hours, within 8 hours, within 10 hours or within 12 hours.
- hydrophilic polymers refers to a molecule ⁇ e.g., a macromolecule) comprised of three or more repeating units that contain polar or charged functional groups, rendering them soluble in water.
- the hydrophilic polymer is soluble to at least 50 mg/mL in water, to at least lOOmg/mL in water, to at least 150 mg/mL in water, to at least 200mg/mL in water, to at least 250mg/mL in water, to at least 300 mg/mL in water, to at least 400mg/mL in water, to at least 500mg/mL in water, to at least 600 mg/mL in water, to at least 700mg/mL in water, to at least 800mg/mL in water, to at least 900 mg/mL in water, or at least lOOOmg/mL in water at 20°C.
- the hydrophilic polymer is a linear polymer. In some embodiments, the hydrophilic polymer is a branched polymer, which may be configured in any number of ways. In some embodiments, the hydrophilic polymer is a suitable size and/or has a suitable linear or branched structure for conferring improved properties to any of the antibodies provided herein. In some embodiments, the hydrophilic polymer is from 5kDa to lOOOkDa in size.
- the polymer is at least 5kDa, at least lOkDa, at least 15kDa, at least 20kDa, at least 25kDa, at least 30kDa, at least 40kDa, at least 50kDa, at least 70kDa, at least lOOkDa, at least 150kDa, at least 200kDa, at least 300kDa, at least 400kDa, at least 500kDa, at least 600kDa, at least 700kDa, at least 800kDa, at least 900kDa, or at least lOOOkDa in size.
- the hydrophilic polymer useful in the present invention is synthetic polymer.
- the hydrophilic polymer is not a polypeptide, polynucleotide, or polysaccharide.
- hydrophilic synthetic polymers include, without limitation polyethylene glycol (PEG), polyvinyl pyrrolidone (PVP), polyvinyl alcohol (PVA), polyacrylic acid (PAA), polyacrylamide, N-(2-hydroxypropyl)
- HPMA divinyl ether-maleic anhydride
- DIVEMA divinyl ether-maleic anhydride
- polyoxazoline polyphosphoester
- PEI polyethyleneimine
- polyphosphazene polyphosphazene
- any of the hydrophilic polymers provided herein are natural polymers.
- natural polymers include, without limitation, polysaccharides, xanthan gum, pectins, chitosan derivatives, dextran, carrageenan, guar gum, cellulose ethers (e.g., Sodium CMC, HPC, and HPMC), hyaluronic acid (HA), albumin, and starch or starch based derivatives.
- cellulose ethers e.g., Sodium CMC, HPC, and HPMC
- HA hyaluronic acid
- albumin hyaluronic acid
- starch or starch based derivatives starch or starch based derivatives.
- Additional hydrophilic polymers would be apparent to the skilled artisan and are within the scope of this disclosure.
- exemplary hydrophilic polymers have been described previously in Veeran, G.
- PEGylation also refers to the addition of any hydrophilic polymer, for example any of the hydrophilic polymers provided herein.
- chelating moieties are an agent whose molecules can form several bonds to a single metal ion.
- the chelating moiety is an agent that binds to a radionuclide.
- the chelating moiety is an agent that binds to rubidium-82, copper-61, copper- 62, copper-64, yttrium-86, gallium-68, zirconium-89.
- the chelating moiety may be an agent that binds to additional radioactive metals.
- Exemplary chelating moieties include, without limitation, 1,4,7-triazacyclononane-triacetic acid
- chelating moieties may be used and are within the scope of this invention.
- Exemplary metallic radionuclides and chelators have been described in the art and are within the scope of this disclosure.
- exemplary metallic radionuclides and chelators have been described in Liu X., et al., "A Brief Review of Chelators for Radiolabeling Oligomers" Materials, 2010, 3, 3204-3217, the entire contents of which are incorporated by reference herein.
- Compounds described herein can comprise one or more asymmetric centers, and thus can exist in various stereoisomeric forms, e.g., enantiomers and/or diastereomers.
- the compounds described herein can be in the form of an individual enantiomer, diastereomer or geometric isomer, or can be in the form of a mixture of stereoisomers, including racemic mixtures and mixtures enriched in one or more stereoisomer.
- Isomers can be isolated from mixtures by methods known to those skilled in the art, including chiral high pressure liquid chromatography (HPLC) and the formation and crystallization of chiral salts; or preferred isomers can be prepared by asymmetric syntheses.
- HPLC high pressure liquid chromatography
- the invention additionally encompasses compounds as individual isomers substantially free of other isomers, and alternatively, as mixtures of various isomers.
- aliphatic includes both saturated and unsaturated, nonaromatic, straight chain (i.e. , unbranched), branched, acyclic, and cyclic (i.e. , carbocyclic) hydrocarbons, which are optionally substituted with one or more functional groups.
- aliphatic is intended herein to include, but is not limited to, alkyl, alkenyl, alkynyl, cycloalkyl, cycloalkenyl, and cycloalkynyl moieties.
- alkyl includes straight, branched and cyclic alkyl groups.
- alkyl is used to indicate those aliphatic groups (cyclic, acyclic, substituted, unsubstituted, branched or unbranched) having 1-20 carbon atoms (Ci-20 aliphatic). In certain embodiments, the aliphatic group has 1-10 carbon atoms (Ci-10 aliphatic). In certain embodiments, the aliphatic group has 1-6 carbon atoms (C 1-6 aliphatic). In certain
- the aliphatic group has 1-5 carbon atoms (C 1-5 aliphatic). In certain embodiments, the aliphatic group has 1-5 carbon atoms (C 1-5 aliphatic). In certain embodiments, the aliphatic group has 1-5 carbon atoms (C 1-5 aliphatic). In certain embodiments, the aliphatic group has 1-5 carbon atoms (C 1-5 aliphatic). In certain embodiments, the aliphatic group has 1-5 carbon atoms (C 1-5 aliphatic). In certain
- the aliphatic group has 1-4 carbon atoms (C 1-4 aliphatic).
- the aliphatic group has 1-3 carbon atoms (C 1-3 aliphatic). In certain embodiments, the aliphatic group has 1-3 carbon atoms (C 1-3 aliphatic). In certain
- the aliphatic group has 1-2 carbon atoms (C 1-2 aliphatic).
- Aliphatic group substituents include, but are not limited to, any of the substituents described herein, that result in the formation of a stable moiety.
- heteroaliphatic refers to aliphatic moieties that contain one or more oxygen, sulfur, nitrogen, phosphorus, or silicon atoms, e.g. , in place of carbon atoms. Heteroaliphatic moieties may be branched, unbranched, cyclic or acyclic and include saturated and unsaturated heterocycles such as morpholino, pyrrolidinyl, etc.
- heteroaliphatic moieties are substituted by independent replacement of one or more of the hydrogen atoms thereon with one or more moieties including, but not limited to aliphatic; heteroaliphatic; aryl; heteroaryl; arylalkyl; heteroarylalkyl; alkoxy; aryloxy;
- alkyl refers to saturated, straight- or branched-chain hydrocarbon radicals derived from a hydrocarbon moiety containing between one and twenty carbon atoms by removal of a single hydrogen atom.
- the alkyl group employed in the invention contains 1-20 carbon atoms (Ci_ 2 oalkyl).
- the alkyl group employed contains 1-15 carbon atoms (Ci-isalkyl).
- the alkyl group employed contains 1-10 carbon atoms (Ci-ioalkyl).
- the alkyl group employed contains 1-8 carbon atoms (Ci_ 8 alkyl).
- the alkyl group employed contains 1-6 carbon atoms (Ci_ 6 alkyl). In another embodiment, the alkyl group employed contains 1-5 carbon atoms (Ci-salkyl). In another embodiment, the alkyl group employed contains 1-4 carbon atoms (Ci_ 4 alkyl). In another embodiment, the alkyl group employed contains 1-3 carbon atoms (Ci_ 3 alkyl). In another embodiment, the alkyl group employed contains 1-2 carbon atoms (Ci_ 2 alkyl).
- alkyl radicals include, but are not limited to, methyl, ethyl, n-propyl, isopropyl, n-butyl, iso-butyl, sec- butyl, sec-pentyl, iso-pentyl, tert-butyl, n-pentyl, neopentyl, n-hexyl, sec-hexyl, n-heptyl, n-octyl, n-decyl, n-undecyl, dodecyl, and the like, which may bear one or more substituents.
- Alkyl group substituents include, but are not limited to, any of the substituents described herein, that result in the formation of a stable moiety.
- alkylene refers to a biradical derived from an alkyl group, as defined herein, by removal of two hydrogen atoms. Alkylene groups may be cyclic or acyclic, branched or unbranched, substituted or unsubstituted. Alkylene group substituents include, but are not limited to, any of the substituents described herein, that result in the formation of a stable moiety.
- alkenyl denotes a monovalent group derived from a straight- or branched-chain hydrocarbon moiety having at least one carbon-carbon double bond by the removal of a single hydrogen atom.
- the alkenyl group employed in the invention contains 2-20 carbon atoms (C 2 - 2 oalkenyl).
- the alkenyl group employed in the invention contains 2-15 carbon atoms (d isalkenyl).
- the alkenyl group employed contains 2-10 carbon atoms (C 2 -ioalkenyl).
- the alkenyl group contains 2-8 carbon atoms (C 2 - 8 alkenyl).
- the alkenyl group contains 2-6 carbons (C 2 _ 6 alkenyl).
- the alkenyl group contains 2-5 carbons (C 2 _salkenyl).
- the alkenyl group contains 2-4 carbons (C 2 _ 4 alkenyl). In yet other words, the alkenyl group contains 2-4 carbons (C 2 _ 4 alkenyl). In yet other words, the alkenyl group contains 2-4 carbons (C 2 _ 4 alkenyl).
- the alkenyl group contains 2-3 carbons (C 2 _ 3 alkenyl). In yet other words, the alkenyl group contains 2-3 carbons (C 2 _ 3 alkenyl). In yet other words, the alkenyl group contains 2-3 carbons (C 2 _ 3 alkenyl).
- the alkenyl group contains 2 carbons (C 2 alkenyl).
- Alkenyl groups include, for example, ethenyl, propenyl, butenyl, l-methyl-2-buten-l-yl, and the like, which may bear one or more substituents.
- Alkenyl group substituents include, but are not limited to, any of the substituents described herein, that result in the formation of a stable moiety.
- alkenylene refers to a biradical derived from an alkenyl group, as defined herein, by removal of two hydrogen atoms.
- Alkenylene groups may be cyclic or acyclic, branched or unbranched, substituted or unsubstituted.
- Alkenylene group substituents include, but are not limited to, any of the substituents described herein, that result in the formation of a stable moiety.
- alkynyl refers to a monovalent group derived from a straight- or branched-chain hydrocarbon having at least one carbon-carbon triple bond by the removal of a single hydrogen atom.
- the alkynyl group employed in the invention contains 2-20 carbon atoms (C 2 _ 2 oalkynyl).
- the alkynyl group employed in the invention contains 2-15 carbon atoms (C 2 _isalkynyl).
- the alkynyl group employed contains 2-10 carbon atoms (C 2 _ioalkynyl).
- the alkynyl group contains 2-8 carbon atoms (C 2 _ 8 alkynyl). In still other embodiments, the alkynyl group contains 2-6 carbon atoms (C 2 _ 6 alkynyl). In still other embodiments, the alkynyl group contains 2-5 carbon atoms (C 2 _salkynyl). In still other embodiments, the alkynyl group contains 2-4 carbon atoms (C 2 _ 4 alkynyl). In still other embodiments, the alkynyl group contains 2-3 carbon atoms (C 2 - 3 alkynyl). In still other embodiments, the alkynyl group contains 2 carbon atoms (C 2 alkynyl).
- alkynyl groups include, but are not limited to, ethynyl, 2-propynyl (propargyl), 1-propynyl, and the like, which may bear one or more substituents.
- Alkynyl group substituents include, but are not limited to, any of the substituents described herein, that result in the formation of a stable moiety.
- alkynylene refers to a biradical derived from an alkynylene group, as defined herein, by removal of two hydrogen atoms. Alkynylene groups may be cyclic or acyclic, branched or unbranched, substituted or unsubstituted.
- Alkynylene group substituents include, but are not limited to, any of the substituents described herein, that result in the formation of a stable moiety.
- heteroalkyl refers to an alkyl group, which further includes at least one heteroatom (e.g., 1, 2, 3, or 4 heteroatoms) selected from oxygen, nitrogen, or sulfur within (i.e., inserted between adjacent carbon atoms of) and/or placed at one or more terminal position(s) of the parent chain.
- a heteroalkyl group refers to a saturated group having from 1 to 10 carbon atoms and 1 or more heteroatoms within the parent chain (“heteroCi_io alkyl").
- a heteroalkyl group is a saturated group having 1 to 9 carbon atoms and 1 or more heteroatoms within the parent chain
- a heteroalkyl group is a saturated group having 1 to 8 carbon atoms and 1 or more heteroatoms within the parent chain ("heteroCi_ 8 alkyl”). In some embodiments, a heteroalkyl group is a saturated group having 1 to 7 carbon atoms and 1 or more heteroatoms within the parent chain (“heteroCi_7 alkyl”). In some embodiments, a heteroalkyl group is a saturated group having 1 to 6 carbon atoms and 1 or more heteroatoms within the parent chain (“heteroCi_6 alkyl").
- a heteroalkyl group is a saturated group having 1 to 5 carbon atoms and 1 or 2 heteroatoms within the parent chain ("heteroCi_5 alkyl"). In some embodiments, a heteroalkyl group is a saturated group having 1 to 4 carbon atoms and lor 2 heteroatoms within the parent chain ("heteroCi ⁇ alkyl”). In some embodiments, a heteroalkyl group is a saturated group having 1 to 3 carbon atoms and 1 heteroatom within the parent chain (“heteroCi_3 alkyl”). In some embodiments, a heteroalkyl group is a saturated group having 1 to 2 carbon atoms and 1 heteroatom within the parent chain (“heteroCn alkyl").
- a heteroalkyl group is a saturated group having 1 carbon atom and 1 heteroatom (“heteroCi alkyl"). In some embodiments, a heteroalkyl group is a saturated group having 2 to 6 carbon atoms and 1 or 2 heteroatoms within the parent chain ("heteroC 2 -6 alkyl"). Unless otherwise specified, each instance of a heteroalkyl group is independently unsubstituted (an "unsubstituted
- heteroalkyl or substituted (a "substituted heteroalkyl") with one or more substituents.
- the heteroalkyl group is an unsubstituted heteroCi_io alkyl. In certain embodiments, the heteroalkyl group is a substituted heteroCi_io alkyl.
- heteroalkenyl refers to an alkenyl group, which further includes at least one heteroatom (e.g., 1, 2, 3, or 4 heteroatoms) selected from oxygen, nitrogen, or sulfur within (i.e., inserted between adjacent carbon atoms of) and/or placed at one or more terminal position(s) of the parent chain.
- a heteroalkenyl group refers to a group having from 2 to 10 carbon atoms, at least one double bond, and 1 or more heteroatoms within the parent chain (“heteroC 2 -io alkenyl").
- a heteroalkenyl group has 2 to 9 carbon atoms at least one double bond, and 1 or more heteroatoms within the parent chain ("heteroC 2 -9 alkenyl"). In some embodiments, a heteroalkenyl group has 2 to 8 carbon atoms, at least one double bond, and 1 or more heteroatoms within the parent chain ("heteroC 2 -8 alkenyl"). In some embodiments, a heteroalkenyl group has 2 to 7 carbon atoms, at least one double bond, and 1 or more heteroatoms within the parent chain (“heteroC 2 -7 alkenyl").
- a heteroalkenyl group has 2 to 6 carbon atoms, at least one double bond, and 1 or more heteroatoms within the parent chain ("heteroC 2 -6 alkenyl"). In some embodiments, a heteroalkenyl group has 2 to 5 carbon atoms, at least one double bond, and 1 or 2 heteroatoms within the parent chain ("heterod-s alkenyl"). In some embodiments, a heteroalkenyl group has 2 to 4 carbon atoms, at least one double bond, and lor 2
- heteroalkenyl group has 2 to 3 carbon atoms, at least one double bond, and 1 heteroatom within the parent chain ("heteroC 2 -3 alkenyl”). In some embodiments, a heteroalkenyl group has 2 to 6 carbon atoms, at least one double bond, and 1 or 2 heteroatoms within the parent chain ("heteroC 2 -6 alkenyl”). Unless otherwise specified, each instance of a heteroalkenyl group is independently unsubstituted (an "unsubstituted heteroalkenyl") or substituted (a "substituted heteroalkenyl") with one or more substituents. In certain embodiments, the heteroalkenyl group is an unsubstituted heteroC 2 -io alkenyl. In certain embodiments, the heteroalkenyl group is a substituted heteroC 2 -io alkenyl.
- heteroalkynyl refers to an alkynyl group, which further includes at least one heteroatom (e.g., 1, 2, 3, or 4 heteroatoms) selected from oxygen, nitrogen, or sulfur within (i.e., inserted between adjacent carbon atoms of) and/or placed at one or more terminal position(s) of the parent chain.
- a heteroalkynyl group refers to a group having from 2 to 10 carbon atoms, at least one triple bond, and 1 or more heteroatoms within the parent chain (“heteroC 2 io alkynyl").
- a heteroalkynyl group has 2 to 9 carbon atoms, at least one triple bond, and 1 or more heteroatoms within the parent chain ("heteroC 2 -9 alkynyl"). In some embodiments, a heteroalkynyl group has 2 to 8 carbon atoms, at least one triple bond, and 1 or more heteroatoms within the parent chain ("heteroC 2 - 8 alkynyl"). In some embodiments, a heteroalkynyl group has 2 to 7 carbon atoms, at least one triple bond, and 1 or more heteroatoms within the parent chain (“heteroC 2 -7 alkynyl").
- a heteroalkynyl group has 2 to 6 carbon atoms, at least one triple bond, and 1 or more heteroatoms within the parent chain ("heteroC 2 -6 alkynyl"). In some embodiments, a heteroalkynyl group has 2 to 5 carbon atoms, at least one triple bond, and 1 or 2 heteroatoms within the parent chain ("heteroC 2 -5 alkynyl"). In some embodiments, a heteroalkynyl group has 2 to 4 carbon atoms, at least one triple bond, and lor 2 heteroatoms within the parent chain (“heteroC 2 ⁇ alkynyl").
- a heteroalkynyl group has 2 to 3 carbon atoms, at least one triple bond, and 1 heteroatom within the parent chain ("heteroC 2 - 3 alkynyl"). In some embodiments, a heteroalkynyl group has 2 to 6 carbon atoms, at least one triple bond, and 1 or 2 heteroatoms within the parent chain ("heteroC 2 -6 alkynyl"). Unless otherwise specified, each instance of a heteroalkynyl group is independently unsubstituted (an “unsubstituted heteroalkynyl") or substituted (a "substituted
- heteroalkynyl with one or more substituents.
- the heteroalkynyl group is an unsubstituted heteroC 2 -io alkynyl. In certain embodiments, the heteroalkynyl group is a substituted heteroC 2 -io alkynyl.
- carbocyclyl refers to a radical of a non-aromatic cyclic hydrocarbon group having from 3 to 14 ring carbon atoms ("C 3 _i 4 carbocyclyl") and zero heteroatoms in the non-aromatic ring system.
- a carbocyclyl group has 3 to 10 ring carbon atoms ("C 3 _io carbocyclyl”).
- a carbocyclyl group has 3 to 8 ring carbon atoms (“C 3 _ 8 carbocyclyl”).
- a carbocyclyl group has 3 to 7 ring carbon atoms (“C 3 _7 carbocyclyl”).
- a carbocyclyl group has 3 to 6 ring carbon atoms ("C 3 _6 carbocyclyl”). In some embodiments, a carbocyclyl group has 4 to 6 ring carbon atoms ("C 4 _ 6 carbocyclyl”). In some embodiments, a carbocyclyl group has 5 to 6 ring carbon atoms (“Cs_6 carbocyclyl”). In some embodiments, a carbocyclyl group has 5 to 10 ring carbon atoms ("Cs-io carbocyclyl”).
- Exemplary C 3 _ 6 carbocyclyl groups include, without limitation, cyclopropyl (C 3 ), cyclopropenyl (C 3 ), cyclobutyl (C 4 ), cyclobutenyl (C 4 ), cyclopentyl (C 5 ), cyclopentenyl (C 5 ), cyclohexyl (C 6 ), cyclohexenyl (C 6 ), cyclohexadienyl (C 6 ), and the like.
- Exemplary C 3 _ 8 carbocyclyl groups include, without limitation, the aforementioned C 3 _ 6 carbocyclyl groups as well as
- C 7 cycloheptyl
- C 7 cycloheptenyl
- C 7 cycloheptadienyl
- C 7 cycloheptatrienyl
- C 7 cyclooctyl
- C 8 cyclooctenyl
- Exemplary C 3 _io carbocyclyl groups include, without limitation, the
- C 3 _ 8 carbocyclyl groups as well as cyclononyl (C9), cyclononenyl (C9), cyclodecyl (C 10 ), cyclodecenyl (C 10 ), octahydro-lH-indenyl (C9), decahydronaphthalenyl (Cio), spiro[4.5]decanyl (C 10 ), and the like.
- the carbocyclyl group is either monocyclic (“monocyclic carbocyclyl”) or polycyclic (e.g., containing a fused, bridged or spiro ring system such as a bicyclic system (“bicyclic carbocyclyl”) or tricyclic system (“tricyclic carbocyclyl”)) and can be saturated or can contain one or more carbon-carbon double or triple bonds.
- Carbocyclyl also includes ring systems wherein the carbocyclyl ring, as defined above, is fused with one or more aryl or heteroaryl groups wherein the point of attachment is on the carbocyclyl ring, and in such instances, the number of carbons continue to designate the number of carbons in the carbocyclic ring system.
- each instance of a carbocyclyl group is independently unsubstituted (an "unsubstituted carbocyclyl") or substituted (a "substituted carbocyclyl”) with one or more substituents.
- the carbocyclyl group is an unsubstituted C 3 _i 4 carbocyclyl.
- the carbocyclyl group is a substituted C 3 _i 4 carbocyclyl.
- “carbocyclyl” is a monocyclic, saturated carbocyclyl group having from 3 to 14 ring carbon atoms ("C 3 _i 4 cycloalkyl”). In some embodiments, a cycloalkyl group has 3 to 10 ring carbon atoms ("C 3 _io cycloalkyl”). In some embodiments, a cycloalkyl group has 3 to 8 ring carbon atoms ("C 3 _ 8 cycloalkyl”). In some embodiments, a cycloalkyl group has 3 to 6 ring carbon atoms ("C 3 _6 cycloalkyl").
- a cycloalkyl group has 4 to 6 ring carbon atoms ("C 4 _6 cycloalkyl”). In some embodiments, a cycloalkyl group has 5 to 6 ring carbon atoms (“Cs_6 cycloalkyl”). In some embodiments, a cycloalkyl group has 5 to 10 ring carbon atoms ("Cs-io cycloalkyl”). Examples of Cs_6 cycloalkyl groups include cyclopentyl (C 5 ) and cyclohexyl (C5).
- C 3 _ 6 cycloalkyl groups include the aforementioned Cs_ 6 cycloalkyl groups as well as cyclopropyl (C 3 ) and cyclobutyl (C 4 ).
- C 3 _ 8 cycloalkyl groups include the aforementioned C 3 _6 cycloalkyl groups as well as cycloheptyl (C 7 ) and cyclooctyl (C 8 ).
- each instance of a cycloalkyl group is independently unsubstituted (an "unsubstituted cycloalkyl") or substituted (a "substituted cycloalkyl") with one or more substituents.
- the cycloalkyl group is an unsubstituted C 3 _i 4 cycloalkyl. In certain embodiments, the cycloalkyl group is a substituted C 3 _i 4 cycloalkyl.
- heterocyclyl refers to a radical of a 3- to 14- membered non-aromatic ring system having ring carbon atoms and 1 to 4 ring heteroatoms, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur ("3-14 membered heterocyclyl").
- heterocyclyl groups that contain one or more nitrogen atoms, the point of attachment can be a carbon or nitrogen atom, as valency permits.
- a heterocyclyl group can either be monocyclic (“monocyclic heterocyclyl”) or polycyclic (e.g., a fused, bridged or spiro ring system such as a bicyclic system (“bicyclic heterocyclyl”) or tricyclic system (“tricyclic heterocyclyl”)), and can be saturated or can contain one or more carbon- carbon double or triple bonds.
- Heterocyclyl polycyclic ring systems can include one or more heteroatoms in one or both rings.
- Heterocyclyl also includes ring systems wherein the heterocyclyl ring, as defined above, is fused with one or more carbocyclyl groups wherein the point of attachment is either on the carbocyclyl or heterocyclyl ring, or ring systems wherein the heterocyclyl ring, as defined above, is fused with one or more aryl or heteroaryl groups, wherein the point of attachment is on the heterocyclyl ring, and in such instances, the number of ring members continue to designate the number of ring members in the heterocyclyl ring system.
- each instance of heterocyclyl is independently unsubstituted (an "unsubstituted heterocyclyl") or substituted (a "substituted heterocyclyl") with one or more substituents.
- the heterocyclyl group is an unsubstituted 3-14 membered heterocyclyl. In certain embodiments, the heterocyclyl group is a substituted 3-14 membered heterocyclyl.
- a heterocyclyl group is a 5-10 membered non-aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur ("5-10 membered heterocyclyl").
- a heterocyclyl group is a 5-8 membered non-aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms, wherein each heteroatom is
- a heterocyclyl group is a 5-6 membered non-aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms, wherein each heteroatom is
- the 5-6 membered heterocyclyl has 1-3 ring heteroatoms selected from nitrogen, oxygen, and sulfur. In some embodiments, the 5-6 membered heterocyclyl has 1-2 ring heteroatoms selected from nitrogen, oxygen, and sulfur. In some embodiments, the 5-6 membered heterocyclyl has 1 ring heteroatom selected from nitrogen, oxygen, and sulfur.
- Exemplary 3-membered heterocyclyl groups containing 1 heteroatom include, without limitation, azirdinyl, oxiranyl, and thiiranyl.
- Exemplary 4-membered heterocyclyl groups containing 1 heteroatom include, without limitation, azetidinyl, oxetanyl, and thietanyl.
- Exemplary 5-membered heterocyclyl groups containing 1 heteroatom include, without limitation, tetrahydrofuranyl, dihydrofuranyl, tetrahydrothiophenyl,
- Exemplary 5- membered heterocyclyl groups containing 2 heteroatoms include, without limitation, dioxolanyl, oxathiolanyl and dithiolanyl.
- Exemplary 5-membered heterocyclyl groups containing 3 heteroatoms include, without limitation, triazolinyl, oxadiazolinyl, and thiadiazolinyl.
- Exemplary 6-membered heterocyclyl groups containing 1 heteroatom include, without limitation, piperidinyl, tetrahydropyranyl, dihydropyridinyl, and thianyl.
- Exemplary 6-membered heterocyclyl groups containing 2 heteroatoms include, without limitation, piperazinyl, morpholinyl, dithianyl, and dioxanyl. Exemplary 6-membered heterocyclyl groups containing 2 heteroatoms include, without limitation, triazinanyl. Exemplary 7- membered heterocyclyl groups containing 1 heteroatom include, without limitation, azepanyl, oxepanyl and thiepanyl. Exemplary 8-membered heterocyclyl groups containing 1 heteroatom include, without limitation, azocanyl, oxecanyl and thiocanyl.
- bicyclic heterocyclyl groups include, without limitation, indolinyl, isoindolinyl, dihydrobenzofuranyl, dihydrobenzothienyl, tetrahydrobenzothienyl, tetrahydrobenzofuranyl, tetrahydroindolyl, tetrahydroquinolinyl, tetrahydroisoquinolinyl, decahydroquinolinyl, decahydroisoquinolinyl, octahydrochromenyl, octahydroisochromenyl, decahydronaphthyridinyl, decahydro-1,8- naphthyridinyl, octahydropyrrolo[3,2-b]pyrrole, indolinyl, phthalimidyl, naphthalimidyl, chromanyl, chromenyl, lH-benzo[e][l,4-
- aryl refers to a radical of a monocyclic or polycyclic (e.g., bicyclic or tricyclic) 4n+2 aromatic ring system (e.g., having 6, 10, or 14 ⁇ electrons shared in a cyclic array) having 6-14 ring carbon atoms and zero heteroatoms provided in the aromatic ring system ("C6 i 4 aryl").
- an aryl group has 6 ring carbon atoms ("C 6 aryl”; e.g., phenyl).
- an aryl group has 10 ring carbon atoms ("Cio aryl”; e.g., naphthyl such as 1-naphthyl and 2-naphthyl). In some embodiments, an aryl group has 14 ring carbon atoms ("Ci 4 aryl”; e.g., anthracyl).
- Aryl also includes ring systems wherein the aryl ring, as defined above, is fused with one or more carbocyclyl or heterocyclyl groups wherein the radical or point of attachment is on the aryl ring, and in such instances, the number of carbon atoms continue to designate the number of carbon atoms in the aryl ring system. Unless otherwise specified, each instance of an aryl group is
- the aryl group is an unsubstituted C 6 - i 4 aryl. In certain embodiments, the aryl group is a substituted C 6 -i 4 aryl.
- heteroaryl refers to a radical of a 5-14 membered monocyclic or polycyclic (e.g., bicyclic, tricyclic) 4n+2 aromatic ring system (e.g., having 6, 10, or 14 ⁇ electrons shared in a cyclic array) having ring carbon atoms and 1-4 ring heteroatoms rovided in the aromatic ring system, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur ("5-14 membered heteroaryl").
- the point of attachment can be a carbon or nitrogen atom, as valency permits.
- Heteroaryl polycyclic ring systems can include one or more heteroatoms in one or both rings.
- Heteroaryl includes ring systems wherein the heteroaryl ring, as defined above, is fused with one or more carbocyclyl or heterocyclyl groups wherein the point of attachment is on the heteroaryl ring, and in such instances, the number of ring members continue to designate the number of ring members in the heteroaryl ring system.
- Heteroaryl also includes ring systems wherein the heteroaryl ring, as defined above, is fused with one or more aryl groups wherein the point of attachment is either on the aryl or heteroaryl ring, and in such instances, the number of ring members designates the number of ring members in the fused polycyclic (aryl/heteroaryl) ring system.
- Polycyclic heteroaryl groups wherein one ring does not contain a heteroatom e.g., indolyl, quinolinyl, carbazolyl, and the like
- the point of attachment can be on either ring, i.e., either the ring bearing a heteroatom (e.g., 2-indolyl) or the ring that does not contain a heteroatom (e.g., 5-indolyl).
- a heteroaryl group is a 5-10 membered aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms provided in the aromatic ring system, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur ("5-10 membered heteroaryl").
- a heteroaryl group is a 5-8 membered aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms provided in the aromatic ring system, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur ("5-8 membered heteroaryl").
- a heteroaryl group is a 5-6 membered aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms provided in the aromatic ring system, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur ("5-6 membered heteroaryl").
- the 5-6 membered heteroaryl has 1-3 ring heteroatoms selected from nitrogen, oxygen, and sulfur.
- the 5-6 membered heteroaryl has 1-2 ring heteroatoms selected from nitrogen, oxygen, and sulfur.
- the 5-6 membered heteroaryl has 1 ring heteroatom selected from nitrogen, oxygen, and sulfur. Unless otherwise specified, each instance of a heteroaryl group is independently unsubstituted (an
- heteroaryl group is an unsubstituted 5-14 membered heteroaryl.
- heteroaryl group is a substituted 5-14 membered heteroaryl.
- Exemplary 5-membered heteroaryl groups containing 1 heteroatom include, without limitation, pyrrolyl, furanyl, and thiophenyl.
- Exemplary 5-membered heteroaryl groups containing 2 heteroatoms include, without limitation, imidazolyl, pyrazolyl, oxazolyl, isoxazolyl, thiazolyl, and isothiazolyl.
- Exemplary 5-membered heteroaryl groups containing 3 heteroatoms include, without limitation, triazolyl, oxadiazolyl, and thiadiazolyl.
- 5- membered heteroaryl groups containing 4 heteroatoms include, without limitation, tetrazolyl.
- Exemplary 6-membered heteroaryl groups containing 1 heteroatom include, without limitation, pyridinyl.
- Exemplary 6-membered heteroaryl groups containing 2 heteroatoms include, without limitation, pyridazinyl, pyrimidinyl, and pyrazinyl.
- 6- membered heteroaryl groups containing 3 or 4 heteroatoms include, without limitation, triazinyl and tetrazinyl, respectively.
- Exemplary 7-membered heteroaryl groups containing 1 heteroatom include, without limitation, azepinyl, oxepinyl, and thiepinyl.
- Exemplary 5,6- bicyclic heteroaryl groups include, without limitation, indolyl, isoindolyl, indazolyl, benzotriazolyl, benzothiophenyl, isobenzothiophenyl, benzofuranyl, benzoisofuranyl, benzimidazolyl, benzoxazolyl, benzisoxazolyl, benzoxadiazolyl, benzthiazolyl,
- Exemplary 6,6-bicyclic heteroaryl groups include, without limitation, naphthyridinyl, pteridinyl, quinolinyl, isoquinolinyl, cinnolinyl, quinoxalinyl, phthalazinyl, and quinazolinyl.
- Exemplary tricyclic heteroaryl groups include, without limitation, phenanthridinyl, dibenzofuranyl, carbazolyl, acridinyl, phenothiazinyl, phenoxazinyl and phenazinyl.
- alkylene is the divalent moiety of alkyl
- alkenylene is the divalent moiety of alkenyl
- alkynylene is the divalent moiety of alkynyl
- heteroalkylene is the divalent moiety of heteroalkyl
- heteroalkenylene is the divalent moiety of heteroalkenyl
- heteroalkynylene is the divalent moiety of heteroalkynyl
- carbocyclylene is the divalent moiety of carbocyclyl
- heterocyclylene is the divalent moiety of heterocyclyl
- arylene is the divalent moiety of aryl
- heteroarylene is the divalent moiety of heteroaryl.
- a group is optionally substituted unless expressly provided otherwise.
- alkyl, alkenyl, alkynyl, heteroalkyl, heteroalkenyl, heteroalkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl groups are optionally substituted.
- "Optionally substituted” refers to a group which may be substituted or unsubstituted (e.g., "substituted" or
- substituted means that at least one hydrogen present on a group is replaced with a permissible substituent, e.g., a substituent which upon substitution results in a stable compound, e.g., a compound which does not spontaneously undergo transformation such as by rearrangement, cyclization, elimination, or other reaction.
- a "substituted" group has a substituent at one or more substitutable positions of the group, and when more than one position in any given structure is substituted, the substituent is either the same or different at each position.
- substituted is contemplated to include substitution with all permissible substituents of organic compounds, and includes any of the substituents described herein that results in the formation of a stable compound.
- present invention contemplates any and all such combinations in order to arrive at a stable
- heteroatoms such as nitrogen may have hydrogen substituents and/or any suitable substituent as described herein which satisfy the valencies of the heteroatoms and results in the formation of a stable moiety.
- the invention is not intended to be limited in any manner by the exemplary substituents described herein.
- halo refers to fluorine (fluoro, -F), chlorine (chloro, -CI), bromine (bromo, -Br), or iodine (iodo, -I).
- amino refers to the group -NH 2 .
- substituted amino by extension, refers to a monosubstituted amino, a disubstituted amino, or a trisubstituted amino. In certain embodiments, the "substituted amino” is a monosubstituted amino or a
- trisubstituted amino refers to an amino group wherein the nitrogen atom directly attached to the parent molecule is substituted with three groups, and includes groups selected from -N(R bb ) 3 and -N(R bb ) 3 + X ⁇ , wherein R bb and X " are as defined herein.
- the substituent present on the nitrogen atom is an nitrogen protecting group (also referred to herein as an "amino protecting group").
- Nitrogen protecting groups such as carbamate groups include, but are not limited to, methyl carbamate, ethyl carbamante, 9-fluorenylmethyl carbamate (Fmoc), 9-(2-sulfo)fluorenylmethyl carbamate, 9-(2,7-dibromo)fluoroenylmethyl carbamate, 2,7-di-i-butyl-[9-( 10, 10-dioxo-lO, 10, 10, 10-tetrahydrothioxanthyl)]methyl carbamate (DBD-Tmoc), 4-methoxyphenacyl carbamate (Phenoc), 2,2,2-trichloroethyl carbamate (Troc), 2-trimethylsilylethyl carbamate (Teoc), 2-phenylethyl carbamate (hZ), 1- (l-adamantyl)-l-methylethyl
- Nitrogen protecting groups such as sulfonamide groups include, but are not limited to, /?-toluenesulfonamide (Ts), benzenesulfonamide, 2,3,6,-trimethyl-4- methoxybenzenesulfonamide (Mtr), 2,4,6-trimethoxybenzenesulfonamide (Mtb), 2,6- dimethyl-4-methoxybenzenesulfonamide (Pme), 2,3,5, 6-tetramethyl-4- methoxybenzenesulfonamide (Mte), 4-methoxybenzenesulfonamide (Mbs), 2,4,6- trimethylbenzenesulfonamide (Mts), 2,6-dimethoxy-4-methylbenzenesulfonamide (iMds), 2,2,5,7, 8-pentamethylchroman-6-sulfonamide (Pmc), methanes
- Ts /?-toluenesulfonamide
- Mtr
- nitrogen protecting groups include, but are not limited to, phenothiazinyl- (lO)-acyl derivative, N'-p-toluenesulfonylaminoacyl derivative, N'-phenylaminothioacyl derivative, N-benzoylphenylalanyl derivative, N-acetylmethionine derivative, 4,5-diphenyl- 3-oxazolin-2-one, N-phthalimide, N-dithiasuccinimide (Dts), N-2,3-diphenylmaleimide, N-2,5-dimethylpyrrole, N-l,l,4,4-tetramethyldisilylazacyclopentane adduct (STABASE), 5-substituted l,3-dimethyl-l,3,5-triazacyclohexan-2-one, 5-substituted 1,3-dibenzyl- l,3,5-triazacyclohexan-2-one
- benzenesulfenamide o-nitrobenzenesulfenamide (Nps), 2,4-dinitrobenzenesulfenamide, pentachlorobenzenesulfenamide, 2-nitro-4-methoxybenzenesulfenamide,
- the substituent present on an oxygen atom is an oxygen protecting group (also referred to herein as an "hydroxyl protecting group").
- Oxygen protecting groups are well known in the art and include those described in detail in Protecting Groups in Organic Synthesis, T. W. Greene and P. G. M. Wuts, 3 edition, John Wiley & Sons, 1999, incorporated herein by reference.
- oxygen protecting groups include, but are not limited to, methyl, methoxylmethyl (MOM), methylthiomethyl (MTM), i-butylthiomethyl,
- DPMS diphenylmethylsilyl
- TMPS i-butylmethoxyphenylsilyl
- dimethylphosphinothioyl dimethylphosphinothioyl, alkyl 2,4-dinitrophenylsulfenate, sulfate, methanesulfonate (mesylate), benzylsulfonate, and tosylate (Ts).
- the substituent present on an sulfur atom is a sulfur protecting group (also referred to as a "thiol protecting group").
- aminooxy or “aminooxy group,” are used interchangeably herein and refer to functional groups having the general formula: NH 2 ⁇ w herein
- R 31 is optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, optionally substituted heteroaryl, or optionally substituted heterocyclyl.
- R 31 is an amino acid, wherein the point of attachment for the oxygen is on the side chain of the amino acid. In certain embodimetns, the amino acid is withinin a polypeptide.
- tautomers refers to two or more interconvertable compounds resulting from at least one formal migration of a hydrogen atom and at least one change in valency (e.g., a single bond to a double bond, a triple bond to a single bond, or vice versa).
- the exact ratio of the tautomers depends on several factors, including temperature, solvent, and pH. Tautomerizations (i.e., the reaction providing a tautomeric pair) may catalyzed by acid or base.
- Exemplary tautomerizations include keto-to-enol, amide-to-imide, lactam-to-lactim, enamine-to-imine, and enamine-to-(a different enamine) tautomerizations.
- enantiomers and those that are non-superimposable mirror images of each other are termed "enantiomers".
- An enantiomer can be characterized by the absolute configuration of its asymmetric center and is described by the R- and S-sequencing rules of Cahn and Prelog, or by the manner in which the molecule rotates the plane of polarized light and designated as dextrorotatory or levorotatory (i.e., as (+) or (-)-isomers respectively).
- a chiral compound can exist as either individual enantiomer or as a mixture thereof. A mixture containing equal proportions of the enantiomers is called a "racemic mixture".
- carbonyl or “carbonyl group,” are used interchangeably herein and refer to functional groups composed of a carbon atom double-bonded to any oxygen atom.
- Carbonyls have the general formula: R wherein each of R and R independently represents hydroxyl, optionally substituted amino, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, optionally substituted heteroaryl, or optionally substituted heterocyclyl.
- Examples of carbonyls include, but are not limited to, aldehydes, ketones, carboxylic acids, esters, amides, enones, acyl halides, acid anhydrides, and imides.
- a carbonyl- containing compound refers to a compound having an aldehyde group, or a compound capable of forming an aldehyde group through isomerization.
- certain sugars such as glucose
- a sugar is classified as a reducing sugar if it has an open-chain form with an aldehyde group or a free hemiacetal group.
- Monosaccharides which contain an aldehyde group are known as aldoses, and those with a ketone group are known as ketoses.
- the aldehyde can be oxidized via a redox reaction in which another compound is reduced.
- a reducing sugar is one that is capable of reducing certain chemicals.
- R 34 is optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, optionally substituted heteroaryl, or optionally substituted heterocyclyl.
- R 34 is an amino acid, wherein the point of attachment for the oxygen is on the side chain of the amino acid.
- the amino acid is withinin a polypeptide.
- hydrozone refers to compound having the general formula: , wherein each of R , R , and R is independently optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, optionally substituted heteroaryl, or optionally substituted heterocyclyl.
- hydrozone linkage is independently optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, optionally substituted heteroaryl, or optionally substituted heterocyclyl.
- Hydrzones can be prepared from, for example, joining of a compound comprising a hydrazide group and a compound comprising a carbonyl.
- acyl groups include aldehydes (-CHO), carboxylic acids (-C0 2 H), ketones, acyl halides, esters, amides, imines, carbonates, carbamates, and ureas.
- Acyl substituents include, but are not limited to, any of the substituents described herein, that result in the formation of a stable moiety.
- azide or "azido,” as used herein, refers to a group of the formula (-N 3 ).
- Compounds described herein can comprise one or more asymmetric centers, and thus can exist in various stereoisomeric forms, e.g., enantiomers and/or diastereomers.
- the compounds described herein can be in the form of an individual enantiomer, diastereomer or geometric isomer, or can be in the form of a mixture of stereoisomers, including racemic mixtures and mixtures enriched in one or more stereoisomer.
- Isomers can be isolated from mixtures by methods known to those skilled in the art, including chiral high pressure liquid chromatography (HPLC) and the formation and crystallization of chiral salts; or preferred isomers can be prepared by asymmetric syntheses.
- HPLC high pressure liquid chromatography
- the invention additionally encompasses compounds as individual isomers substantially free of other isomers, and alternatively, as mixtures of various isomers.
- — is absent, a coordination bond between a ligand and a metal, or a single bond.
- Ci_6 alkyl is intended to encompass, Ci, C 2 , C 3 , C 4 , C5,
- aliphatic includes both saturated and unsaturated, nonaromatic, straight chain ⁇ i.e., unbranched), branched, acyclic, and cyclic ⁇ i.e., carbocyclic) hydrocarbons, which are optionally substituted with one or more functional groups.
- aliphatic is intended herein to include, but is not limited to, alkyl, alkenyl, alkynyl, cycloalkyl, cycloalkenyl, and cycloalkynyl moieties.
- alkyl includes straight, branched and cyclic alkyl groups.
- alkyl is used to indicate those aliphatic groups (cyclic, acyclic, substituted, unsubstituted, branched or unbranched) having 1-20 carbon atoms (Ci-20 aliphatic).
- the aliphatic group has 1-10 carbon atoms (CMO aliphatic).
- the aliphatic group has 1-6 carbon atoms (C 1-6 aliphatic).
- the aliphatic group has 1-5 carbon atoms (C 1-5 aliphatic). In certain embodiments, the aliphatic group has 1-5 carbon atoms (C 1-5 aliphatic). In certain embodiments, the aliphatic group has 1-5 carbon atoms (C 1-5 aliphatic). In certain embodiments, the aliphatic group has 1-5 carbon atoms (C 1-5 aliphatic). In certain embodiments, the aliphatic group has 1-5 carbon atoms (C 1-5 aliphatic). In certain
- the aliphatic group has 1-4 carbon atoms (C 1-4 aliphatic).
- the aliphatic group has 1-3 carbon atoms (C 1-3 aliphatic). In certain embodiments, the aliphatic group has 1-3 carbon atoms (C 1-3 aliphatic). In certain
- the aliphatic group has 1-2 carbon atoms (Ci_2 aliphatic).
- Aliphatic group substituents include, but are not limited to, any of the substituents described herein, that result in the formation of a stable moiety.
- heteroaliphatic refers to aliphatic moieties that contain one or more oxygen, sulfur, nitrogen, phosphorus, or silicon atoms, e.g., in place of carbon atoms. Heteroaliphatic moieties may be branched, unbranched, cyclic or acyclic and include saturated and unsaturated heterocycles such as morpholino, pyrrolidinyl, etc.
- heteroaliphatic moieties are substituted by independent replacement of one or more of the hydrogen atoms thereon with one or more moieties including, but not limited to aliphatic; heteroaliphatic; aryl; heteroaryl; arylalkyl; heteroarylalkyl; alkoxy; aryloxy;
- alkyl refers to saturated, straight- or branched-chain hydrocarbon radicals derived from a hydrocarbon moiety containing between one and twenty carbon atoms by removal of a single hydrogen atom.
- the alkyl group employed in the invention contains 1-20 carbon atoms (Ci_ 2 oalkyl).
- the alkyl group employed contains 1-15 carbon atoms (Ci-isalkyl).
- the alkyl group employed contains 1-10 carbon atoms (Ci_ioalkyl).
- the alkyl group employed contains 1-8 carbon atoms (Ci_ 8 alkyl).
- the alkyl group employed contains 1-6 carbon atoms (Ci_ 6 alkyl). In another embodiment, the alkyl group employed contains 1-5 carbon atoms (Ci-salkyl). In another embodiment, the alkyl group employed contains 1-4 carbon atoms (Ci_ 4 alkyl). In another embodiment, the alkyl group employed contains 1-3 carbon atoms (Ci_ 3 alkyl). In another embodiment, the alkyl group employed contains 1-2 carbon atoms (Ci_ 2 alkyl).
- alkyl radicals include, but are not limited to, methyl, ethyl, n-propyl, isopropyl, n-butyl, iso-butyl, sec- butyl, sec-pentyl, iso-pentyl, tert-butyl, n-pentyl, neopentyl, n-hexyl, sec-hexyl, n-heptyl, n-octyl, n-decyl, n-undecyl, dodecyl, and the like, which may bear one or more substituents.
- Alkyl group substituents include, but are not limited to, any of the substituents described herein, that result in the formation of a stable moiety.
- alkylene refers to a biradical derived from an alkyl group, as defined herein, by removal of two hydrogen atoms. Alkylene groups may be cyclic or acyclic, branched or unbranched, substituted or unsubstituted. Alkylene group substituents include, but are not limited to, any of the substituents described herein, that result in the formation of a stable moiety.
- alkenyl denotes a monovalent group derived from a straight- or branched-chain hydrocarbon moiety having at least one carbon-carbon double bond by the removal of a single hydrogen atom.
- the alkenyl group employed in the invention contains 2-20 carbon atoms (C 2 - 2 oalkenyl).
- the alkenyl group employed in the invention contains 2-15 carbon atoms (d isalkenyl).
- the alkenyl group employed contains 2-10 carbon atoms (C 2 -ioalkenyl).
- the alkenyl group contains 2-8 carbon atoms (C 2 - 8 alkenyl).
- the alkenyl group contains 2-6 carbons (C 2 - 6 alkenyl).
- the alkenyl group contains 2-5 carbons (C 2 - 5 alkenyl).
- the alkenyl group contains 2-4 carbons (C 2 - 4 alkenyl). In yet other words, the alkenyl group contains 2-4 carbons (C 2 - 4 alkenyl). In yet other words, the alkenyl group contains 2-4 carbons (C 2 - 4 alkenyl).
- the alkenyl group contains 2-3 carbons (C 2 - 3 alkenyl). In yet other words, the alkenyl group contains 2-3 carbons (C 2 - 3 alkenyl). In yet other words, the alkenyl group contains 2-3 carbons (C 2 - 3 alkenyl).
- the alkenyl group contains 2 carbons (C 2 alkenyl).
- Alkenyl groups include, for example, ethenyl, propenyl, butenyl, l-methyl-2-buten-l-yl, and the like, which may bear one or more substituents.
- Alkenyl group substituents include, but are not limited to, any of the substituents described herein, that result in the formation of a stable moiety.
- alkenylene refers to a biradical derived from an alkenyl group, as defined herein, by removal of two hydrogen atoms.
- Alkenylene groups may be cyclic or acyclic, branched or unbranched, substituted or unsubstituted.
- Alkenylene group substituents include, but are not limited to, any of the substituents described herein, that result in the formation of a stable moiety.
- alkynyl refers to a monovalent group derived from a straight- or branched-chain hydrocarbon having at least one carbon-carbon triple bond by the removal of a single hydrogen atom.
- the alkynyl group employed in the invention contains 2-20 carbon atoms (C 2 - 2 oalkynyl).
- the alkynyl group employed in the invention contains 2-15 carbon atoms (C 2 -i 5 alkynyl).
- the alkynyl group employed contains 2-10 carbon atoms (C 2 -ioalkynyl).
- the alkynyl group contains 2-8 carbon atoms (C 2 - 8 alkynyl). In still other embodiments, the alkynyl group contains 2-6 carbon atoms (C 2 - 6 alkynyl). In still other embodiments, the alkynyl group contains 2-5 carbon atoms (C 2 - 5 alkynyl). In still other embodiments, the alkynyl group contains 2-4 carbon atoms (C 2 _ 4 alkynyl). In still other embodiments, the alkynyl group contains 2-3 carbon atoms (C 2 - 3 alkynyl). In still other embodiments, the alkynyl group contains 2 carbon atoms (C 2 alkynyl).
- alkynyl groups include, but are not limited to, ethynyl, 2-propynyl (propargyl), 1-propynyl, and the like, which may bear one or more substituents.
- Alkynyl group substituents include, but are not limited to, any of the substituents described herein, that result in the formation of a stable moiety.
- alkynylene refers to a biradical derived from an alkynylene group, as defined herein, by removal of two hydrogen atoms.
- Alkynylene groups may be cyclic or acyclic, branched or unbranched, substituted or unsubstituted.
- Alkynylene group substituents include, but are not limited to, any of the substituents described herein, that result in the formation of a stable moiety.
- heteroalkyl refers to an alkyl group, which further includes at least one heteroatom (e.g., 1, 2, 3, or 4 heteroatoms) selected from oxygen, nitrogen, or sulfur within (i.e., inserted between adjacent carbon atoms of) and/or placed at one or more terminal position(s) of the parent chain.
- a heteroalkyl group refers to a saturated group having from 1 to 10 carbon atoms and 1 or more heteroatoms within the parent chain (“heteroCi_io alkyl").
- a heteroalkyl group is a saturated group having 1 to 9 carbon atoms and 1 or more heteroatoms within the parent chain
- a heteroalkyl group is a saturated group having 1 to 8 carbon atoms and 1 or more heteroatoms within the parent chain ("heteroCi_ 8 alkyl”). In some embodiments, a heteroalkyl group is a saturated group having 1 to 7 carbon atoms and 1 or more heteroatoms within the parent chain (“heteroCi_7 alkyl”). In some embodiments, a heteroalkyl group is a saturated group having 1 to 6 carbon atoms and 1 or more heteroatoms within the parent chain (“heteroCi_ 6 alkyl").
- a heteroalkyl group is a saturated group having 1 to 5 carbon atoms and 1 or 2 heteroatoms within the parent chain ("heteroCi_ 5 alkyl"). In some embodiments, a heteroalkyl group is a saturated group having 1 to 4 carbon atoms and lor 2 heteroatoms within the parent chain ("heteroCi ⁇ alkyl"). In some embodiments, a heteroalkyl group is a saturated group having 1 to 3 carbon atoms and 1 heteroatom within the parent chain (“heteroCi_ 3 alkyl"). In some embodiments, a heteroalkyl group is a saturated group having 1 to 2 carbon atoms and 1 heteroatom within the parent chain (“heteroCi_ 2 alkyl").
- a heteroalkyl group is a saturated group having 1 carbon atom and 1 heteroatom (“heteroCi alkyl"). In some embodiments, a heteroalkyl group is a saturated group having 2 to 6 carbon atoms and 1 or 2 heteroatoms within the parent chain ("heteroC 2 -6 alkyl"). Unless otherwise specified, each instance of a heteroalkyl group is independently unsubstituted (an "unsubstituted
- heteroalkyl or substituted (a "substituted heteroalkyl") with one or more substituents.
- the heteroalkyl group is an unsubstituted heteroCi_io alkyl. In certain embodiments, the heteroalkyl group is a substituted heteroCi_io alkyl.
- heteroalkenyl refers to an alkenyl group, which further includes at least one heteroatom (e.g., 1, 2, 3, or 4 heteroatoms) selected from oxygen, nitrogen, or sulfur within (i.e., inserted between adjacent carbon atoms of) and/or placed at one or more terminal position(s) of the parent chain.
- a heteroalkenyl group refers to a group having from 2 to 10 carbon atoms, at least one double bond, and 1 or more heteroatoms within the parent chain (“heterod-io alkenyl").
- a heteroalkenyl group has 2 to 9 carbon atoms at least one double bond, and 1 or more heteroatoms within the parent chain ("heteroC 2 -9 alkenyl"). In some embodiments, a heteroalkenyl group has 2 to 8 carbon atoms, at least one double bond, and 1 or more heteroatoms within the parent chain ("heteroC 2 -8 alkenyl"). In some embodiments, a heteroalkenyl group has 2 to 7 carbon atoms, at least one double bond, and 1 or more heteroatoms within the parent chain (“heteroC 2 -7 alkenyl").
- a heteroalkenyl group has 2 to 6 carbon atoms, at least one double bond, and 1 or more heteroatoms within the parent chain ("heteroC 2 -6 alkenyl"). In some embodiments, a heteroalkenyl group has 2 to 5 carbon atoms, at least one double bond, and 1 or 2 heteroatoms within the parent chain ("heteroC 2 -5 alkenyl"). In some embodiments, a heteroalkenyl group has 2 to 4 carbon atoms, at least one double bond, and lor 2
- heteroalkenyl group has 2 to 3 carbon atoms, at least one double bond, and 1 heteroatom within the parent chain ("heteroC 2 -3 alkenyl”). In some embodiments, a heteroalkenyl group has 2 to 6 carbon atoms, at least one double bond, and 1 or 2 heteroatoms within the parent chain ("heteroC 2 -6 alkenyl”). Unless otherwise specified, each instance of a heteroalkenyl group is independently unsubstituted (an "unsubstituted heteroalkenyl") or substituted (a "substituted heteroalkenyl") with one or more substituents. In certain embodiments, the heteroalkenyl group is an unsubstituted heteroC 2 -io alkenyl. In certain embodiments, the heteroalkenyl group is a substituted heteroC 2 -io alkenyl.
- heteroalkynyl refers to an alkynyl group, which further includes at least one heteroatom (e.g., 1, 2, 3, or 4 heteroatoms) selected from oxygen, nitrogen, or sulfur within (i.e., inserted between adjacent carbon atoms of) and/or placed at one or more terminal position(s) of the parent chain.
- a heteroalkynyl group refers to a group having from 2 to 10 carbon atoms, at least one triple bond, and 1 or more heteroatoms within the parent chain (“heteroC 2 -io alkynyl").
- a heteroalkynyl group has 2 to 9 carbon atoms, at least one triple bond, and 1 or more heteroatoms within the parent chain ("heteroC 2 -9 alkynyl"). In some embodiments, a heteroalkynyl group has 2 to 8 carbon atoms, at least one triple bond, and 1 or more heteroatoms within the parent chain ("heteroC 2 - 8 alkynyl"). In some embodiments, a heteroalkynyl group has 2 to 7 carbon atoms, at least one triple bond, and 1 or more heteroatoms within the parent chain (“heteroC 2 -7 alkynyl").
- a heteroalkynyl group has 2 to 6 carbon atoms, at least one triple bond, and 1 or more heteroatoms within the parent chain ("heteroC 2 -6 alkynyl"). In some embodiments, a heteroalkynyl group has 2 to 5 carbon atoms, at least one triple bond, and 1 or 2 heteroatoms within the parent chain ("heteroC 2 -5 alkynyl"). In some embodiments, a heteroalkynyl group has 2 to 4 carbon atoms, at least one triple bond, and lor 2 heteroatoms within the parent chain (“heteroC 2 ⁇ alkynyl").
- a heteroalkynyl group has 2 to 3 carbon atoms, at least one triple bond, and 1 heteroatom within the parent chain ("heteroC 2 -3 alkynyl"). In some embodiments, a heteroalkynyl group has 2 to 6 carbon atoms, at least one triple bond, and 1 or 2 heteroatoms within the parent chain ("heteroC 2 -6 alkynyl"). Unless otherwise specified, each instance of a heteroalkynyl group is independently unsubstituted (an “unsubstituted heteroalkynyl") or substituted (a "substituted
- heteroalkynyl with one or more substituents.
- the heteroalkynyl group is an unsubstituted heteroC 2 io alkynyl. In certain embodiments, the heteroalkynyl group is a substituted heteroC 2 -io alkynyl.
- carbocyclyl refers to a radical of a non-aromatic cyclic hydrocarbon group having from 3 to 14 ring carbon atoms ("C 3 _i 4 carbocyclyl") and zero heteroatoms in the non-aromatic ring system.
- a carbocyclyl group has 3 to 10 ring carbon atoms ("C 3 _io carbocyclyl”).
- a carbocyclyl group has 3 to 8 ring carbon atoms (“C 3 _ 8 carbocyclyl”).
- a carbocyclyl group has 3 to 7 ring carbon atoms (“C 3 _7 carbocyclyl”).
- a carbocyclyl group has 3 to 6 ring carbon atoms ("C 3 _6 carbocyclyl”). In some embodiments, a carbocyclyl group has 4 to 6 ring carbon atoms ("C 4 _ 6 carbocyclyl”). In some embodiments, a carbocyclyl group has 5 to 6 ring carbon atoms (“Cs_6 carbocyclyl”). In some embodiments, a carbocyclyl group has 5 to 10 ring carbon atoms ("Cs-io carbocyclyl”).
- Exemplary C 3 _ 6 carbocyclyl groups include, without limitation, cyclopropyl (C 3 ), cyclopropenyl (C 3 ), cyclobutyl (C 4 ), cyclobutenyl (C 4 ), cyclopentyl (C5), cyclopentenyl (C5), cyclohexyl (C 6 ), cyclohexenyl (C 6 ), cyclohexadienyl (C 6 ), and the like.
- Exemplary C 3 _ 8 carbocyclyl groups include, without limitation, the aforementioned C 3 _ 6 carbocyclyl groups as well as
- C 7 cycloheptyl
- C 7 cycloheptenyl
- C 7 cycloheptadienyl
- C 7 cycloheptatrienyl
- C 7 cyclooctyl
- C 8 cyclooctenyl
- Exemplary C 3 _io carbocyclyl groups include, without limitation, the
- C 3 _ 8 carbocyclyl groups as well as cyclononyl (C 9 ), cyclononenyl (C 9 ), cyclodecyl (Cio), cyclodecenyl (Cio), octahydro-lH-indenyl (C 9 ), decahydronaphthalenyl (Cio), spiro[4.5]decanyl (Cio), and the like.
- the carbocyclyl group is either monocyclic (“monocyclic carbocyclyl”) or polycyclic (e.g., containing a fused, bridged or spiro ring system such as a bicyclic system (“bicyclic carbocyclyl”) or tricyclic system (“tricyclic carbocyclyl”)) and can be saturated or can contain one or more carbon-carbon double or triple bonds.
- Carbocyclyl also includes ring systems wherein the carbocyclyl ring, as defined above, is fused with one or more aryl or heteroaryl groups wherein the point of attachment is on the carbocyclyl ring, and in such instances, the number of carbons continue to designate the number of carbons in the carbocyclic ring system.
- each instance of a carbocyclyl group is independently unsubstituted (an "unsubstituted carbocyclyl") or substituted (a "substituted carbocyclyl”) with one or more substituents.
- the carbocyclyl group is an unsubstituted C 3 _i 4 carbocyclyl.
- the carbocyclyl group is a substituted C 3 _i 4 carbocyclyl.
- “carbocyclyl” is a monocyclic, saturated carbocyclyl group having from 3 to 14 ring carbon atoms ("C 3 _i 4 cycloalkyl”). In some embodiments, a cycloalkyl group has 3 to 10 ring carbon atoms ("C 3 _io cycloalkyl”). In some embodiments, a cycloalkyl group has 3 to 8 ring carbon atoms ("C 3 _ 8 cycloalkyl”). In some embodiments, a cycloalkyl group has 3 to 6 ring carbon atoms ("C 3 _6 cycloalkyl").
- a cycloalkyl group has 4 to 6 ring carbon atoms ("C 4 _6 cycloalkyl”). In some embodiments, a cycloalkyl group has 5 to 6 ring carbon atoms ("Cs_6 cycloalkyl”). In some embodiments, a cycloalkyl group has 5 to 10 ring carbon atoms ("Cs-io cycloalkyl”). Examples of Cs_6 cycloalkyl groups include cyclopentyl (C 5 ) and cyclohexyl (C 5 ).
- C 3 _ 6 cycloalkyl groups include the aforementioned Cs_ 6 cycloalkyl groups as well as cyclopropyl (C 3 ) and cyclobutyl (C 4 ).
- C 3 _ 8 cycloalkyl groups include the aforementioned C 3 _6 cycloalkyl groups as well as cycloheptyl (C 7 ) and cyclooctyl (C 8 ).
- each instance of a cycloalkyl group is independently unsubstituted (an "unsubstituted cycloalkyl") or substituted (a "substituted cycloalkyl") with one or more substituents.
- the cycloalkyl group is an unsubstituted C 3 _i 4 cycloalkyl. In certain embodiments, the cycloalkyl group is a substituted C 3 _i 4 cycloalkyl.
- heterocyclyl refers to a radical of a 3- to 14- membered non-aromatic ring system having ring carbon atoms and 1 to 4 ring heteroatoms, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur ("3-14 membered heterocyclyl").
- the point of attachment can be a carbon or nitrogen atom, as valency permits.
- a heterocyclyl group can either be monocyclic (“monocyclic heterocyclyl”) or polycyclic (e.g., a fused, bridged or spiro ring system such as a bicyclic system (“bicyclic heterocyclyl”) or tricyclic system (“tricyclic heterocyclyl”)), and can be saturated or can contain one or more carbon- carbon double or triple bonds.
- Heterocyclyl polycyclic ring systems can include one or more heteroatoms in one or both rings.
- Heterocyclyl also includes ring systems wherein the heterocyclyl ring, as defined above, is fused with one or more carbocyclyl groups wherein the point of attachment is either on the carbocyclyl or heterocyclyl ring, or ring systems wherein the heterocyclyl ring, as defined above, is fused with one or more aryl or heteroaryl groups, wherein the point of attachment is on the heterocyclyl ring, and in such instances, the number of ring members continue to designate the number of ring members in the heterocyclyl ring system.
- each instance of heterocyclyl is independently unsubstituted (an "unsubstituted heterocyclyl") or substituted (a "substituted heterocyclyl") with one or more substituents.
- the heterocyclyl group is an unsubstituted 3-14 membered heterocyclyl. In certain embodiments, the heterocyclyl group is a substituted 3-14 membered heterocyclyl.
- a heterocyclyl group is a 5-10 membered non-aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur ("5-10 membered heterocyclyl").
- a heterocyclyl group is a 5-8 membered non-aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms, wherein each heteroatom is
- a heterocyclyl group is a 5-6 membered non-aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms, wherein each heteroatom is
- the 5-6 membered heterocyclyl has 1-3 ring heteroatoms selected from nitrogen, oxygen, and sulfur. In some embodiments, the 5-6 membered heterocyclyl has 1-2 ring heteroatoms selected from nitrogen, oxygen, and sulfur. In some embodiments, the 5-6 membered heterocyclyl has 1 ring heteroatom selected from nitrogen, oxygen, and sulfur.
- Exemplary 3-membered heterocyclyl groups containing 1 heteroatom include, without limitation, azirdinyl, oxiranyl, and thiiranyl.
- Exemplary 4-membered heterocyclyl groups containing 1 heteroatom include, without limitation, azetidinyl, oxetanyl, and thietanyl.
- Exemplary 5-membered heterocyclyl groups containing 1 heteroatom include, without limitation, tetrahydrofuranyl, dihydrofuranyl, tetrahydrothiophenyl,
- Exemplary 5- membered heterocyclyl groups containing 2 heteroatoms include, without limitation, dioxolanyl, oxathiolanyl and dithiolanyl.
- Exemplary 5-membered heterocyclyl groups containing 3 heteroatoms include, without limitation, triazolinyl, oxadiazolinyl, and thiadiazolinyl.
- Exemplary 6-membered heterocyclyl groups containing 1 heteroatom include, without limitation, piperidinyl, tetrahydropyranyl, dihydropyridinyl, and thianyl.
- Exemplary 6-membered heterocyclyl groups containing 2 heteroatoms include, without limitation, piperazinyl, morpholinyl, dithianyl, and dioxanyl. Exemplary 6-membered heterocyclyl groups containing 2 heteroatoms include, without limitation, triazinanyl. Exemplary 7- membered heterocyclyl groups containing 1 heteroatom include, without limitation, azepanyl, oxepanyl and thiepanyl. Exemplary 8-membered heterocyclyl groups containing 1 heteroatom include, without limitation, azocanyl, oxecanyl and thiocanyl.
- bicyclic heterocyclyl groups include, without limitation, indolinyl, isoindolinyl, dihydrobenzofuranyl, dihydrobenzothienyl, tetrahydrobenzothienyl, tetrahydrobenzofuranyl, tetrahydroindolyl, tetrahydroquinolinyl, tetrahydroisoquinolinyl, decahydroquinolinyl, decahydroisoquinolinyl, octahydrochromenyl, octahydroisochromenyl, decahydronaphthyridinyl, decahydro-1,8- naphthyridinyl, octahydropyrrolo[3,2-b]pyrrole, indolinyl, phthalimidyl, naphthalimidyl, chromanyl, chromenyl, lH-benzo[e][l,4-
- aryl refers to a radical of a monocyclic or polycyclic (e.g., bicyclic or tricyclic) 4n+2 aromatic ring system (e.g., having 6, 10, or 14 ⁇ electrons shared in a cyclic array) having 6-14 ring carbon atoms and zero heteroatoms provided in the aromatic ring system ("C 6 -i 4 aryl").
- an aryl group has 6 ring carbon atoms ("C 6 aryl”; e.g., phenyl).
- an aryl group has 10 ring carbon atoms ("Qo aryl”; e.g., naphthyl such as 1-naphthyl and 2-naphthyl).
- an aryl group has 14 ring carbon atoms ("C 14 aryl”; e.g., anthracyl).
- Aryl also includes ring systems wherein the aryl ring, as defined above, is fused with one or more carbocyclyl or heterocyclyl groups wherein the radical or point of attachment is on the aryl ring, and in such instances, the number of carbon atoms continue to designate the number of carbon atoms in the aryl ring system. Unless otherwise specified, each instance of an aryl group is
- the aryl group is an unsubstituted C 6 - 14 aryl. In certain embodiments, the aryl group is a substituted C 6 -i 4 aryl.
- heteroaryl refers to a radical of a 5-14 membered monocyclic or polycyclic (e.g., bicyclic, tricyclic) 4n+2 aromatic ring system (e.g., having 6, 10, or 14 ⁇ electrons shared in a cyclic array) having ring carbon atoms and 1-4 ring heteroatoms rovided in the aromatic ring system, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur ("5-14 membered heteroaryl").
- the point of attachment can be a carbon or nitrogen atom, as valency permits.
- Heteroaryl polycyclic ring systems can include one or more heteroatoms in one or both rings.
- Heteroaryl includes ring systems wherein the heteroaryl ring, as defined above, is fused with one or more carbocyclyl or heterocyclyl groups wherein the point of attachment is on the heteroaryl ring, and in such instances, the number of ring members continue to designate the number of ring members in the heteroaryl ring system.
- Heteroaryl also includes ring systems wherein the heteroaryl ring, as defined above, is fused with one or more aryl groups wherein the point of attachment is either on the aryl or heteroaryl ring, and in such instances, the number of ring members designates the number of ring members in the fused polycyclic (aryl/heteroaryl) ring system.
- Polycyclic heteroaryl groups wherein one ring does not contain a heteroatom e.g., indolyl, quinolinyl, carbazolyl, and the like
- the point of attachment can be on either ring, i.e., either the ring bearing a heteroatom (e.g., 2-indolyl) or the ring that does not contain a heteroatom (e.g., 5-indolyl).
- a heteroaryl group is a 5-10 membered aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms provided in the aromatic ring system, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur ("5-10 membered heteroaryl").
- a heteroaryl group is a 5-8 membered aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms provided in the aromatic ring system, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur ("5-8 membered heteroaryl").
- a heteroaryl group is a 5-6 membered aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms provided in the aromatic ring system, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur ("5-6 membered heteroaryl").
- the 5-6 membered heteroaryl has 1-3 ring heteroatoms selected from nitrogen, oxygen, and sulfur.
- the 5-6 membered heteroaryl has 1-2 ring heteroatoms selected from nitrogen, oxygen, and sulfur.
- the 5-6 membered heteroaryl has 1 ring heteroatom selected from nitrogen, oxygen, and sulfur. Unless otherwise specified, each instance of a heteroaryl group is independently unsubstituted (an
- heteroaryl group is an unsubstituted 5-14 membered heteroaryl. In certain embodiments, the heteroaryl group is a substituted 5-14 membered heteroaryl.
- Exemplary 5-membered heteroaryl groups containing 1 heteroatom include, without limitation, pyrrolyl, furanyl, and thiophenyl.
- Exemplary 5-membered heteroaryl groups containing 2 heteroatoms include, without limitation, imidazolyl, pyrazolyl, oxazolyl, isoxazolyl, thiazolyl, and isothiazolyl.
- Exemplary 5-membered heteroaryl groups containing 3 heteroatoms include, without limitation, triazolyl, oxadiazolyl, and thiadiazolyl.
- 5- membered heteroaryl groups containing 4 heteroatoms include, without limitation, tetrazolyl.
- Exemplary 6-membered heteroaryl groups containing 1 heteroatom include, without limitation, pyridinyl.
- Exemplary 6-membered heteroaryl groups containing 2 heteroatoms include, without limitation, pyridazinyl, pyrimidinyl, and pyrazinyl.
- 6- membered heteroaryl groups containing 3 or 4 heteroatoms include, without limitation, triazinyl and tetrazinyl, respectively.
- Exemplary 7-membered heteroaryl groups containing 1 heteroatom include, without limitation, azepinyl, oxepinyl, and thiepinyl.
- Exemplary 5,6- bicyclic heteroaryl groups include, without limitation, indolyl, isoindolyl, indazolyl, benzotriazolyl, benzothiophenyl, isobenzothiophenyl, benzofuranyl, benzoisofuranyl, benzimidazolyl, benzoxazolyl, benzisoxazolyl, benzoxadiazolyl, benzthiazolyl,
- Exemplary 6,6-bicyclic heteroaryl groups include, without limitation, naphthyridinyl, pteridinyl, quinolinyl, isoquinolinyl, cinnolinyl, quinoxalinyl, phthalazinyl, and quinazolinyl.
- Exemplary tricyclic heteroaryl groups include, without limitation, phenanthridinyl, dibenzofuranyl, carbazolyl, acridinyl, phenothiazinyl, phenoxazinyl and phenazinyl.
- alkylene is the divalent moiety of alkyl
- alkenylene is the divalent moiety of alkenyl
- alkynylene is the divalent moiety of alkynyl
- heteroalkylene is the divalent moiety of heteroalkyl
- heteroalkenylene is the divalent moiety of heteroalkenyl
- heteroalkynylene is the divalent moiety of heteroalkynyl
- carbocyclylene is the divalent moiety of carbocyclyl
- heterocyclylene is the divalent moiety of heterocyclyl
- arylene is the divalent moiety of aryl
- heteroarylene is the divalent moiety of heteroaryl.
- a group is optionally substituted unless expressly provided otherwise.
- alkyl, alkenyl, alkynyl, heteroalkyl, heteroalkenyl, heteroalkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl groups are optionally substituted.
- "Optionally substituted” refers to a group which may be substituted or unsubstituted (e.g., "substituted" or
- substituted means that at least one hydrogen present on a group is replaced with a permissible substituent, e.g., a substituent which upon substitution results in a stable compound, e.g., a compound which does not spontaneously undergo transformation such as by rearrangement, cyclization, elimination, or other reaction.
- a "substituted" group has a substituent at one or more substitutable positions of the group, and when more than one position in any given structure is substituted, the substituent is either the same or different at each position.
- substituted is contemplated to include substitution with all permissible substituents of organic compounds, and includes any of the substituents described herein that results in the formation of a stable compound.
- present invention contemplates any and all such combinations in order to arrive at a stable
- halo refers to fluorine (fluoro, -F), chlorine (chloro, -CI), bromine (bromo, -Br), or iodine (iodo, -I).
- amino refers to the group -NH 2 .
- substituted amino by extension, refers to a monosubstituted amino, a disubstituted amino, or a trisubstituted amino. In certain embodiments, the "substituted amino” is a monosubstituted amino or a
- trisubstituted amino refers to an amino group wherein the nitrogen atom directly attached to the parent molecule is substituted with three groups, and includes groups selected from -N(R bb ) 3 and -N(R bb ) 3 + X ⁇ , wherein R bb and X " are as defined herein.
- the substituent present on the nitrogen atom is an nitrogen protecting group (also referred to herein as an "amino protecting group").
- Nitrogen protecting groups are well known in the art and include those described in detail in Protecting Groups in Organic Synthesis, T. W. Greene and P. G. M. Wuts, 3 edition, John Wiley & Sons, 1999, incorporated herein by reference.
- Nitrogen protecting groups such as carbamate groups include, but are not limited to, methyl carbamate, ethyl carbamante, 9-fluorenylmethyl carbamate (Fmoc), 9-(2-sulfo)fluorenylmethyl carbamate, 9-(2,7-dibromo)fluoroenylmethyl carbamate, 2,7-di-t-butyl-[9-( 10, 10-dioxo-lO, 10, 10, 10-tetrahydrothioxanthyl)]methyl carbamate (DBD-Tmoc), 4-methoxyphenacyl carbamate (Phenoc), 2,2,2-trichloroethyl carbamate (Troc), 2-trimethylsilylethyl carbamate (Teoc), 2-phenylethyl carbamate (hZ), 1- (l-adamantyl)-l-methylethyl
- Nitrogen protecting groups such as sulfonamide groups include, but are not limited to, /?-toluenesulfonamide (Ts), benzenesulfonamide, 2,3,6,-trimethyl-4- methoxybenzenesulfonamide (Mtr), 2,4,6-trimethoxybenzenesulfonamide (Mtb), 2,6- dimethyl-4-methoxybenzenesulfonamide (Pme), 2,3,5, 6-tetramethyl-4- methoxybenzenesulfonamide (Mte), 4-methoxybenzenesulfonamide (Mbs), 2,4,6- trimethylbenzenesulfonamide (Mts), 2,6-dimethoxy-4-methylbenzenesulfonamide (iMds), 2,2,5,7, 8-pentamethylchroman-6-sulfonamide (Pmc), methanes
- Ts /?-toluenesulfonamide
- Mtr
- nitrogen protecting groups include, but are not limited to, phenothiazinyl- (10)-acyl derivative, N'-p-toluenesulfonylaminoacyl derivative, N'-phenylaminothioacyl derivative, N-benzoylphenylalanyl derivative, N-acetylmethionine derivative, 4,5-diphenyl- 3-oxazolin-2-one, N-phthalimide, N-dithiasuccinimide (Dts), N-2,3-diphenylmaleimide, N-2,5-dimethylpyrrole, N-l, l,4,4-tetramethyldisilylazacyclopentane adduct (STABASE), 5-substituted l,3-dimethyl-l,3,5-triazacyclohexan-2-one, 5-substituted 1,3-dibenzyl- l,3,5-triazacyclohexan-2-one,
- benzenesulfenamide o-nitrobenzenesulfenamide (Nps), 2,4-dinitrobenzenesulfenamide, pentachlorobenzenesulfenamide, 2-nitro-4-methoxybenzenesulfenamide,
- triphenylmethylsulfenamide triphenylmethylsulfenamide
- 3-nitropyridinesulfenamide Npys
- the substituent present on an oxygen atom is an oxygen protecting group (also referred to herein as an "hydroxyl protecting group").
- Oxygen protecting groups are well known in the art and include those described in detail in Protecting Groups in Organic Synthesis, T. W. Greene and P. G. M. Wuts, 3 edition, John Wiley & Sons, 1999, incorporated herein by reference.
- oxygen protecting groups include, but are not limited to, methyl, methoxylmethyl (MOM), methylthiomethyl (MTM), i-butylthiomethyl,
- DPMS diphenylmethylsilyl
- TMPS i-butylmethoxyphenylsilyl
- dimethylphosphinothioyl dimethylphosphinothioyl, alkyl 2,4-dinitrophenylsulfenate, sulfate, methanesulfonate (mesylate), benzylsulfonate, and tosylate (Ts).
- the substituent present on an sulfur atom is a sulfur protecting group (also referred to as a "thiol protecting group").
- Sulfur protecting groups are well known in the art and include those described in detail in Protecting Groups in Organic Synthesis, T. W. Greene and P. G. M. Wuts, 3 rd edition, John Wiley & Sons, 1999, incorporated herein by reference.
- aminooxy or aminooxy group
- aminooxy group are used interchangeably herein and refer to functional groups having the general formula:
- R 31 is optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, optionally substituted heteroaryl, or optionally substituted heterocyclyl.
- R 31 is an amino acid, wherein the point of attachment for the oxygen is on the side chain of the amino acid. In certain embodimetns, the amino acid is withinin a polypeptide.
- tautomers refers to two or more interconvertable compounds resulting from at least one formal migration of a hydrogen atom and at least one change in valency (e.g., a single bond to a double bond, a triple bond to a single bond, or vice versa).
- the exact ratio of the tautomers depends on several factors, including temperature, solvent, and pH. Tautomerizations (i.e., the reaction providing a tautomeric pair) may catalyzed by acid or base.
- Exemplary tautomerizations include keto-to-enol, amide-to-imide, lactam-to-lactim, enamine-to-imine, and enamine-to-(a different enamine) tautomerizations.
- An enantiomer can be characterized by the absolute configuration of its asymmetric center and is described by the R- and S-sequencing rules of Cahn and Prelog, or by the manner in which the molecule rotates the plane of polarized light and designated as dextrorotatory or levorotatory (i.e., as (+) or (-)-isomers respectively).
- a chiral compound can exist as either individual enantiomer or as a mixture thereof. A mixture containing equal proportions of the enantiomers is called a "racemic mixture".
- carbonyl or “carbonyl group,” are used interchangeably herein and refer to functional groups composed of a carbon atom double-bonded to any oxygen atom.
- Carbonyls have the general formula:
- each of R and R independently represents hydroxyl, optionally substituted amino, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, optionally substituted heteroaryl, or optionally substituted heterocyclyl.
- carbonyls include, but are not limited to, aldehydes, ketones, carboxylic acids, esters, amides, enones, acyl halides, acid anhydrides, and imides.
- a carbonyl- containing compound refers to a compound having an aldehyde group, or a compound capable of forming an aldehyde group through isomerization.
- certain sugars e.g.
- reducing sugars such as glucose
- a sugar is classified as a reducing sugar if it has an open-chain form with an aldehyde group or a free hemiacetal group.
- Monosaccharides which contain an aldehyde group are known as aldoses, and those with a ketone group are known as ketoses.
- the aldehyde can be oxidized via a redox reaction in which another compound is reduced.
- a reducing sugar is one that is capable of reducing certain chemicals.
- Sugars with ketone groups in their open chain form are capable of isomerizing via a series of tautomeric shifts to produce an aldehyde group in solution.
- ketone-bearing sugars like fructose are considered reducing sugars but it is the isomer containing an aldehyde group which is reducing since ketones cannot be oxidized without decomposition of the sugar.
- This type of isomerization is catalyzed by the base present in solutions which test for the presence of aldehydes.
- R is optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, optionally substituted heteroaryl, or optionally substituted heterocyclyl.
- R 34 is an amino acid, wherein the point of attachment for the oxygen is on the side chain of the amino acid. In certain embodimetns, the amino acid is withinin a polypeptide.
- hydrozone refers to compound having the general formula: , wherein each of R 33 , R ib , and R J/ is independently optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, optionally substituted heteroaryl, or optionally substituted heterocyclyl.
- hydrozone linkage is independently optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, optionally substituted heteroaryl, or optionally substituted heterocyclyl.
- Hydrzones can be prepared from, for example, joining of a compound comprising a hydrazide group and a compound comprising a carbonyl.
- acyl groups include aldehydes (-CHO), carboxylic acids (-C0 2 H), ketones, acyl halides, esters, amides, imines, carbonates, carbamates, and ureas.
- Acyl substituents include, but are not limited to, any of the substituents described herein, that result in the formation of a stable moiety.
- azide or "azido,” as used herein, refers to a group of the formula (-N 3 ).
- Radiolabled proteins [00187] Aspects of the disclosure provide antibodies, or fragments thereof, (e.g., single domain antibodies) comprising a radiolabel and/or a hydrophilic polymer. It shold be appreciated that any of the linkages provided herein may be used to link proteins (e.g., antibodies) to a radiolabel and/or a hydrophilic polymer. It should also be appreciated that agents, such as the chelating moieties and radionuclides provided below may be substituted with another agents, such as any of the chelating moieties and radionuclides provided herein
- radiolabeled proteins can be prepared from modified proteins of Formula (I).
- L 1 is a linker comprising at least four amino acids formed by enzymatic conjugation between two enzyme recognition sequences
- R 1 comprises a reactive group capable of undergoing a click chemistry reaction.
- L 1 is a linker formed by enzymatic conjugation between two enzyme recognition sequences. In certain embodiments, L 1 comprises at least four amino acids. In certain embodiments, L 1 comprises at least five amino acids. In certain embodiments, L 1 comprises at least six amino acids. In certain embodiments, L 1 comprises at least seven amino acids. In certain embodiments, L 1 is a linker formed by sortase-mediated transpeptidation of two sortase recognition sequences.
- L 1 is - LPXTGGGK-, -LPXTGGG-, -NPXTGGGK-, NPXTGGG-, -LPXTAAA-, -NPXTAAA-,- LPXTGGGGG-, or -LPGAG-, wherein each instance of X is independently an amino acid.
- X is E.
- X is Q.
- X is K.
- the modified protein is formed by enzymatic conjugation and a compound of Formula (a): B— R (a), wherein each of A and B is independently an enzyme recognition sequence.
- the modified protein is formed by enzymatic conjugation and a compound of Formula (a): B— R (a), wherein each of A and B is independently an enzyme recognition sequence.
- the modified protein is formed by enzymatic conjugation and a compound of Formula (a): B— R (a), wherein each of A and B is independently an enzyme recognition sequence.
- the modified protein is formed by enzymatic conjugation and a compound of Formula (a): B— R (a), wherein each of A and B is independently an enzyme recognition sequence.
- A comprises LPXTX or NPXTX
- B comprises an oligoglycine or an oligoalanine sequence; wherein each instance of X is independently an amino acid.
- B comprises LPXTX or NPXTX
- A comprises an oligoglycine or an oligoalanine sequence; wherein each instance of X is independently an amino acid.
- A is LPETG, LPETA , NPQTN, or NPKTG, and B is GGG or AAA.
- A comprises an oligoglycine or an oligoalanine sequence
- B comprises LPXTX or NPXTX, wherein each instance of X is independently an amino acid.
- B is LPETG, LPETA, NPQTN, or NPKTG, and A is GGG or AAA.
- the enzyme recognition sequence is an amino acid sequence recognized by a transamidase enzyme.
- the transamidase recognition sequence is a sortase recognition sequence or a sortase recognition motif.
- the sortase is sortase A (SrtA). In certain embodiments, the sortase is sortase B (SrtB).
- R 1 is a reactive group capable of undergoing a click chemistry reaction.
- Click chemistry is a chemical approach introduced by Sharpies s in 2001 and describes chemistry tailored to generate substances quickly and reliably by joining small units together. See, e.g., Kolb, Finn and Sharpless Angewandte Chemie International Edition (2001) 40: 2004-2021; Evans, Australian Journal of Chemistry (2007) 60: 384-395).
- Exemplary coupling reactions include, but are not limited to, formation of esters, thioesters, amides (e.g., such as peptide coupling) from activated acids or acyl halides; nucleophilic displacement reactions (e.g., such as nucleophilic displacement of a halide or ring opening of strained ring systems); azide-alkyne Huisgon cycloaddition; thiol-yne addition; imine formation; Michael additions (e.g., maleimide addition); Diels-Alder reaction and inverse electron demand Diels-Alder reaction; and [4+1] cycloadditions (e.g.
- the click chemistry reaction is a Diels-Alder reaction. It is to be understood that the click chemistry reaction may be followed by additional one or more chemical transformations. In certain embodiments, the click chemistry reaction is a Diels-Alder reaction followed by an retro-Diels-Alder reaction.
- R 1 is a reactive group capable of undergoing a [3+2] cycloaddition. In certain embodiments, R 1 comprises a dipolarophile. In certain
- R 1 comprises an alkynyl group. In certain embodiments, R 1 comprises comprises a 1,3-dipole. In certain embodiments, R comprises an azido. In certain
- R 1 is a reactive group capable of undergoing a a Diels-Alder cycloaddition. In certain embodiments, R 1 comprises a conjugated diene. In certain embodiments, R 1 comprises a tetrazine or a quadricyclane. In certain embodiments, R 1 comprises a tetrazine. In certain embodiments, R 1 comprises an unsubstituted tetrazine. In certain embodiments, R 1 comprises a substituted tetrazine.
- R 1 is of Formula (i):
- R £ is hydrogen, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, optionally substituted heteroaryl, or optionally substituted heterocyclyl;
- R s is a bond, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted arylene, optionally substituted heteroarylene, or optionally substituted heterocyclylene.
- R £ is hydrogen, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, optionally substituted heteroaryl, or optionally substituted heterocyclyl.
- R £ is hydrogen.
- R £ is optionally substituted aliphatic.
- R £ is optionally substituted C 1-6 alkyl.
- R £ is unsubstituted C 1-6 alkyl.
- R £ is methyl or ethyl.
- R £ is substituted Ci_ 6 alkyl.
- R £ is optionally substituted aryl.
- R £ is optionally substituted phenyl.
- R £ is optionally substituted heteroaryl.
- R £ is optionally substituted pyridine.
- R s is a bond, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted arylene, optionally substituted heteroarylene, or optionally substituted heterocyclylene. In certain embodiments, R s is a bond. In certain embodiments, R s is optionally substituted aliphatic. In certain embodiments, R s is optionally substituted Ci_ 6 alkyl. In certain embodiments, R s is unsubstituted Ci_ 6 alkyl. In certain embodiments, R s is methyl or ethyl. In certain embodiments, R s is substituted Ci_ 6 alkyl. In certain embodiments, R s is optionally substituted heteroaliphatic.
- R s is optionally substituted arylene. In certain embodiments, R s is optionally substituted phenyl. In certain embodiments, R s is optionally substituted heteroarylene. In certain embodiments, R s is optionally substituted pyridine.
- R 1 comprises a dienophile. In certain embodiments, R 1 comprises an optionally substituted alkene. In certain embodiments, R 1 comprises a
- R 1 comprises a substututed cyclooctene of the formula:
- R is a bond, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted arylene, optionally substituted heteroarylene, or optionally substituted heterocyclylene.
- R 1 comprises a substututed cyclooctene of the
- R 1 comprises a irans-cyclooctene. In iments, R 1 comprises a substututed irans-cyclooctene of the formula
- R is as de s, R comprises a
- R 1 comprises an unsubstututed irans-cyclooctene.
- Another aspect of the invention provides a radioactive protein of Formula (II)
- L 1 is a linker comprising at least four amino acids formed by enzymatic conjugation between two enzyme recognition sequences
- L is optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted arylene, optionally substituted heteroarylene, or optionally substituted
- the linker L is formed by a click chemistry reaction.
- the linker L is formed by a [3+2] cycloaddition.
- the linker L is formed by a Diels-Alder cycloaddition.
- the linker L is formed by a Diels-Alder cycloaddition followed by one or more chemical transformations. In certain embodiments, the linker L is formed by a Diels- Alder cycloaddition followed by retro- Diels-Alder reaction.
- L is optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted arylene, optionally substituted
- L is optionally substituted aliphatic. In certain embodiments, L is optionally substituted heteroaliphatic. In certain embodiments, L is optionally substituted arylene. In certain
- L is optionally substituted cycloalkylene. In certain embodiments, L is optionally substituted heteroarylene.
- the radioactive protein of Formula (II) is formed by a click chemistry reaction of the modified protein of Formula (I) and a compound of Formula (b):
- R 2 is a reactive group capable of undergoing the click chemistry reaction.
- R is a reactive group capable of undergoing a click chemistry reaction.
- R is a reactive unsaturated group capable of undergoing a [3+2] cycloaddition.
- R comprises a dipolarophile.
- R 2 comprises an alkynyl group.
- R 2 comprises a 1,3-dipole.
- R 2 comprises an azido.
- R 2 is a reactive group capable of undergoing a a Diels-Alder cycloaddition. In certain embodiments,
- R 2 comprises a conjugated diene. In certain embodiments, R 2 comprises a tetrazine or a quadricyclane. In certain embodiments, R 2 comprises a tetrazine. In certain embodiments, R 2 comprises an unsubstituted tetrazine. In certain embodiments, R comprises a substituted tetrazine.
- R is of Formula (i):
- R £ is hydrogen, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, optionally substituted heteroaryl, or optionally substituted heterocyclyl;
- R s is a bond, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted arylene, optionally substituted heteroarylene, or optionally substituted heterocyclylene.
- R 2 comprises a dienophile. In certain embodiments, R 2 comprises an optionally substituted alkene. In certain embodiments, R comprises a cyclooctene. In certain embodiments, R comprises a irans-cyclooctene. In certain embodiments, R 2 comprises a substututed irans-cyclooctene. In certain embodiments, R 2 comprises an unsubstututed irans-cyclooctene.
- a compound of Formula (b): 18 F-R 2 (b), is of Formula (b- 1):
- R ⁇ is optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, optionally substituted heteroaryl, or optionally substituted heterocyclyl; and R ⁇ comprises 18 F.
- R ⁇ is optionally substituted aliphatic.
- R ⁇ is optionally substituted heteroaliphatic.
- R ⁇ is -0-Ci_ 6 alkylene, wherein the Ci_ 6 alkylene comprises 18 F.
- a compound of Formula (b) is of Formula (b-1 -a): erein h is an integer of 1 to 5, inclusive.
- the compounds of Formula (b-1) can be prepared according to Scheme S6 or Scheme S6-a.
- leaving group is given its ordinary meaning in the art of synthetic organic chemistry and refers to an atom or a group capable of being displaced by a nucleophile.
- suitable leaving groups include, but are not limited to, halogen (such as F, CI, Br, or I (iodine)), alkoxycarbonyloxy, aryloxycarbonyloxy, alkanesulfonyloxy, arenesulfonyloxy, alkyl-carbonyloxy (e.g., acetoxy), arylcarbonyloxy, aryloxy, methoxy, N,0-dimethylhydroxylamino, pixyl, and haloformates.
- halogen such as F, CI, Br, or I (iodine
- the leaving group is a sulfonic acid ester, such as toluenesulfonate (tosylate, -OTs), methanesulfonate (mesylate, - OMs), /?-bromobenzenesulfonyloxy (brosylate, -OBs), or trifluoromethanesulfonate (triflate, -OTf).
- the leaving group is a brosylate, such as /?-bromobenzenesulfonyloxy.
- the leaving group is a nosylate, such as 2-nitrobenzenesulfonyloxy.
- the leaving group is a sulfonate-containing group. In some embodiments, the leaving group is a tosylate group.
- the leaving group may also be a phosphineoxide (e.g. , formed during a Mitsunobu reaction) or an internal leaving group such as an epoxide or cyclic sulfate.
- Other non-limiting examples of leaving groups are water, ammonia, alcohols, ether moieties, thioether moieties, zinc halides, magnesium moieties, diazonium salts, and copper moieties.
- LG is -OTs.
- L 4 and Y are as defined herein.
- L 4 , M, L a , L b , and L c are as defined herein, and— indicates a coordination bond or absent, as valency permits.
- — is a single coordination bond.
- — is absent.
- a compound of Formula (b) is of the formula:
- a compound of Formula (b): F-R (b), is of Formula (b-
- R s and R £ are as defined herein.
- a compound of Formula (b) is of Formula (b-2-a):
- R £ , R p , and p are as defined herein.
- a compound of Formula (b) is of Formula (b-2-al):
- R £ , R N1 , L 3 , R ql , and ql are as defined herein; and R is an optionally substituted
- a "carbohydrate group” or a “carbohydrate” refers to a monosaccharide or a polysaccharide (e.g. , a disaccharide or oligosaccharide).
- exemplary monosaccharides include, but are not limited to, natural sugars, such as allose, altrose, glucose, mannose, gulose, idose, galactose, talose, ribose, arabinose, xylose, and lyxose.
- Disaccharides are two joined monosaccharides.
- Exemplary disaccharides include, but are not limited to, sucrose, maltose, cellobiose, and lactose.
- an oligosaccharide includes between three and ten monosaccharide units (e.g. , raffinose, stachyose).
- the carbohydrate group may be a natural sugar or a modified sugar.
- modified sugars include, but are not limited to, sugars where the hydroxyl group is replaced with an amino group and/or alkyl group (e.g., such as desosamine), 2'-deoxyribose wherein a hydroxyl group is removed, 2 '-fluororibose wherein a hydroxyl group is replace with a fluorine, or N-acetylglucosamine, or a nitrogen- containing form of glucose (e.g.
- a compound of Formula (b) is of Formula (b-2-a2):
- R £ , R N1 are as defined herein; and R G1 is an optionally substituted carbohydrate group or a fragment thereof; provided that R Gl comprises 18 F.
- the reaction is carried out in the presence of a catalyst.
- the catalyst is m- phenylenediamine, p-phenylenediamine, or p-anisidine. In certain embodiments, the catalyst is m-phenylenediamine. In certain embodiments, the molar ratio of the optionally substituted tetrazine-aminooxy to the catalyst is from about 10: 1 to 1: 10. In certain embodiments, the molar ratio of the optionally substituted tetrazine-aminooxy to the catalyst is from about 1: 1 to 1:8. In certain embodiments, the molar ratio of the optionally substituted tetrazine- aminooxy to the catalyst is from about 1: 1 to 1:6.
- the molar ratio of the optionally substituted tetrazine-aminooxy to the catalyst is from about 1:2 to 1:4. In certain embodiments, the molar ratio of the optionally substituted tetrazine-aminooxy to the catalyst is about 1:4.
- the resulting oxime product can be easily purified from the reaction mixture to the change in hydrophilicity.
- the excess of tetrazine-aminooxy can be captured by reacting with another water soluble carbohydrate.
- the water soluble carbohydrate is glucosamine 6-sulfate.
- a compound of Formula (b) is of Formula (b-2-a2):
- R £ , R N1 , L 3 , R sl , R s2 , R s3 , and R s4 are as defined herein.
- a compound of Formula (b) is of Formula (b-2-a3):
- a compound of Formula (b) is of Formula (b-2-b):
- R R N1 , L 3 , R QL , and ql are as defined herein.
- a compound of Formula (b) is of Formula (b-2-bl):
- a compound of Formula (b) is of Formula (b-3):
- R L 4 , and Y are as defined herein.
- a compound of Formula (b) is of Formula (b-3-a):
- a compound of Formula (b) is of the following formula:
- linker L is of Formula (ii):
- R £ is hydrogen, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, optionally substituted heteroaryl, or optionally substituted heterocyclyl;
- R s is a bond, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted arylene, optionally substituted heteroarylene, or optionally substituted heterocyclylene;
- each instance of R cl is hydrogen, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, optionally substituted heteroaryl, or optionally substituted heterocyclyl; or optionally two R cl taken with the intervening atoms to form an optionally substituted carbocyclyl or optionally substituted heterocyclyl ring;
- R c2 is a bond, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted arylene, optionally substituted heteroarylene, or optionally substituted heterocyclylene;
- n 0, 1, 2, 3, 4, 5, 6, 7, or 8, as valency permits;
- each instance of R cl is independently hydrogen, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, optionally substituted heteroaryl, or optionally substituted heterocyclyl.
- R cl is hydrogen.
- R cl is optionally substituted aliphatic.
- R cl is optionally substituted alkyl.
- R cl is optionally substituted heteroaliphatic.
- R c2 is a bond, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted arylene, optionally substituted heteroarylene, or optionally substituted heterocyclylene. In certain embodiments, R c2 is a bond. In certain embodiments, R c2 is optionally substituted aliphatic. In certain embodiments, R c2 is optionally substituted alkyl. In certain embodiments, R c2 is optionally substituted heteroaliphatic. In certain embodiments, R c2 is optionally substituted alkoxy. In certain embodiments, R c2 is an optionally substituted amino group.
- linker L is of Formula (ii-a):
- n is an integer between 1 and 8, inclusive.
- n is 1. In certain embodiments, n is 2. In certain embodiments, n is 3. In certain embodiments, n is 4. In certain embodiments, n is 5. In embodiments, n is 6. In certain embodiments, n is 7. In certain embodiments, n is 8.
- the linker L is of Formula (ii-b):
- n is an integer between 1 and 8, inclusive.
- linker L is of Formula (iii):
- R £ is hydrogen, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, optionally substituted heteroaryl, or optionally substituted heterocyclyl;
- R s is a bond, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted arylene, optionally substituted heteroarylene, or optionally substituted heterocyclylene;
- each instance of R cl is hydrogen, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, optionally substituted heteroaryl, or optionally substituted heterocyclyl;
- R c2 is a bond, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted arylene, optionally substituted heteroarylene, or optionally substituted heterocyclylene;
- n 0, 1, 2, 3, 4, 5, 6, 7, or 8, as valency permits;
- the linker L is of Formula (iii-a):
- each instance of R p is independently hydrogen, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted heterocyclyl, hydroxyl, or optionally substituted amino; provided at least one R ⁇ p is not hydrogen and comprises F 18 ; and
- p is 1, 2, 3, 4, or 5.
- p is 1. In certain embodiments, p is 2. In certain embodiments, p is 3. In certain embodiments, p is 4. In certain embodiments, p is 3. In certain embodiments, p is 5.
- R p is hydrogen, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted heterocyclyl, hydroxyl, or optionally substituted amino; wherein at least one R p is not hydrogen and comprises F 18 .
- R p is hydrogen.
- R p is optionally substituted aliphatic.
- R p is optionally substituted Ci_ 6 alkyl.
- R p is unsubstituted Ci_6 alkyl.
- R p is methyl or ethyl.
- R p is substituted Ci_6 alkyl. In certain embodiments, R p is optionally substituted aryl. In certain embodiments, R p is optionally substituted phenyl. In certain embodiments, R p is optionally substituted heteroaryl. In certain embodiments, R p is optionally substituted pyridine. In certain embodiments, least one R p is not hydrogen and comprises F .
- L is a bond, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted arylene, optionally substituted heteroarylene, or optionally substituted heterocyclylene;
- R N1 is independently hydrogen, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, or optionally substituted heteroaryl, or a nitrogen protecting group;
- each of R sl , R s2 , R s3 , and R s4 is independently hydrogen, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, or optionally substituted heteroaryl, or an oxygen protecting group.
- L is a bond, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted arylene, optionally substituted heteroarylene, or optionally substituted heterocyclylene. In certain embodiments, L is a bond. In certain embodiments, L is optionally substituted aliphatic. In certain embodiments,
- L is optionally substituted heteroaliphatic.
- L comprises an oxime
- R N1 is independently hydrogen. In certain embodiments, R N1 is optionally substituted aliphatic. In certain embodiments, R N1 is optionally substituted alkyl. In certain embodiments, R N1 is an amino protectin group.
- R sl is independently hydrogen. In certain embodiments, R sl is optionally substituted aliphatic. In certain embodiments, R sl is optionally substituted alkyl. In certain embodiments, R sl is an oxygen protectin group. In certain embodiments, R s is acyl (e.g. acetyl).
- R s2 is independently hydrogen. In certain embodiments, R s2 is optionally substituted aliphatic. In certain embodiments, R s2 is optionally substituted alkyl. In certain embodiments, R s2 is an oxygen protectin group. In certain embodiments, R s is acyl (e.g. acetyl).
- R s3 is independently hydrogen. In certain embodiments, R s3 is optionally substituted aliphatic. In certain embodiments, R s3 is optionally substituted alkyl. In certain embodiments, R s3 is an oxygen protectin group. In certain embodiments, R s is acyl (e.g. acetyl).
- R s4 is independently hydrogen. In certain embodiments, R s4 is optionally substituted aliphatic. In certain embodiments, R s4 is optionally substituted alkyl. In certain embodiments, R s4 is an oxygen protectin group. In certain embodiments, R s is acyl (e.g. acetyl).
- R sl , R s2 , R s3 , and R 54 are all hydrogen.
- R N1 , R sl , R s2 , R s3 , and R s4 are all hydrogen.
- R N1 , R sl , R s2 , R s3 , and R s4 are all hydrogen; and R £ is optionally substituted aliphatic. In certain embodiments, R N1 , R sl , R s2 , R s3 , and R s4 are all hydrogen; and R £ is optionally substituted Ci_ 6 alkyl. In certain embodiments, R N1 , R sl , R s2 , R s3 , and R s4 are all hydrogen; and R £ is methyl or ethyl.
- L is a bond, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted arylene, optionally substituted heteroarylene, or optionally substituted heterocyclylene;
- R N1 is independently hydrogen, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, or optionally substituted heteroaryl, or a nitrogen protecting group;
- each instance of R ql is independently hydrogen, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted heterocyclyl, hydroxyl, or optionally substituted amino; and ql is 0, 1, 2, 3, or 4.
- R £ is optionally substituted aliphatic and R ql is h drogen.
- R £ is optionally substituted C 1-6 alkyl;
- L 3 is
- -L 2 -F 18 is of the formula:
- -L 2 -F 18 is of Formula (Hi-b3):
- R N1 is independently hydrogen, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, or optionally substituted heteroaryl, or a nitrogen protecting group;
- each instance of R q2 is independently hydrogen, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, optionally substituted carbocyclyl, optionally substituted heteroaryl, optionally substituted heterocyclyl, hydroxyl, or optionally substituted amino; and
- q2 is 0, 1, 2, 3, or 4.
- q2 is 0. In certain embodiments, q2 is 1. In certain embodiments, ql is 2. In certain embodiments, q2 is 3. In certain embodiments, q2 is 4.
- R q2 is hydrogen. In certain embodiments, R q2 is optionally substituted aliphatic. In certain embodiments, R q2 is optionally substituted Ci_ 6 alkyl.
- R £ is optionally substituted aliphatic and R q2 is hydrogen.
- -L 2 -F 18 is of the formula:
- L is a bond, optionally substituted aliphatic, optionally substituted hetero aliphatic, optionally substituted arylene, optionally substituted heteroarylene, or optionally substituted heterocyclylene;
- R N1 is independently hydrogen, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, or optionally substituted heteroaryl, or a nitrogen protecting group;
- R is independently hydrogen, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, or optionally substituted heteroaryl, wherein RZ comprise F.
- R is an optionally substituted thiol.
- -L 2 -F 18 is of Formula (iii-c):
- Y is a ligand capable of chelating to a pharmaceutically acceptable metal complex comprising F 18 ;
- L 4 is is a bond, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted arylene, optionally substituted cycloalkylene, optionally substituted heteroarylene, or optionally substituted heterocyclylene.
- Y is a ligand capable of chelating to a
- a ligand refers to an ion or molecule (functional group) that binds to a central metal atom to form a
- metal-ligand bonding generally involves formal donation of one or more of the ligand 's electron pairs.
- the nature of metal-ligand bonding can range from covalent to ionic.
- Exemplary monodentate ligands include, but are not limited to, CO, organonitriles (e.g., CH 3 CN, CH 3 CH 2 CN), monosubstituted amines, disubstituted amines, trisubstituted amines, heterocyclyls (e.g., pyridine, piperidine), dialkylcyanamides, triphenylphosphine oxide, THF, DMF, or NMF.
- Exemplary bidentate ligands include, but are not limited to, 1,5-cyclooctadiene, norbornadiene, 1,2-ethylenediamine,
- tridentate ligands include, but are not limited to, conjugated cyclic triene (e.g. ,
- cycloheptatriene conjugated acyclic triene
- arenes e.g., benzene, toluene, xylene, mesitylene, naphthalene
- tetraazamacrocyles e.g., tetraazacyclododecane
- polyamines e.g., diethylenetriamine
- trithiocylononane e.g., the ligand is a polydentate ligand.
- the ligand comprises 1,4,7-triazacyclononane- triacetic acid (NOT A), 1,4,7, 10-tetraazacyclododecane-tetraacetic acid (DOT A), or triazacyclononane-phosphinate (TRAP).
- NOT A 1,4,7-triazacyclononane- triacetic acid
- DOT A 1,4,7, 10-tetraazacyclododecane-tetraacetic acid
- TRIP triazacyclononane-phosphinate
- the phrase "pharmaceutically acceptable” means that the metal complex is suitable for administration to a subject.
- the metal complex is a halide metal complex.
- the metal is a pharmaceutically acceptable metal.
- the metal is IIA or IDA group metal.
- the metal is an early transition metal.
- the metal is Al.
- L 4 is a bond. In certain embodiments, L 4 is an optionally substituted aliphatic. In certain embodiments, L 4 is an optionally substituted heteroaliphatic.
- -L -F is of Formula (iii-cl):
- M is a pharmaceutically acceptable metal
- each of L a , L b , and L c is independently optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted arylene, optionally substituted
- L a is optionally substituted aliphatic.
- L b is optionally substituted aliphatic.
- L c is optionally substituted aliphatic.
- -L 2 -F 18 is of Formula (iii-c2):
- the radioactive protein is one of the following formulae:
- linker L is of one of the followin formulae:
- R s , R £ , R cl , R c2 , and m are as de .ffiinneedd hheerreeiinn..
- radioactive protein of Formula (III) is provided herein.
- L 1 is as defined herein;
- R comprises a ligand capable of chelating to a pharmaceutically acceptable radioactive metal complex.
- L 1 -R 3 is of the following formula: , wherein R 22 is optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, or optionally substituted heteroaryl, or a nitrogen protecting group; wherein R comprises a ligand capable of chelating to a pharmaceutically acceptable radioactive metal complex.
- R comprises mono-dentecate ligand.
- R 3 comprises a polydentecate ligand.
- R 3 comprises 1,4,7-triazacyclononane-triacetic acid (NOTA), 1,4,7, 10-tetraazacyclododecane-tetraacetic acid (DOT A), or triazacyclononane-phosphinate (TRAP).
- NOTA 1,4,7-triazacyclononane-triacetic acid
- DOT A 1,4,7, 10-tetraazacyclododecane-tetraacetic acid
- TRIP triazacyclononane-phosphinate
- the metal is ⁇ Cu 2"1" . In certain embodiments, the metal is 68 Ga 3+ .
- the radioactive protein is one of the following formulae:
- radioactive protein of Formula (IV) is provided herein.
- L 1 is a linker comprising at least four amino acids formed by enzymatic conjugation between two enzyme recognition sequences
- R 4 comprises a radioactive optionally substituted carbohydrate
- R 4 is linked to the C-terminus of the adjacent amino acid in L 1 .
- R 4 comprises a radioactive optionally substituted carbohydrate. In certain embodiments, R 4 comprises a radioactive optionally substituted glucose. In certain embodiments, R 4 comprises a radioactive glucose comprising 18 F. In certain embodiments, R 4 comprises an optionally substituted glucose comprising 18 F. In certain embodiments, R 4 is linked to the C-terminus of the adjacent amino acid in L 1 . In certain embodiments, R 4 is linked to the side chain of the adjacent amino acid in L 1 .
- R 4 is of Formula (iv):
- v 1, 2, 3, 4, or 5;
- each of R s5 , R s6 , R s7 , and R sS is independently hydrogen, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, or optionally substituted heteroaryl, or an oxygen protecting group.
- R s5 is independently hydrogen. In certain embodiments, R s5 is optionally substituted aliphatic. In certain embodiments, R s5 is optionally substituted alkyl. In certain embodiments, R s5 is an oxygen protectin group. In certain embodiments, R 1 is acyl (e.g. acetyl).
- R s6 is independently hydrogen. In certain embodiments, R s6 is optionally substituted aliphatic. In certain embodiments, R s6 is optionally substituted alkyl. In certain embodiments, R s6 is an oxygen protectin group. In certain embodiments, R 1 is acyl (e.g. acetyl).
- R s7 is independently hydrogen. In certain embodiments, R s7 is optionally substituted aliphatic. In certain embodiments, R s7 is optionally substituted alkyl. In certain embodiments, R s7 is an oxygen protectin group. In certain embodiments, R 1 is acyl (e.g. acetyl).
- R sS is independently hydrogen. In certain embodiments, R sS is optionally substituted aliphatic. In certain embodiments, R sS is optionally substituted alkyl. In certain embodiments, R sS is an oxygen protectin group. In certain embodiments, R 1 is acyl (e.g. acetyl).
- R 4 is of the formula:
- the radioactive protein is of the following formula:
- R s5 , R s6 , R s7 , and R s8 are as defined herein; and L G is optionally substituted aliphatic or optionally substituted heteroaliphatic.
- L is optionally substituted aliphatic.
- L G is optionally substituted Ci_io alkyl. In certain embodiments, L G is optionally substituted heteroaliphatic. In certain embodiments, L is of the formula:
- e indicates the point of attachment to oxygen and/indicates the point of attachment to the alpha carbon of the amino acid.
- the radioactive protein is of the following formula:
- ⁇ ' is an antibody, a nuclear factor, a neuropeptide, a receptor protein, an enzyme, a structural protein, or a fragment thereof.
- ' is an antibody or a fragment thereof. In certain embodiments,
- R as and R bs can be prepared from optionally substituted tetrazine-aminooxy and a radiolabeled optionally substituted aldehyde or optionally substituted ketone of the formula R as -CO-R bs , wherein R G1 is as defined herein; each of R as and R bs is independently hydrogen, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, optionally substituted heteroaryl, or optionally substituted heterocyclyl; provided R as and R bs are not both hydrogen (Scheme S I).
- R as is an optionally substituted carbohydrate group or a fragment thereof. In certain embodiments, R as is an optionally substituted glucose or a fragment thereof. In certain embodiments, the reaction is carried out in the presence of a catalyst. In certain embodiments, the catalyst is m-phenylenediamine, p-phenylenediamine, or p-anisidine. In certain embodiments, the catalyst is m-phenylenediamine. In certain embodiments, the molar ratio of the optionally substituted tetrazine-aminooxy to the catalyst is from about 10: 1 to 1: 10. In certain embodiments, the molar ratio of the optionally substituted tetrazine-aminooxy to the catalyst is from about 1: 1 to 1:8. In certain
- the molar ratio of the optionally substituted tetrazine-aminooxy to the catalyst is from about 1: 1 to 1:6. In certain embodiments, the molar ratio of the optionally substituted tetrazine-aminooxy to the catalyst is from about 1:2 to 1:4. In certain embodiments, the molar ratio of the optionally substituted tetrazine-aminooxy to the catalyst is about 1:4.
- the resulting oxime product can be easily purified from the reaction mixture to the change in hydrophilicity.
- the excess of tetrazine- aminooxy can be captured by reacting with another water soluble carbohydrate.
- the water soluble carbohydrate is glucosamine 6-sulfate.
- the Nu is an amino group.
- the electrophile is an optionally substituted N-succinimidyl comprising 18 F.
- the optionally substituted N-succinimidyl is 18 F-SFB of the formula
- the radioactive protein of Formula (II) can be prepared from a modified protein of
- R 1 is the first click chemistry handle and R 2 is the second
- R is the first click chemistry handle and R is the second click chemistry handle.
- Click chemistry should be modular, wide in scope, give high chemical yields, generate inoffensive byproducts, be stereospecific, be physiologically stable, exhibit a large thermodynamic driving force (e.g., > 84 kJ/mol to favor a reaction with a single reaction product), and/or have high atom economy.
- Several reactions have been identified which fit this concept:
- the Huisgen 1,3-dipolar cycloaddition e.g., the Cu(I)-catalyzed stepwise variant, often referred to simply as the "click reaction”; see, e.g., Tornoe et ah, Journal of Organic Chemistry (2002) 67: 3057-3064).
- Copper and ruthenium are the commonly used catalysts in the reaction. The use of copper as a catalyst results in the formation of 1,4-regioisomer whereas ruthenium results in formation of the 1,5- regioisomer;
- the click chemistry is a Diels-Alder cycloaddition.
- the radioactive protein of Formula (III) can be prepared from a compound comprising an aminooxy moiety with an optionally substituted aldehyde (Scheme S4):
- the radioactive protein of Formula (IV) can be prepared from a compound comprising an aminooxy moiety with an optionally substituted aldehyde or an optionally substituted ketone (Scheme S5), wherein L is as defined herein.
- the aldehyde is an optionally substituted carbohydrate comprising an aldehyde group or is capable of forming one through isomerism.
- the optionally substituted aldehyde is an optionally substituted
- the optionally substituted aldehyde is optionally substituted glucose, optionally substituted glyceraldehyde, or optionally substituted galactose. In certain embodiments, the optionally substituted aldehyde is optionally substituted glucose.
- the catalyst is m-phenylenediamine (mPDA), o- phenylenediamine, /?-phenylenediamine, o-aminophenol, m-aminophenol, /?-aminophenol, o- aminobenzoic acid, 5-methoxyanthranilic acid, 3,5-diaminobenzoic acid or aniline.
- the catalyst is m-phenylenediamine (mPDA).
- the radioactive optionally substituted cyclooctene is synthesized by a nucleophilic reaction with an 18 F anion with a substituted cyclooctene comprising a leaving group LG (Scheme S6), wherein LG is as defined herein and L 61 is optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted arylene, optionally substituted heteroarylene, or optionally substituted heterocyclylene.
- L is optionally substituted hereo aliphatic.
- L 61 is straight chain heteroaliphatic.
- L 61 is -0-Ci_ 8 alkylene.
- L 61 is -0-(CH 2 )i- 8 -.
- the radioactive optionally substituted cyclooctene is synthesized as shown in Scheme S6-a, wherein L 61 is as defined herein.
- the 18 F - " anion is from an inorganic salt comprising 18 F - "
- the F " anion is from a metal salt comprising F " anion.
- the 18 F " anion is from IA, IIA, or IIIA metal fluoride.
- the F " anion is from transition metal complex comprising F " .
- the enzymatic conjugation is a modification using a formylglycine generating enzyme (FGE).
- FGE formylglycine generating enzyme
- the protein is an antibody.
- the enzyme is FGE.
- the FGE recognition sequence is CXPXR.
- the FGE recognition sequence is LCTPSRGSLFTGR.
- the radioactive protein is prepared according to Scheme El.
- R is a reactive group capable of undergoing a click chemistry reaction, comprising a radioactive optionally substituted carbohydrate, or comprising a ligand capable of chelating to a pharmaceutically acceptable radioactive metal complex.
- X an independently amino acid
- the -CHO group generated from the FGE modification can undergo any suitable reaction to incorporate a radioactive label, for example, a click chemistry handle, a radioactive carbohydrate, or a ligand capable of chelating to a radioactive label, for example, a click chemistry handle, a radioactive carbohydrate, or a ligand capable of chelating to a radioactive label, for example, a click chemistry handle, a radioactive carbohydrate, or a ligand capable of chelating to a
- radioactive metal complex exemplary transformations such as reacting with hydrazine or hydroxylamine are shown in the Scheme El.
- the enzymatic conjugation is a modification using
- the protein is a cell surface polypeptide. In certain embodiments, the protein is a glycan.
- An exemplary sialylation is shown in Scheme E2, wherein R 4 is as defined herein.
- R comprises a radioactive optionally substituted carbohydrate
- R 4 comprises radioactive optionally substituted glucose. In certain embodiments, R 4 comprises 18 F-FDG. In certain embodiments, R 4 comprises radioactive optionally substituted aldolase. In certain embodiments, R comprises radioactive optionally substituted mannose.
- the enzymatic conjugation is a modification using phosphopantetheinyltransferases (PPTases).
- the protein is peptide carrier protein (PCP).
- the protein is acyl carrier protein (ACP).
- the PPT recognition sequence comprises a serine residue.
- the PPTase recognition sequence is DSLEFIASKLA, VLDSLEFIASKLA, or GSQD VLDSLEFIASKLA.
- the phosphopantetheinyltransferase is Sfp.
- Scheme E3 An exemplary modification using PPTase is shown in Scheme E3, wherein R is as defined herein.
- the enzymatic conjugation is a modification using polypeptidyltransferases (OGTases).
- the protein is nuclear pore protein.
- the OGTase is UDP-Glc-NAc.
- the OGTase recognition sequence comprises a serine residue or threonine residue. Exemplary modifications using polypeptidyltransferases are shown in Scheme E4, wherein R is as defined herein.
- each of R vl , R v2 , R v3 , R v4 , R v5 , R v(5 , and R v7 is independently H, optionally substituted CI -6 alkyl, or an oxygen protecting group
- the enzymatic conjugation is a modification using transglutaminase (TGases).
- the protein is an antibody.
- the TGase recognition sequence comprises a glutamine (Q) residue.
- the TGase recognition sequence comprises XXQXX.
- the protein recognition sequence is GGGSLLQG, PNPQLPF, PKPQQFM, or GQQQLG.
- the protein recognition sequence comprises a lysine (K) residue.
- the protein recognition sequence is MRHKGS.
- the enzymatic conjugation is a modification using protein farnesyltransferase (PFTase).
- the protein is an antibody.
- the PFTase recognition sequence comprises CaaX, wherein each instance of a is independently an aliphatic amino acid and X is as defined herein. Exemplary modifications using PFTases are shown in Scheme E6, wherein R F is as defined herein.
- the enzymatic conjugation is a modification using biotin ligases.
- the protein is an antibody.
- the biotin ligase recognition sequence comprises lysine (K).
- the biotin ligase recognition sequence comprises GLNDIFEAQKIEWHE.
- the enzyme is E.coli biotin ligase, BirA.
- Scheme E7 An exemplary modification using biotin ligases is shown in Scheme E7, wherein R is as defined herein
- the enzymatic conjugation is a modification using lipoic acid ligases (LplAs).
- the protein is an antibody.
- the protein is a growth factor receptor.
- the LplA recognition sequence comprises GFEIDKVWYDLDA.
- the enzyme is E.coli Lpl.
- Scheme E8 An exemplary modification using LplAs is shown in Scheme E8, wherein R is as defined herein.
- the enzymatic conjugation is a modification using N- myristoyltransferase (NMT).
- NMT N- myristoyltransferase
- the protein is an antibody.
- the protein is a tyrosine kinase.
- the protein is a HIV-1 matrix protein.
- the protein is a HIV Gag.
- the protein is an ADP-ribosylating factor.
- the NMT recognition sequence comprises GXXXS/T, wherein X is any amino acid.
- R is a reactive group capable of undergoing a click
- R is R as defined herein.
- R is optionally substituted tetrazine. In certain embodiments, R is optionally substituted tetrazine comprising 18 F. In certain embodiments, R F is optionally substituted tetrazine comprising 18 F-FDG or a fragment thereof. In certain embodiments, R F is optionally substituted tetrazine comprising 18 F-SFB or a fragment thereof. In certain embodiments, R F is p
- R is optionally substituted trans- p
- R is optionally substituted trans-cyclooctene comprising 18 F.
- R F is comprises a ligand capable of chelating to a pharmaceutically acceptable radioactive metal complex.
- R F is R 3 as p
- R comprises a ligand capable of chelating to a pharmaceutically acceptable metal complex comprising F 18.
- R F is Y p
- R comprises a radioactive optionally substituted carbohydrate.
- R F is R 4 as defined herein.
- R F comprises 18 F-FDG or a fragment thereof.
- kits useful for labeling proteins with radioactive agents and/or hydrophilic polymers, and/or for generating radiolabeled sortase substrate peptides are provided.
- the kit comprises a radiolabeled protein generated according to an inventive method provided herein.
- the kit comprises (i) a single domain antibody comprising a sortase recognition sequence, (ii) a sortase substrate comprising a first click chemistry handle, and (iii) a hydrophilic polymer conjugated to a second click chemistry handle.
- the kit comprises (i) a first single domain antibody comprising a first click chemistry handle, and (ii) a second single domain antibody comprising a second click chemistry handle.
- the kit comprises (i) a first single domain antibody comprising a sortase recognition sequence, (ii) a first sortase substrate, wherein the first sortase substrate comprises a first click chemistry handle, (iii) a second single domain antibody comprising a sortase
- the kit further comprises a radionuclide.
- the radionuclide is carbon- 11, carbon- 14, nitrogen-13, oxygen-15, fluorine-18, rubidium-82, copper-61, copper-62, copper-64, yttrium- 86, gallium-68, zirconium-89, or iodine- 124.
- the kit further comprises a sortase A from Staphylococcus aureus (SrtAaureus), sortase A from Streptococcus pyogenes (SrtApyogenes), sortase B from S. aureus (SrtBaureus), sortase B from Bacillus anthracis (SrtBanthracis), or sortase B from Listeria monocytogenes (SrtBmonocytogenes).
- SertAaureus Staphylococcus aureus
- SertApyogenes sortase A from Streptococcus pyogenes
- SertBaureus sortase B from S. aureus
- SertBanthracis sortase B from Bacillus anthracis
- sortase B from Listeria monocytogenes
- the kit further comprises a buffer or reagent useful for carrying out a sortase-mediated transpeptidation reaction.
- Example 1 Enzyme-Mediated Dual-labeling of Antibodies for Multimodal Imaging and to Manipulate their Characteristics.
- VHHs show that their C-terminus is positioned away from the antigen binding site [13] . Therefore a chemical approach was chosen to link two fully functional VHHs via their C-termini to ensure that their antigen binding capacity would not be compromised by modification of one of the N-termini in the resulting fusion, and that the two binding sites thus created would be equivalent, which may be more difficult to ascertain for genetic fusions.
- the dimers were produced as exemplified in Figure 2.
- DC8 anti Class II
- splenocytes were stained with different concentrations of monomers and dimers and analyzed by FACS.
- DC13 anti CDl lb
- the CDl lb + mutuDC dendritic cell line was used.
- VHH dimers bind approximately 3.3 and 2.3-fold better than their corresponding monomers respectively ( Figure 3).
- the in vivo binding characteristics of the VHH dimers versus monomers were evaluated. Due to the more abundant expression of Class II MHC molecules on splenocytes compared to that of CDl lb, the in vivo binding affinity for anti-Class II dimers was explored. Mice were injected i.v. with equal amounts of monomers and dimers (0.25 nmol) of DC8. 2 h p.L, mice were euthanized and lymphoid organs were excised for examination.
- the anti Class II MHC dimer showed stronger staining of lymphoid organs, particularly the spleen, compared to the anti CDl lb dimer ( Figures 4D and 4F). This may be attributed to the fact that in spleen there are fewer CDl lb + cells compared to Class II MHC + cells and less CDl lb expressed per cell.
- VHHs sortagged with substrate 2 or 3 were reacted with DBCO-functionalized PEG (5 kDa, 10 kDa or 20 kDa) to yield the final PEGylated VHHs ( Figures 2E-2F).
- B6 mice received 5 ⁇ g of PEGylated VHH and were euthanized 3 h later, followed by dissection of lymph nodes and spleen for FACS and two- photon microscopy.
- FACS showed a significant increase in staining of the PEGylated DC8- Alexa647 versus the non-PEGylated DC8.
- DC8 was PEGylated and modified with an F radionuclide.
- PEGylated VHHs showed increased staining of the lymphoid organs, confirming FACS and two-photon microscopy ( Figure 5D).
- the longer circulatory half-life of PEGylated VHHs may increase the likelihood of a VHH binding to its target, as long as target accessibility is not compromised by
- the 18 F-labeled-DC8-PEG-20 kDa had the highest PET signal in blood at the time of imaging (3 h p.i) ( Figure 5D). While the larger 20 kDa PEG can significantly increase the staining efficiency in lymphoid organs, it can delay circulatory clearance, a factor to consider when isotopes with short half-lives, such as as 18F or 11C, are being used. However, a 10 kDa or a 5 kDa PEG-modified VHH can still significantly increase staining efficiency and yet be rapidly cleared. For labeling of VHHs, the use of isotopes with longer half-lives, such as 89 Zr or 64 Cu, the use of a 20 kDa PEG moiety may improve staining.
- the methods provided herein may produce site- specifically PEGylated
- the peptide (Gly)3-PEGi 2 -Cys-PEG 5 -Lys(azide) was synthesized by standard solid phase peptide synthesis.
- Maleimide-TCO from Conju-bio
- the peptide was added and left to stir at room temperature for 1 h until LC-MS indicated near-complete conversion to the product.
- peptide (Gly)3-PEGi 2 -Cys-PEGs-Lys(azide) was synthesized by standard solid phase peptide synthesis and was dissolved in 0.05 M NaHCCh buffer pH 8.3. Maleimide- Texas Red (from Vector Labs) was dissolved in DMSO and then was added to the solution and left to stir at room temperature for 1 h until LC-MS indicated near-complete conversion to the product.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Medicinal Chemistry (AREA)
- Biochemistry (AREA)
- Engineering & Computer Science (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Physics & Mathematics (AREA)
- Epidemiology (AREA)
- Optics & Photonics (AREA)
- Biophysics (AREA)
- Zoology (AREA)
- Wood Science & Technology (AREA)
- Hematology (AREA)
- Biomedical Technology (AREA)
- Urology & Nephrology (AREA)
- General Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Microbiology (AREA)
- Biotechnology (AREA)
- General Chemical & Material Sciences (AREA)
- Cell Biology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Food Science & Technology (AREA)
- Analytical Chemistry (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Abstract
Provided herein are methods for producing site specific PEG modifications to single domain antibodies (e.g., VHHs). Methods for producing site- specific ally conjugated bivalent single domain antibodies (e.g., VHHs) are also provided. Methods for labeling (e.g., with a fluorophore or radionuclide) site-specifically PEGylated single domain antibodies and site- specifically conjugated bivalent single domain antibodies are also provided.
Description
LABELING OF ANTIBODIES
RELATED APPLICATIONS
[0001] This application claims priority under 35 U.S.C. § 119(e) to U.S. provisional application, U.S. S.N. 62/236,117, filed October 1, 2015, which is incorporated by reference herein.
BACKGROUND
[0002] Positron emission tomography (PET) is a powerful technology for medical and biological imaging and the scope of PET applications is expanding rapidly. The development of suitable PET tracers is critical to PET technology. Accordingly new PET tracers, such as peptide/protein based tracers would be useful to specifically label tissues in therapeutic and/or diagnostic applications.
SUMMARY
[0003] Some aspects of the disclosure are based on the recognition that antibody binding fragments, and in particular the single domain antibody fragment VHH, show an improved ability to detect antigens in vivo when site specifically conjugated to a hydrophilic polymer (e.g., PEG) and a radiolabel (e.g. Zr). Such antibodies are useful for inter alia detecting tumors and lymphocyte infiltration into tumors in vivo. Accordingly, the present disclosure provides antibodies that are site specifically labeled with a hydrophilic polymer and/or a radiolabel, as well as methods of making and using such antibodies.
[0004] The success of immunotherapies such as the administration of monoclonal antibodies against immune checkpoint inhibitors (e.g., CTLA4, PD-1 on T cells, and PD-Ll) warrants the development of new methods, systems, and compositions for assessing whether an immunotherapy would be beneficial for treating patients. As one example, macrophages can affect tumor growth by establishing either a detrimental or favorable microenvironment. Thus, the ability to image the present of myeloid cells is of diagnostic and therpaeutic relevance and, compared to tumor- specific markers[1], may be a more generally applicable approach for detection of tumor cells[2'3]. Immune cells often invade or surround solid tumors[1]. The success of immunotherapies such as the administration of monoclonal antibodies against immune checkpoint inhibitors (e.g., CTLA4, PD-1 on T cells, and PD-Ll) may be assessed by imaging the presence and/or distribution of immune cells (e.g., myeloid and/or lymphoid cells) in a subject, for example, in a tumor of the subject. Accordingly, new
methods and compositions to explore and assess the microenvironment of tumors non- invasively are needed.
[0005] Immune cells often infiltrate tumors and can thus serve as a proxy to assess the presence of a malignancy. The ability to image tumor-infiltrating cells depends on the availability of targeting molecules with the requisite affinity and specificity. Camelid-derived single domain antibody fragments (VHHs) Provided herein is the design and synthesis of site- specifically PEGylated VHHs and engineered bivalent VHHs fused site-specifically via their C-termini. VHHs, which recognize Class II MHC products and CD1 lb, were used to image immune cells, both in vitro and in vivo, by FACS, two-photon microscopy and positron emission tomography (PET). Both PEGylated and bivalent VHHs stained lymphoid organs and stained them more efficiently than their monovalent non-PEGylated counterparts. By PET imaging, modified VHHs detected engrafted melanoma and pancreatic tumors -as small as ~1 mm in size- by virtue of their association with myeloid cells. Modified VHHs showed significant improvement in fluorescence imaging, especially for the PEGylated VHHs.
[0006] In one aspect, a chemical approach was chosen to link two fully functional and properly refolded VHHs via their C-termini to ensure that their antigen binding capacity would not be compromised by modification of one of the N-termini, and that the two binding sites thus created would be equivalent, in the manner of a full-sized antibody. Accordingly, bivalent VHHs were produced through application of sortase-mediated enzymatic
transformations in combination with click chemistry. Mono- and bivalent VHHs were compared in in vitro (FACS) experiments, by two-photon microscopy on lymph nodes and spleen excised from mice injected with VHHs, and by non-invasive in vivo immuno-PET imaging.
[0007] One minimally-invasive clinical diagnostic approach is the use of 10F-2-fluoro-2- deoxy-D-glucose positron emission tomography (FDG-PET), which distinguishes areas of high metabolic activity, such as tumors, from surrounding tissue with lesser glucose uptake[4]. These methods may not typically provide information on immune cells in the tumor microenvironment. They can be used to track immune cells, using isotopically labeled anti- CDl lb, anti-Class II MHC, and anti CD8 antibody fragments [5 7].
[0008] The comparatively large size of intact full-sized antibodies results in a long circulatory half-life and may also hinder efficient tissue penetration[8]. These considerations have driven the search for smaller antibody-derived formats as alternative imaging tools11' 6]. Thus, provided herein are camelid single domain antibody fragments (VHHs), as the smallest
antigen binding derivatives obtainable from naturally occurring antibodies . VHHs may be enzymatically modified and have been used in a variety of applications including imaging[10].
[0009] The production of bivalent single domain antibodies based on their monovalent equivalents could address issues of avidity, while retaining desirable properties such as small size. For example, the bivalent derivatives of single domain antibodies maybe small enough to penetrate tissues, be rapidly cleared from the circulation, yet benefit from increased avidity. On the other hand, tuning circulatory half-life could improve the staining efficiency of the targets by VHHs. Attachment of small PEG groups (e.g., PEGylation) or other hydrophilic polymers could be used as a tool to tune persistence of a VHH in the circulation. Moreover, PEGylation can decrease the immunogenicity of VHHs, which is important in cases when repeated administration is required but in rare cases even the PEG functionality itself may be immunogenic1121. Thus, provided herein are methods for introducing site specific hydrophilic polymer (e.g., PEG) and radiolabel (e.g., Zr)modifications onto single domain antibodies (e.g., VHHs) and methods for producing site- specifically conjugated bivalent single domain antibodies. In some embodiments, the single domain antibodies provided herein are site specifically modified with PEG and a Zr. However, it should be appreciated that additional hydrophilic polymers and other radiolabels may be used to modify the antibodies (e.g., single domain antibodies) provided herein.
[0010] The details of certain embodiments of the invention are set forth in the Detailed Description of Certain Embodiments, as described below. Other features, objects, and advantages of the invention will be apparent from the Definitions, Examples, Figures, and Claims.
BRIEF DESCRIPTION OF THE DRAWINGS
[0011] The accompanying drawings, which constitute a part of this specification, illustrate several exemplary embodiments of the invention and together with the description, serve to explain the principles of the invention. The embodiments disclosed in the drawings are exemplary and do not limit the scope of this disclosure.
[0012] Figures 1A-1B show site-specific labeling of single domain antibodies (VHHs) using sortase and design (Figure 1A) as well as (Figure IB) structures of the substrates. LPETG-GH6 is SEQ ID NO: 5; GGH6 is SEQ ID NO: 6; LPET is SEQ ID NO: 7; LPET-G3 is SEQ ID NO: 8.
[0013] Figures 2A-2F show synthesis of VHH-derivatives (Figure 2A and Figure 2B). Characterizations were performed on all the products (Figure 2C and Figure 2D). Here is
shown the LC-MS and SDS-PAGE analysis for DC 13. Numbers indicate the followings: #1 : marker, #2: DC 13, #3: DC13-DBCO, #4: DC13-azide-Texas Red, #5: DC 13-dimer-Texas Red, #6: DC13-azide-Alexa647, #7: DC13-dimer-Alexa647. (Figures 2E-2F) PEGylation of VHHs and characterization. Numbers indicate the following: #1 : marker, #2: DC8-alexa647- azide, #3: DC8-alexa647-PEG-5kDa, #4: DC8-alexa647-PEG-10kDa, #5: DC8-alexa647- PEG-20kDa. LPETG-XX is SEQ ID NO: 9; LPET-G3 is SEQ ID NO: 8; LPET-G3-Cys is SEQ ID NO: 10.
[0014] Figures 3A-3D (Figures 3A-3B) show dimers that are able to stain their targets with increased efficiency compared to their corresponding monomers; for Figure 3 A: cells were stained in vitro with the indicated concentrations of Alexa647-labeled VHH monomers or dimers; for Figure 3B: equal amount of DC8 monomer and DC8-dimer is injected IV. 2 h p.L, the mice are euthanized and spleens are excised for two-photon imaging. (Figure 3C) Equal amount of DC8 with or without PEG, both equipped with Texas Red is injected IV. 3 h p.L, the mice are euthanized and spleens are excised for two-photon imaging. (Figure 3D) Equal amount of DC8 with or without PEG (0.4 nmols), all equipped with Alexa647 is injected IV. 3 h p.L, the mice are euthanized and spleen is excised. Cells were harvested and analyzed with FACS.
18 18
[0015] Figures 4A-4I (Figure 4A) show synthesis of F-Tetrazine. (Figure 4B) F- labeling of VHH-dimers, monomers or PEG- VHHs. (Figure 4C) radio-TLC analysis of the
18 18
F-labeling reactions. (Figures 4D-4I) F-DC8-dimer and 18F-DC13-dimer detects lymphoid organs and reveals tumor-infiltrated immune cells. PET images are represented in both coronal and sagittal views for better visualization. CT images are provided for better visualization (Figure 4 ). (Figures 4D-4E) PET images of WT (Figure 4D) and class II
18
MHC-/- (Figure 4E) mice 2 h p.i. of F-DC8 dimer; letters indicate: CV: cervical lymph nodes; BM: bone marrow; GB: gallbladder; LV: liver; KD: kidneys; Ints: intestines; BL: bladder; SP: spinal cord. (Figures 4F-4G) PET images of WT (Figure 4F) and CD l ib-/-
18
(Figure 4G) mice 2 h p.i. of F-DC 13 dimer. (Figure 41) Tumor- associated class II MHC+
18 cells (Figure 41 (coronal)) or CD1 lb+ cells (Figure 41 (sagittal)) were visualized using F-
18
DC13 dimer (Figure 41 (coronal)) or F-DC8 dimer (Figure 41 (sagittal)). Arrows are pointing at the tumors. In (Figure 41 (sagittal)) stars are showing the lymph nodes. PET scale bars have arbitrary units. Images are representative of two to four mice with similar results.
18
[0016] Figures 5A-5D (Figures 5A-5B) show postmortem biodistribution of F-VHHs in
18 18
all organs. Mice were injected with same amount of either F -VHH or F -VHH dimer. 3 h p.i., mice were euthanized and activity in different organs were measured. (Figure 5C) VHH
monomer can block binding of F -VHH dimer onto the lymphoid organs. WT mice were
18
injected with different amount of unlabeled DC8. F -DC8 dimer was injected 20 min later. PET SUVs are calculated based on PET images acquired 2 h p.i. of the F -labeled DC8
18
dimer. (Figure 5D) WT mice were injected with same amount of either F -DC8 with or without labeled-PEGs. 3 h p.i., the mice were euthanized and activity in different organs were measured.
[0017] Figures 6A-6H show LC-MS analysis of VHHs, their corresponding sortagged products and dimers. DC8 and its derivatives (Figures 6A-6H).
[0018] Figures 7A-7H show LC-MS analysis of VHHs, their corresponding sortagged products and dimers. DC13 and its derivatives (Figures 7A-7H).
[0019] Figure 8 Shows a table of radiochemical yield (non-decay corrected) and a radio HPLC chromatogram. The column was luna 5u C18 100 A 250 x 4.6 mm, the mobile phase was 60% CH3CN, 40% 0.1 M NH4 HC02(aq), and the flow rate was lmL/min.
[0020] Figure 9 Shows a schematic of the GE TRACERlab™ FXFN radiosynthesis
18
module automated synthesis manifold for [ F]-5.
18
[0021] Figure 10 shows a semi-preparative HPLC trace of a typical radiosynthesis of [ F]- 5.
[0022] Figure 11 shows the PD-10 cartridge was eluted with PBS (10 x 500 μΐ), and each fragment was collected into a new 1.5 mL tube. The desired product [18F]-VHHs usually eluted at tubes #4-7. Characterization (using [18F]-DC8-dimer as an example): rTLC chromatography (left panel[18F]-Tz 5; right panel[18F]-DC8-dimer; at 20 min).
[0023] Figure 12 shows fragments collection through PD-10 cartridge. After size-exclusion chromatography, a 47 ± 9% (n = 5, non-decay corrected) radiochemical yield was obtained.
[0024] Figures 13A-13B show NMR spectra of [19F]tetrazine 5 : ^-NMR (Figure 13 A) and 13C-NMR (Figure 13B).
[0025] Figures 14A-14B show a schematic of a camelid heavy chain only antibody and a conventional IgG. A VHH portion is shown within the circle indicated by the arrow (Figure 14A). Figure 14B is a schematic representation of site-specific labeling of VHHs using sortase. LPETG-XX is SEQ ID NO: 9.
[0026] Figures 15A-15B shows the structure of the synthesized bi-orthogonal sortase substrate (Figure 15A). The azide functionality allows installment of PEG groups, and DFO chelator is used to install radiometal 89Zr allowing PET imaging. Figure 15B is a schematic representation of preparing PEGylated 89Zr-labeled VHHs for PET imaging.
[0027] Figures 16A-16B shows that Zr-PEGylated-VHH7 detects secondary lymphoid organs and B 16 tumor in a wild-type B6 mouse injected with B 16 tumor cells (Figure 16A), and Zr-PEGylated-VHH7 detects secondary lymphoid organs a wild-type B6 mouse not injected with B 16 tumor cells (Figure 16B).
DETAILED DESCRIPTION OF CERTAIN EMBODIMENTS
[0028] Antibodies are currently the fastest growing class of therapeutics. Although naked antibodies have proven their value as successful pharmaceuticals, they suffer from some limitations such as low tissue penetration and a long circulatory half-life. They have been conjugated to toxic payloads, PEGs or other polymers, or radioisotopes to increase and optimize their therapeutic efficacy. Although non-specific conjugation is suitable for most in vitro applications, for in vivo applications, site- specifically modified antibodies may have advantages. Provided herein is a novel approach in which an antibody fragment is tagged with two handles: one is used for the introduction of a fluorophore or radio-isotope, and the second one is used to further modify the fragment with functionalities including a PEG moiety or a second antibody fragment. Such modifications may improve desired properties (e.g., circulatory half-life or avidity). Exemplary antibodies (e.g., single domain antibodies) provided herein, which recognize epitopes, such as Class II MHC, and CD1 lb showed high avidity and specificity. In some embodiments, antibodies congjuated to a hydrophilic polymer (e.g., PEG), and/or a fluorophore are referred to as constructs. Such constructs were used to image cancers and could detect tumors as small as about 1 mm in size.
[0029] The term "antibody", as used herein, refers to a protein belonging to the
immunoglobulin superfamily. The terms antibody and immunoglobulin are used
interchangeably. The term "antibody" encompasses not only intact (e.g., full-length) polyclonal or monoclonal antibodies, but also antigen-binding fragments thereof (such as Fab, Fab', F(ab')2, Fv), single chain (scFv), mutants thereof, fusion proteins comprising an antibody portion, humanized antibodies, chimeric antibodies, diabodies, linear antibodies, single chain antibodies, multispecific antibodies (e.g., bispecific antibodies) and any other modified configuration of the immunoglobulin molecule that comprises an antigen recognition site of the required specificity, including glycosylation variants of antibodies, amino acid sequence variants of antibodies, and covalently modified antibodies. With some exceptions, mammalian antibodies are typically made of basic structural units each with two large heavy chains and two small light chains. There are several different types of antibody
heavy chains, and several different kinds of antibodies, which are grouped into different isotypes based on which heavy chain they possess. Five different antibody isotypes are known in mammals, IgG, IgA, IgE, IgD, and IgM, which perform different roles, and help direct the appropriate immune response for each different type of foreign object they encounter. In some embodiments, an antibody is an IgG antibody, e.g., an antibody of the IgGl, 2, 3, or 4 human subclass. Antibodies from mammalian species (e.g., human, mouse, rat, goat, pig, horse, cattle, camel) are within the scope of the term, as are antibodies from non-mammalian species (e.g., from birds, reptiles, amphibia) are also within the scope of the term, e.g., IgY antibodies.
[0030] Only part of an antibody is involved in the binding of the antigen, and antigen- binding antibody fragments, their preparation and use, are well known to those of skill in the art. As is well-known in the art, only a small portion of an antibody molecule, the paratope, is involved in the binding of the antibody to its epitope (see, in general, Clark, W.R. (1986) The Experimental Foundations of Modern Immunology Wiley & Sons, Inc., New York; Roitt, I. (1991) Essential Immunology, 7th Ed., Blackwell Scientific Publications, Oxford).
Suitable antibodies and antibody fragments for use in the context of some embodiments of the present invention include, for example, human antibodies, humanized antibodies, domain antibodies, F(ab'), F(ab')2, Fab, Fv, Fc, and Fd fragments, antibodies in which the Fc and/or FR and/or CDR1 and/or CDR2 and/or light chain CDR3 regions have been replaced by homologous human or non-human sequences; antibodies in which the FR and/or CDR1 and/or CDR2 and/or light chain CDR3 regions have been replaced by homologous human or non-human sequences; antibodies in which the FR and/or CDR1 and/or CDR2 and/or light chain CDR3 regions have been replaced by homologous human or non-human sequences; and antibodies in which the FR and/or CDR1 and/or CDR2 regions have been replaced by homologous human or non-human sequences. In some embodiments, so-called single chain antibodies (e.g., ScFv), (single) domain antibodies, and other intracellular antibodies may be used in the context of the present invention. Domain antibodies, camelid and camelized antibodies and fragments thereof, for example, VHH domains, or nanobodies, such as those described in patents and published patent applications of Ablynx NV and Domantis are also encompassed in the term antibody. Further, chimeric antibodies, e.g., antibodies comprising two antigen-binding domains that bind to different antigens, are also suitable for use in the context of some embodiments of the present invention. In some embodiments, the term antibody may also refer to "antibody mimetics," which are organic compounds the can specifically bind antigens, but are not structurally related to antibodies. For example,
antibody mimetics known as "affibodies," or "affibody molecules," are small proteins engineered to bind e.g., target proteins or peptides with affinities comparable to monoclonal antibodies. In some embodiments, an affibody includes a protein scaffold based on the Z domain (the immunoglobulin G binding domain) of protein A, and in contrast to antibodies, affibody molecules are composed of alpha helices and lack disulfide bridges. Methods for engineering and producing affibodies are known, and include those described in Nord et al., "A combinatorial library of an a-helical bacterial receptor domain." Prot. Eng. 1995; 8 (6): 601-608; Nord et al., "Binding proteins selected from combinatorial libraries of an a-helical bacterial receptor domain." Nature Biotechnol. 1997; 15 (8): 772-777; Stahl et ah, "The use of gene fusions to protein A and protein G in immunology and biotechnology." Pathol. Biol. (Paris) 1997; 45 (1): 66-76; Ronnmark et ah, "Construction and characterization of affibody- Fc chimeras produced in Escherichia coli." J. Immunol. Methods. 2002; 261 (1-2): 199-211; Ronnmark et ah, "Affibody-beta-galactosidase immunoconjugates produced as soluble fusion proteins in the Escherichia coli cytosol." J. Immunol. Methods. 2003; 281 (1-2): 149-160; Nord et ah, "Recombinant human factor Vlll-specific affinity ligands selected from phage- displayed combinatorial libraries of protein A." Eur. J. Biochem. 2001; 268 (15): 1-10;
Engfeldt et ah, "Chemical synthesis of triple-labeled three -helix bundle binding proteins for specific fluorescent detection of unlabeled protein." Chem. BioChem. 2005; 6 (6): 1043- 1050; Ahlgren et ah, "Targeting of HER2-expressing tumors with a site- specifically 99mTc- labeled recombinant affibody molecule, ZHER2:2395, with C-terminally engineered cysteine." J. Nucl. Med. 2009; 50 (5): 781-789; Orlova et al, "Evaluation of
[(l l l/114m)In]CHX-A"-DTPA-ZHER2:342, an affibody ligand conjugate for targeting of HER2-expressing malignant tumors." Q. J. Nucl. Med. Mol. Imaging. 2007; 51 (4): 314-23; Tran et al., "(99m)Tc-maEEE-Z(HER2:342), an Affibody molecule-based tracer for the detection of HER2 expression in malignant tumors". Bioconjug. Chem. 2007; 18 (6): 1956— 64; Orlova et al., "Tumor imaging using a picomolar affinity HER2 binding affibody molecule." Cancer Res. 2006; 66 (8): 4339-48; Holm et al, "Electrophilic Affibodies Forming Covalent Bonds to Protein Targets." The Journal of Biological Chemistry 2009; 284 (47): 32906-13; Renberg et al., "Affibody molecules in protein capture microarrays:
evaluation of multidomain ligands and different detection formats." J. Proteome Res. 2007; 6 (1): 171-179; Lundberg et al., "Site-specifically conjugated anti-HER2 Affibody molecules as one-step reagents for target expression analyses on cells and xenograft samples." J.
Immunol. Methods 2007; 319 (1-2): 53-63; Tolmachev et al., "Radionuclide therapy of HER2-positive microxenografts using a 177Lu-labeled HER2-specific Affibody molecule."
Cancer Res. 2007; 67 (6): 2773-82; and Gebauer & Skerra, "Engineered protein scaffolds as next-generation antibody therapeutics." Current Opinion in Chemical Biology 2009; 13 (3): 245-55; Siontorou C, "Nanobodies as novel agents for disease diagnosis and therapy." Int. J. Nanomedicine 2013; 8: 4215-4227; the entire contents of each are hereby incorporated by reference in their entirety.
[0031] The term "antigen-binding antibody fragment," as used herein, refers to a fragment of an antibody that comprises the paratope, or a fragment of the antibody that binds to the antigen the antibody binds to, with similar specificity and affinity as the intact antibody. Antibodies, e.g., fully human monoclonal antibodies, may be identified using phage display (or other display methods such as yeast display, ribosome display, bacterial display). Display libraries, e.g., phage display libraries, are available (and/or can be generated by one of ordinary skill in the art) that can be screened to identify an antibody that binds to an antigen of interest, e.g., using panning. See, e.g., Sidhu, S. (ed.) Phage Display in Biotechnology and Drug Discovery (Drug Discovery Series; CRC Press; 1st ed., 2005; Aitken, R. (ed.) Antibody Phage Display: Methods and Protocols (Methods in Molecular Biology) Humana Press; 2nd ed., 2009.
[0032] The term "single domain antibody," as used herein, refers to an antibody, in which the complementarity determining regions (CDRs) are part of a single domain polypeptide, that is, the complementarity determining regions are all on a single polypeptide chain.
Examples of single domain antibodies include, but are not limited to, heavy chain antibodies, antibodies naturally devoid of light chains, single domain antibodies derived from
conventional 4-chain antibodies, engineered antibodies, and single domain scaffolds other than those derived from antibodies. Single domain antibodies may be any of those known in the art, or any future single domain antibodies. Methods for making single domain antibodies and VHHs are known in the art and would be apparent to the skilled artisan. For example methods for making single domain antibodies and VHHs are provided in U.S. patent publication No.: US 2006/0034845, published on February 16, 2006, the entire contents of which are incorporated by reference herein. Single domain antibodies may be derived from any species including, but not limited to, mouse, rat, human, camel, llama, goat, rabbit, and bovine. According to one aspect of the invention, a single domain antibody as used herein is a naturally occurring single domain antibody known as a heavy chain antibody devoid of light chains. Such single domain antibodies are disclosed in published international PCT application, WO 2013/024059, the entire contents of which are incorporated by reference herein. The variable domain derived from a heavy chain antibody naturally devoid of light
chain is known as a VHH or nanobody to distinguish it from the conventional VH of four chain immunoglobulins. Such a VHH molecule can be derived from antibodies raised in Camelidae species, for example, camel, dromedary, llama, vicuna, alpaca, and guanaco. Other species besides Camelidae may produce heavy chain antibodies naturally devoid of light chain; such VHHs are within the scope of the invention. As used herein, a
"VHH" refers to the variable region of a heavy chain antibody, for example the heavy chain antibody from a camelid. VHHs, useful in the present invention and as known to the skilled artisan, may be heavy chain variable domains derived from immunoglobulins naturally devoid of light chains such as those derived from Camelidae as described in published international PCT Applciation, WO 2013/024059, published on February 21, 2013 (and referred to hereinafter as VHH domains or nanobodies). Typically, VHH molecules are about lOx smaller than IgG molecules. For example, in some embodiments, VHH molecules are between lOkDa and 50kDa. In some embodiments, VHH molecules are between lOkDa and 25kDa. In some embodiments, VHH molecules are between 12 kDa and 16 kDa in size. In some embodiments, VHHs lend themselves to sortase-catalyzed enzymatic transformations for a variety of purposes, including the installation of radioisotopes and/or PEG modifications for administration to a subject and imaging (e.g., PET imaging). They are single
polypeptides and are stable, resisting extreme pH and temperature conditions. They have the advantage of specificity, small size, and rapid circulatory clearance (<30 min). In some embodiments, the VHHs provided herein may be modified (e.g., with a polymer, such as PEG, and/or a detectable label) to yield improved properties for efficient detection of one or more molecules, proteins, or cells, for example, in vivo. Moreover, VHHs are resistant to the action of proteases which is not the case for conventional antibodies. Furthermore, in vitro expression of VHHs produces properly folded functional VHHs in high yield. In addition, antibodies generated in Camelids will recognize epitopes other than those recognized by antibodies generated in vitro through the use of antibody libraries or via immunization of mammals other than Camelids (in published international PCT Applciation,WO
2006/079372, published on August 3, 2006; the entire contents of which are incorporated by reference herein). Since VHHs are known to bind 'unusual' epitopes such as cavities or grooves (WO 2006/079372), the affinity of such VHHs may be more suitable for diagnostic purposes. Single domain antibodies useful in the present invention may be produced my any method known in the art.
[0033] The term "binding agent," as used herein, refers to any molecule that binds another molecule with high affinity. In some embodiments, a binding agent binds its binding partner
with high specificity. Examples for binding agents include, without limitation, antibodies, antibody fragments, nucleic acid molecules, receptors, ligands, aptamers, and adnectins.
[0034] The term "click chemistry" refers to a chemical philosophy introduced by K. Barry Sharpless of The Scripps Research Institute, describing chemistry tailored to generate covalent bonds quickly and reliably by joining small units comprising reactive groups together (see H. C. Kolb, M. G. Finn and K. B. Sharpless (2001). Click Chemistry: Diverse Chemical Function from a Few Good Reactions. Angewandte Chemie International Edition 40 (11): 2004-2021. Click chemistry does not refer to a specific reaction, but to a concept including, but not limited to, reactions that mimic reactions found in nature. In some embodiments, click chemistry reactions are modular, wide in scope, give high chemical yields, generate inoffensive byproducts, are stereo specific, exhibit a large thermodynamic driving force to favor a reaction with a single reaction product, and/or can be carried out under physiological conditions. In some embodiments, a click chemistry reaction exhibits high atom economy, can be carried out under simple reaction conditions, use readily available starting materials and reagents, uses no toxic solvents or uses a solvent that is benign or easily removed (preferably water), and/or provides simple product isolation by non-chromatographic methods (crystallisation or distillation). In some embodiments, the click chemistry reaction is a [2+3] dipolar cyclo addition. In certain embodiments, the click chemistry reaction is a Diels-Alder cycloaddition.
[0035] The term "click chemistry handle," as used herein, refers to a reactant, or a reactive group, that can partake in a click chemistry reaction. Exemplary click chemistry handles are demonstrated in U.S. Patent Publication 20130266512, which is incorporated by reference herein. For example, a strained alkyne, e.g., a cyclooctyne, is a click chemistry handle, since it can partake in a strain-promoted cycloaddition (see, e.g., Table 1). In general, click chemistry reactions require at least two molecules comprising click chemistry handles that can react with each other. Such click chemistry handle pairs that are reactive with each other are sometimes referred to herein as partner click chemistry handles. For example, an azide is a partner click chemistry handle to a cyclooctyne or any other alkyne. Exemplary click chemistry handles suitable for use according to some aspects of this invention are described herein, for example, in Tables 1 and 2. In some embodiments, the click chemistry partners are a conjugated diene and an optionally substituted alkene, In other embodiments, the click chemistry partners are an optionally substituted tetrazine and an optionally substituted trans- cyclooctene (TCO). In some embodiments, the click chemistry partners are optionally substituted tetrazine (Tz) and optionally substituted trans-cyclooctene (TCO). Tz and TCO
react with each other in a reverse-electron demand Diels-Alder cycloaddition reaction (See e.g., Example 2, Figure 4; Blackman et ah, "The Tetrazine Ligation: Fast Bioconjugation based on Inverse-electron-demand Diels-Alder Reactivity." J. Am. Chem. Soc. 2008; 130, 13518-13519). In other embodiments, the click chemistry partners are an optionally substituted alkyne and an optionally substituted azide. For example, a difluorinated cyclooctyne, a dibenzocyclooctyne, a biarylazacyclooctynone, or a cyclopropyl-fused bicyclononyne can be paired with an azide as a click chemistry pair. In other embodiments, the click chemistry partners are reactive dienes and suitable tetrazine dienophiles. For example, TCO, norbornene, or biscyclononene can be paired with a suitable tetrazine dienophile as a click chemistry pair. In yet other embodiments, tetrazoles can act as latent sources of nitrile imines, which can pair with unactivated alkenes in the presence of ultraviolet light to create a click chemistry pair, termed a "photo-click" chemistry pair. The click chemistry pair may also be a cysteine and a maleimide. For example the cysteine from a peptide (e.g., GGGC (SEQ ID NO: 12)) may be reacted with a maleimide that is associated with a chelating agent (e.g., NOTA). Other suitable click chemistry handles are known to those of skill in the art (See, e.g., Table 1; Spicer et ah, "Selective chemical protein modification." Nature Communications. 2014; 5:4740). For two molecules to be conjugated via click chemistry, the click chemistry handles of the molecules have to be reactive with each other, for example, in that the reactive moiety of one of the click chemistry handles can react with the reactive moiety of the second click chemistry handle to form a covalent bond. Such reactive pairs of click chemistry handles are well known to those of skill in the art and include, but are not limited to, those described in Table 1.
Table 1: Exemplary click chemistry handles and reactions.
Exempl ary rate constan t
(M"1 s"1) n -R 42
N- 1 ,3-dipolar cycloaddition
R 41 1 x 10"
3 a romoted cycloaddition
er reaction e reaction train-promoted cycloaddition
Nc ,N-P42
N R
Each of R , R , and R is indpendently hydrogen, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, optionally substituted heteroaryl, or optionally substituted heterocyclyl. In certain embodiments, at least one of R41, R42, and R43 independently comprises a sortase recognition motif. In certain embodiments, one of R41, R42, and R43 independently comprises a sortase recognition motif. In certain embodiments, two of R41, R42, and R43 independently comprise a sortase recognition motif. In certain embodiments, each of R41, R42, and R43 independently comprises a sortase recognition motif. In some embodiments, at least one of R41, R42, and R43 is independently RR-LPXT-[X]y- (SEQ ID NO: 22), wherein each occurrence of X independently represents any amino acid residue; each occurrence of y is an integer between 0 and 10, inclusive; and each occurrence of RR independently represents a protein or an agent (e.g., a protein, peptide, a detectable label, a binding agent, a small molecule), and, optionally, a linker. Each instance of R3 is independently H, substituted or unsubstituted alkyl (e.g., -CH3), or substituted or unsubstituted aryl.
aExemplary rate constant for small-molecule models.
bExemplary on-protein rate constant.
[0036] In some embodiments, click chemistry handles used can react to form covalent bonds in the absence of a metal catalyst. Such click chemistry handles are well known to those of skill in the art and include the click chemistry handles described in Becer,
Hoogenboom, and Schubert (Table 2), "Click Chemistry beyond Metal-Catalyzed
Cycloaddition," Angewandte Chemie International Edition (2009) 48: 4900 - 4908:
Table 2: Exemplary click chemistry reactions.
Reagent A Rea ent Mecbanism Notes on reaction1"5
0 a2jde aikyne Cu-cataljfjred {3+2| 2 h at SO'-C in Η-,Ο
azide-a!kyne cycioaddition
{CuAAQ
1 32ide cyciooetyne strain-promoted J3+23 aride-affcytie cytioi sddition 1 h at RT
(SPAAC)
1 activated [3+2] Huisgeti cycloaddiiiert 4 h at 50°C
alk ne
3 aside electron-deficient si- [3÷2] cydoadd ittion 12 b at RT in H20
kyne
4 aside ar ne [3÷2] cy oadd ition 4 h at RT in THF with crown ether or
24 b at RT in CH3CN
5 tetrazifw a!kene Dieis-Aider retro-[4+2] cycioaddition 40 min at 2S°C (100% yield)
N2 is the only by-product
& tetraioie aikens 1 ,3-dipciar cydoaddition few min UV irradiation and then overnight
{photodick; at
7 oithioester diene heterc-Diefc-Aidef cycioaddition 10 m in at RT
S ant racene nriaietmlde [4+2j D ids-Alder reaction 2 days at reflux in tolue e
9 thiol kene radical addition 0 rnin UV ( ;u.¾ntir.attve conv.) or
[tbio click} 24 h UV irradiation ( %)
10 thioi enone Michael addition 24 h at RT in CH,CN
1 1 thioi maieim-de Michael addition 1 h at 40°C in TH F or
16 h at RT in dicKafie
1 2 thioi para-flooro ms eophilic substitution overnight at RT in DM F or
60 min at 40»C in DM F
1 3 amine pcffU-Suoro nucieopbiiic substitution 20 m in M at 95 *C in N P as solvent
RT ::: room temperature, DMF ::: N j V-dimetbyifcrmamide, ΝΜΡ:.·.· N-methylpyro ■iidone, TH F ::-- tetrahydroiuran, CHjCN .-- acetonitrile.
[0037] Methods and compositions for using click chemistry in combination with sortagging technologies are known, and include those described by Ploegh et al. , international PCT application, PCT/US2012/044584, filed June 28 2012, published as WO 2013/003555 on January 3, 2013; and Ploegh et al. , U.S. Patent Application, U.S.S.N. 13/918,278, filed June 14, 2013; the entire contents of each of which are incorporated herein by reference.
[0038] The term "conjugated" or "conjugation" refers to an association of two molecules, for example, two proteins or a protein and an agent, e.g. , a small molecule, with one another in a way that they are linked by a direct or indirect covalent or non-covalent interaction. In certain embodiments, the association is covalent, and the entities are said to be "conjugated" to one another. In some embodiments, a protein is post-translationally conjugated to another molecule, for example, a second protein, a small molecule, a detectable label, a click chemistry handle, or a binding agent, by forming a covalent bond between the protein and the other molecule after the protein has been formed, and, in some embodiments, after the protein has been isolated. In some embodiments, two molecules are conjugated via a linker connecting both molecules. For example, in some embodiments where two proteins are conjugated to each other to form a protein fusion, the two proteins may be conjugated via a polypeptide linker, e.g. , an amino acid sequence connecting the C-terminus of one protein to the N-terminus of the other protein. In some embodiments, two proteins are conjugated at their respective C-termini, generating a C-C conjugated chimeric protein. In some
embodiments, two proteins are conjugated at their respective N-termini, generating an N-N conjugated chimeric protein. In some embodiments, conjugation of a protein to a peptide is achieved by transpeptidation using a sortase. See, e.g., Ploegh et al., International PCT Patent Application, PCT/US2010/000274, filed February 1, 2010, published as
WO/2010/087994 on August 5, 2010, and Ploegh et al, International Patent Application, PCT/US2011/033303, filed April 20, 2011, published as WO/2011/133704 on October 27, 2011, the entire contents of each of which are incorporated herein by reference, for exemplary sortases, proteins, recognition motifs, reagents, and methods for sortase-mediated transpeptidation. In other embodiments, conjugation of a protein to a peptide or other moiety may be achieved using other enzymes known in the art, for example, formylglycine generating enzyme, sialyltransferase, phosphopantetheinyltransferase, transglutaminase, farnesyltransferase, biotin ligase, lipoic acid ligase, or N-myristoyl transferase. Exemplary techniques and approaches for enzymatic labeling of proteins can be found in Rashidian, M., et al. "Enzymatic Labeling of Proteins: Techniques and Approaches", Bioconjugate Chem., 2013; 24, 1277-1294; which is incorporated by reference.
[0039] As used herein, a "detectable label" refers to a moiety that has at least one element, isotope, or functional group incorporated into the moiety which enables detection of the molecule, e.g., a protein or polypeptide, or other entity, to which the label is attached. Labels can be directly attached (i.e., via a bond) or can be attached by a tether (such as, for example, an optionally substituted alkylene; an optionally substituted alkenylene; an optionally substituted alkynylene; an optionally substituted heteroalkylene; an optionally substituted heteroalkenylene; an optionally substituted hetero alkynylene; an optionally substituted arylene; an optionally substituted heteroarylene; or an optionally substituted acylene, or any combination thereof, which can make up a tether). It will be appreciated that the label may be attached to or incorporated into a molecule, for example, a protein, polypeptide, or other entity, at any position.
[0040] In general, a label can fall into any one (or more) of five classes: a) a label which contains isotopic moieties, which may be radioactive or heavy isotopes, including, but not limited to, 2H, ¾ 13C, 14C, 15N, 18F, 31P, 32P, 35S, 67Ga, 76Br, 99mTc (Tc-99m), mIn, 123I, 125I, 131I, 153Gd, 169Yb, and 186Re; b) a label which contains an immune moiety, which may be antibodies or antigens, which may be bound to enzymes (e.g., such as horseradish
peroxidase); c) a label which is a colored, luminescent, phosphorescent, or fluorescent moieties (e.g., such as the fluorescent label fluoresceinisothiocyanat (FITC); d) a label which has one or more photo affinity moieties; and e) a label which is a ligand for one or more
known binding partners (e.g. , biotin-streptavidin, FK506-FKBP). In certain embodiments, a label comprises a radioactive isotope, preferably an isotope which emits detectable particles, such as β particles. In certain embodiments, the label comprises a fluorescent moiety. In certain embodiments, the label comprises a fluorophore. In some embodiments, the label is the fluorescent label fluoresceinisothiocyanat (FITC). In certain embodiments, the label comprises a ligand moiety with one or more known binding partners. In certain
embodiments, the label comprises biotin. In some embodiments, a label is a fluorescent polypeptide (e.g. , GFP or a derivative thereof such as enhanced GFP (EGFP)) or a luciferase (e.g., a firefly, Renilla, or Gaussia luciferase). It will be appreciated that, in certain embodiments, a label may react with a suitable substrate (e.g., a luciferin) to generate a detectable signal. Non-limiting examples of fluorescent proteins include GFP and derivatives thereof, proteins comprising chromophores that emit light of different colors such as red, yellow, and cyan fluorescent proteins, etc. Exemplary fluorescent proteins include, e.g., Sirius, Azurite, EBFP2, TagBFP, mTurquoise, ECFP, Cerulean, TagCFP, mTFPl, mUkGl, mAGl, AcGFPl, TagGFP2, EGFP, mWasabi, EmGFP, TagYPF, EYFP, Topaz, SYFP2, Venus, Citrine, mKO, mK02, mOrange, mOrange2, TagRFP, TagRFP-T, mStrawberry, mRuby, mCherry, mRaspberry, mKate2, mPlum, mNeptune, T- Sapphire, mAmetrine, mKeima. See, e.g., Chalfie, M. and Kain, SR (eds.) Green fluorescent protein: properties, applications, and protocols (Methods of biochemical analysis, v. 47). Wiley-Interscience, Hoboken, N.J., 2006, and/or Chudakov, DM, et al , Physiol Rev. 90(3): 1103-63, 2010 for discussion of GFP and numerous other fluorescent or luminescent proteins. In some embodiments, a label comprises a dark quencher, e.g., a substance that absorbs excitation energy from a fluorophore and dissipates the energy as heat.
[0041] In some aspects, any of the antibodies (e.g. single domain antibodies) and/or methods of making said antibodies provided herein comprise a radionuclide. In some embodiments, the radionuclide is 2H, 3H, UC, 13C, 14C, 61Cu, 62Cu, 13N, 15N, 150, 18F, 31P, 32P, 35S, 67Ga, 68Ga, 76Br, 99mTc (Tc-99m), mIn, 1231, 124I, 125I, 131I, 153Gd, 89Zr, 86Y, 169Yb, 82Rb, or 186Re. However, in other embodiments, the radionuclide is not 18F. In other embodiments, the radionuclide is not Zr.
[0042] The term "linker," as used herein, refers to a chemical group or molecule covalently linked to a molecule, for example, a protein, and a chemical group or moiety, for example, a click chemistry handle. In some embodiments, the linker is positioned between, or flanked by, two groups, molecules, or moieties and connected to each one via a covalent bond, thus connecting the two. In some embodiments, the linker comprises one or more atoms. In some
embodiments, the linker comprises between 1 and 500 atoms. In some embodiments, the linker comprises between 1 and 10, 1 and 15, 1 and 20, 1 and 50, 1 and 100, 1 and 150, 1 and 200, 1 and 250, 1 and 300, 1 and 350, 1 and 400, and 1 and 450 atoms. In some
embodiments, the linker is an amino acid or a plurality of amino acids. In some
embodiments, the linker comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or more than 20 amino acids. In some embodiments, the linker comprises a poly- glycine sequence. In some embodiments, the linker comprises a non-protein structure. In some embodiments, the linker is an organic molecule, group, polymer, or chemical moiety (e.g., poylethylene, polyethylene glycol).
[0043] The term "sortase," as used herein, refers to an enzyme able to carry out a transpeptidation reaction conjugating the C-terminus of a protein or peptide to the N-terminus of a protein or peptide via transamidation. Sortases are also referred to as transamidases, and typically exhibit both a protease and a transpeptidation activity. Various sortases from prokaryotic organisms have been identified. For example, some sortases from Gram-positive bacteria cleave and translocate proteins to proteoglycan moieties in intact cell walls. Among the sortases that have been isolated from Staphylococcus aureus, are sortase A (Srt A) and sortase B (Srt B). Thus, in certain embodiments, a transamidase used in accordance with the present invention is sortase A, e.g., from S. aureus, also referred to herein as SrtAaureus. In certain embodiments, a transamidase is a sortase B, e.g., from S. aureus, also referred to herein as SrtBaureus-
[0044] Sortases have been classified into four classes, designated A , B, C, and D, designated sortase A, sortase B, sortase C, and sortase D, respectively, based on sequence alignment and phylogenetic analysis of 61 sortases from Gram-positive bacterial genomes (Dramsi S, Trieu-Cuot P, Bierne H, Sorting sortases: a nomenclature proposal for the various sortases of Gram-positive bacteria. Res Microbiol.156(3):289-97, 2005; the entire contents of which are incorporated herein by reference). These classes correspond to the following subfamilies, into which sortases have also been classified by Comfort and Clubb (Comfort D, Clubb RT. "A comparative genome analysis identifies distinct sorting pathways in gram- positive bacteria" Infect Immun., 72(5):2710-22, 2004; the entire contents of which are incorporated herein by reference): Class A (Subfamily 1), Class B (Subfamily 2), Class C (Subfamily 3), Class D (Subfamilies 4 and 5). The aforementioned references disclose numerous sortases and recognition motifs. See also Pallen, M. J.; Lam, A. C; Antonio, M.; Dunbar, K. TRENDS in Microbiology, 2001, 9(3), 97-101; the entire contents of which are incorporated herein by reference. Those skilled in the art will readily be able to assign a
sortase to the correct class based on its sequence and/or other characteristics such as those described in Drami, et al. , supra.
[0045] The term "sortase A" is used herein to refer to a class A sortase, usually named SrtA in any particular bacterial species, e.g., SrtA from S. aureus. Likewise "sortase B" is used herein to refer to a class B sortase, usually named SrtB in any particular bacterial species, e.g., SrtB from S. aureus. The invention encompasses embodiments relating to a sortase A from any bacterial species or strain. The invention encompasses embodiments relating to a sortase B from any bacterial species or strain. The invention encompasses embodiments relating to a class C sortase from any bacterial species or strain. The invention encompasses embodiments relating to a class D sortase from any bacterial species or strain.
[0046] Amino acid sequences of Srt A and Srt B and the nucleotide sequences that encode them are known to those of skill in the art and are disclosed in a number of references cited herein, the entire contents of all of which are incorporated herein by reference. The amino acid sequence of a sortase-transamidase from Staphylococcus aureus also has substantial homology with sequences of enzymes from other Gram-positive bacteria, and such transamidases can be utilized in the ligation processes described herein. For example, for SrtA there is about a 31 % sequence identity (and about 44% sequence similarity) with best alignment over the entire sequenced region of the S. pyogenes open reading frame. There is about a 28% sequence identity with best alignment over the entire sequenced region of the A. naeslundii open reading frame. It will be appreciated that different bacterial strains may exhibit differences in sequence of a particular polypeptide, and the sequences herein are exemplary.
[0047] In certain embodiments a transamidase bearing 18% or more sequence identity, 20% or more sequence identity, 30% or more sequence identity, 40% or more sequence identity, or 50% or more sequence identity with an S. pyogenes, A. naeslundii, S. mutans, E. faecalis or B. subtilis open reading frame encoding a sortase can be screened, and enzymes having transamidase activity comparable to Srt A or Srt B from S. aureas can be utilized (e.g., comparable activity sometimes is 10% of Srt A or Srt B activity or more).
[0048] Thus in some embodiments of the invention the sortase is a sortase A (SrtA). SrtA recognizes the motif (e.g., the sortase recognition motif) LPXTX (wherein each occurrence of X represents independently any amino acid residue) (SEQ ID NO: 15), with common recognition motifs being, e.g., LPKTG (SEQ ID NO: 23), LPATG (SEQ ID NO: 24), LPNTG (SEQ ID NO: 25). In some embodiments LPETG (SEQ ID NO: 11) is used as the sortase recognition motif. However, motifs falling outside this consensus may also be recognized.
For example, in some embodiments the motif comprises an 'A' rather than a ' at position 4, e.g., LPXAG (SEQ ID NO: 17), e.g., LPNAG (SEQ ID NO: 26). In some embodiments the motif comprises an 'A' rather than a 'G' at position 5, e.g., LPXTA (SEQ ID NO: 27), e.g., LPNTA (SEQ ID NO: 28), e.g., LPETA (SEQ ID NO: 29). In some embodiments the motif comprises a 'G' rather than 'P' at position 2, e.g., LGXTG (SEQ ID NO: 30), e.g., LGATG (SEQ ID NO: 31). In some embodiments the motif comprises an T rather than 'L' at position 1, e.g., IPXTG (SEQ ID NO: 32), e.g., IPNTG (SEQ ID NO:33) or IPETG (SEQ ID NO: 34). Additional suitable sortase recognition motifs will be apparent to those of skill in the art, and the invention is not limited in this respect. It will be appreciated that the terms "recognition motif and "recognition sequence", with respect to sequences recognized by a transamidase or sortase, are used interchangeably.
[0049] In some embodiments of the invention the sortase is a sortase B (SrtB), e.g., a sortase B of S. aureus, B. anthracis, or L. monocytogenes. Motifs recognized by sortases (sortase recognition motifs) of the B class (SrtB) often fall within the consensus sequences NPXTX (SEQ ID NO: 16), e.g., NP[Q/K]-[T/s]-[N/G/s] (SEQ ID NO: 35), such as NPQTN (SEQ ID NO: 36) or NPKTG (SEQ ID NO: 37). For example, sortase B of S. aureus or B. anthracis cleaves the NPQTN (SEQ ID NO:36) or NPKTG (SEQ ID NO:37) motif of IsdC in the respective bacteria (see, e.g., Marraffini, L. and Schneewind, O., Journal of Bacteriology, 189(17), p. 6425-6436, 2007). Other recognition motifs found in putative substrates of class B sortases are NSKTA (SEQ ID NO: 38), NPQTG (SEQ ID NO: 39), NAKTN (SEQ ID NO:40), and NPQSS (SEQ ID NO: 41). For example, SrtB from L. monocytogenes recognizes certain motifs lacking P at position 2 and/or lacking Q or K at position 3, such as NAKTN (SEQ ID NO: 40) and NPQSS (SEQ ID NO:41) (Mariscotti JF, Garcia-Del Portillo F, Pucciarelli MG. The listeria monocytogenes sortase-B recognizes varied amino acids at position two of the sorting motif. J Biol Chem. 2009 Jan 7.)
[0050] In some embodiments, the sortase is a sortase C (Srt C). Sortase C may utilize LPXTX (SEQ ID NO: 15) as a recognition motif, with each occurrence of X independently representing any amino acid residue.
[0051] In some embodiments, the sortase is a sortase D (Srt D). Sortases in this class are predicted to recognize motifs with a consensus sequence NA-[E/A/S/H]-TG (SEQ ID NO: 42) (Comfort D, supra). Sortase D has been found, e.g., in Streptomyces spp.,
Corynebacterium spp., Tropheryma whipplei, Thermobifida fusca, and Bifidobacterium longhum. LPXTA (SEQ ID NO: 43) or LAXTG (SEQ ID NO:44) may serve as a recognition sequence for sortase D, e.g., of subfamilies 4 and 5, respectively subfamily-4 and subfamily-
5 enzymes process the motifs LPXTA (SEQ ID NO: 27) and LAXTG (SEQ ID NO: 44), respectively). For example, B. anthracis Sortase C has been shown to specifically cleave the LPNTA (SEQ ID NO: 28) motif in B. anthracis Basl and BasH (see Marrafini, supra).
[0052] See Barnett and Scott for description of a sortase that recognizes QVPTGV (SEQ ID NO: 45) motif (Barnett, TC and Scott, JR, Differential Recognition of Surface Proteins in Streptococcus pyogenes by Two Sortase Gene Homologs. Journal of Bacteriology, Vol. 184, No. 8, p. 2181-2191, 2002; the entire contents of which are incorporated herein by reference). Additional sortases, including, but not limited to, sortases and sortase variants recognizing additional sortase recognition motifs are also suitable for use in some embodiments of this invention. For example, sortases described in Chen I. et al.,"A general strategy for the evolution of bond-forming enzymes using yeast display." Proc Natl Acad Sci USA. 2011 Jul 12;108(28): 11399; Dorr, B. M., et al., "Reprogramming the specificity of sortase enzymes." Proc. Natl. Acad. Sci. U.S.A. 2014, 111, 13343-13348; the entire contents of each of which are incorporated herein by reference.
[0053] In some embodiments, a variant of a naturally occurring sortase may be used. Such variants may be produced through processes such as directed evolution, site-specific modification, etc. Considerable structural information regarding sortase enzymes, e.g., sortase A enzymes, is available, including NMR or crystal structures of SrtA alone or bound to a sortase recognition sequence (see, e.g., Zong Y, et al. J. Biol Chem. 2004, 279, 31383- 31389). Three dimensional structure information is also available for other sortases, e.g., S. pyogenes SrtA (Race, PR, et al., J Biol Chem. 2009, 284(11):6924-33). The active site and substrate binding pocket of S. aureus SrtA have been identified. One of ordinary skill in the art can generate functional variants by, for example, avoiding deletions or substitutions that would disrupt or substantially alter the active site or substrate binding pocket of a sortase. In some embodiments a functional variant of S. aureus SrtA comprises His at position 120, Cys at position 184, and Arg at position 197, wherein Cys at position 184 is located within a TLXTC (SEQ ID NO: 46) motif. Functional variants of other SrtA proteins may have His, Cys, Arg, and TLXTC (SEQ ID NO: 46) motifs at positions that correspond to the positions of these residues in S. aureus SrtA. In some embodiments, a sortase variant comprises a sequence at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a wild type sortase A sequence or catalytic domain thereof, e.g., at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to amino acids 60- 206 of SEQ ID NO: 47 or SEQ ID NO: 48, or at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to amino acids 26-206 of SEQ ID NO: 47 or
SEQ ID NO: 48. In some embodiments, a sortase variant comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 amino acid substitutions relative to amino acids 60 - 206 of SEQ ID NO: 47 or relative to amino acids 26 - 206 of SEQ ID NO: 47 or SEQ ID NO: 48.
[0054] In some embodiments, a transamidase having higher transamidase activity than a naturally occurring sortase may be used. In some embodiments the activity of the transamidase is at least about 10, 15, 20, 40, 60, 80, 100, 120, 140, 160, 180, or 200 times as high as that of S. aureus sortase A. In some embodiments the activity is between about 10 and 50 times as high as that of S. aureus sortase A, e.g., between about 10 and 20 times as high, between about 20 and 30 times as high, between about 30 and 50 times as high. In some embodiments the activity is between about 50 and about 150 times as high as that of S. aureus sortase A, e.g., between about 50 and 75 times as high, between about 75 and 100 times as high, between about 100 - 125 times as high, or between about 125 and 150 times as high. For example, variants of S. aureus sortase A with up to a 140-fold increase in LPETG- coupling (SEQ ID NO: 11) activity compared with the starting wild-type enzyme have been identified (Chen, I., et al., PNAS 108(28): 11399-11404, 2011). In some embodiments such a sortase variant is used in a composition or method of the invention. In some embodiments a sortase variant comprises any one or more of the following substitutions relative to a wild type S. aureus SrtA: P94S or P94R, D160N, D165A, K190E, and K196T mutations.
[0055] One of ordinary skill in the art will appreciate that the foregoing descriptions of substitutions utilize standard notation of the form X1NX2, in which Xi and X2i represent amino acids and N represents an amino acid position, Xi represents an amino acid present in a first sequence (e.g., a wild type S. aureus SrtA sequence), and X2 represents an amino acid that is substituted for Xi at position N, resulting in a second sequence that has X2 at position N instead of Xi. It should be understood that the present disclosure is not intended to be limited in any way by the identity of the original amino acid residue Xi that is present at a particular position N in a wild type SrtA sequence used to generate a SrtA variant and is replaced by X2 in the variant. Any substitution which results in the specified amino acid residue at a position specified herein is contemplated by the disclosure. Thus a substitution may be defined by the position and the identity of X2, whereas Xi may vary depending, e.g., on the particular bacterial species or strain from which a particular SrtA originates. Thus in some embodiments, a sortase A variant comprises any one or more of the following: an S residue at position 94 (S94) or an R residue at position 94 (R94), an N residue at position 160 (N160), an A residue at position 165 (A165) , an E residue at position 190 (E190), a T residue at position 196 (T196) (numbered according to the numbering of a wild type SrtA,
e.g., SEQ ID NO: 47). For example, in some embodiments a sortase A variant comprises two, three, four, or five of the afore-mentioned mutations relative to a wild type S. aureus SrtA (e.g., SEQ ID NO: 47). In some embodiments a sortase A variant comprises an S residue at position 94 (S94) or an R residue at position 94 (R94), and also an N residue at position 160 (N160), an A residue at position 165 (A 165) , and a T residue at position 196 (T196). For example, in some embodiments a sortase A variant comprises P94S or P94R, and also D160N, D165A, and K196T. In some embodiments a sortase A variant comprises an S residue at position 94 (S94) or an R residue at position 94 (R94) and also an N residue at position 160 (N160), A residue at position 165 (A165), a E residue at position 190, and a T residue at position 196. For example, in some embodiments a sortase A variant comprises P94S or P94R, and also D160N, D165A, K190E, and K196T. In some embodiments a sortase A variant comprises an R residue at position 94 (R94), an N residue at position 160 (N160), a A residue at position 165 (A165), E residue at position 190, and a T residue at position 196. In some embodiments a sortase comprises P94R, D160N, D165A, K190E, and K196T.
[0056] It is to be further understood that the disclosure contemplates variants of any wild- type sortase A. Those skilled in the art will appreciate that wild-type sequences of sortase A may vary, e.g., SrtA from various species may have gaps, insertions, and/or may vary in length relative to the amino acid sequence of exemplary wild-type S. aureus SrtA. Those skilled in the art will appreciate that the positions described herein in regard to substitutions or other alterations pertain to the sequence of exemplary wild type S. aureus SrtA, unless otherwise indicated, and that such positions may be adjusted when making corresponding substitutions in different bacterial SrtA sequences in order to account for such gaps, insertions, and/or length differences. For example, as noted above, certain sortase variants comprise a substitution at amino acid position 94 (e.g., the amino acid is changed to an S residue). However, the amino acid at position 94 in S. aureus SrtA may correspond to an amino acid at a different position (e.g., position Z) in SrtA from a second bacterial species when the sequences are aligned. When generating a variant of the SrtA of the second bacterial species comprising a substitution at "position 94" (based on the wild type S. aureus SrtA sequence numbering), it is the amino acid at position Z of the SrtA from the second bacterial species that should be changed (e.g., to S) rather than the amino acid at position 94. Those skilled in the art will understand how to align any original wild-type sortase A sequence to be used for generating a SrtA variant with an exemplary wild-type S. aureus sortase A sequence for purposes of determining the positions in the original wild-type sortase
A sequence that correspond to the exemplary wild-type S. aureus sortase A sequence when taking into account gaps and/or insertions in the alignment of the two sequences.
[0057] In some embodiments, amino acids at position 94, 160, 165, 190, and/or 196 are altered in a variant as compared with the amino acids present at those positions in a wild type
S. aureus SrtA, and the other amino acids of the variant are identical to those present at the corresponding positions in a wild type SrtA, e.g., a wild type S. aureus SrtA. In some embodiments, one or more of the other amino acids of a variant, e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 of the other amino acids differ from those present at corresponding position(s) in a wild type SrtA, e.g., a wild type S. aureus SrtA. In some embodiments a variant may have any of the properties or degrees of sequence identity specified in the definition of "variants" above.
[0058] An exemplary wild type S. aureus SrtA sequence (Gene ID: 1125243, NCBI RefSeq
Acc. No. NP_375640.1) is shown below, with the afore-mentioned positions underlined:
MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASK
DNKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQ
NISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVEVLD
EQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK (SEQ ID NO: 47).
[0059] One of ordinary skill in the art will appreciate that different subspecies, strains, and isolates may differ in sequence at positions that do not significantly affect activity. For example, another exemplary wild type S. aureus SrtA sequence (Gene ID: 3238307, NCBI
RefSeq Acc. No. YP_187332.1; GenBank Acc. No. AAD48437) has a K residue at position
57 and a G residue at position 167, as shown below in SEQ ID NO: 48:
MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASK
DKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQ
NISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLD
EQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK (SEQ ID NO: 48)
[0060] Either or both of these amino acids (i.e., K57 and/or G167) may be present in or introduced into any SrtA sequence, e.g., any S. aureus SrtA sequence, whether naturally occurring or generated by man. Furthermore, as described herein, any sortase sequence may further comprise a tag (e.g., 6XHis), a spacer, or both. For example, the N- or C-terminus may be extended to encompass a tag, optionally separated from the rest of the sequence by a spacer,
[0061] In some embodiments a sortase variant comprising the following sequence may be used, in which amino acid substitutions relative to a wild type S. aureus SrtA of SEQ ID NO: 47 or SEQ ID NO: 48 are shown in underlined bold letters:
MQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATREQLNRGVSFAEENESLDDQNISI AGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRNVKPTAVEVLDEQK GKDKQLTLITCDDYNEETGVWETRKIFVATEVK (SEQ ID NO: 49).
[0062] As will be appreciated, amino acids 2-148 of the above sequence correspond to amino acids 60-206 of the full length S. aureus SrtA sequence (the catalytic domain). For example, the "R" residue at position 36 of SEQ ID NO: 49 corresponds to the "P" residue at position 94 in SEQ ID NO: 47 or 48. It is also contemplated in some embodiments to use sortase variants that have other substitutions at one or more of positions 94, 160, 165, 190, and 196 (numbered according to the numbering of SEQ ID NO: 47 or 48), e.g., wherein such substitutions utilize an amino acid that would be a conservative substitution at the relevant position as compared with the sequence of SEQ ID NO: 49.
[0063] The use of sortases found in any gram-positive organism, such as those mentioned herein and/or in the references (including databases) cited herein is contemplated in the context of some embodiments of this invention. Also contemplated is the use of sortases found in gram negative bacteria, e.g., Colwellia psychrerythraea, Microbulbifer degradans, Bradyrhizobium japonicum, Shewanella oneidensis, and Shewanella putrefaciens . Such sortases recognize sequence motifs outside the LPXTX (SEQ ID NO: 15) consensus, for example, LP[Q/K]T[A/S]T (SEQ ID NO: 50). In keeping with the variation tolerated at position 3 in sortases from gram-positive organisms, a sequence motif LPXT[A/S] (SEQ ID NO: 51), e.g., LPXTA (SEQ ID NO:27) or LPSTS (SEQ ID NO: 52) may be used.
[0064] Those of skill in the art will appreciate that any sortase recognition motif known in the art can be used in some embodiments of this invention, and that the invention is not limited in this respect. For example, in some embodiments the sortase recognition motif is selected from: LPKTG (SEQ ID NO: 23), LPITG (SEQ ID NO: 53), LPDTA (SEQ ID NO: 54), SPKTG (SEQ ID NO:55), LAETG (SEQ ID NO: 56), LAATG (SEQ ID NO: 57), LAHTG (SEQ ID NO: 58), LASTG (SEQ ID NO: 59), LPLTG (SEQ ID NO: 60), LSRTG (SEQ ID NO: 61), LPETG (SEQ ID NO: 11), VPDTG (SEQ ID NO: 62), IPQTG (SEQ ID NO: 63), YPRRG (SEQ ID NO: 64), LPMTG (SEQ ID NO:65), LAFTG (SEQ ID NO: 66), LPQTS (SEQ ID NO: 67), it being understood that in various embodiments of the invention the fifth residue may be replaced with any other amino acid residue. For example, the sequence used may be LPXT (SEQ ID NO: 22), LAXT (SEQ ID NO: 68), LPXA (SEQ ID NO: 69), LGXT (SEQ ID NO: 70), IPXT (SEQ ID NO: 71), NPXT (SEQ ID NO: 72), NPQS (SEQ ID NO: 73), LPST (SEQ ID NO: 74), NSKT (SEQ ID NO: 75), NPQT (SEQ ID NO: 76), NAKT (SEQ ID NO: 77), LPIT (SEQ ID NO: 78), LAET (SEQ ID NO: 79), or NPQS
(SEQ ID NO: 80). The invention encompasses embodiments in which 'X' in any sortase recognition motif disclosed herein or known in the art is amino acid, for example, any naturally occurring or any non-naturally occurring amino acid. In some embodiments, X is selected from the 20 standard amino acids found most commonly in proteins found in living organisms. In some embodiments, e.g., where the recognition motif is LPXTG (SEQ ID NO: 81) or LPXT (SEQ ID NO: 22), X is D, E, A, N, Q, K, or R. In some embodiments, X in a particular recognition motif is selected from those amino acids that occur naturally at position 3 in a naturally occurring sortase substrate. For example, in some embodiments X is selected from K, E, N, Q, A in an LPXTG (SEQ ID NO: 81) or LPXT (SEQ ID NO: 22)motif where the sortase is a sortase A. In some embodiments X is selected from K, S, E, L, A, N in an LPXTG (SEQ ID NO: 81) or LPXT (SEQ ID NO: 22) motif and a class C sortase is used.
[0065] In some embodiments, a sortase recognition sequence further comprises one or more additional amino acids, e.g. , at the N- or C-terminus. For example, one or more amino acids (e.g., up to five amino acids) having the identity of amino acids found immediately N- terminal to, or C-terminal to, a five amino acid recognition sequence in a naturally occurring sortase substrate may be incorporated. Such additional amino acids may provide context that improves the recognition of the recognition motif.
[0066] The term "sortase recognition motif," as used herein, refers to any molecule that is recognized by a sortase, for example, any molecule that can partake in a sortase-mediated transpeptidation reaction. In some embodiments, "sortase recognition motif and "sortase recognition sequence" are used interchangeably. A typical sortase-mediated transpeptidation reaction involves a substrate comprising a C-terminal sortase recognition motif, e.g., an LPXTX (SEQ ID NO: 15) motif, and a second substrate, referred to herein as a "sortase substrate." A sortase substrate is a chemical moiety that can partake in a sortase-mediated transpeptidation reaction with a sortase recognition motif. In some embodiments, the sortase substrate is a polyglycine or polyalanine. In some embodiments, the sortase substrate comprises an alkylamine group. In some embodiments, the sortase substrate is N-terminal. In some embodiments, the sortase substrate is C-terminal In some embodiments, a sortase substrate, or substrate recognition motif though described as being "C-terminal" or N- terminal," is not required to be at the immediate C- or N-terminus. For example, in some embodiments, other amino acids, for example a tag (e.g. , a 6xHis-tag), are found at the immediate C-terminus of a protein comprising a C-terminal sortase recognition motif, and the C-terminal sortase recognition motif is adjacent (e.g. , within 5, 10, 15 or 20 amino acids) thereto. A sortase recognition motif may be a peptide or a protein, for example, a peptide
comprising a sortase recognition motif such as an LPXTX (SEQ ID NO: 15). In some embodiments, a sortase substrate is a polyglycine a polyalanine, or an alkylamine group wherein the peptide is conjugated to an agent, e.g., a radiolabeled compound or small molecule. Accordingly, both proteins and non-protein molecules can be sortase substrates. Some examples of sortase substrates are described in more detail elsewhere herein and additional suitable sortase substrates will be apparent to the skilled artisan. The invention is not limited in this respect.
[0067] The term "sortagging," as used herein, refers to the process of adding a tag or agent, e.g., a moiety or molecule, for example, a radiolabeled compound or small molecule, onto a target molecule, for example, a target protein for use in PET applications via a sortase- mediated transpeptidation reaction. Examples of additional suitable tags include, but are not limited to, amino acids, nucleic acids, polynucleotides, sugars, carbohydrates, polymers, lipids, fatty acids, and small molecules. Other suitable tags will be apparent to those of skill in the art and the invention is not limited in this aspect. In some embodiments, a tag comprises a sequence useful for purifying, expressing, solubilizing, and/or detecting a polypeptide. In some embodiments, a tag can serve multiple functions. In some
embodiments, a tag comprises an HA, TAP, Myc, 6xHis, Flag, streptavidin, biotin, or GST tag, to name a few examples. In some embodiments, a tag is cleavable, so that it can be removed, e.g., by a protease. In some embodiments, this is achieved by including a protease cleavage site in the tag, e.g., adjacent or linked to a functional portion of the tag. Exemplary proteases include, e.g., thrombin, TEV protease, Factor Xa, PreScission protease, etc. In some embodiments, a "self-cleaving" tag is used. See, e.g., Wood et ah, International PCT Application PCT/US2005/05763, filed on February 24, 2005, and published as
WO/2005/086654 on September 22, 2005.
[0068] The term "subject" includes, but is not limited to, vertebrates, more specifically a mammal {e.g., a human, horse, pig, rabbit, dog, sheep, goat, non-human primate, cow, cat, guinea pig or rodent), a fish, a bird or a reptile or an amphibian. In some embodiments, the subject is a human subject. As used herein, "patient" refers to a subject afflicted with a disease or disorder. The term "patient" includes human and veterinary subjects of any sex or stage of development.
[0069] The term "target protein," as used herein in the context of sortase-mediated modification of proteins, refers to a protein that is modified by the conjugation of an agent, for example a radioactive agent that renders the protein suitable for diagnostic and/or therapeutic applications, such as PET imaging. The term "target protein" may refer to a wild
type or naturally occurring form of the respective protein, or to an engineered form, for example, to a recombinant protein variant comprising a sortase recognition motif not contained in a wild-type form of the protein. The term "modifying a target protein," as used herein in the context of sortase-mediated protein modification, refers to a process of altering a target protein comprising a sortase recognition motif via a sortase-mediated transpeptidation reaction. Typically, the modification leads to the target protein being conjugated to an agent, for example, a peptide, protein, detectable label, or small molecule. In certain embodiments, the modification provides radiolabeled proteins.
Antibodies and single domain antibodies
[0070] Some aspects of the disclosure provide antibodies (e.g., single domain antibodies) comprising a hydrophilic polymer and a detectable label. Other aspects of the disclosure provide methods for conjugating hydrophilic polymers and/or detectable labels to antibodies (e.g., single domain antibodies). In some embodiments, such antibodies are useful for imaging, for example a tumor, a tissue, or an organ in a subject. It should be appreciated that any of the antibodies provided herein may bind to a particular antigen. In some
embodiments, any of the antibodies provided herein may be produced, for example, by immunizing a subject (e.g., research animal) with an antigen, or using other methods, such as phage display. In some embodiments, an antibody is said to bind to an antigen if it is capable of binding to said antigen with an affinity better than 10~6M. In some embodiments, an antibody is said to bind to an antigen if it is capable of binding to said antigen with an affinity better than 10"6 M, 10"7 M, 10"8 M, 10"9 M, 10"10 M, or 10"11 M.
[0071] Any of the antibodies (e.g., single domain antibodies) provided herein may be humanized. Methods of humanizing antibodies are known in the art and would be apparent to the skilled artisan. Technology to humanize camelid VHHs has been developed (see e.g., Vincke et al., J. Biol. Chem. 2009, 284, 3273-3284; which is incorporated herein by reference), and several VHHs have been used already in a number of phase I and phase II clinical trials for therapeutic applications (see, e.g., De Meyer et al., Trends Biotechnol. 2014, 32, 263-270; which is incorporated herein by reference). Accordingly, in some
embodiments, methods for using VHHs (e.g., any of the VHHs provided herein) are provided. In some embodiments, the methods include detecting an epitope in a subject. In some embodiments, the methods include detecting a lymphocyte, e.g., in a tumor of a subject. In some embodiments, the methods include determining whether a subject will respond to a therapeutic agent.
[0072] In some embodiments, any of the antibodies provided herein bind to any immune cell. Some examples of immune cells include T-cells, B-cells, plasma cells, macrophages, dendritic cells, neutrophils, eosinophils, or mast cells. In some embodiments, the antibody binds to a marker of inflammation. For example, in some embodiments, the antibody useful in diagnostic applications involving PET. Use of antibodies for PET based applications is referred to as immunoPET (See, e.g., Knowles et al., "Advances in immuno-positron emission tomography: antibodies for molecular imaging in oncology." Clin Oncol. 2012; 30:3884-3892; the entire contents of which are hereby incorporated by reference). Such antibodies include monoclonal antibodies known to target or bind cancerous cells or tissues in a subject's body. For example, a non-limiting list of antibodies approved by the U.S. Food and Drug Administration (FDA) and the European Medicines Agency is provided in Table 3 of Salsano and Treglia, "PET imaging using radiolabeled antibodies: future direction in tumor diagnosis and correlate applications." Research and Reports in Nuclear Medicine. 2013: 3; 9-17, the entire contents of which are hereby incorporated by reference. The table is reproduced below.
Table 3 List of monoclonal antibodies approved by the US Food and Drug Administration and the European Medicines Agency in cancer therapy.
Type Targe :
ευ USA
BSB2 2o
CD3J At«<* iSysfoiii MA f'Safc siftjw.A, HjiffKWiiEsNi ¾g«S5 C052 i.ooi 239 i
[0073] Any of the antibodies, or fragments thereof, disclosed in Table 3 of Salsano and Treglia can be labeled according to the methods provided herein. Other antibodies amenable to labeling as described herein include, but are not limited to, those described in Wright and Lapi, "Designing the magic bullet? The advancement of immuno-PET into clinical use." . Nucl. Med. 2013 Aug;54(8): 1171-4; the entire contents of which are hereby incorporated by reference. These antibodies (see below) were successfully labeled with isotopes and were used in PET based diagnostic and/or therapeutic applications. However, the antibodies were labeled via chemical means that are not always amenable to quickly generating labeled antibodies with isotopes having a short half-life. Thus, such antibodies can be quickly and efficiently labeled with any desired isotope according to the methods, compositions, reagents, and kits provided herein. Antibodies disclosed by Wright and Lapi, include:
[0074] Humanized A33 (huA33), which recognizes A33 antigen, which is known to be expressed in greater than 95% of human colon adenocarcinomas. In a study utilizing radiolabeled huA33 (Carrasquillo et al, " 124 I-huA33 antibody PET of colorectal cancer." . Nucl. Med. 2011;52: 1173-1180; the entire contents of which are hereby incorporated by reference), 25 patients with primary or metastatic colorectal cancer (CRC) were administered
44.4-396 MBq (median, 343 MBq) of 1 4I-huA33 with a total of 10 mg of huA33. No adverse side effects were observed during the treatment that could be attributed to the huA33. The antibody could be administered via intravenous administration or hepatic arterial infusion (HAI), with HAI giving no detectable advantage over intravenous injection. Eleven patients had 12 primary tumors, 10 of which were detected via immuno-PET. Ten patients had liver metastases, all of which were detected by 124 I-huA33. Four of 7 patients with nodal metastases displayed uptake of the 124 I-huA33, and 2 of 5 patients had lung lesions that were visualized by immuno-PET.
[0075] Radretumab (L19SIP), which targets an epitope contained in the extra-domain B of fibronectin, was labeled with 124 I and used to establish provisional doses of 131 I-labeled radretumab in 6 patients with brain metastasis (Poli et al., "Radretumab radioimmunotherapy in patients with brain metastasis: a 124 I-L19SIP dosimetric PET study. Cancer Immunol Res. 2013:OF1-OF10; the entire contents of which are hereby incorporated by reference).
[0076] Girentuximab (cG250), a chimeric antibody that binds carbonic anhydrase IX
(CAIX), expressed in >95% of clear cell renal carcinoma (ccRCC), was labeled with 124 I and used to detect such cancers (Divgi et al., "Positron emission tomography/computed tomography identification of clear cell renal cell carcinoma: results from the REDECT Trial." J. Clin. Oncol. 2013; 31: 187-194; the entire contents of which are hereby incorporated by reference).
[0077] Panitumumab, a fully humanized antibody that binds epidermal growth factor
QQ
receptor (EGFR), was successfully labeled with Zr and used to image colorectal tumor xenografts (Nayak et al., "PET and MR imaging of metastatic peritoneal and pulmonary colorectal cancer in mice with human epidermal growth factor receptor 1 -targeted Zr- Labeled panitumumab." J. Nucl. Med. 2012; 53: 113-120; Chang et al., "Development and characterization of Zr-labeled panitumumab for immuno-positron emission tomographic imaging of the epidermal growth factor receptor." Mol. Imaging. 2013; 12: 17-27; the entire contents of each are hereby incorporated by reference).
[0078] U36, a chimeric antibody that recognizes the v6 region of CD44, was labeled with
QQ
Zr to image head and neck squamous cell carcinoma (Borjesson et al. "Radiation dosimetry of 89Zr-labeled chimeric monoclonal antibody U36 as used for immuno-PET in head and neck cancer patients." J. Nucl. Med. 2009; 50: 1828-1836; the entire contents of which are hereby incorporated by reference).
[0079] Trastuzumab, cetuximab, and bevacizumab (see Table 4 above), were also
QQ
successfully labeled with Zr and used in PET applications (Dijkers et al., "Biodistribution
of Zr-trastuzumab and PET imaging of HER2-positive lesions in patients with metastatic breast cancer." Clin. Pharmacol. Ther. 2010;87:586-592;
www.cancer.gov/clinicaltrials/search/results7protocolsearchid511815785. Accessed July 15, 2013; the entire contents of each are hereby incorporated by reference).
[0080] In some embodiments, any of the antibodies provided herein binds to a tumor antigen. In general, a tumor antigen can be any antigenic substance produced by a tumor cell (e.g., tumorigenic cells, or in some embodiments tumor stromal cells, e.g. , tumor-associated cells such as cancer-associated fibroblasts). In many embodiments, a tumor antigen is a molecule (or portion thereof) that is differentially expressed by tumor cells as compared with non-tumor cells. In other embodiments, a tumor antigen is expressed on the surface of the cell. Tumor antigens may include, e.g., proteins that are normally produced in very small quantities and are expressed in larger quantities by tumor cells, proteins that are normally produced only in certain stages of development, proteins whose structure (e.g. , sequence or post-translational modification(s)) is modified due to a mutation in tumor cells, or normal proteins that are (under normal conditions) sequestered from the immune system. Tumor antigens may be useful in, e.g. , identifying or detecting tumor cells (e.g., for purposes of diagnosis and/or for purposes of monitoring subjects who have received treatment for a tumor, e.g., to test for recurrence) and/or for purposes of targeting various agents (e.g., therapeutic agents) to tumor cells. For example, in some embodiments, a radiolabeled antibody is provided comprising an antibody or antibody fragment that binds a tumor antigen, thereby allowing detection of the tumor in vivo, e.g. , using PET. In some embodiments, a tumor antigen is an expression product of a mutated gene, e.g. , an oncogene or mutated tumor suppressor gene, an overexpressed or aberrantly expressed cellular protein, an antigen encoded by an oncogenic virus (e.g., HBV; HCV; herpesvirus family members such as EBV, KSV; papilloma virus, etc.), or an oncofetal antigen. Oncofetal antigens are normally produced in the early stages of embryonic development and largely or completely disappear by the time the immune system is fully developed. Examples are alphafetoprotein (AFP, found, e.g., in germ cell tumors and hepatocellular carcinoma) and carcinoembryonic antigen (CEA, found, e.g. , in bowel cancers and occasionally in lung and breast cancers). Tyrosinase is an example of a protein normally produced in very low quantities but whose production is greatly increased in certain tumor cells (e.g. , melanoma cells). Other exemplary tumor antigens include, e.g. , CA-125 (found, e.g., in ovarian cancer); MUC- 1 (found, e.g., in breast cancer); epithelial tumor antigen (found, e.g., in breast cancer); melanoma-associated antigen (MAGE; found, e.g., in malignant melanoma); and prostatic acid phosphatase (PAP, found in
prostate cancer). In some embodiments, a tumor antigen is at least in part exposed at the cell surface of tumor cells. In some embodiments, a tumor antigen comprises an abnormally modified polypeptide or lipid, e.g., an aberrantly modified cell surface glycolipid or glycoprotein. It will be appreciated that a tumor antigen may be expressed by a subset of tumors of a particular type and/or by a subset of cells in a tumor. Additional exemplary tumor antigens are known in the art and are within the scope of this disclosure. For example exemplary tumor antigens are described in WO 2014/183066 and US 20160122707, the entire contents of each are incorporated by reference herein.
[0081] Other exemplary therapeutic/diagnostic antibodies, or fragments thereof, that are useful in the production of radiolabeled antibodies or proteins according to the methods provided herein include, but are not limited to, the following antibodies, or fragments thereof (the target of the antibody is listed in parentheses together with exemplary non-limiting therapeutic indications):
[0082] Abciximab (glycoprotein Ilb/IIIa; cardiovascular disease), Adalimumab (TNF-a, various auto-immune disorders, e.g., rheumatoid arthritis), Alemtuzumab (CD52; chronic lymphocytic leukemia), Basiliximab (IL-2Ra receptor (CD25); transplant rejection),
Bevacizumab (vascular endothelial growth factor A; various cancers, e.g. , colorectal cancer, non-small cell lung cancer, glioblastoma, kidney cancer; wet age-related macular
degeneration), Catumaxomab (CD3 and EpCAM, malignant ascites), Cetuximab (EGF receptor, various cancers, e.g., colorectal cancer, head and neck cancer), Certolizumab (e.g., Certolizumab pegol) (TNF alpha; Crohn' s disease, rheumatoid arthritis), Daclizumab (IL- 2Ra receptor (CD25); transplant rejection), Eculizumab (complement protein C5; paroxysmal nocturnal hemoglobinuria), Efalizumab (CDl la; psoriasis), Gemtuzumab (CD33; acute myelogenous leukemia (e.g., conjugated to calicheamicin)), Ibritumomab tiuxetan (CD20; Non-Hodgkin lymphoma (e.g. , labeled with yttrium-90 or indium- 111)), Infliximab (TNF alpha; various autoimmune disorders, e.g., rheumatoid arthritis) Muromonab-CD3 (T Cell CD3 receptor; transplant rejection), Natalizumab (alpha-4 (a4) integrin; multiple sclerosis, Crohn's disease), Omalizumab (IgE; allergy-related asthma), Palivizumab (epitope of RSV F protein; Respiratory Syncytial Virus infection), Panitumumab (EGF receptor; cancer, e.g. , colorectal cancer), Ranibizumab (vascular endothelial growth factor A; wet age-related macular degeneration) Rituximab (CD20; non-Hodgkin lymphoma), Tositumomab (CD20; non-Hodgkin lymphoma), Trastuzumab (ErbB2; breast cancer), and any antigen-binding fragments thereof.
[0083] In some embodiments, any of the antibodies, or fragments thereof, (e.g., radiolabeled and/or PEGylated), described herein, may be used to image an immune response. The in vivo imaging of the inflammatory response, e.g., by labeling sites of inflammation using the methods and compositions provided herein, allows for non-invasive diagnosis, monitoring, and treatment of inflammatory disorders, as described herein. Other exemplary inflammatory markers to which radiolabeled proteins of the instant disclosure may bind include, but are not limited to, cytokines, tumor necrosis factor (TNF)-a, IL-6, IL-1 beta, IL-8, IL-10, IL-12, IL-16, IL-18, monocyte chemoattractant protein- 1 (MCP-1), GRO-a (Growth Related Oncogene-a), matrix metalloproteinase-8 (MMP-8), CSFs (colony- stimulating factors), epithelial cell-derived neutrophil-activating peptide-78 (ENA-78), regulated on activation normal T cell expressed and secreted (RANTES) CCL5, CXCL6 (granulocyte chemotactic protein-2), CXCL9 MIG, CXCL10; IP-10, CXCL11, CXCL13 (BCA-1), Exodus-1 (CCL20), MIF (macrophage migration inhibitory factor): MIP-lalpha (CCL3), MIP-lbeta (CCL4), CDl lb, CDl lc, CD13, CD15, CD66, CD14, CD64, CD66b, CD18, CD16, CD62L, CD67, HLA-DR, sHLA-G, Dihydroepiandrotendione (DHEA)-S, Cortisol CRF (corticotrophin-releasing factor), CRF-binding protein, alpha-defensin, beta- defensin, neutrophil defensins (HNP 1-3), bactericidal/permeability-increasing protein (BPI), calprotectin (MRP8/14), surfactant protein-A, surfactant protein-D, serum amyloid P component, serum amyloid A, complement factors, mannan-binding lectin, fibrinogen, prothrombin, factor VIII, von Willebrand factor, plasminogen, mannan-bindinglectin, c- reactive protein, Pentraxin 3, scavenger receptors, C-type lectins, Toll-like receptor (TLR)-4, TLR-2, TLR-3, TLR-6, intracellular pattern recognition receptors (Nodi, Nod2, RIG-1, MDA-5), RAGE (receptor for advanced glycation endproduct), alpha 2-macroglobulin, ferritin, hepcidin, ceruloplasmin, haptoglobin, orosomucoid, alpha 1 -antitrypsin, alpha 1- antichymotrypsin, lipopolysaccharide-binding protein (LBP), albumin, transferrin (including lactoferrin), transthyretin, retinol-binding protein, antithrombin, transcortin,
adrenocorticotropin, Urocortin, estriol, MMP-1, MMP-2, TIMP-2, MMP-3, MMP-7, MMP-9, arachidonate lipoxygenase metabolites, prostaglandins, prostacyclins, thromboxanes, leukotrienes, Catalase, Caspase-1 (NALP3 inflammasome), leptin, adiponectin, resistin, visfatin, Retinol binding protein 4 (RBP4), endotoxin, Epidermal growth factor (EGF), insulin-like growth factor binding protein- 1 (IGFBP-1), neutrophil elastase, leukocyte elastase (ELA2, neutrophil), SLPI (secretory leukocyte protease inhibitor), S 100 calcium binding protein B, Heat shock protein, Endothel in-1, -2, Angiopoietin-2, Calcium-binding protein, Soluble Triggering receptor expressed on myeloid cells 1 (sTREMl), Protein-Z
(vitamin K-dependent plasma glycoprotein), and Tissue factor and Platelet activating factor (PAF).
[0084] In some embodiments, any of the antibodies, or fragments thereof, (e.g.,
radiolabeled and/or PEGylated), described herein, may be used to image immune cells independent of an immune response. This may be done using antibodies that detect specific immune cell markers that are not indicative of an active immune response. As one example, naive T cells may be imaged using any of the radiolabelled antibodies or antibody fragments, described herein, that bind to the naive T cell markers CD3, CD4, CD45RA, CD45RB, CD197, or CD62L. Further information on varous immune cell types may be found in, e.g., Zhu, J., et al., Differentiation of effector CD4 T cell populations. Annu. Rev. Immunol., 28 (2010), pp. 445-489; S. Crotty, Follicular helper CD4 T cells (TFH), Annu. Rev. Immunol., 29 (2011), pp. 621-663. Of course it would be understood that certain of these markers (e.g., CD3, CD4) would also be expressed on T cells involved in an immune response and could be used as targets for imaging an immune response.
[0085] In some embodiments, any of the antibodies, or fragments thereof, (e.g.,
radiolabeled and/or PEGylated), described herein may be used to non-invasively image tumor and/or T cell markers. In some embodiments, any of the antibodies, or fragments thereof, (e.g., radiolabeled and/or PEGylated), described herein may be used to non-invasively image a tumor cell and/or a T cell. In some embodiments, the radiolabeled antibodies or antibody fragments detect markers including, but not limited to PD-L1, PD-1, PD-2, CTLA-4, CD3, CD4, CD8, and CD28.
[0086] In some embodiments, any of the antibodies, or fragments thereof, (e.g.,
radiolabeled and/or PEGylated) described herein bind to proteins involved in immune checkpoint pathways. "Immune checkpoint pathways" or "immune checkpoints" are naturally existing inhibitory pathways of the immune system that play important roles in maintaining self-tolerance and modulating the duration and level of effector output (e.g., in the case of T cells, the levels of cytokine production, proliferation or target killing potential) of
physiological immune responses in order to minimize damage to the tissues of the individual mounting the immune response. Such pathways may, for example, downmodulate T cell activity or enhance regulatory T cell immunosuppressive activity. Examples of immune checkpoint pathways include, but are not limited to the PD- 1 pathway and the CTLA-4 pathway and the TIM3 pathway. Tumors frequently co-opt certain immune-checkpoint pathways as a major mechanism of immune resistance, e.g., against T cells that are specific for tumor antigens. Furthermore, chronic antigen exposure, such as occurs in cancer, can
lead to high levels of expression of immune checkpoint proteins (e.g., PD1, PD-L1, PD-L2) by immune cells, which can induce a state of T cell exhaustion or anergy. Certain immune checkpoint proteins such as CTLA4 and PD1 are highly expressed on T regulatory (TReg) cells and may enhance their proliferation. Many tumours are highly infiltrated with TReg cells that likely suppress effector immune responses, Thus, blockade of the PD1 pathway and/or the CTLA4 pathway may enhance antitumour immune responses by diminishing the number and/or suppressive activity of intratumoral TReg cells. Certain aspects of the invention utilize the radiolabeled proteins (e.g., radiolabeled antibodies or antibody fragments) for diagnosing or monitoring a disease or condition (e.g., cancer) or the response of a disease or condition (e.g., cancer) to therapy. For example, the radiolebeled antibodies or antibody fragments may be used to detect whether a tumor expresses an immune checkpoint marker (e.g., an immune checkpoint protein) and/or to detect whether a tumor contains immune cells that express an immune checkpoint marker (e.g., an immune checkpoint protein). In other embodiments, the inventive radiolabeled proteins (e.g., radiolabeled antibodies or antibody fragments) bind to an immune checkpoint modulator. In some embodiments the immune checkpoint modulator is an immune checkpoint inhibitor. "Immune checkpoint inhibitor" refers to any agent that inhibits (suppresses, reduces activity of) an immune checkpoint pathway. In some embodiments the immune checkpoint modulator is an immune checkpoint activator.
"Immune checkpoint activator" refers to any agent that activates (stimulates, increases activity of) an immune checkpoint pathway.
[0087] Immune checkpoint inhibitors, e.g., monoclonal antibodies that bind to immune checkpoint proteins such as CTLA4, PD1, PD-L1 have shown notable efficacy in treating a variety of different cancers, including cancers that are advanced, have failed to respond to conventional chemotherapeutic agents, and/or have a poor prognosis, such as metastatic melanoma (see, e.g., Pardoll, DM,, The blockade of immune checkpoints in cancer immunotherapy, Nat Rev Cancer. 2012; 12(4):252-64). However, not all subjects with tumors of a particular type may experience benefit from treatment with a given immune checkpoint inhibitor. One or ordinary skill would appreciate that a benefit could be, e.g., stable disease rather than progressive disease, eventual reduced number and/or volume of tumor lesions, increased mean survival, etc. Detection of immune checkpoint markers using any of the methods ,described herein, may be used to determine whether or not to administer a therapeutic and/or to select a therapeutic (e.g., from among multiple different therapeutic options). For example, a radiolabeled antibody or antibody fragment that binds PD-L1 can be used to detect whether a tumor within a patient expresses PD-L1. Patients having a PD-L1
positive tumor may then be administered a therapeutic that targets the PD1 pathway, e.g., a therapeutic (such as an antibody) that targets PD1 or PD-L1. A radiolabeled protein (e.g., radiolabeled antibody or antibody fragment) that binds PD1 can be used to detect whether a tumor within a patient is positive for PD1 (e.g., due to the presence of immune cells that express high levels of PD1). Patients having a PD1 positive tumor may then be administered a therapeutic agent that targets the PD1 pathway, In some embodiments a radiolabeled protein (e.g., radiolabeled antibody or antibody fragment) that binds TIM3 can be used to detect whether a tumor within a patient is positive for TIM3 (e.g., due to the presence of immune cells that express high levels of TIM3). Patients having a TIM3 positive tumor may then be administered a therapeutic that targets the TTM3 pathway,e.g., a therapeutic (such as an antibody) that targets TTM3. In some embodiments a radiolabeled protein (e.g., radiolabeled antibody or antibody fragment) that binds CTLA4 can be used to detect whether a tumor within a patient is positive for CTLA4 (e.g., due to the presence of immune cells that express high levels of CTLA4). Patients having a CTLA4 positive tumor may then be administered a therapeutic that targets the CTLA4 pathway, e.g., a therapeutic (such as an antibody) that targets CTLA4. In some embodiments a subject with a tumor may be imaged with two, three, or more radiolabeled proteins (e.g., antibodies, antibody fragments) that bind to different immune checkpoint proteins (e.g., proteins involved in different immune checkpoint pathways). One or more immune checkpoint pathways that are positive in the tumor are identified. The patient is then treated with one or more agent(s) that target those immune checkpoint pathways for which a tumor (or one or more tumor(s)) in the subject is positive. In some embodiments, if the tumor is negative for a particular immune checkpoint pathway or immune checkpoint protein, an alternative treatment may be administered instead of an immune checkpoint inhibitor that would target that immune checkpoint pathway or immune checkpoint protein. Other aspects of the invention utilize the radiolabeled antibodies or antibody fragments for monitoring the response to a therapeutic or monitoring expression of a protein, such as an immune checkpoint inhibitor protein. For example, a radiolabeled antibody or antibody fragmenat, described herein, may be used to detect whether an immune response has been generated or enhanced or suppressed at a site of interest, such as at the site of a tumor or a site of infection, or whether the tumor expresses an immune checkpoint protein (e.g., PD-L1). In some embodiments a radiolabeled protein that binds to an immune cell, e.g., a T cell, may be administered to a subject before, concurrently, and/or after administration of a treatment intended to enhance or inhibit an immune response. Images may be compared from before and after treatment to assess the effect of the treatment on the
immune response. In some embodiments, the inventive radiolabeled proteins may be used to monitor the response to a therapeutic at least every 1 day, at least every 5 days, at least everylO days, at least every 15 days, at least every 30 days, at least every 45 days, at least every 60 days, at least every 120 days, at least every 180 days, at least every 240 days or at least every year. In some embodiments a subject may be monitored for, e.g., up to 3, 6, 9 months, up to 1, 2, 5, years, or more. In some embodiments, a therapeutic agent that targets an immune checkpoint inhibitor pathway is a monoclonal antibody. In some embodiments, the monoclonal antibody is a chimeric, humanized, or human monoclonal antibody. In some embodiments, the antibody is an IgG antibody, e.g., an IgGl or IgG4 antibody. In some embodiments, a therapeutic agent that targets the CTLA4 pathway is a monoclonal antibody that binds to CTLA4, such as ipilimumab (Yervoy) or tremilimumab. In some embodiments, a therapeutic agent that targets the PDl pathway is a monoclonal antibody that binds to PDl, such as nivolumab (a fully human IgG4 monoclonal antibody), pidilizumab (also known as CT-011, a humanized IgGl monoclonal antibody), or pembrolizumab (Keytruda, formerly lambrolizumab; also known as MK-3475), a humanized IgG4 monoclonal antibody), or MEDI0680 (AMP-514, a humanized IgG4mAb against PD-1). In some embodiments, a therapeutic agent that targets the PDl pathway is a monoclonal antibody that binds to PD-L1 such as BMS-936559 (a fully human IgG4 monoclonal antibody), MPDL3280A (human monoclonal, Genentech), MSB0010718C (Merck Serono), or MEDI4736. In some embodiments, a therapeutic agent that targets the PDl pathway is a monoclonal antibody that binds to PD-L2. In some embodiments, a therapeutic agent that targets the PDl pathway is a recombinant fusion protein comprising extracellular domain of PD-L2 such as AMP-224. A variety of PDl pathway inhibitors, e.g., antibodies that bind to PD-1, PD-L1, or PD-L2 are described in U.S. Pat. Pub. No. 20040213795, 20110195068, 20120039906, 20120114649, 20130095098, 20130108651, 20130109843, 20130237580, and 20130291136, all of which are incorporated by reference herein.
[0088] In some embodiments, the subject suffers from a solid tumor. In some embodiments, the subject suffers from melanoma, renal cell carcinoma, non- small-cell lung cancer, ovarian cancer, brain cancer (e.g., glioblastoma), lymphoma (e.g., Non-Hodgkin lymphoma), hepatocellular, esophageal, breast (e.g., triple negative breast cancer), multiple myeloma, or pancreatic cancer. In some embodiments, the subject has a metastatic cancer, stage III cancer, or stage IV cancer.
[0089] It would be understood that the immune checkpoint inhibitor could be administered as a single agent or in combination with one or more other anti-tumor agents.
Properties
[0090] In some embodiments, any of the antibodies, or fragments thereof, (e.g.,
radiolabeled and/or PEGylated), described herein, are capable of reaching their targets and are cleared quickly from the circulation. Whole antibodies and their fragments have different characteristics that determine their targeting properties, such as how quickly they reach the target antigen and clear from the blood, which organ clears the antibody from the blood, penetration into the tumor and amount of the injected radiolabeled antibody or antibody fragment binding to the target. Once antibodies target their respective antigens, they generally bind with high avidity, which in turn determines their tumor residence time, whereas the unbound antibody is processed by various organs in the body and eventually degraded and excreted. Whole IgG, which is the principal antibody form used, clears very slowly from the blood, requiring several days before a sufficient amount leaves the circulation to allow the specific concentration taken into the tumor to be distinguished from blood and adjacent tissue radioactivity. Its slow clearance is in part owing to its large size (approximately 150,000 Da) that impedes its extravasation, resulting in a slow tumor accretion. As the molecular size of an antibody is reduced from a divalent F(ab')2 fragment (approximately 100,000 Da) to the monovalent binding Fab fragment (approximately 50,000 Da), there is a progressively faster clearance from the blood. Molecular engineering has enabled the formation of even smaller antibody structures, such as scFv (approximately 25,000 Da), which are cleared even more rapidly from the blood. See Goldenberg D. M. et al., "Novel radiolabeled antibody conjugates." Oncogene.2007, 26, 3734-3744; the entire contents of which are hereby incorporated by reference. Accordingly, in some embodiments any of the antibodies, or fragments thereof, (e.g., radiolabeled and/or PEGylated), described herein,, have a molecular weight of less than 60kDa, less than 55 kDa, less than 50 kDa, less than 45 kDa, less than 40kDa, less than 35 kDa, less than 30 kDa, less than 25 kDa less than 20 kDa, less than 15 kDa, less than lOkDa, or less than 5 kDa. In other embodiments the radiolabeled proteins (e.g., antibodies or antibody fragments), described herein, have a molecular weight ranging from 5 kDa- 15 kDa, from 5 kDa-20kDa, from 5 kDa-25 kDa, from 5 kDa-30kDa, from 5 kDa-35 kDa, from 5 kDa-40kDa, from 5 kDa-45 kDa, from 5 kDa-55kDa, from 5 kDa- 60kDa, froml5 kDa-20 kDa, from 15 kDa-25 kDa, from 15 kDa-30 kDa, from 15 kDa-35 kDa, from 15 kDa-40 kDa, from 15 kDa-45 kDa, from 15 kDa-50 kDa, from 15 kDa-55 kDa, from 15 kDa-60 kDa, from 25 kDa-35 kDa, from 25 kDa-45 kDa, from 25 kDa-55 kDa, from 25 kDa-60 kDa, from 35 kDa-45 kDa, from 35 kDa-55 kDa, from 35 kDa-60 kDa, from 45
kDa-55 kDa, from 45 kDa-60 kDa, or from 50 kDa-60 kDa. In yet other embodiments, any of the antibodies, or fragments thereof, (e.g., radiolabeled and/or PEGylated), described herein, are expediently cleared from the circulation following injection into a patient. In some embodiments, at least 95% of the radiolabeled proteins (e.g., antibodies or antibody fragments) are cleared from the blood within 20 minutes, within 30 minutes, within 40 minutes, within 60 minutes, within 80 minutes, within 30 minutes, within 40 minutes, within 60 minutes, within 90 minutes, within 2 hours, whithin 3 hours, within 4 hours, within 6 hours, within 8 hours, within 10 hours or within 12 hours. In other embodiments, at least 95% of the radiolabeled proteins (e.g., antibodies or antibody fragments) are cleared from the body within 20 minutes, within 30 minutes, within 40 minutes, within 60 minutes, within 80 minutes, within 30 minutes, within 40 minutes, within 60 minutes, within 90 minutes, within 2 hours, whithin 3 hours, within 4 hours, within 6 hours, within 8 hours, within 10 hours or within 12 hours.
Hydrophilic polymers
[0091] Some aspects of the disclosure are related to the use hydrophilic polymers and methods of conjugating hydrophilic polymers to an antibody {e.g., a single domain antibody). As used herein, a "hydrophilic polymer" refers to a molecule {e.g., a macromolecule) comprised of three or more repeating units that contain polar or charged functional groups, rendering them soluble in water. In some embodiments, the hydrophilic polymer is soluble to at least 50 mg/mL in water, to at least lOOmg/mL in water, to at least 150 mg/mL in water, to at least 200mg/mL in water, to at least 250mg/mL in water, to at least 300 mg/mL in water, to at least 400mg/mL in water, to at least 500mg/mL in water, to at least 600 mg/mL in water, to at least 700mg/mL in water, to at least 800mg/mL in water, to at least 900 mg/mL in water, or at least lOOOmg/mL in water at 20°C. In some embodiments, the hydrophilic polymer is a linear polymer. In some embodiments, the hydrophilic polymer is a branched polymer, which may be configured in any number of ways. In some embodiments, the hydrophilic polymer is a suitable size and/or has a suitable linear or branched structure for conferring improved properties to any of the antibodies provided herein. In some embodiments, the hydrophilic polymer is from 5kDa to lOOOkDa in size. In some embodiments, the polymer is at least 5kDa, at least lOkDa, at least 15kDa, at least 20kDa, at least 25kDa, at least 30kDa, at least 40kDa, at least 50kDa, at least 70kDa, at least lOOkDa, at least 150kDa, at least 200kDa, at least 300kDa, at least 400kDa, at least 500kDa, at least 600kDa, at least 700kDa, at least 800kDa, at least 900kDa, or at least lOOOkDa in size.
[0092] In some embodiments, the hydrophilic polymer useful in the present invention is synthetic polymer. In certain embodiments, the hydrophilic polymer is not a polypeptide, polynucleotide, or polysaccharide. Examples of hydrophilic synthetic polymers include, without limitation polyethylene glycol (PEG), polyvinyl pyrrolidone (PVP), polyvinyl alcohol (PVA), polyacrylic acid (PAA), polyacrylamide, N-(2-hydroxypropyl)
methacrylamide (HPMA), divinyl ether-maleic anhydride (DIVEMA), polyoxazoline, polyphosphoester (PPE), polyethyleneimine (PEI), and polyphosphazene. However, it should be appreciated that other synthetic polymers may be used and are considered to be within the scope of this disclosure.
[0093] In some embodiments, any of the hydrophilic polymers provided herein are natural polymers. Examples of natural polymers include, without limitation, polysaccharides, xanthan gum, pectins, chitosan derivatives, dextran, carrageenan, guar gum, cellulose ethers (e.g., Sodium CMC, HPC, and HPMC), hyaluronic acid (HA), albumin, and starch or starch based derivatives. However, it should be appreciated that other synthetic polymers may be used and are within the scope of this disclosure. Additional hydrophilic polymers would be apparent to the skilled artisan and are within the scope of this disclosure. For example, exemplary hydrophilic polymers have been described previously in Veeran, G. K., et ah, "Water Soluble Polymers for Pharmaceutical Applications" Polymers 2011, 3, 1972-2009; the entire contents of which are incorporated by reference herein. It should be appreciated that, in some embodiments, PEGylation also refers to the addition of any hydrophilic polymer, for example any of the hydrophilic polymers provided herein.
Chelating moieties
[0094] Some aspects of the disclosure provide chelating moieties and methods for conjugating chelating moieties to antibodies (e.g., single domain antibodies). As used here a "chelating moiety" is an agent whose molecules can form several bonds to a single metal ion. In some embodiments, the chelating moiety is an agent that binds to a radionuclide. In some embodiments, the chelating moiety is an agent that binds to rubidium-82, copper-61, copper- 62, copper-64, yttrium-86, gallium-68, zirconium-89. However, it should be appreciated that the chelating moiety may be an agent that binds to additional radioactive metals. Exemplary chelating moieties include, without limitation, 1,4,7-triazacyclononane-triacetic acid
(NOT A), 1,4,7, 10-tetraazacyclododecane-tetraacetic acid (DOT A), triazacyclononane- phosphinate (TRAP), or desferoxamine (DFO). However, it should be appreciated that additional chelating moieties may be used and are within the scope of this invention.
Exemplary metallic radionuclides and chelators have been described in the art and are within the scope of this disclosure. For example, exemplary metallic radionuclides and chelators have been described in Liu X., et al., "A Brief Review of Chelators for Radiolabeling Oligomers" Materials, 2010, 3, 3204-3217, the entire contents of which are incorporated by reference herein.
Chemistry definitions
[0095] Definitions of specific functional groups and chemical terms are described in more detail below. The chemical elements are identified in accordance with the Periodic Table of the Elements, CAS version, Handbook of Chemistry and Physics, 75th Ed., inside cover, and specific functional groups are generally defined as described therein. Additionally, general principles of organic chemistry, as well as specific functional moieties and reactivity, are described in Organic Chemistry, Thomas Sorrell, University Science Books, Sausalito, 1999; Smith and March March 's Advanced Organic Chemistry, 5th Edition, John Wiley & Sons, Inc., New York, 2001; Larock, Comprehensive Organic Transformations, VCH Publishers, Inc., New York, 1989; and Carruthers, Some Modern Methods of Organic Synthesis, 3 Edition, Cambridge University Press, Cambridge, 1987.
[0096] Compounds described herein can comprise one or more asymmetric centers, and thus can exist in various stereoisomeric forms, e.g., enantiomers and/or diastereomers. For example, the compounds described herein can be in the form of an individual enantiomer, diastereomer or geometric isomer, or can be in the form of a mixture of stereoisomers, including racemic mixtures and mixtures enriched in one or more stereoisomer. Isomers can be isolated from mixtures by methods known to those skilled in the art, including chiral high pressure liquid chromatography (HPLC) and the formation and crystallization of chiral salts; or preferred isomers can be prepared by asymmetric syntheses. See, for example, Jacques et al., Enantiomers, Racemates and Resolutions (Wiley Interscience, New York, 1981); Wilen et al., Tetrahedron 33:2725 (1977); Eliel, E.L. Stereochemistry of Carbon Compounds (McGraw-Hill, NY, 1962); and Wilen, S.H. Tables of Resolving Agents and Optical
Resolutions p. 268 (E.L. Eliel, Ed., Univ. of Notre Dame Press, Notre Dame, IN 1972). The invention additionally encompasses compounds as individual isomers substantially free of other isomers, and alternatively, as mixtures of various isomers.
[0097] In a formula,— is absent, a coordination bond between a ligand and a metal, or a single bond.
[0098] When a range of values is listed, it is intended to encompass each value and subrange within the range. For example "Ci_6 alkyl" is intended to encompass, Ci, C2, C3, C4, C5,
C6, Ci_6, Ci_5, Ci^, Ci_3, Ci_2, C2-6, C2-5, C2^, C2-3, C3_6, C3_5, C3^, C4_6, C4_5, and Cs_6 alkyl.
[0099] The term "aliphatic," as used herein, includes both saturated and unsaturated, nonaromatic, straight chain (i.e. , unbranched), branched, acyclic, and cyclic (i.e. , carbocyclic) hydrocarbons, which are optionally substituted with one or more functional groups. As will be appreciated by one of ordinary skill in the art, "aliphatic" is intended herein to include, but is not limited to, alkyl, alkenyl, alkynyl, cycloalkyl, cycloalkenyl, and cycloalkynyl moieties. Thus, as used herein, the term "alkyl" includes straight, branched and cyclic alkyl groups. An analogous convention applies to other generic terms such as "alkenyl," "alkynyl," and the like. Furthermore, as used herein, the terms "alkyl," "alkenyl," "alkynyl," and the like encompass both substituted and unsubstituted groups. In certain embodiments, as used herein, "aliphatic" is used to indicate those aliphatic groups (cyclic, acyclic, substituted, unsubstituted, branched or unbranched) having 1-20 carbon atoms (Ci-20 aliphatic). In certain embodiments, the aliphatic group has 1-10 carbon atoms (Ci-10 aliphatic). In certain embodiments, the aliphatic group has 1-6 carbon atoms (C1-6 aliphatic). In certain
embodiments, the aliphatic group has 1-5 carbon atoms (C1-5 aliphatic). In certain
embodiments, the aliphatic group has 1-4 carbon atoms (C1-4 aliphatic). In certain
embodiments, the aliphatic group has 1-3 carbon atoms (C1-3 aliphatic). In certain
embodiments, the aliphatic group has 1-2 carbon atoms (C1-2 aliphatic). Aliphatic group substituents include, but are not limited to, any of the substituents described herein, that result in the formation of a stable moiety.
[00100] The term "heteroaliphatic", as used herein, refers to aliphatic moieties that contain one or more oxygen, sulfur, nitrogen, phosphorus, or silicon atoms, e.g. , in place of carbon atoms. Heteroaliphatic moieties may be branched, unbranched, cyclic or acyclic and include saturated and unsaturated heterocycles such as morpholino, pyrrolidinyl, etc. In certain embodiments, heteroaliphatic moieties are substituted by independent replacement of one or more of the hydrogen atoms thereon with one or more moieties including, but not limited to aliphatic; heteroaliphatic; aryl; heteroaryl; arylalkyl; heteroarylalkyl; alkoxy; aryloxy;
heteroalkoxy; heteroaryloxy; alkylthio; arylthio; heteroalkylthio; heteroaryl thio; -F; -CI; -Br; -I; -OH; -N02; -CN; -CF3; -CH2CF3; -CHC12; -CH2OH; -CH2CH2OH; -CH2NH2; - CH2S02CH3; -C(0)Rx; -C02(Rx); -CON(Rx)2; -OC(0)Rx; -OC02Rx; -OCON(Rx)2; -N(RX)2; - S(0)2Rx; -NRx(CO)Rx, wherein each occurrence of Rx independently includes, but is not
limited to, aliphatic, heteroaliphatic, aryl, heteroaryl, arylalkyl, or heteroarylalkyl, wherein any of the aliphatic, heteroaliphatic, arylalkyl, or heteroarylalkyl substituents described above and herein may be substituted or unsubstituted, branched or unbranched, cyclic or acyclic, and wherein any of the aryl or heteroaryl substituents described above and herein may be substituted or unsubstituted. Additional examples of generally applicable substitutents are illustrated by the specific embodiments shown in the Examples that are described herein.
[00101] The term "alkyl," as used herein, refers to saturated, straight- or branched-chain hydrocarbon radicals derived from a hydrocarbon moiety containing between one and twenty carbon atoms by removal of a single hydrogen atom. In some embodiments, the alkyl group employed in the invention contains 1-20 carbon atoms (Ci_2oalkyl). In another embodiment, the alkyl group employed contains 1-15 carbon atoms (Ci-isalkyl). In another embodiment, the alkyl group employed contains 1-10 carbon atoms (Ci-ioalkyl). In another embodiment, the alkyl group employed contains 1-8 carbon atoms (Ci_8alkyl). In another embodiment, the alkyl group employed contains 1-6 carbon atoms (Ci_6alkyl). In another embodiment, the alkyl group employed contains 1-5 carbon atoms (Ci-salkyl). In another embodiment, the alkyl group employed contains 1-4 carbon atoms (Ci_4alkyl). In another embodiment, the alkyl group employed contains 1-3 carbon atoms (Ci_3alkyl). In another embodiment, the alkyl group employed contains 1-2 carbon atoms (Ci_2alkyl). Examples of alkyl radicals include, but are not limited to, methyl, ethyl, n-propyl, isopropyl, n-butyl, iso-butyl, sec- butyl, sec-pentyl, iso-pentyl, tert-butyl, n-pentyl, neopentyl, n-hexyl, sec-hexyl, n-heptyl, n-octyl, n-decyl, n-undecyl, dodecyl, and the like, which may bear one or more substituents. Alkyl group substituents include, but are not limited to, any of the substituents described herein, that result in the formation of a stable moiety. The term "alkylene," as used herein, refers to a biradical derived from an alkyl group, as defined herein, by removal of two hydrogen atoms. Alkylene groups may be cyclic or acyclic, branched or unbranched, substituted or unsubstituted. Alkylene group substituents include, but are not limited to, any of the substituents described herein, that result in the formation of a stable moiety.
[00102] The term "alkenyl," as used herein, denotes a monovalent group derived from a straight- or branched-chain hydrocarbon moiety having at least one carbon-carbon double bond by the removal of a single hydrogen atom. In certain embodiments, the alkenyl group employed in the invention contains 2-20 carbon atoms (C2-2oalkenyl). In some embodiments, the alkenyl group employed in the invention contains 2-15 carbon atoms (d isalkenyl). In another embodiment, the alkenyl group employed contains 2-10 carbon atoms (C2-ioalkenyl). In still other embodiments, the alkenyl group contains 2-8 carbon atoms (C2-8alkenyl). In yet
other embodiments, the alkenyl group contains 2-6 carbons (C2_6alkenyl). In yet other embodiments, the alkenyl group contains 2-5 carbons (C2_salkenyl). In yet other
embodiments, the alkenyl group contains 2-4 carbons (C2_4alkenyl). In yet other
embodiments, the alkenyl group contains 2-3 carbons (C2_3alkenyl). In yet other
embodiments, the alkenyl group contains 2 carbons (C2alkenyl). Alkenyl groups include, for example, ethenyl, propenyl, butenyl, l-methyl-2-buten-l-yl, and the like, which may bear one or more substituents. Alkenyl group substituents include, but are not limited to, any of the substituents described herein, that result in the formation of a stable moiety. The term "alkenylene," as used herein, refers to a biradical derived from an alkenyl group, as defined herein, by removal of two hydrogen atoms. Alkenylene groups may be cyclic or acyclic, branched or unbranched, substituted or unsubstituted. Alkenylene group substituents include, but are not limited to, any of the substituents described herein, that result in the formation of a stable moiety.
[00103] The term "alkynyl," as used herein, refers to a monovalent group derived from a straight- or branched-chain hydrocarbon having at least one carbon-carbon triple bond by the removal of a single hydrogen atom. In certain embodiments, the alkynyl group employed in the invention contains 2-20 carbon atoms (C2_2oalkynyl). In some embodiments, the alkynyl group employed in the invention contains 2-15 carbon atoms (C2_isalkynyl). In another embodiment, the alkynyl group employed contains 2-10 carbon atoms (C2_ioalkynyl). In still other embodiments, the alkynyl group contains 2-8 carbon atoms (C2_8alkynyl). In still other embodiments, the alkynyl group contains 2-6 carbon atoms (C2_6alkynyl). In still other embodiments, the alkynyl group contains 2-5 carbon atoms (C2_salkynyl). In still other embodiments, the alkynyl group contains 2-4 carbon atoms (C2_4alkynyl). In still other embodiments, the alkynyl group contains 2-3 carbon atoms (C2-3alkynyl). In still other embodiments, the alkynyl group contains 2 carbon atoms (C2alkynyl). Representative alkynyl groups include, but are not limited to, ethynyl, 2-propynyl (propargyl), 1-propynyl, and the like, which may bear one or more substituents. Alkynyl group substituents include, but are not limited to, any of the substituents described herein, that result in the formation of a stable moiety. The term "alkynylene," as used herein, refers to a biradical derived from an alkynylene group, as defined herein, by removal of two hydrogen atoms. Alkynylene groups may be cyclic or acyclic, branched or unbranched, substituted or unsubstituted. Alkynylene group substituents include, but are not limited to, any of the substituents described herein, that result in the formation of a stable moiety.
[00104] The term "heteroalkyl" refers to an alkyl group, which further includes at least one heteroatom (e.g., 1, 2, 3, or 4 heteroatoms) selected from oxygen, nitrogen, or sulfur within (i.e., inserted between adjacent carbon atoms of) and/or placed at one or more terminal position(s) of the parent chain. In certain embodiments, a heteroalkyl group refers to a saturated group having from 1 to 10 carbon atoms and 1 or more heteroatoms within the parent chain ("heteroCi_io alkyl"). In some embodiments, a heteroalkyl group is a saturated group having 1 to 9 carbon atoms and 1 or more heteroatoms within the parent chain
("heteroCi_9 alkyl"). In some embodiments, a heteroalkyl group is a saturated group having 1 to 8 carbon atoms and 1 or more heteroatoms within the parent chain ("heteroCi_8 alkyl"). In some embodiments, a heteroalkyl group is a saturated group having 1 to 7 carbon atoms and 1 or more heteroatoms within the parent chain ("heteroCi_7 alkyl"). In some embodiments, a heteroalkyl group is a saturated group having 1 to 6 carbon atoms and 1 or more heteroatoms within the parent chain ("heteroCi_6 alkyl"). In some embodiments, a heteroalkyl group is a saturated group having 1 to 5 carbon atoms and 1 or 2 heteroatoms within the parent chain ("heteroCi_5 alkyl"). In some embodiments, a heteroalkyl group is a saturated group having 1 to 4 carbon atoms and lor 2 heteroatoms within the parent chain ("heteroCi^ alkyl"). In some embodiments, a heteroalkyl group is a saturated group having 1 to 3 carbon atoms and 1 heteroatom within the parent chain ("heteroCi_3 alkyl"). In some embodiments, a heteroalkyl group is a saturated group having 1 to 2 carbon atoms and 1 heteroatom within the parent chain ("heteroCn alkyl"). In some embodiments, a heteroalkyl group is a saturated group having 1 carbon atom and 1 heteroatom ("heteroCi alkyl"). In some embodiments, a heteroalkyl group is a saturated group having 2 to 6 carbon atoms and 1 or 2 heteroatoms within the parent chain ("heteroC2-6 alkyl"). Unless otherwise specified, each instance of a heteroalkyl group is independently unsubstituted (an "unsubstituted
heteroalkyl") or substituted (a "substituted heteroalkyl") with one or more substituents. In certain embodiments, the heteroalkyl group is an unsubstituted heteroCi_io alkyl. In certain embodiments, the heteroalkyl group is a substituted heteroCi_io alkyl.
[00105] The term "heteroalkenyl" refers to an alkenyl group, which further includes at least one heteroatom (e.g., 1, 2, 3, or 4 heteroatoms) selected from oxygen, nitrogen, or sulfur within (i.e., inserted between adjacent carbon atoms of) and/or placed at one or more terminal position(s) of the parent chain. In certain embodiments, a heteroalkenyl group refers to a group having from 2 to 10 carbon atoms, at least one double bond, and 1 or more heteroatoms within the parent chain ("heteroC2-io alkenyl"). In some embodiments, a heteroalkenyl group has 2 to 9 carbon atoms at least one double bond, and 1 or more heteroatoms within the
parent chain ("heteroC2-9 alkenyl"). In some embodiments, a heteroalkenyl group has 2 to 8 carbon atoms, at least one double bond, and 1 or more heteroatoms within the parent chain ("heteroC2-8 alkenyl"). In some embodiments, a heteroalkenyl group has 2 to 7 carbon atoms, at least one double bond, and 1 or more heteroatoms within the parent chain ("heteroC2-7 alkenyl"). In some embodiments, a heteroalkenyl group has 2 to 6 carbon atoms, at least one double bond, and 1 or more heteroatoms within the parent chain ("heteroC2-6 alkenyl"). In some embodiments, a heteroalkenyl group has 2 to 5 carbon atoms, at least one double bond, and 1 or 2 heteroatoms within the parent chain ("heterod-s alkenyl"). In some embodiments, a heteroalkenyl group has 2 to 4 carbon atoms, at least one double bond, and lor 2
heteroatoms within the parent chain ("heteroC2^ alkenyl"). In some embodiments, a heteroalkenyl group has 2 to 3 carbon atoms, at least one double bond, and 1 heteroatom within the parent chain ("heteroC2-3 alkenyl"). In some embodiments, a heteroalkenyl group has 2 to 6 carbon atoms, at least one double bond, and 1 or 2 heteroatoms within the parent chain ("heteroC2-6 alkenyl"). Unless otherwise specified, each instance of a heteroalkenyl group is independently unsubstituted (an "unsubstituted heteroalkenyl") or substituted (a "substituted heteroalkenyl") with one or more substituents. In certain embodiments, the heteroalkenyl group is an unsubstituted heteroC2-io alkenyl. In certain embodiments, the heteroalkenyl group is a substituted heteroC2-io alkenyl.
[00106] The term "heteroalkynyl" refers to an alkynyl group, which further includes at least one heteroatom (e.g., 1, 2, 3, or 4 heteroatoms) selected from oxygen, nitrogen, or sulfur within (i.e., inserted between adjacent carbon atoms of) and/or placed at one or more terminal position(s) of the parent chain. In certain embodiments, a heteroalkynyl group refers to a group having from 2 to 10 carbon atoms, at least one triple bond, and 1 or more heteroatoms within the parent chain ("heteroC2 io alkynyl"). In some embodiments, a heteroalkynyl group has 2 to 9 carbon atoms, at least one triple bond, and 1 or more heteroatoms within the parent chain ("heteroC2-9 alkynyl"). In some embodiments, a heteroalkynyl group has 2 to 8 carbon atoms, at least one triple bond, and 1 or more heteroatoms within the parent chain ("heteroC2- 8 alkynyl"). In some embodiments, a heteroalkynyl group has 2 to 7 carbon atoms, at least one triple bond, and 1 or more heteroatoms within the parent chain ("heteroC2-7 alkynyl"). In some embodiments, a heteroalkynyl group has 2 to 6 carbon atoms, at least one triple bond, and 1 or more heteroatoms within the parent chain ("heteroC2-6 alkynyl"). In some embodiments, a heteroalkynyl group has 2 to 5 carbon atoms, at least one triple bond, and 1 or 2 heteroatoms within the parent chain ("heteroC2-5 alkynyl"). In some embodiments, a heteroalkynyl group has 2 to 4 carbon atoms, at least one triple bond, and lor 2 heteroatoms
within the parent chain ("heteroC2^ alkynyl"). In some embodiments, a heteroalkynyl group has 2 to 3 carbon atoms, at least one triple bond, and 1 heteroatom within the parent chain ("heteroC2-3 alkynyl"). In some embodiments, a heteroalkynyl group has 2 to 6 carbon atoms, at least one triple bond, and 1 or 2 heteroatoms within the parent chain ("heteroC2-6 alkynyl"). Unless otherwise specified, each instance of a heteroalkynyl group is independently unsubstituted (an "unsubstituted heteroalkynyl") or substituted (a "substituted
heteroalkynyl") with one or more substituents. In certain embodiments, the heteroalkynyl group is an unsubstituted heteroC2-io alkynyl. In certain embodiments, the heteroalkynyl group is a substituted heteroC2-io alkynyl.
[00107] The term "carbocyclyl" or "carbocyclic" refers to a radical of a non-aromatic cyclic hydrocarbon group having from 3 to 14 ring carbon atoms ("C3_i4 carbocyclyl") and zero heteroatoms in the non-aromatic ring system. In some embodiments, a carbocyclyl group has 3 to 10 ring carbon atoms ("C3_io carbocyclyl"). In some embodiments, a carbocyclyl group has 3 to 8 ring carbon atoms ("C3_8 carbocyclyl"). In some embodiments, a carbocyclyl group has 3 to 7 ring carbon atoms ("C3_7 carbocyclyl"). In some embodiments, a carbocyclyl group has 3 to 6 ring carbon atoms ("C3_6 carbocyclyl"). In some embodiments, a carbocyclyl group has 4 to 6 ring carbon atoms ("C4_6 carbocyclyl"). In some embodiments, a carbocyclyl group has 5 to 6 ring carbon atoms ("Cs_6 carbocyclyl"). In some embodiments, a carbocyclyl group has 5 to 10 ring carbon atoms ("Cs-io carbocyclyl"). Exemplary C3_6 carbocyclyl groups include, without limitation, cyclopropyl (C3), cyclopropenyl (C3), cyclobutyl (C4), cyclobutenyl (C4), cyclopentyl (C5), cyclopentenyl (C5), cyclohexyl (C6), cyclohexenyl (C6), cyclohexadienyl (C6), and the like. Exemplary C3_8 carbocyclyl groups include, without limitation, the aforementioned C3_6 carbocyclyl groups as well as
cycloheptyl (C7), cycloheptenyl (C7), cycloheptadienyl (C7), cycloheptatrienyl (C7), cyclooctyl (C8), cyclooctenyl (C8), bicyclo[2.2.1]heptanyl (C7), bicyclo[2.2.2]octanyl (C8), and the like. Exemplary C3_io carbocyclyl groups include, without limitation, the
aforementioned C3_8 carbocyclyl groups as well as cyclononyl (C9), cyclononenyl (C9), cyclodecyl (C10), cyclodecenyl (C10), octahydro-lH-indenyl (C9), decahydronaphthalenyl (Cio), spiro[4.5]decanyl (C10), and the like. As the foregoing examples illustrate, in certain embodiments, the carbocyclyl group is either monocyclic ("monocyclic carbocyclyl") or polycyclic (e.g., containing a fused, bridged or spiro ring system such as a bicyclic system ("bicyclic carbocyclyl") or tricyclic system ("tricyclic carbocyclyl")) and can be saturated or can contain one or more carbon-carbon double or triple bonds. "Carbocyclyl" also includes ring systems wherein the carbocyclyl ring, as defined above, is fused with one or more aryl or
heteroaryl groups wherein the point of attachment is on the carbocyclyl ring, and in such instances, the number of carbons continue to designate the number of carbons in the carbocyclic ring system. Unless otherwise specified, each instance of a carbocyclyl group is independently unsubstituted (an "unsubstituted carbocyclyl") or substituted (a "substituted carbocyclyl") with one or more substituents. In certain embodiments, the carbocyclyl group is an unsubstituted C3_i4 carbocyclyl. In certain embodiments, the carbocyclyl group is a substituted C3_i4 carbocyclyl.
[00108] In some embodiments, "carbocyclyl" is a monocyclic, saturated carbocyclyl group having from 3 to 14 ring carbon atoms ("C3_i4 cycloalkyl"). In some embodiments, a cycloalkyl group has 3 to 10 ring carbon atoms ("C3_io cycloalkyl"). In some embodiments, a cycloalkyl group has 3 to 8 ring carbon atoms ("C3_8 cycloalkyl"). In some embodiments, a cycloalkyl group has 3 to 6 ring carbon atoms ("C3_6 cycloalkyl"). In some embodiments, a cycloalkyl group has 4 to 6 ring carbon atoms ("C4_6 cycloalkyl"). In some embodiments, a cycloalkyl group has 5 to 6 ring carbon atoms ("Cs_6 cycloalkyl"). In some embodiments, a cycloalkyl group has 5 to 10 ring carbon atoms ("Cs-io cycloalkyl"). Examples of Cs_6 cycloalkyl groups include cyclopentyl (C5) and cyclohexyl (C5). Examples of C3_6 cycloalkyl groups include the aforementioned Cs_6 cycloalkyl groups as well as cyclopropyl (C3) and cyclobutyl (C4). Examples of C3_8 cycloalkyl groups include the aforementioned C3_6 cycloalkyl groups as well as cycloheptyl (C7) and cyclooctyl (C8). Unless otherwise specified, each instance of a cycloalkyl group is independently unsubstituted (an "unsubstituted cycloalkyl") or substituted (a "substituted cycloalkyl") with one or more substituents. In certain embodiments, the cycloalkyl group is an unsubstituted C3_i4 cycloalkyl. In certain embodiments, the cycloalkyl group is a substituted C3_i4 cycloalkyl.
[00109] The term "heterocyclyl" or "heterocyclic" refers to a radical of a 3- to 14- membered non-aromatic ring system having ring carbon atoms and 1 to 4 ring heteroatoms, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur ("3-14 membered heterocyclyl"). In heterocyclyl groups that contain one or more nitrogen atoms, the point of attachment can be a carbon or nitrogen atom, as valency permits. A heterocyclyl group can either be monocyclic ("monocyclic heterocyclyl") or polycyclic (e.g., a fused, bridged or spiro ring system such as a bicyclic system ("bicyclic heterocyclyl") or tricyclic system ("tricyclic heterocyclyl")), and can be saturated or can contain one or more carbon- carbon double or triple bonds. Heterocyclyl polycyclic ring systems can include one or more heteroatoms in one or both rings. "Heterocyclyl" also includes ring systems wherein the heterocyclyl ring, as defined above, is fused with one or more carbocyclyl groups wherein the
point of attachment is either on the carbocyclyl or heterocyclyl ring, or ring systems wherein the heterocyclyl ring, as defined above, is fused with one or more aryl or heteroaryl groups, wherein the point of attachment is on the heterocyclyl ring, and in such instances, the number of ring members continue to designate the number of ring members in the heterocyclyl ring system. Unless otherwise specified, each instance of heterocyclyl is independently unsubstituted (an "unsubstituted heterocyclyl") or substituted (a "substituted heterocyclyl") with one or more substituents. In certain embodiments, the heterocyclyl group is an unsubstituted 3-14 membered heterocyclyl. In certain embodiments, the heterocyclyl group is a substituted 3-14 membered heterocyclyl.
[00110] In some embodiments, a heterocyclyl group is a 5-10 membered non-aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur ("5-10 membered heterocyclyl"). In some embodiments, a heterocyclyl group is a 5-8 membered non-aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms, wherein each heteroatom is
independently selected from nitrogen, oxygen, and sulfur ("5-8 membered heterocyclyl"). In some embodiments, a heterocyclyl group is a 5-6 membered non-aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms, wherein each heteroatom is
independently selected from nitrogen, oxygen, and sulfur ("5-6 membered heterocyclyl"). In some embodiments, the 5-6 membered heterocyclyl has 1-3 ring heteroatoms selected from nitrogen, oxygen, and sulfur. In some embodiments, the 5-6 membered heterocyclyl has 1-2 ring heteroatoms selected from nitrogen, oxygen, and sulfur. In some embodiments, the 5-6 membered heterocyclyl has 1 ring heteroatom selected from nitrogen, oxygen, and sulfur.
[00111] Exemplary 3-membered heterocyclyl groups containing 1 heteroatom include, without limitation, azirdinyl, oxiranyl, and thiiranyl. Exemplary 4-membered heterocyclyl groups containing 1 heteroatom include, without limitation, azetidinyl, oxetanyl, and thietanyl. Exemplary 5-membered heterocyclyl groups containing 1 heteroatom include, without limitation, tetrahydrofuranyl, dihydrofuranyl, tetrahydrothiophenyl,
dihydrothiophenyl, pyrrolidinyl, dihydropyrrolyl, and pyrrolyl-2,5-dione. Exemplary 5- membered heterocyclyl groups containing 2 heteroatoms include, without limitation, dioxolanyl, oxathiolanyl and dithiolanyl. Exemplary 5-membered heterocyclyl groups containing 3 heteroatoms include, without limitation, triazolinyl, oxadiazolinyl, and thiadiazolinyl. Exemplary 6-membered heterocyclyl groups containing 1 heteroatom include, without limitation, piperidinyl, tetrahydropyranyl, dihydropyridinyl, and thianyl. Exemplary 6-membered heterocyclyl groups containing 2 heteroatoms include, without limitation,
piperazinyl, morpholinyl, dithianyl, and dioxanyl. Exemplary 6-membered heterocyclyl groups containing 2 heteroatoms include, without limitation, triazinanyl. Exemplary 7- membered heterocyclyl groups containing 1 heteroatom include, without limitation, azepanyl, oxepanyl and thiepanyl. Exemplary 8-membered heterocyclyl groups containing 1 heteroatom include, without limitation, azocanyl, oxecanyl and thiocanyl. Exemplary bicyclic heterocyclyl groups include, without limitation, indolinyl, isoindolinyl, dihydrobenzofuranyl, dihydrobenzothienyl, tetrahydrobenzothienyl, tetrahydrobenzofuranyl, tetrahydroindolyl, tetrahydroquinolinyl, tetrahydroisoquinolinyl, decahydroquinolinyl, decahydroisoquinolinyl, octahydrochromenyl, octahydroisochromenyl, decahydronaphthyridinyl, decahydro-1,8- naphthyridinyl, octahydropyrrolo[3,2-b]pyrrole, indolinyl, phthalimidyl, naphthalimidyl, chromanyl, chromenyl, lH-benzo[e][l,4]diazepinyl, l,4,5,7-tetrahydropyrano[3,4- b]pyrrolyl, 5,6-dihydro-4H-furo[3,2-b]pyrrolyl, 6,7-dihydro-5H-furo[3,2-b]pyranyl, 5,7- dihydro-4H-thieno[2,3-c]pyranyl, 2,3-dihydro-lH-pyrrolo[2,3-b]pyridinyl, 2,3- dihydrofuro[2,3-b]pyridinyl, 4,5,6,7-tetrahydro-lH-pyrrolo[2,3-b]pyridinyl, 4,5,6,7-tetra- hydrofuro[3,2-c]pyridinyl, 4,5,6,7-tetrahydrothieno[3,2-b]pyridinyl, l,2,3,4-tetrahydro-l,6- naphthyridinyl, and the like.
[00112] The term "aryl" refers to a radical of a monocyclic or polycyclic (e.g., bicyclic or tricyclic) 4n+2 aromatic ring system (e.g., having 6, 10, or 14 π electrons shared in a cyclic array) having 6-14 ring carbon atoms and zero heteroatoms provided in the aromatic ring system ("C6 i4 aryl"). In some embodiments, an aryl group has 6 ring carbon atoms ("C6 aryl"; e.g., phenyl). In some embodiments, an aryl group has 10 ring carbon atoms ("Cio aryl"; e.g., naphthyl such as 1-naphthyl and 2-naphthyl). In some embodiments, an aryl group has 14 ring carbon atoms ("Ci4 aryl"; e.g., anthracyl). "Aryl" also includes ring systems wherein the aryl ring, as defined above, is fused with one or more carbocyclyl or heterocyclyl groups wherein the radical or point of attachment is on the aryl ring, and in such instances, the number of carbon atoms continue to designate the number of carbon atoms in the aryl ring system. Unless otherwise specified, each instance of an aryl group is
independently unsubstituted (an "unsubstituted aryl") or substituted (a "substituted aryl") with one or more substituents. In certain embodiments, the aryl group is an unsubstituted C6- i4 aryl. In certain embodiments, the aryl group is a substituted C6-i4 aryl.
[00113] The term "heteroaryl" refers to a radical of a 5-14 membered monocyclic or polycyclic (e.g., bicyclic, tricyclic) 4n+2 aromatic ring system (e.g., having 6, 10, or 14 π electrons shared in a cyclic array) having ring carbon atoms and 1-4 ring heteroatoms
rovided in the aromatic ring system, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur ("5-14 membered heteroaryl"). In heteroaryl groups that contain one or more nitrogen atoms, the point of attachment can be a carbon or nitrogen atom, as valency permits. Heteroaryl polycyclic ring systems can include one or more heteroatoms in one or both rings. "Heteroaryl" includes ring systems wherein the heteroaryl ring, as defined above, is fused with one or more carbocyclyl or heterocyclyl groups wherein the point of attachment is on the heteroaryl ring, and in such instances, the number of ring members continue to designate the number of ring members in the heteroaryl ring system. "Heteroaryl" also includes ring systems wherein the heteroaryl ring, as defined above, is fused with one or more aryl groups wherein the point of attachment is either on the aryl or heteroaryl ring, and in such instances, the number of ring members designates the number of ring members in the fused polycyclic (aryl/heteroaryl) ring system. Polycyclic heteroaryl groups wherein one ring does not contain a heteroatom (e.g., indolyl, quinolinyl, carbazolyl, and the like) the point of attachment can be on either ring, i.e., either the ring bearing a heteroatom (e.g., 2-indolyl) or the ring that does not contain a heteroatom (e.g., 5-indolyl).
[00114] In some embodiments, a heteroaryl group is a 5-10 membered aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms provided in the aromatic ring system, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur ("5-10 membered heteroaryl"). In some embodiments, a heteroaryl group is a 5-8 membered aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms provided in the aromatic ring system, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur ("5-8 membered heteroaryl"). In some embodiments, a heteroaryl group is a 5-6 membered aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms provided in the aromatic ring system, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur ("5-6 membered heteroaryl"). In some embodiments, the 5-6 membered heteroaryl has 1-3 ring heteroatoms selected from nitrogen, oxygen, and sulfur. In some embodiments, the 5-6 membered heteroaryl has 1-2 ring heteroatoms selected from nitrogen, oxygen, and sulfur. In some embodiments, the 5-6 membered heteroaryl has 1 ring heteroatom selected from nitrogen, oxygen, and sulfur. Unless otherwise specified, each instance of a heteroaryl group is independently unsubstituted (an
"unsubstituted heteroaryl") or substituted (a "substituted heteroaryl") with one or more substituents. In certain embodiments, the heteroaryl group is an unsubstituted 5-14 membered heteroaryl. In certain embodiments, the heteroaryl group is a substituted 5-14 membered heteroaryl.
[00115] Exemplary 5-membered heteroaryl groups containing 1 heteroatom include, without limitation, pyrrolyl, furanyl, and thiophenyl. Exemplary 5-membered heteroaryl groups containing 2 heteroatoms include, without limitation, imidazolyl, pyrazolyl, oxazolyl, isoxazolyl, thiazolyl, and isothiazolyl. Exemplary 5-membered heteroaryl groups containing 3 heteroatoms include, without limitation, triazolyl, oxadiazolyl, and thiadiazolyl. Exemplary
5- membered heteroaryl groups containing 4 heteroatoms include, without limitation, tetrazolyl. Exemplary 6-membered heteroaryl groups containing 1 heteroatom include, without limitation, pyridinyl. Exemplary 6-membered heteroaryl groups containing 2 heteroatoms include, without limitation, pyridazinyl, pyrimidinyl, and pyrazinyl. Exemplary
6- membered heteroaryl groups containing 3 or 4 heteroatoms include, without limitation, triazinyl and tetrazinyl, respectively. Exemplary 7-membered heteroaryl groups containing 1 heteroatom include, without limitation, azepinyl, oxepinyl, and thiepinyl. Exemplary 5,6- bicyclic heteroaryl groups include, without limitation, indolyl, isoindolyl, indazolyl, benzotriazolyl, benzothiophenyl, isobenzothiophenyl, benzofuranyl, benzoisofuranyl, benzimidazolyl, benzoxazolyl, benzisoxazolyl, benzoxadiazolyl, benzthiazolyl,
benzisothiazolyl, benzthiadiazolyl, indolizinyl, and purinyl. Exemplary 6,6-bicyclic heteroaryl groups include, without limitation, naphthyridinyl, pteridinyl, quinolinyl, isoquinolinyl, cinnolinyl, quinoxalinyl, phthalazinyl, and quinazolinyl. Exemplary tricyclic heteroaryl groups include, without limitation, phenanthridinyl, dibenzofuranyl, carbazolyl, acridinyl, phenothiazinyl, phenoxazinyl and phenazinyl.
[00116] The term "unsaturated" or "partially unsaturated" refers to a moiety that includes at least one double or triple bond.
[00117] Affixing the suffix "-ene" to a group indicates the group is a divalent moiety, e.g. , alkylene is the divalent moiety of alkyl, alkenylene is the divalent moiety of alkenyl, alkynylene is the divalent moiety of alkynyl, heteroalkylene is the divalent moiety of heteroalkyl, heteroalkenylene is the divalent moiety of heteroalkenyl, heteroalkynylene is the divalent moiety of heteroalkynyl, carbocyclylene is the divalent moiety of carbocyclyl, heterocyclylene is the divalent moiety of heterocyclyl, arylene is the divalent moiety of aryl, and heteroarylene is the divalent moiety of heteroaryl.
[00118] A group is optionally substituted unless expressly provided otherwise. In certain embodiments, alkyl, alkenyl, alkynyl, heteroalkyl, heteroalkenyl, heteroalkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl groups are optionally substituted. "Optionally substituted" refers to a group which may be substituted or unsubstituted (e.g., "substituted" or
"unsubstituted" alkyl, "substituted" or "unsubstituted" alkenyl, "substituted" or
"unsubstituted" alkynyl, "substituted" or "unsubstituted" heteroalkyl, "substituted" or "unsubstituted" heteroalkenyl, "substituted" or "unsubstituted" heteroalkynyl, "substituted" or "unsubstituted" carbocyclyl, "substituted" or "unsubstituted" heterocyclyl, "substituted" or "unsubstituted" aryl or "substituted" or "unsubstituted" heteroaryl group). In general, the term "substituted" means that at least one hydrogen present on a group is replaced with a permissible substituent, e.g., a substituent which upon substitution results in a stable compound, e.g., a compound which does not spontaneously undergo transformation such as by rearrangement, cyclization, elimination, or other reaction. Unless otherwise indicated, a "substituted" group has a substituent at one or more substitutable positions of the group, and when more than one position in any given structure is substituted, the substituent is either the same or different at each position. The term "substituted" is contemplated to include substitution with all permissible substituents of organic compounds, and includes any of the substituents described herein that results in the formation of a stable compound. The present invention contemplates any and all such combinations in order to arrive at a stable
compound. For purposes of this invention, heteroatoms such as nitrogen may have hydrogen substituents and/or any suitable substituent as described herein which satisfy the valencies of the heteroatoms and results in the formation of a stable moiety. The invention is not intended to be limited in any manner by the exemplary substituents described herein.
[00119] The term "halo" or "halogen" refers to fluorine (fluoro, -F), chlorine (chloro, -CI), bromine (bromo, -Br), or iodine (iodo, -I).
[00120] The term "amino" refers to the group -NH2. The term "substituted amino," by extension, refers to a monosubstituted amino, a disubstituted amino, or a trisubstituted amino. In certain embodiments, the "substituted amino" is a monosubstituted amino or a
disubstituted amino group.
[00121] The term "monosubstituted amino" refers to an amino group wherein the nitrogen atom directly attached to the parent molecule is substituted with one hydrogen and one group other than hydrogen, and includes groups selected from -NH(Rbb), -NHC(=0)Raa, - NHC02Raa, -NHC(=0)N(Rbb)2, -NHC(=NRbb)N(Rbb)2, -NHS02Raa, -NHP(=0)(ORcc)2, and -NHP(=0)(NRbb)2, wherein Raa, Rbb and Rcc are as defined herein, and wherein Rbb of the group -NH(Rbb) is not hydrogen.
[00122] The term "disubstituted amino" refers to an amino group wherein the nitrogen atom directly attached to the parent molecule is substituted with two groups other than hydrogen, and includes groups selected from -N(Rbb)2, -NRbb C(=0)Raa, -NRbbC02Raa, - NRbbC(=0)N(Rbb)2, -NRbbC(=NRbb)N(Rbb)2, -NRbbS02Raa, -NRbbP(=0)(ORcc)2, and -
NRbbP(=0)(NRbb)2, wherein Raa, Rbb, and Rcc are as defined herein, with the proviso that the nitrogen atom directly attached to the parent molecule is not substituted with hydrogen.
[00123] The term "trisubstituted amino" refers to an amino group wherein the nitrogen atom directly attached to the parent molecule is substituted with three groups, and includes groups selected from -N(Rbb)3 and -N(Rbb)3 +X~, wherein Rbb and X" are as defined herein.
[00124] In certain embodiments, the substituent present on the nitrogen atom is an nitrogen protecting group (also referred to herein as an "amino protecting group"). Nitrogen protecting groups include, but are not limited to, -OH, -OR"*, -N(RCC)2, -C(=0)Raa, -C(=0)N(Rcc)2, - CC^R^, -S02Raa, -C(=NRcc)Raa, -C(=NRcc)ORaa, -C(=NRCC)N(RCC)2, -S02N(Rcc)2, -S02Rcc, -S02ORcc, -SORaa, -C(=S)N(RCC)2, -C(=0)SRcc, -C(=S)SRCC, Ci_i0 alkyl (e.g., aralkyl, heteroaralkyl), C2-io alkenyl, C2-io alkynyl, heteroCno alkyl, heteroC2-io alkenyl, heteroC2-io alkynyl, C3_io carbocyclyl, 3-14 membered heterocyclyl, C6-i4 aryl, and 5-14 membered heteroaryl groups, wherein each alkyl, alkenyl, alkynyl, heteroalkyl, heteroalkenyl, heteroalkynyl, carbocyclyl, heterocyclyl, aralkyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 Rdd groups, and wherein Raa, Rbb, Rcc and Rdd are as defined herein. Nitrogen protecting groups are well known in the art and include those described in detail in Protecting Groups in Organic Synthesis, T. W. Greene and P. G. M. Wuts, 3 edition, John Wiley & Sons, 1999, incorporated herein by reference.
[00125] For example, nitrogen protecting groups such as amide groups (e.g., -C(=0)Raa) include, but are not limited to, formamide, acetamide, chloroacetamide, trichloroacetamide, trifluoroacetamide, phenylacetamide, 3-phenylpropanamide, picolinamide, 3- pyridylcarboxamide, N-benzoylphenylalanyl derivative, benzamide, /?-phenylbenzamide, o- nitophenylacetamide, o-nitrophenoxyacetamide, acetoacetamide, (Ν'- dithiobenzyloxyacylamino)acetamide, 3-(p-hydroxyphenyl)propanamide, 3-(o- nitrophenyl)propanamide, 2-methyl-2-(o-nitrophenoxy)propanamide, 2-methyl-2-(o- phenylazophenoxy)propanamide, 4-chlorobutanamide, 3-methyl-3-nitrobutanamide, o- nitrocinnamide, N-acetylmethionine derivative, o-nitrobenzamide and o- (benzoyloxymethyl)benzamide.
[00126] Nitrogen protecting groups such as carbamate groups (e.g., -C(=0)ORaa) include, but are not limited to, methyl carbamate, ethyl carbamante, 9-fluorenylmethyl carbamate (Fmoc), 9-(2-sulfo)fluorenylmethyl carbamate, 9-(2,7-dibromo)fluoroenylmethyl carbamate, 2,7-di-i-butyl-[9-( 10, 10-dioxo-lO, 10, 10, 10-tetrahydrothioxanthyl)]methyl carbamate (DBD-Tmoc), 4-methoxyphenacyl carbamate (Phenoc), 2,2,2-trichloroethyl carbamate (Troc), 2-trimethylsilylethyl carbamate (Teoc), 2-phenylethyl carbamate (hZ), 1-
(l-adamantyl)-l-methylethyl carbamate (Adpoc), l, l-dimethyl-2-haloethyl carbamate, l,l-dimethyl-2,2-dibromoethyl carbamate (DB-i-BOC), l,l-dimethyl-2,2,2-trichloroethyl carbamate (TCBOC), l-methyl-l-(4-biphenylyl)ethyl carbamate (Bpoc), 1— (3,5— di— f— butylphenyl)-l-methylethyl carbamate (i-Bumeoc), 2-(2'- and 4'-pyridyl)ethyl carbamate (Pyoc), 2-(N,N-dicyclohexylcarboxamido)ethyl carbamate, i-butyl carbamate (BOC or Boc), 1-adamantyl carbamate (Adoc), vinyl carbamate (Voc), allyl carbamate (Alloc), 1- isopropylallyl carbamate (Ipaoc), cinnamyl carbamate (Coc), 4-nitrocinnamyl carbamate (Noc), 8-quinolyl carbamate, N-hydroxypiperidinyl carbamate, alkyldithio carbamate, benzyl carbamate (Cbz), /?-methoxybenzyl carbamate (Moz), /?-nitobenzyl carbamate, p- bromobenzyl carbamate, /?-chlorobenzyl carbamate, 2,4-dichlorobenzyl carbamate, 4- methylsulfinylbenzyl carbamate (Msz), 9-anthrylmethyl carbamate, diphenylmethyl carbamate, 2-methylthioethyl carbamate, 2-methylsulfonylethyl carbamate, 2-(p- toluenesulfonyl)ethyl carbamate, [2-(l,3-dithianyl)]methyl carbamate (Dmoc), 4- methylthiophenyl carbamate (Mtpc), 2,4-dimethylthiophenyl carbamate (Bmpc), 2- phosphonioethyl carbamate (Peoc), 2-triphenylphosphonioisopropyl carbamate (Ppoc), 1, 1- dimethyl-2-cyanoethyl carbamate, m-chloro-p-acyloxybenzyl carbamate, p- (dihydroxyboryl)benzyl carbamate, 5-benzisoxazolylmethyl carbamate, 2-(trifluoromethyl)- 6-chromonylmethyl carbamate (Tcroc), m-nitrophenyl carbamate, 3,5-dimethoxybenzyl carbamate, o-nitrobenzyl carbamate, 3,4-dimethoxy-6-nitrobenzyl carbamate, phenyl(o- nitrophenyl)methyl carbamate, i-amyl carbamate, S-benzyl thiocarbamate, /?-cyanobenzyl carbamate, cyclobutyl carbamate, cyclohexyl carbamate, cyclopentyl carbamate,
cyclopropylmethyl carbamate, /?-decyloxybenzyl carbamate, 2,2-dimethoxyacylvinyl carbamate, o-(N,N-dimethylcarboxamido)benzyl carbamate, l,l-dimethyl-3-(N,N- dimethylcarboxamido)propyl carbamate, 1, 1-dimethylpropynyl carbamate, di(2- pyridyl)methyl carbamate, 2-furanylmethyl carbamate, 2-iodoethyl carbamate, isoborynl carbamate, isobutyl carbamate, isonicotinyl carbamate, p-(p '-methoxyphenylazo)benzyl carbamate, 1-methylcyclobutyl carbamate, 1-methylcyclohexyl carbamate, 1-methyl-l- cyclopropylmethyl carbamate, l-methyl-l-(3,5-dimethoxyphenyl)ethyl carbamate, 1- methyl-l-(/?-phenylazophenyl)ethyl carbamate, 1 -methyl- 1-phenylethyl carbamate, 1- methyl-l-(4-pyridyl)ethyl carbamate, phenyl carbamate, /?-(phenylazo)benzyl carbamate, 2,4,6-tri-i-butylphenyl carbamate, 4-(trimethylammonium)benzyl carbamate, and 2,4,6- trimethylbenzyl carbamate.
[00127] Nitrogen protecting groups such as sulfonamide groups (e.g., -S(=0)2Raa) include, but are not limited to, /?-toluenesulfonamide (Ts), benzenesulfonamide, 2,3,6,-trimethyl-4-
methoxybenzenesulfonamide (Mtr), 2,4,6-trimethoxybenzenesulfonamide (Mtb), 2,6- dimethyl-4-methoxybenzenesulfonamide (Pme), 2,3,5, 6-tetramethyl-4- methoxybenzenesulfonamide (Mte), 4-methoxybenzenesulfonamide (Mbs), 2,4,6- trimethylbenzenesulfonamide (Mts), 2,6-dimethoxy-4-methylbenzenesulfonamide (iMds), 2,2,5,7, 8-pentamethylchroman-6-sulfonamide (Pmc), methanesulfonamide (Ms), β- trimethylsilylethanesulfonamide (SES), 9-anthracenesulfonamide, 4-(4',8'- dimethoxynaphthylmethyl)benzenesulfonamide (DNMB S ), benzylsulfonamide,
trifluoromethylsulfonamide, and phenacylsulfonamide.
[00128] Other nitrogen protecting groups include, but are not limited to, phenothiazinyl- (lO)-acyl derivative, N'-p-toluenesulfonylaminoacyl derivative, N'-phenylaminothioacyl derivative, N-benzoylphenylalanyl derivative, N-acetylmethionine derivative, 4,5-diphenyl- 3-oxazolin-2-one, N-phthalimide, N-dithiasuccinimide (Dts), N-2,3-diphenylmaleimide, N-2,5-dimethylpyrrole, N-l,l,4,4-tetramethyldisilylazacyclopentane adduct (STABASE), 5-substituted l,3-dimethyl-l,3,5-triazacyclohexan-2-one, 5-substituted 1,3-dibenzyl- l,3,5-triazacyclohexan-2-one, 1-substituted 3,5-dinitro-4-pyridone, N-methylamine, N- allylamine, N-[2-(trimethylsilyl)ethoxy]methylamine (SEM), N-3-acetoxypropylamine, N- (l-isopropyl-4-nitro-2-oxo-3-pyroolin-3-yl)amine, quaternary ammonium salts, N- benzylamine, N-di(4-methoxyphenyl)methylamine, N-5-dibenzosuberylamine, N- triphenylmethylamine (Tr), N-[(4-methoxyphenyl)diphenylmethyl] amine (MMTr), N-9- phenylfluorenylamine (PhF), N-2,7-dichloro-9-f uorenylmethyleneamine, N- ferrocenylmethylamino (Fcm), N-2-picolylamino N'-oxide, N-1,1- dimethylthiomethyleneamine, N-benzylideneamine, N-p-methoxybenzylideneamine, N- diphenylmethyleneamine, N-[(2-pyridyl)mesityl]methyleneamine, N-(N',N'- dimethylaminomethylene)amine, N,N '-isopropylidenediamine, N-p-nitrobenzylideneamine, N-salicylideneamine, N-5-chlorosalicylideneamine, N-(5-chloro-2- hydroxyphenyl)phenylmethyleneamine, N-cyclohexylideneamine, N-(5,5-dimethyl-3-oxo- l-cyclohexenyl)amine, N-borane derivative, N-diphenylborinic acid derivative, N- [phenyl(pentaacylchromium- or tungsten)acyl] amine, N-copper chelate, N-zinc chelate, N- nitroamine, N-nitrosoamine, amine N-oxide, diphenylphosphinamide (Dpp),
dimethylthiophosphinamide (Mpt), diphenylthiophosphinamide (Ppt), dialkyl
phosphoramidates, dibenzyl phosphoramidate, diphenyl phosphoramidate,
benzenesulfenamide, o-nitrobenzenesulfenamide (Nps), 2,4-dinitrobenzenesulfenamide, pentachlorobenzenesulfenamide, 2-nitro-4-methoxybenzenesulfenamide,
triphenylmethylsulfenamide, and 3-nitropyridinesulfenamide (Npys).
[00129] In certain embodiments, the substituent present on an oxygen atom is an oxygen protecting group (also referred to herein as an "hydroxyl protecting group"). Oxygen protecting groups include, but are not limited to, -Raa, -N(Rbb)2, -C(=0)SRaa, -C(=0)Raa, - C02Raa, -C(=0)N(Rbb)2, -C(=NRbb)Raa, -C(=NRbb)ORaa, -C(=NRbb)N(Rbb)2, -S(=0)Raa, - S02Raa, -Si(Raa)3, -P(Rcc)2, -P(RCC)3, -Ρ(=0)^, -P(=0)(Raa)2, -P(=0)(ORcc)2, - P(=0)2N(Rbb)2, and -P(=0)(NRbb)2, wherein Raa, Rbb, and Rcc are as defined herein. Oxygen protecting groups are well known in the art and include those described in detail in Protecting Groups in Organic Synthesis, T. W. Greene and P. G. M. Wuts, 3 edition, John Wiley & Sons, 1999, incorporated herein by reference.
[00130] Exemplary oxygen protecting groups include, but are not limited to, methyl, methoxylmethyl (MOM), methylthiomethyl (MTM), i-butylthiomethyl,
(phenyldimethylsilyl)methoxymethyl (SMOM), benzyloxymethyl (BOM), /?- methoxybenzyloxymethyl (PMBM), (4-methoxyphenoxy)methyl (p-AOM), guaiacolmethyl (GUM), i-butoxymethyl, 4-pentenyloxymethyl (POM), siloxymethyl, 2- methoxyethoxymethyl (MEM), 2,2,2-trichloroethoxymethyl, bis(2-chloroethoxy)methyl, 2- (trimethylsilyl)ethoxymethyl (SEMOR), tetrahydropyranyl (THP), 3- bromotetrahydropyranyl, tetrahydrothiopyranyl, 1-methoxycyclohexyl, 4- methoxytetrahydropyranyl (MTHP), 4-methoxytetrahydrothiopyranyl, 4- methoxytetrahydrothiopyranyl S ,S-dioxide, l-[(2-chloro-4-methyl)phenyl]-4- methoxypiperidin-4-yl (CTMP), l,4-dioxan-2-yl, tetrahydrofuranyl, tetrahydrothiofuranyl, 2,3,3a,4,5,6,7,7a-octahydro-7,8,8-trimethyl-4,7-methanobenzofuran-2-yl, 1-ethoxyethyl, l-(2-chloroethoxy)ethyl, 1-methyl-l-methoxyethyl, 1-methyl-l-benzyloxyethyl, 1- methyl-l-benzyloxy-2-fluoroethyl, 2,2,2-trichloroethyl, 2-trimethylsilylethyl, 2- (phenylselenyl)ethyl, i-butyl, allyl, /?-chlorophenyl, /?-methoxyphenyl, 2,4-dinitrophenyl, benzyl (Bn), /?-methoxybenzyl, 3,4-dimethoxybenzyl, o-nitrobenzyl, /?-nitrobenzyl, p- halobenzyl, 2,6-dichlorobenzyl, /?-cyanobenzyl, /?-phenylbenzyl, 2-picolyl, 4-picolyl, 3- methyl-2-picolyl N-oxido, diphenylmethyl, p,p '-dinitrobenzhydryl, 5-dibenzosuberyl, triphenylmethyl, a-naphthyldiphenylmethyl, /?-methoxyphenyldiphenylmethyl, di(p- methoxyphenyl)phenylmethyl, tri( ?-methoxyphenyl)methyl, 4-(4'- bromophenacyloxyphenyl)diphenylmethyl, 4,4',4"-tris(4,5- dichlorophthalimidophenyl)methyl, 4,4',4"-tris(levulinoyloxyphenyl)methyl, 4,4',4"- tris(benzoyloxyphenyl)methyl, 3-(imidazol-l-yl)bis(4',4"-dimethoxyphenyl)methyl, 1,1- bis(4-methoxyphenyl)-l'-pyrenylmethyl, 9-anthryl, 9-(9-phenyl)xanthenyl, 9-(9-phenyl- 10-oxo)anthryl, l,3-benzodithiolan-2-yl, benzisothiazolyl S,S-dioxido, trimethylsilyl
(TMS), triethylsilyl (TES), triisopropylsilyl (TIPS), dimethylisopropylsilyl (IPDMS), diethylisopropylsilyl (DEIPS), dimethylthexylsilyl, i-butyldimethylsilyl (TBDMS), t- butyldiphenylsilyl (TBDPS), tribenzylsilyl, tri-p-xylylsilyl, triphenylsilyl,
diphenylmethylsilyl (DPMS), i-butylmethoxyphenylsilyl (TBMPS), formate,
benzoylformate, acetate, chloroacetate, dichloroacetate, trichloroacetate, trifluoroacetate, methoxyacetate, triphenylmethoxyacetate, phenoxyacetate, /?-chlorophenoxyacetate, 3- phenylpropionate, 4-oxopentanoate (levulinate), 4,4-(ethylenedithio)pentanoate
(levulinoyldithioacetal), pivaloate, adamantoate, crotonate, 4-methoxycrotonate, benzoate, p- phenylbenzoate, 2,4,6-trimethylbenzoate (mesitoate), methyl carbonate, 9-fluorenylmethyl carbonate (Fmoc), ethyl carbonate, 2,2,2-trichloroethyl carbonate (Troc), 2- (trimethylsilyl)ethyl carbonate (TMSEC), 2-(phenylsulfonyl) ethyl carbonate (Psec), 2- (triphenylphosphonio) ethyl carbonate (Peoc), isobutyl carbonate, vinyl carbonate, allyl carbonate, i-butyl carbonate (BOC or Boc), /?-nitrophenyl carbonate, benzyl carbonate, p- methoxybenzyl carbonate, 3,4-dimethoxybenzyl carbonate, o-nitrobenzyl carbonate, p- nitrobenzyl carbonate, S-benzyl thiocarbonate, 4-ethoxy-l-napththyl carbonate, methyl dithiocarbonate, 2-iodobenzoate, 4-azidobutyrate, 4-nitro-4-methylpentanoate, o- (dibromomethyl)benzoate, 2-formylbenzenesulfonate, 2-(methylthiomethoxy)ethyl, 4- (methylthiomethoxy)butyrate, 2-(methylthiomethoxymethyl)benzoate, 2,6-dichloro-4- methylphenoxyacetate, 2,6-dichloro-4-( 1 , 1 ,3 ,3-tetramethylbutyl)phenoxyacetate, 2,4- bis(l,l-dimethylpropyl)phenoxyacetate, chlorodiphenylacetate, isobutyrate, monosuccinoate, (E)-2-methyl-2-butenoate, o-(methoxyacyl)benzoate, a-naphthoate, nitrate, alkyl
N,N,N',N'-tetramethylphosphorodiamidate, alkyl N-phenylcarbamate, borate,
dimethylphosphinothioyl, alkyl 2,4-dinitrophenylsulfenate, sulfate, methanesulfonate (mesylate), benzylsulfonate, and tosylate (Ts).
[00131] In certain embodiments, the substituent present on an sulfur atom is a sulfur protecting group (also referred to as a "thiol protecting group"). Sulfur protecting groups include, but are not limited to, -Raa, -N(Rbb)2, -C(=0)SRaa, -C(=0)Raa, -C02Raa, - C(=0)N(Rbb)2, -C(=NRbb)Raa, -C(=NRbb)ORaa, -C(=NRbb)N(Rbb)2, -S(=0)Raa, -S02Raa, - Si(Raa)3 -P(RCC)2, -P(RCC) , -P(=0)2Raa, -P(=0)(Raa)2, -P(=0)(ORcc)2, -P(=0)2N(Rbb)2, and - P(=0)(NRbb)2, wherein Raa, Rbb, and Rcc are as defined herein. Sulfur protecting groups are well known in the art and include those described in detail in Protecting Groups in Organic Synthesis, T. W. Greene and P. G. M. Wuts, 3rd edition, John Wiley & Sons, 1999, incorporated herein by reference.
[00132] The terms "aminooxy," or "aminooxy group," are used interchangeably herein and refer to functional groups having the general formula: NH2 ^ wherein R31 is optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, optionally substituted heteroaryl, or optionally substituted heterocyclyl. In some embodiments, R 31 is an amino acid, wherein the point of attachment for the oxygen is on the side chain of the amino acid. In certain embodimetns, the amino acid is withinin a polypeptide.
[00133] The term "tautomers" or "tautomeric" refers to two or more interconvertable compounds resulting from at least one formal migration of a hydrogen atom and at least one change in valency (e.g., a single bond to a double bond, a triple bond to a single bond, or vice versa). The exact ratio of the tautomers depends on several factors, including temperature, solvent, and pH. Tautomerizations (i.e., the reaction providing a tautomeric pair) may catalyzed by acid or base. Exemplary tautomerizations include keto-to-enol, amide-to-imide, lactam-to-lactim, enamine-to-imine, and enamine-to-(a different enamine) tautomerizations.
[00134] It is also to be understood that compounds that have the same molecular formula but differ in the nature or sequence of bonding of their atoms or the arrangement of their atoms in space are termed "isomers". Isomers that differ in the arrangement of their atoms in space are termed "stereoisomers".
[00135] Stereoisomers that are not mirror images of one another are termed
"diastereomers" and those that are non-superimposable mirror images of each other are termed "enantiomers". When a compound has an asymmetric center, for example, it is bonded to four different groups, a pair of enantiomers is possible. An enantiomer can be characterized by the absolute configuration of its asymmetric center and is described by the R- and S-sequencing rules of Cahn and Prelog, or by the manner in which the molecule rotates the plane of polarized light and designated as dextrorotatory or levorotatory (i.e., as (+) or (-)-isomers respectively). A chiral compound can exist as either individual enantiomer or as a mixture thereof. A mixture containing equal proportions of the enantiomers is called a "racemic mixture".
[00136] The terms "carbonyl," or "carbonyl group," are used interchangeably herein and refer to functional groups composed of a carbon atom double-bonded to any oxygen atom.
Carbonyls have the general formula: R
wherein each of R and R independently represents hydroxyl, optionally substituted amino, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, optionally substituted heteroaryl, or optionally substituted heterocyclyl. Examples of carbonyls include, but are not limited to, aldehydes, ketones, carboxylic acids, esters, amides, enones, acyl halides, acid anhydrides, and imides. In some embodiments, a carbonyl- containing compound refers to a compound having an aldehyde group, or a compound capable of forming an aldehyde group through isomerization. For example, in some embodiments, certain sugars (e.g., reducing sugars) such as glucose, form aldehydes through isomerization. A sugar is classified as a reducing sugar if it has an open-chain form with an aldehyde group or a free hemiacetal group. Monosaccharides which contain an aldehyde group are known as aldoses, and those with a ketone group are known as ketoses. The aldehyde can be oxidized via a redox reaction in which another compound is reduced. Thus, a reducing sugar is one that is capable of reducing certain chemicals. Sugars with ketone groups in their open chain form are capable of isomerizing via a series of tautomeric shifts to produce an aldehyde group in solution. Therefore, ketone-bearing sugars like fructose are considered reducing sugars but it is the isomer containing an aldehyde group which is reducing since ketones cannot be oxidized without decomposition of the sugar. This type of isomerization is catalyzed by the base present in solutions which test for the presence of aldehydes.
[00137] The term "hydrazide," as used herein, refers to functional groups having the general formula:
H
R34 NH2
wherein R34 is optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, optionally substituted heteroaryl, or optionally substituted heterocyclyl. In some embodiments, R34 is an amino acid, wherein the point of attachment for the oxygen is on the side chain of the amino acid. In certain embodimetns, the amino acid is withinin a polypeptide.
[00138] The term "hydrazone," as used herein, refers to compound having the general formula:
, wherein each of R , R , and R is independently optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, optionally substituted heteroaryl, or optionally substituted heterocyclyl. The term "hydrazone linkage,"
as used herein, refers to the
. Hydrzones can be prepared from, for example, joining of a compound comprising a hydrazide group and a compound comprising a carbonyl.
[00139] The term "acyl," as used herein, is a subset of a substituted alkyl group, and refers to a group having the general formula -C(=0)RA, -C(=0)ORA, -C(=0)-0-C(=0)RA, - C(=0)SRA, or -C(=0)N(RA)2, wherein each instance of RAis independently hydrogen, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, optionally substituted heteroaryl, or optionally substituted heterocyclyl. Exemplary acyl groups include aldehydes (-CHO), carboxylic acids (-C02H), ketones, acyl halides, esters, amides, imines, carbonates, carbamates, and ureas. Acyl substituents include, but are not limited to, any of the substituents described herein, that result in the formation of a stable moiety.
[00140] The term "azide" or "azido," as used herein, refers to a group of the formula (-N3).
[00141] Definitions of specific functional groups and chemical terms are described in more detail below. The chemical elements are identified in accordance with the Periodic Table of the Elements, CAS version, Handbook of Chemistry and Physics, 75th Ed., inside cover, and specific functional groups are generally defined as described therein. Additionally, general principles of organic chemistry, as well as specific functional moieties and reactivity, are described in Organic Chemistry, Thomas Sorrell, University Science Books, Sausalito, 1999; Smith and March March 's Advanced Organic Chemistry, 5th Edition, John Wiley & Sons, Inc., New York, 2001; Larock, Comprehensive Organic Transformations, VCH Publishers, Inc., New York, 1989; and Carruthers, Some Modern Methods of Organic Synthesis, 3 Edition, Cambridge University Press, Cambridge, 1987.
[00142] Compounds described herein can comprise one or more asymmetric centers, and thus can exist in various stereoisomeric forms, e.g., enantiomers and/or diastereomers. For example, the compounds described herein can be in the form of an individual enantiomer,
diastereomer or geometric isomer, or can be in the form of a mixture of stereoisomers, including racemic mixtures and mixtures enriched in one or more stereoisomer. Isomers can be isolated from mixtures by methods known to those skilled in the art, including chiral high pressure liquid chromatography (HPLC) and the formation and crystallization of chiral salts; or preferred isomers can be prepared by asymmetric syntheses. See, for example, Jacques et al., Enantiomers, Racemates and Resolutions (Wiley Interscience, New York, 1981); Wilen et al., Tetrahedron 33:2725 (1977); Eliel, E.L. Stereochemistry of Carbon Compounds (McGraw-Hill, NY, 1962); and Wilen, S.H. Tables of Resolving Agents and Optical
Resolutions p. 268 (E.L. Eliel, Ed., Univ. of Notre Dame Press, Notre Dame, IN 1972). The invention additionally encompasses compounds as individual isomers substantially free of other isomers, and alternatively, as mixtures of various isomers.
[00143] In a formula,— is absent, a coordination bond between a ligand and a metal, or a single bond.
[00144] When a range of values is listed, it is intended to encompass each value and subrange within the range. For example "Ci_6 alkyl" is intended to encompass, Ci, C2, C3, C4, C5,
C6, Ci_6, Ci_5, Ci^, Ci_3, Ci_2, C2-6, C2-5, C2^, C2-3, C3_6, C3_5, C3^, C4_6, C4_5, and Cs_6 alkyl.
[00145] The term "aliphatic," as used herein, includes both saturated and unsaturated, nonaromatic, straight chain {i.e., unbranched), branched, acyclic, and cyclic {i.e., carbocyclic) hydrocarbons, which are optionally substituted with one or more functional groups. As will be appreciated by one of ordinary skill in the art, "aliphatic" is intended herein to include, but is not limited to, alkyl, alkenyl, alkynyl, cycloalkyl, cycloalkenyl, and cycloalkynyl moieties. Thus, as used herein, the term "alkyl" includes straight, branched and cyclic alkyl groups. An analogous convention applies to other generic terms such as "alkenyl," "alkynyl," and the like. Furthermore, as used herein, the terms "alkyl," "alkenyl," "alkynyl," and the like encompass both substituted and unsubstituted groups. In certain embodiments, as used herein, "aliphatic" is used to indicate those aliphatic groups (cyclic, acyclic, substituted, unsubstituted, branched or unbranched) having 1-20 carbon atoms (Ci-20 aliphatic). In certain embodiments, the aliphatic group has 1-10 carbon atoms (CMO aliphatic). In certain embodiments, the aliphatic group has 1-6 carbon atoms (C1-6 aliphatic). In certain
embodiments, the aliphatic group has 1-5 carbon atoms (C1-5 aliphatic). In certain
embodiments, the aliphatic group has 1-4 carbon atoms (C1-4 aliphatic). In certain
embodiments, the aliphatic group has 1-3 carbon atoms (C1-3 aliphatic). In certain
embodiments, the aliphatic group has 1-2 carbon atoms (Ci_2 aliphatic). Aliphatic group
substituents include, but are not limited to, any of the substituents described herein, that result in the formation of a stable moiety.
[00146] The term "heteroaliphatic", as used herein, refers to aliphatic moieties that contain one or more oxygen, sulfur, nitrogen, phosphorus, or silicon atoms, e.g., in place of carbon atoms. Heteroaliphatic moieties may be branched, unbranched, cyclic or acyclic and include saturated and unsaturated heterocycles such as morpholino, pyrrolidinyl, etc. In certain embodiments, heteroaliphatic moieties are substituted by independent replacement of one or more of the hydrogen atoms thereon with one or more moieties including, but not limited to aliphatic; heteroaliphatic; aryl; heteroaryl; arylalkyl; heteroarylalkyl; alkoxy; aryloxy;
heteroalkoxy; heteroaryloxy; alkylthio; arylthio; heteroalkylthio; heteroaryl thio; -F; -CI; -Br; -I; -OH; -N02; -CN; -CF3; -CH2CF3; -CHC12; -CH2OH; -CH2CH2OH; -CH2NH2; - CH2S02CH3; -C(0)Rx; -C02(Rx); -CON(Rx)2; -OC(0)Rx; -OC02Rx; -OCON(Rx)2; -N(RX)2; - S(0)2Rx; -NRx(CO)Rx, wherein each occurrence of Rx independently includes, but is not limited to, aliphatic, heteroaliphatic, aryl, heteroaryl, arylalkyl, or heteroarylalkyl, wherein any of the aliphatic, heteroaliphatic, arylalkyl, or heteroarylalkyl substituents described above and herein may be substituted or unsubstituted, branched or unbranched, cyclic or acyclic, and wherein any of the aryl or heteroaryl substituents described above and herein may be substituted or unsubstituted. Additional examples of generally applicable substitutents are illustrated by the specific embodiments shown in the Examples that are described herein.
[00147] The term "alkyl," as used herein, refers to saturated, straight- or branched-chain hydrocarbon radicals derived from a hydrocarbon moiety containing between one and twenty carbon atoms by removal of a single hydrogen atom. In some embodiments, the alkyl group employed in the invention contains 1-20 carbon atoms (Ci_2oalkyl). In another embodiment, the alkyl group employed contains 1-15 carbon atoms (Ci-isalkyl). In another embodiment, the alkyl group employed contains 1-10 carbon atoms (Ci_ioalkyl). In another embodiment, the alkyl group employed contains 1-8 carbon atoms (Ci_8alkyl). In another embodiment, the alkyl group employed contains 1-6 carbon atoms (Ci_6alkyl). In another embodiment, the alkyl group employed contains 1-5 carbon atoms (Ci-salkyl). In another embodiment, the alkyl group employed contains 1-4 carbon atoms (Ci_4alkyl). In another embodiment, the alkyl group employed contains 1-3 carbon atoms (Ci_3alkyl). In another embodiment, the alkyl group employed contains 1-2 carbon atoms (Ci_2alkyl). Examples of alkyl radicals include, but are not limited to, methyl, ethyl, n-propyl, isopropyl, n-butyl, iso-butyl, sec- butyl, sec-pentyl, iso-pentyl, tert-butyl, n-pentyl, neopentyl, n-hexyl, sec-hexyl, n-heptyl, n-octyl, n-decyl, n-undecyl, dodecyl, and the like, which may bear one or more substituents.
Alkyl group substituents include, but are not limited to, any of the substituents described herein, that result in the formation of a stable moiety. The term "alkylene," as used herein, refers to a biradical derived from an alkyl group, as defined herein, by removal of two hydrogen atoms. Alkylene groups may be cyclic or acyclic, branched or unbranched, substituted or unsubstituted. Alkylene group substituents include, but are not limited to, any of the substituents described herein, that result in the formation of a stable moiety.
[00148] The term "alkenyl," as used herein, denotes a monovalent group derived from a straight- or branched-chain hydrocarbon moiety having at least one carbon-carbon double bond by the removal of a single hydrogen atom. In certain embodiments, the alkenyl group employed in the invention contains 2-20 carbon atoms (C2-2oalkenyl). In some embodiments, the alkenyl group employed in the invention contains 2-15 carbon atoms (d isalkenyl). In another embodiment, the alkenyl group employed contains 2-10 carbon atoms (C2-ioalkenyl). In still other embodiments, the alkenyl group contains 2-8 carbon atoms (C2-8alkenyl). In yet other embodiments, the alkenyl group contains 2-6 carbons (C2-6alkenyl). In yet other embodiments, the alkenyl group contains 2-5 carbons (C2-5alkenyl). In yet other
embodiments, the alkenyl group contains 2-4 carbons (C2-4alkenyl). In yet other
embodiments, the alkenyl group contains 2-3 carbons (C2-3alkenyl). In yet other
embodiments, the alkenyl group contains 2 carbons (C2alkenyl). Alkenyl groups include, for example, ethenyl, propenyl, butenyl, l-methyl-2-buten-l-yl, and the like, which may bear one or more substituents. Alkenyl group substituents include, but are not limited to, any of the substituents described herein, that result in the formation of a stable moiety. The term "alkenylene," as used herein, refers to a biradical derived from an alkenyl group, as defined herein, by removal of two hydrogen atoms. Alkenylene groups may be cyclic or acyclic, branched or unbranched, substituted or unsubstituted. Alkenylene group substituents include, but are not limited to, any of the substituents described herein, that result in the formation of a stable moiety.
[00149] The term "alkynyl," as used herein, refers to a monovalent group derived from a straight- or branched-chain hydrocarbon having at least one carbon-carbon triple bond by the removal of a single hydrogen atom. In certain embodiments, the alkynyl group employed in the invention contains 2-20 carbon atoms (C2-2oalkynyl). In some embodiments, the alkynyl group employed in the invention contains 2-15 carbon atoms (C2-i5alkynyl). In another embodiment, the alkynyl group employed contains 2-10 carbon atoms (C2-ioalkynyl). In still other embodiments, the alkynyl group contains 2-8 carbon atoms (C2-8alkynyl). In still other embodiments, the alkynyl group contains 2-6 carbon atoms (C2-6alkynyl). In still
other embodiments, the alkynyl group contains 2-5 carbon atoms (C2-5alkynyl). In still other embodiments, the alkynyl group contains 2-4 carbon atoms (C2_4alkynyl). In still other embodiments, the alkynyl group contains 2-3 carbon atoms (C2-3alkynyl). In still other embodiments, the alkynyl group contains 2 carbon atoms (C2alkynyl). Representative alkynyl groups include, but are not limited to, ethynyl, 2-propynyl (propargyl), 1-propynyl, and the like, which may bear one or more substituents. Alkynyl group substituents include, but are not limited to, any of the substituents described herein, that result in the formation of a stable moiety. The term "alkynylene," as used herein, refers to a biradical derived from an alkynylene group, as defined herein, by removal of two hydrogen atoms. Alkynylene groups may be cyclic or acyclic, branched or unbranched, substituted or unsubstituted. Alkynylene group substituents include, but are not limited to, any of the substituents described herein, that result in the formation of a stable moiety.
[00150] The term "heteroalkyl" refers to an alkyl group, which further includes at least one heteroatom (e.g., 1, 2, 3, or 4 heteroatoms) selected from oxygen, nitrogen, or sulfur within (i.e., inserted between adjacent carbon atoms of) and/or placed at one or more terminal position(s) of the parent chain. In certain embodiments, a heteroalkyl group refers to a saturated group having from 1 to 10 carbon atoms and 1 or more heteroatoms within the parent chain ("heteroCi_io alkyl"). In some embodiments, a heteroalkyl group is a saturated group having 1 to 9 carbon atoms and 1 or more heteroatoms within the parent chain
("heteroCi_9 alkyl"). In some embodiments, a heteroalkyl group is a saturated group having 1 to 8 carbon atoms and 1 or more heteroatoms within the parent chain ("heteroCi_8 alkyl"). In some embodiments, a heteroalkyl group is a saturated group having 1 to 7 carbon atoms and 1 or more heteroatoms within the parent chain ("heteroCi_7 alkyl"). In some embodiments, a heteroalkyl group is a saturated group having 1 to 6 carbon atoms and 1 or more heteroatoms within the parent chain ("heteroCi_6 alkyl"). In some embodiments, a heteroalkyl group is a saturated group having 1 to 5 carbon atoms and 1 or 2 heteroatoms within the parent chain ("heteroCi_5 alkyl"). In some embodiments, a heteroalkyl group is a saturated group having 1 to 4 carbon atoms and lor 2 heteroatoms within the parent chain ("heteroCi^ alkyl"). In some embodiments, a heteroalkyl group is a saturated group having 1 to 3 carbon atoms and 1 heteroatom within the parent chain ("heteroCi_3 alkyl"). In some embodiments, a heteroalkyl group is a saturated group having 1 to 2 carbon atoms and 1 heteroatom within the parent chain ("heteroCi_2 alkyl"). In some embodiments, a heteroalkyl group is a saturated group having 1 carbon atom and 1 heteroatom ("heteroCi alkyl"). In some embodiments, a heteroalkyl group is a saturated group having 2 to 6 carbon atoms and 1 or 2
heteroatoms within the parent chain ("heteroC2-6 alkyl"). Unless otherwise specified, each instance of a heteroalkyl group is independently unsubstituted (an "unsubstituted
heteroalkyl") or substituted (a "substituted heteroalkyl") with one or more substituents. In certain embodiments, the heteroalkyl group is an unsubstituted heteroCi_io alkyl. In certain embodiments, the heteroalkyl group is a substituted heteroCi_io alkyl.
[00151] The term "heteroalkenyl" refers to an alkenyl group, which further includes at least one heteroatom (e.g., 1, 2, 3, or 4 heteroatoms) selected from oxygen, nitrogen, or sulfur within (i.e., inserted between adjacent carbon atoms of) and/or placed at one or more terminal position(s) of the parent chain. In certain embodiments, a heteroalkenyl group refers to a group having from 2 to 10 carbon atoms, at least one double bond, and 1 or more heteroatoms within the parent chain ("heterod-io alkenyl"). In some embodiments, a heteroalkenyl group has 2 to 9 carbon atoms at least one double bond, and 1 or more heteroatoms within the parent chain ("heteroC2-9 alkenyl"). In some embodiments, a heteroalkenyl group has 2 to 8 carbon atoms, at least one double bond, and 1 or more heteroatoms within the parent chain ("heteroC2-8 alkenyl"). In some embodiments, a heteroalkenyl group has 2 to 7 carbon atoms, at least one double bond, and 1 or more heteroatoms within the parent chain ("heteroC2-7 alkenyl"). In some embodiments, a heteroalkenyl group has 2 to 6 carbon atoms, at least one double bond, and 1 or more heteroatoms within the parent chain ("heteroC2-6 alkenyl"). In some embodiments, a heteroalkenyl group has 2 to 5 carbon atoms, at least one double bond, and 1 or 2 heteroatoms within the parent chain ("heteroC2-5 alkenyl"). In some embodiments, a heteroalkenyl group has 2 to 4 carbon atoms, at least one double bond, and lor 2
heteroatoms within the parent chain ("heteroC2^ alkenyl"). In some embodiments, a heteroalkenyl group has 2 to 3 carbon atoms, at least one double bond, and 1 heteroatom within the parent chain ("heteroC2-3 alkenyl"). In some embodiments, a heteroalkenyl group has 2 to 6 carbon atoms, at least one double bond, and 1 or 2 heteroatoms within the parent chain ("heteroC2-6 alkenyl"). Unless otherwise specified, each instance of a heteroalkenyl group is independently unsubstituted (an "unsubstituted heteroalkenyl") or substituted (a "substituted heteroalkenyl") with one or more substituents. In certain embodiments, the heteroalkenyl group is an unsubstituted heteroC2-io alkenyl. In certain embodiments, the heteroalkenyl group is a substituted heteroC2-io alkenyl.
[00152] The term "heteroalkynyl" refers to an alkynyl group, which further includes at least one heteroatom (e.g., 1, 2, 3, or 4 heteroatoms) selected from oxygen, nitrogen, or sulfur within (i.e., inserted between adjacent carbon atoms of) and/or placed at one or more terminal position(s) of the parent chain. In certain embodiments, a heteroalkynyl group refers to a
group having from 2 to 10 carbon atoms, at least one triple bond, and 1 or more heteroatoms within the parent chain ("heteroC2-io alkynyl"). In some embodiments, a heteroalkynyl group has 2 to 9 carbon atoms, at least one triple bond, and 1 or more heteroatoms within the parent chain ("heteroC2-9 alkynyl"). In some embodiments, a heteroalkynyl group has 2 to 8 carbon atoms, at least one triple bond, and 1 or more heteroatoms within the parent chain ("heteroC2- 8 alkynyl"). In some embodiments, a heteroalkynyl group has 2 to 7 carbon atoms, at least one triple bond, and 1 or more heteroatoms within the parent chain ("heteroC2-7 alkynyl"). In some embodiments, a heteroalkynyl group has 2 to 6 carbon atoms, at least one triple bond, and 1 or more heteroatoms within the parent chain ("heteroC2-6 alkynyl"). In some embodiments, a heteroalkynyl group has 2 to 5 carbon atoms, at least one triple bond, and 1 or 2 heteroatoms within the parent chain ("heteroC2-5 alkynyl"). In some embodiments, a heteroalkynyl group has 2 to 4 carbon atoms, at least one triple bond, and lor 2 heteroatoms within the parent chain ("heteroC2^ alkynyl"). In some embodiments, a heteroalkynyl group has 2 to 3 carbon atoms, at least one triple bond, and 1 heteroatom within the parent chain ("heteroC2-3 alkynyl"). In some embodiments, a heteroalkynyl group has 2 to 6 carbon atoms, at least one triple bond, and 1 or 2 heteroatoms within the parent chain ("heteroC2-6 alkynyl"). Unless otherwise specified, each instance of a heteroalkynyl group is independently unsubstituted (an "unsubstituted heteroalkynyl") or substituted (a "substituted
heteroalkynyl") with one or more substituents. In certain embodiments, the heteroalkynyl group is an unsubstituted heteroC2 io alkynyl. In certain embodiments, the heteroalkynyl group is a substituted heteroC2-io alkynyl.
[00153] The term "carbocyclyl" or "carbocyclic" refers to a radical of a non-aromatic cyclic hydrocarbon group having from 3 to 14 ring carbon atoms ("C3_i4 carbocyclyl") and zero heteroatoms in the non-aromatic ring system. In some embodiments, a carbocyclyl group has 3 to 10 ring carbon atoms ("C3_io carbocyclyl"). In some embodiments, a carbocyclyl group has 3 to 8 ring carbon atoms ("C3_8 carbocyclyl"). In some embodiments, a carbocyclyl group has 3 to 7 ring carbon atoms ("C3_7 carbocyclyl"). In some embodiments, a carbocyclyl group has 3 to 6 ring carbon atoms ("C3_6 carbocyclyl"). In some embodiments, a carbocyclyl group has 4 to 6 ring carbon atoms ("C4_6 carbocyclyl"). In some embodiments, a carbocyclyl group has 5 to 6 ring carbon atoms ("Cs_6 carbocyclyl"). In some embodiments, a carbocyclyl group has 5 to 10 ring carbon atoms ("Cs-io carbocyclyl"). Exemplary C3_6 carbocyclyl groups include, without limitation, cyclopropyl (C3), cyclopropenyl (C3), cyclobutyl (C4), cyclobutenyl (C4), cyclopentyl (C5), cyclopentenyl (C5), cyclohexyl (C6), cyclohexenyl (C6), cyclohexadienyl (C6), and the like. Exemplary C3_8 carbocyclyl groups
include, without limitation, the aforementioned C3_6 carbocyclyl groups as well as
cycloheptyl (C7), cycloheptenyl (C7), cycloheptadienyl (C7), cycloheptatrienyl (C7), cyclooctyl (C8), cyclooctenyl (C8), bicyclo[2.2.1]heptanyl (C7), bicyclo[2.2.2]octanyl (C8), and the like. Exemplary C3_io carbocyclyl groups include, without limitation, the
aforementioned C3_8 carbocyclyl groups as well as cyclononyl (C9), cyclononenyl (C9), cyclodecyl (Cio), cyclodecenyl (Cio), octahydro-lH-indenyl (C9), decahydronaphthalenyl (Cio), spiro[4.5]decanyl (Cio), and the like. As the foregoing examples illustrate, in certain embodiments, the carbocyclyl group is either monocyclic ("monocyclic carbocyclyl") or polycyclic (e.g., containing a fused, bridged or spiro ring system such as a bicyclic system ("bicyclic carbocyclyl") or tricyclic system ("tricyclic carbocyclyl")) and can be saturated or can contain one or more carbon-carbon double or triple bonds. "Carbocyclyl" also includes ring systems wherein the carbocyclyl ring, as defined above, is fused with one or more aryl or heteroaryl groups wherein the point of attachment is on the carbocyclyl ring, and in such instances, the number of carbons continue to designate the number of carbons in the carbocyclic ring system. Unless otherwise specified, each instance of a carbocyclyl group is independently unsubstituted (an "unsubstituted carbocyclyl") or substituted (a "substituted carbocyclyl") with one or more substituents. In certain embodiments, the carbocyclyl group is an unsubstituted C3_i4 carbocyclyl. In certain embodiments, the carbocyclyl group is a substituted C3_i4 carbocyclyl.
[00154] In some embodiments, "carbocyclyl" is a monocyclic, saturated carbocyclyl group having from 3 to 14 ring carbon atoms ("C3_i4 cycloalkyl"). In some embodiments, a cycloalkyl group has 3 to 10 ring carbon atoms ("C3_io cycloalkyl"). In some embodiments, a cycloalkyl group has 3 to 8 ring carbon atoms ("C3_8 cycloalkyl"). In some embodiments, a cycloalkyl group has 3 to 6 ring carbon atoms ("C3_6 cycloalkyl"). In some embodiments, a cycloalkyl group has 4 to 6 ring carbon atoms ("C4_6 cycloalkyl"). In some embodiments, a cycloalkyl group has 5 to 6 ring carbon atoms ("Cs_6 cycloalkyl"). In some embodiments, a cycloalkyl group has 5 to 10 ring carbon atoms ("Cs-io cycloalkyl"). Examples of Cs_6 cycloalkyl groups include cyclopentyl (C5) and cyclohexyl (C5). Examples of C3_6 cycloalkyl groups include the aforementioned Cs_6 cycloalkyl groups as well as cyclopropyl (C3) and cyclobutyl (C4). Examples of C3_8 cycloalkyl groups include the aforementioned C3_6 cycloalkyl groups as well as cycloheptyl (C7) and cyclooctyl (C8). Unless otherwise specified, each instance of a cycloalkyl group is independently unsubstituted (an "unsubstituted cycloalkyl") or substituted (a "substituted cycloalkyl") with one or more substituents. In
certain embodiments, the cycloalkyl group is an unsubstituted C3_i4 cycloalkyl. In certain embodiments, the cycloalkyl group is a substituted C3_i4 cycloalkyl.
[00155] The term "heterocyclyl" or "heterocyclic" refers to a radical of a 3- to 14- membered non-aromatic ring system having ring carbon atoms and 1 to 4 ring heteroatoms, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur ("3-14 membered heterocyclyl"). In heterocyclyl groups that contain one or more nitrogen atoms, the point of attachment can be a carbon or nitrogen atom, as valency permits. A heterocyclyl group can either be monocyclic ("monocyclic heterocyclyl") or polycyclic (e.g., a fused, bridged or spiro ring system such as a bicyclic system ("bicyclic heterocyclyl") or tricyclic system ("tricyclic heterocyclyl")), and can be saturated or can contain one or more carbon- carbon double or triple bonds. Heterocyclyl polycyclic ring systems can include one or more heteroatoms in one or both rings. "Heterocyclyl" also includes ring systems wherein the heterocyclyl ring, as defined above, is fused with one or more carbocyclyl groups wherein the point of attachment is either on the carbocyclyl or heterocyclyl ring, or ring systems wherein the heterocyclyl ring, as defined above, is fused with one or more aryl or heteroaryl groups, wherein the point of attachment is on the heterocyclyl ring, and in such instances, the number of ring members continue to designate the number of ring members in the heterocyclyl ring system. Unless otherwise specified, each instance of heterocyclyl is independently unsubstituted (an "unsubstituted heterocyclyl") or substituted (a "substituted heterocyclyl") with one or more substituents. In certain embodiments, the heterocyclyl group is an unsubstituted 3-14 membered heterocyclyl. In certain embodiments, the heterocyclyl group is a substituted 3-14 membered heterocyclyl.
[00156] In some embodiments, a heterocyclyl group is a 5-10 membered non-aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur ("5-10 membered heterocyclyl"). In some embodiments, a heterocyclyl group is a 5-8 membered non-aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms, wherein each heteroatom is
independently selected from nitrogen, oxygen, and sulfur ("5-8 membered heterocyclyl"). In some embodiments, a heterocyclyl group is a 5-6 membered non-aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms, wherein each heteroatom is
independently selected from nitrogen, oxygen, and sulfur ("5-6 membered heterocyclyl"). In some embodiments, the 5-6 membered heterocyclyl has 1-3 ring heteroatoms selected from nitrogen, oxygen, and sulfur. In some embodiments, the 5-6 membered heterocyclyl has 1-2
ring heteroatoms selected from nitrogen, oxygen, and sulfur. In some embodiments, the 5-6 membered heterocyclyl has 1 ring heteroatom selected from nitrogen, oxygen, and sulfur.
[00157] Exemplary 3-membered heterocyclyl groups containing 1 heteroatom include, without limitation, azirdinyl, oxiranyl, and thiiranyl. Exemplary 4-membered heterocyclyl groups containing 1 heteroatom include, without limitation, azetidinyl, oxetanyl, and thietanyl. Exemplary 5-membered heterocyclyl groups containing 1 heteroatom include, without limitation, tetrahydrofuranyl, dihydrofuranyl, tetrahydrothiophenyl,
dihydrothiophenyl, pyrrolidinyl, dihydropyrrolyl, and pyrrolyl-2,5-dione. Exemplary 5- membered heterocyclyl groups containing 2 heteroatoms include, without limitation, dioxolanyl, oxathiolanyl and dithiolanyl. Exemplary 5-membered heterocyclyl groups containing 3 heteroatoms include, without limitation, triazolinyl, oxadiazolinyl, and thiadiazolinyl. Exemplary 6-membered heterocyclyl groups containing 1 heteroatom include, without limitation, piperidinyl, tetrahydropyranyl, dihydropyridinyl, and thianyl. Exemplary 6-membered heterocyclyl groups containing 2 heteroatoms include, without limitation, piperazinyl, morpholinyl, dithianyl, and dioxanyl. Exemplary 6-membered heterocyclyl groups containing 2 heteroatoms include, without limitation, triazinanyl. Exemplary 7- membered heterocyclyl groups containing 1 heteroatom include, without limitation, azepanyl, oxepanyl and thiepanyl. Exemplary 8-membered heterocyclyl groups containing 1 heteroatom include, without limitation, azocanyl, oxecanyl and thiocanyl. Exemplary bicyclic heterocyclyl groups include, without limitation, indolinyl, isoindolinyl, dihydrobenzofuranyl, dihydrobenzothienyl, tetrahydrobenzothienyl, tetrahydrobenzofuranyl, tetrahydroindolyl, tetrahydroquinolinyl, tetrahydroisoquinolinyl, decahydroquinolinyl, decahydroisoquinolinyl, octahydrochromenyl, octahydroisochromenyl, decahydronaphthyridinyl, decahydro-1,8- naphthyridinyl, octahydropyrrolo[3,2-b]pyrrole, indolinyl, phthalimidyl, naphthalimidyl, chromanyl, chromenyl, lH-benzo[e][l,4]diazepinyl, l,4,5,7-tetrahydropyrano[3,4- b]pyrrolyl, 5,6-dihydro-4H-furo[3,2-b]pyrrolyl, 6,7-dihydro-5H-furo[3,2-b]pyranyl, 5,7- dihydro-4H-thieno[2,3-c]pyranyl, 2,3-dihydro-lH-pyrrolo[2,3-b]pyridinyl, 2,3- dihydrofuro[2,3-b]pyridinyl, 4,5,6,7-tetrahydro-lH-pyrrolo[2,3-b]pyridinyl, 4,5,6,7-tetra- hydrofuro[3,2-c]pyridinyl, 4,5,6,7-tetrahydrothieno[3,2-b]pyridinyl, l,2,3,4-tetrahydro-l,6- naphthyridinyl, and the like.
[00158] The term "aryl" refers to a radical of a monocyclic or polycyclic (e.g., bicyclic or tricyclic) 4n+2 aromatic ring system (e.g., having 6, 10, or 14 π electrons shared in a cyclic array) having 6-14 ring carbon atoms and zero heteroatoms provided in the aromatic ring
system ("C6-i4 aryl"). In some embodiments, an aryl group has 6 ring carbon atoms ("C6 aryl"; e.g., phenyl). In some embodiments, an aryl group has 10 ring carbon atoms ("Qo aryl"; e.g., naphthyl such as 1-naphthyl and 2-naphthyl). In some embodiments, an aryl group has 14 ring carbon atoms ("C14 aryl"; e.g., anthracyl). "Aryl" also includes ring systems wherein the aryl ring, as defined above, is fused with one or more carbocyclyl or heterocyclyl groups wherein the radical or point of attachment is on the aryl ring, and in such instances, the number of carbon atoms continue to designate the number of carbon atoms in the aryl ring system. Unless otherwise specified, each instance of an aryl group is
independently unsubstituted (an "unsubstituted aryl") or substituted (a "substituted aryl") with one or more substituents. In certain embodiments, the aryl group is an unsubstituted C6- 14 aryl. In certain embodiments, the aryl group is a substituted C6-i4 aryl.
[00159] The term "heteroaryl" refers to a radical of a 5-14 membered monocyclic or polycyclic (e.g., bicyclic, tricyclic) 4n+2 aromatic ring system (e.g., having 6, 10, or 14 π electrons shared in a cyclic array) having ring carbon atoms and 1-4 ring heteroatoms rovided in the aromatic ring system, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur ("5-14 membered heteroaryl"). In heteroaryl groups that contain one or more nitrogen atoms, the point of attachment can be a carbon or nitrogen atom, as valency permits. Heteroaryl polycyclic ring systems can include one or more heteroatoms in one or both rings. "Heteroaryl" includes ring systems wherein the heteroaryl ring, as defined above, is fused with one or more carbocyclyl or heterocyclyl groups wherein the point of attachment is on the heteroaryl ring, and in such instances, the number of ring members continue to designate the number of ring members in the heteroaryl ring system. "Heteroaryl" also includes ring systems wherein the heteroaryl ring, as defined above, is fused with one or more aryl groups wherein the point of attachment is either on the aryl or heteroaryl ring, and in such instances, the number of ring members designates the number of ring members in the fused polycyclic (aryl/heteroaryl) ring system. Polycyclic heteroaryl groups wherein one ring does not contain a heteroatom (e.g., indolyl, quinolinyl, carbazolyl, and the like) the point of attachment can be on either ring, i.e., either the ring bearing a heteroatom (e.g., 2-indolyl) or the ring that does not contain a heteroatom (e.g., 5-indolyl).
[00160] In some embodiments, a heteroaryl group is a 5-10 membered aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms provided in the aromatic ring system, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur ("5-10 membered heteroaryl"). In some embodiments, a heteroaryl group is a 5-8 membered
aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms provided in the aromatic ring system, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur ("5-8 membered heteroaryl"). In some embodiments, a heteroaryl group is a 5-6 membered aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms provided in the aromatic ring system, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur ("5-6 membered heteroaryl"). In some embodiments, the 5-6 membered heteroaryl has 1-3 ring heteroatoms selected from nitrogen, oxygen, and sulfur. In some embodiments, the 5-6 membered heteroaryl has 1-2 ring heteroatoms selected from nitrogen, oxygen, and sulfur. In some embodiments, the 5-6 membered heteroaryl has 1 ring heteroatom selected from nitrogen, oxygen, and sulfur. Unless otherwise specified, each instance of a heteroaryl group is independently unsubstituted (an
"unsubstituted heteroaryl") or substituted (a "substituted heteroaryl") with one or more substituents. In certain embodiments, the heteroaryl group is an unsubstituted 5-14 membered heteroaryl. In certain embodiments, the heteroaryl group is a substituted 5-14 membered heteroaryl.
[00161] Exemplary 5-membered heteroaryl groups containing 1 heteroatom include, without limitation, pyrrolyl, furanyl, and thiophenyl. Exemplary 5-membered heteroaryl groups containing 2 heteroatoms include, without limitation, imidazolyl, pyrazolyl, oxazolyl, isoxazolyl, thiazolyl, and isothiazolyl. Exemplary 5-membered heteroaryl groups containing 3 heteroatoms include, without limitation, triazolyl, oxadiazolyl, and thiadiazolyl. Exemplary
5- membered heteroaryl groups containing 4 heteroatoms include, without limitation, tetrazolyl. Exemplary 6-membered heteroaryl groups containing 1 heteroatom include, without limitation, pyridinyl. Exemplary 6-membered heteroaryl groups containing 2 heteroatoms include, without limitation, pyridazinyl, pyrimidinyl, and pyrazinyl. Exemplary
6- membered heteroaryl groups containing 3 or 4 heteroatoms include, without limitation, triazinyl and tetrazinyl, respectively. Exemplary 7-membered heteroaryl groups containing 1 heteroatom include, without limitation, azepinyl, oxepinyl, and thiepinyl. Exemplary 5,6- bicyclic heteroaryl groups include, without limitation, indolyl, isoindolyl, indazolyl, benzotriazolyl, benzothiophenyl, isobenzothiophenyl, benzofuranyl, benzoisofuranyl, benzimidazolyl, benzoxazolyl, benzisoxazolyl, benzoxadiazolyl, benzthiazolyl,
benzisothiazolyl, benzthiadiazolyl, indolizinyl, and purinyl. Exemplary 6,6-bicyclic heteroaryl groups include, without limitation, naphthyridinyl, pteridinyl, quinolinyl, isoquinolinyl, cinnolinyl, quinoxalinyl, phthalazinyl, and quinazolinyl. Exemplary tricyclic
heteroaryl groups include, without limitation, phenanthridinyl, dibenzofuranyl, carbazolyl, acridinyl, phenothiazinyl, phenoxazinyl and phenazinyl.
[00162] The term "unsaturated" or "partially unsaturated" refers to a moiety that includes at least one double or triple bond.
[00163] Affixing the suffix "-ene" to a group indicates the group is a divalent moiety, e.g. , alkylene is the divalent moiety of alkyl, alkenylene is the divalent moiety of alkenyl, alkynylene is the divalent moiety of alkynyl, heteroalkylene is the divalent moiety of heteroalkyl, heteroalkenylene is the divalent moiety of heteroalkenyl, heteroalkynylene is the divalent moiety of heteroalkynyl, carbocyclylene is the divalent moiety of carbocyclyl, heterocyclylene is the divalent moiety of heterocyclyl, arylene is the divalent moiety of aryl, and heteroarylene is the divalent moiety of heteroaryl.
[00164] A group is optionally substituted unless expressly provided otherwise. In certain embodiments, alkyl, alkenyl, alkynyl, heteroalkyl, heteroalkenyl, heteroalkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl groups are optionally substituted. "Optionally substituted" refers to a group which may be substituted or unsubstituted (e.g., "substituted" or
"unsubstituted" alkyl, "substituted" or "unsubstituted" alkenyl, "substituted" or
"unsubstituted" alkynyl, "substituted" or "unsubstituted" heteroalkyl, "substituted" or "unsubstituted" heteroalkenyl, "substituted" or "unsubstituted" heteroalkynyl, "substituted" or "unsubstituted" carbocyclyl, "substituted" or "unsubstituted" heterocyclyl, "substituted" or "unsubstituted" aryl or "substituted" or "unsubstituted" heteroaryl group). In general, the term "substituted" means that at least one hydrogen present on a group is replaced with a permissible substituent, e.g., a substituent which upon substitution results in a stable compound, e.g., a compound which does not spontaneously undergo transformation such as by rearrangement, cyclization, elimination, or other reaction. Unless otherwise indicated, a "substituted" group has a substituent at one or more substitutable positions of the group, and when more than one position in any given structure is substituted, the substituent is either the same or different at each position. The term "substituted" is contemplated to include substitution with all permissible substituents of organic compounds, and includes any of the substituents described herein that results in the formation of a stable compound. The present invention contemplates any and all such combinations in order to arrive at a stable
compound. For purposes of this invention, heteroatoms such as nitrogen may have hydrogen substituents and/or any suitable substituent as described herein which satisfy the valencies of the heteroatoms and results in the formation of a stable moiety. The invention is not intended to be limited in any manner by the exemplary substituents described herein.
[00165] The term "halo" or "halogen" refers to fluorine (fluoro, -F), chlorine (chloro, -CI), bromine (bromo, -Br), or iodine (iodo, -I).
[00166] The term "amino" refers to the group -NH2. The term "substituted amino," by extension, refers to a monosubstituted amino, a disubstituted amino, or a trisubstituted amino. In certain embodiments, the "substituted amino" is a monosubstituted amino or a
disubstituted amino group.
[00167] The term "monosubstituted amino" refers to an amino group wherein the nitrogen atom directly attached to the parent molecule is substituted with one hydrogen and one group other than hydrogen, and includes groups selected from -NH(Rbb), -NHC(=0)Raa, - NHC02Raa, -NHC(=0)N(Rbb)2, -NHC(=NRbb)N(Rbb)2, -NHS02Raa, -NHP(=0)(ORcc)2, and -NHP(=0)(NRbb)2, wherein Raa, Rbb and Rcc are as defined herein, and wherein Rbb of the group -NH(Rbb) is not hydrogen.
[00168] The term "disubstituted amino" refers to an amino group wherein the nitrogen atom directly attached to the parent molecule is substituted with two groups other than hydrogen, and includes groups selected from -N(Rbb)2, -NRbb C(=0)Raa, -NRbbC02Raa, - NRbbC(=0)N(Rbb)2, -NRbbC(=NRbb)N(Rbb)2, -NRbbS02Raa, -NRbbP(=0)(ORcc)2, and - NRbbP(=0)(NRbb)2, wherein Raa, Rbb, and Rcc are as defined herein, with the proviso that the nitrogen atom directly attached to the parent molecule is not substituted with hydrogen.
[00169] The term "trisubstituted amino" refers to an amino group wherein the nitrogen atom directly attached to the parent molecule is substituted with three groups, and includes groups selected from -N(Rbb)3 and -N(Rbb)3 +X~, wherein Rbb and X" are as defined herein.
[00170] In certain embodiments, the substituent present on the nitrogen atom is an nitrogen protecting group (also referred to herein as an "amino protecting group"). Nitrogen protecting groups include, but are not limited to, -OH, -OR"*, -N(RCC)2, -C(=0)Raa, -C(=0)N(Rcc)2, - CC^R^, -S02Raa, -C(=NRcc)Raa, -C(=NRcc)ORaa, -C(=NRCC)N(RCC)2, -S02N(Rcc)2, -S02Rcc, -S02ORcc, -SORaa, -C(=S)N(RCC)2, -C(=0)SRcc, -C(=S)SRCC, Ci_i0 alkyl (e.g., aralkyl, heteroaralkyl), C2-io alkenyl, C2-io alkynyl, heteroCno alkyl, heteroC2-io alkenyl, heteroC2-io alkynyl, C3_io carbocyclyl, 3-14 membered heterocyclyl, C6-i4 aryl, and 5-14 membered heteroaryl groups, wherein each alkyl, alkenyl, alkynyl, heteroalkyl, heteroalkenyl, heteroalkynyl, carbocyclyl, heterocyclyl, aralkyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 Rdd groups, and wherein Raa, Rbb, Rcc and Rdd are as defined herein. Nitrogen protecting groups are well known in the art and include those described in detail in Protecting Groups in Organic Synthesis, T. W. Greene and P. G. M. Wuts, 3 edition, John Wiley & Sons, 1999, incorporated herein by reference.
[00171] For example, nitrogen protecting groups such as amide groups (e.g., -C(=0)Raa) include, but are not limited to, formamide, acetamide, chloroacetamide, trichloroacetamide, trifluoroacetamide, phenylacetamide, 3-phenylpropanamide, picolinamide, 3- pyridylcarboxamide, N-benzoylphenylalanyl derivative, benzamide, /?-phenylbenzamide, o- nitophenylacetamide, o-nitrophenoxyacetamide, acetoacetamide, (Ν'- dithiobenzyloxyacylamino)acetamide, 3-(p-hydroxyphenyl)propanamide, 3-(o- nitrophenyl)propanamide, 2-methyl-2-(o-nitrophenoxy)propanamide, 2-methyl-2-(o- phenylazophenoxy)propanamide, 4-chlorobutanamide, 3-methyl-3-nitrobutanamide, o- nitrocinnamide, N-acetylmethionine derivative, o-nitrobenzamide and o- (benzoyloxymethyl)benzamide.
[00172] Nitrogen protecting groups such as carbamate groups (e.g., -C(=0)ORaa) include, but are not limited to, methyl carbamate, ethyl carbamante, 9-fluorenylmethyl carbamate (Fmoc), 9-(2-sulfo)fluorenylmethyl carbamate, 9-(2,7-dibromo)fluoroenylmethyl carbamate, 2,7-di-t-butyl-[9-( 10, 10-dioxo-lO, 10, 10, 10-tetrahydrothioxanthyl)]methyl carbamate (DBD-Tmoc), 4-methoxyphenacyl carbamate (Phenoc), 2,2,2-trichloroethyl carbamate (Troc), 2-trimethylsilylethyl carbamate (Teoc), 2-phenylethyl carbamate (hZ), 1- (l-adamantyl)-l-methylethyl carbamate (Adpoc), l, l-dimethyl-2-haloethyl carbamate, l,l-dimethyl-2,2-dibromoethyl carbamate (DB-i-BOC), l,l-dimethyl-2,2,2-trichloroethyl carbamate (TCBOC), l-methyl-l-(4-biphenylyl)ethyl carbamate (Bpoc), 1— (3,5— di— f— butylphenyl)-l-methylethyl carbamate (i-Bumeoc), 2-(2'- and 4'-pyridyl)ethyl carbamate (Pyoc), 2-(N,N-dicyclohexylcarboxamido)ethyl carbamate, i-butyl carbamate (BOC or Boc), 1-adamantyl carbamate (Adoc), vinyl carbamate (Voc), allyl carbamate (Alloc), 1- isopropylallyl carbamate (Ipaoc), cinnamyl carbamate (Coc), 4-nitrocinnamyl carbamate (Noc), 8-quinolyl carbamate, N-hydroxypiperidinyl carbamate, alkyldithio carbamate, benzyl carbamate (Cbz), /?-methoxybenzyl carbamate (Moz), /?-nitobenzyl carbamate, p- bromobenzyl carbamate, /?-chlorobenzyl carbamate, 2,4-dichlorobenzyl carbamate, 4- methylsulfinylbenzyl carbamate (Msz), 9-anthrylmethyl carbamate, diphenylmethyl carbamate, 2-methylthioethyl carbamate, 2-methylsulfonylethyl carbamate, 2-(p- toluenesulfonyl)ethyl carbamate, [2-(l,3-dithianyl)]methyl carbamate (Dmoc), 4- methylthiophenyl carbamate (Mtpc), 2,4-dimethylthiophenyl carbamate (Bmpc), 2- phosphonioethyl carbamate (Peoc), 2-triphenylphosphonioisopropyl carbamate (Ppoc), 1, 1- dimethyl-2-cyanoethyl carbamate, m-chloro-p-acyloxybenzyl carbamate, p- (dihydroxyboryl)benzyl carbamate, 5-benzisoxazolylmethyl carbamate, 2-(trifluoromethyl)- 6-chromonylmethyl carbamate (Tcroc), m-nitrophenyl carbamate, 3,5-dimethoxybenzyl
carbamate, o-nitrobenzyl carbamate, 3,4-dimethoxy-6-nitrobenzyl carbamate, phenyl(o- nitrophenyl)methyl carbamate, i-amyl carbamate, S-benzyl thiocarbamate, /?-cyanobenzyl carbamate, cyclobutyl carbamate, cyclohexyl carbamate, cyclopentyl carbamate,
cyclopropylmethyl carbamate, /?-decyloxybenzyl carbamate, 2,2-dimethoxyacylvinyl carbamate, o-(N,N-dimethylcarboxamido)benzyl carbamate, l,l-dimethyl-3-(N,N- dimethylcarboxamido)propyl carbamate, 1, 1-dimethylpropynyl carbamate, di(2- pyridyl)methyl carbamate, 2-furanylmethyl carbamate, 2-iodoethyl carbamate, isoborynl carbamate, isobutyl carbamate, isonicotinyl carbamate, p-(p '-methoxyphenylazo)benzyl carbamate, 1-methylcyclobutyl carbamate, 1-methylcyclohexyl carbamate, 1-methyl-l- cyclopropylmethyl carbamate, l-methyl-l-(3,5-dimethoxyphenyl)ethyl carbamate, 1- methyl-l-(/?-phenylazophenyl)ethyl carbamate, 1 -methyl- 1-phenylethyl carbamate, 1- methyl-l-(4-pyridyl)ethyl carbamate, phenyl carbamate, /?-(phenylazo)benzyl carbamate, 2,4,6-tri-i-butylphenyl carbamate, 4-(trimethylammonium)benzyl carbamate, and 2,4,6- trimethylbenzyl carbamate.
[00173] Nitrogen protecting groups such as sulfonamide groups (e.g., -S(=0)2Raa) include, but are not limited to, /?-toluenesulfonamide (Ts), benzenesulfonamide, 2,3,6,-trimethyl-4- methoxybenzenesulfonamide (Mtr), 2,4,6-trimethoxybenzenesulfonamide (Mtb), 2,6- dimethyl-4-methoxybenzenesulfonamide (Pme), 2,3,5, 6-tetramethyl-4- methoxybenzenesulfonamide (Mte), 4-methoxybenzenesulfonamide (Mbs), 2,4,6- trimethylbenzenesulfonamide (Mts), 2,6-dimethoxy-4-methylbenzenesulfonamide (iMds), 2,2,5,7, 8-pentamethylchroman-6-sulfonamide (Pmc), methanesulfonamide (Ms), β- trimethylsilylethanesulfonamide (SES), 9-anthracenesulfonamide, 4-(4' ,8'- dimethoxynaphthylmethyl)benzenesulfonamide (DNMB S ), benzylsulfonamide,
trifluoromethylsulfonamide, and phenacylsulfonamide.
[00174] Other nitrogen protecting groups include, but are not limited to, phenothiazinyl- (10)-acyl derivative, N'-p-toluenesulfonylaminoacyl derivative, N'-phenylaminothioacyl derivative, N-benzoylphenylalanyl derivative, N-acetylmethionine derivative, 4,5-diphenyl- 3-oxazolin-2-one, N-phthalimide, N-dithiasuccinimide (Dts), N-2,3-diphenylmaleimide, N-2,5-dimethylpyrrole, N-l, l,4,4-tetramethyldisilylazacyclopentane adduct (STABASE), 5-substituted l,3-dimethyl-l,3,5-triazacyclohexan-2-one, 5-substituted 1,3-dibenzyl- l,3,5-triazacyclohexan-2-one, 1-substituted 3,5-dinitro-4-pyridone, N-methylamine, N- allylamine, N-[2-(trimethylsilyl)ethoxy]methylamine (SEM), N-3-acetoxypropylamine, N- (l-isopropyl-4-nitro-2-oxo-3-pyroolin-3-yl)amine, quaternary ammonium salts, N- benzylamine, N-di(4-methoxyphenyl)methylamine, N-5-dibenzosuberylamine, N-
triphenylmethylamine (Tr), N-[(4-methoxyphenyl)diphenylmethyl] amine (MMTr), N-9- phenylfluorenylamine (PhF), N-2,7-dichloro-9-fluorenylmethyleneamine, N- ferrocenylmethylamino (Fcm), N-2-picolylamino N'-oxide, N-1,1- dimethylthiomethyleneamine, N-benzylideneamine, N-p-methoxybenzylideneamine, N- diphenylmethyleneamine, N-[(2-pyridyl)mesityl]methyleneamine, N-(N',N'- dimethylaminomethylene)amine, N,N '-isopropylidenediamine, N-p-nitrobenzylideneamine, N-salicylideneamine, N-5-chlorosalicylideneamine, N-(5-chloro-2- hydroxyphenyl)phenylmethyleneamine, N-cyclohexylideneamine, N-(5,5-dimethyl-3-oxo- l-cyclohexenyl)amine, N-borane derivative, N-diphenylborinic acid derivative, N- [phenyl(pentaacylchromium- or tungsten)acyl] amine, N-copper chelate, N-zinc chelate, N- nitroamine, N-nitrosoamine, amine N-oxide, diphenylphosphinamide (Dpp),
dimethylthiophosphinamide (Mpt), diphenylthiophosphinamide (Ppt), dialkyl
phosphoramidates, dibenzyl phosphoramidate, diphenyl phosphoramidate,
benzenesulfenamide, o-nitrobenzenesulfenamide (Nps), 2,4-dinitrobenzenesulfenamide, pentachlorobenzenesulfenamide, 2-nitro-4-methoxybenzenesulfenamide,
triphenylmethylsulfenamide, and 3-nitropyridinesulfenamide (Npys).
[00175] In certain embodiments, the substituent present on an oxygen atom is an oxygen protecting group (also referred to herein as an "hydroxyl protecting group"). Oxygen protecting groups include, but are not limited to, -Raa, -N(Rbb)2, -C(=0)SRaa, -C(=0)Raa, - C02Raa, -C(=0)N(Rbb)2, -C(=NRbb)Raa, -C(=NRbb)ORaa, -C(=NRbb)N(Rbb)2, -S(=0)Raa, - S02Raa, -Si(Raa)3, -P(Rcc)2, -P(RCC)3, -Ρ(=0)^, -P(=0)(Raa)2, -P(=0)(ORcc)2, - P(=0)2N(Rbb)2, and -P(=0)(NRbb)2, wherein Raa, Rbb, and Rcc are as defined herein. Oxygen protecting groups are well known in the art and include those described in detail in Protecting Groups in Organic Synthesis, T. W. Greene and P. G. M. Wuts, 3 edition, John Wiley & Sons, 1999, incorporated herein by reference.
[00176] Exemplary oxygen protecting groups include, but are not limited to, methyl, methoxylmethyl (MOM), methylthiomethyl (MTM), i-butylthiomethyl,
(phenyldimethylsilyl)methoxymethyl (SMOM), benzyloxymethyl (BOM), /?- methoxybenzyloxymethyl (PMBM), (4-methoxyphenoxy)methyl (p-AOM), guaiacolmethyl (GUM), i-butoxymethyl, 4-pentenyloxymethyl (POM), siloxymethyl, 2- methoxyethoxymethyl (MEM), 2,2,2-trichloroethoxymethyl, bis(2-chloroethoxy)methyl, 2- (trimethylsilyl)ethoxymethyl (SEMOR), tetrahydropyranyl (THP), 3- bromotetrahydropyranyl, tetrahydrothiopyranyl, 1-methoxycyclohexyl, 4- methoxytetrahydropyranyl (MTHP), 4-methoxytetrahydrothiopyranyl, 4-
methoxytetrahydrothiopyranyl S ,S-dioxide, l-[(2-chloro-4-methyl)phenyl]-4- methoxypiperidin-4-yl (CTMP), l,4-dioxan-2-yl, tetrahydrofuranyl, tetrahydrothiofuranyl, 2,3,3a,4,5,6,7,7a-octahydro-7,8,8-trimethyl-4,7-methanobenzofuran-2-yl, 1-ethoxyethyl, l-(2-chloroethoxy)ethyl, 1-methyl-l-methoxyethyl, 1-methyl-l-benzyloxyethyl, 1- methyl-l-benzyloxy-2-fluoroethyl, 2,2,2-trichloroethyl, 2-trimethylsilylethyl, 2- (phenylselenyl)ethyl, i-butyl, allyl, /?-chlorophenyl, /?-methoxyphenyl, 2,4-dinitrophenyl, benzyl (Bn), /?-methoxybenzyl, 3,4-dimethoxybenzyl, o-nitrobenzyl, /?-nitrobenzyl, p- halobenzyl, 2,6-dichlorobenzyl, /?-cyanobenzyl, /?-phenylbenzyl, 2-picolyl, 4-picolyl, 3- methyl-2-picolyl N-oxido, diphenylmethyl, p,p '-dinitrobenzhydryl, 5-dibenzosuberyl, triphenylmethyl, a-naphthyldiphenylmethyl, /?-methoxyphenyldiphenylmethyl, di(p- methoxyphenyl)phenylmethyl, tri( ?-methoxyphenyl)methyl, 4-(4'- bromophenacyloxyphenyl)diphenylmethyl, 4,4',4"-tris(4,5- dichlorophthalimidophenyl)methyl, 4,4',4"-tris(levulinoyloxyphenyl)methyl, 4,4',4"- tris(benzoyloxyphenyl)methyl, 3-(imidazol-l-yl)bis(4',4"-dimethoxyphenyl)methyl, 1,1- bis(4-methoxyphenyl)- -pyrenylmethyl, 9-anthryl, 9-(9-phenyl)xanthenyl, 9-(9-phenyl- 10-oxo)anthryl, l,3-benzodithiolan-2-yl, benzisothiazolyl S,S-dioxido, trimethylsilyl (TMS), triethylsilyl (TES), triisopropylsilyl (TIPS), dimethylisopropylsilyl (IPDMS), diethylisopropylsilyl (DEIPS), dimethylthexylsilyl, i-butyldimethylsilyl (TBDMS), t- butyldiphenylsilyl (TBDPS), tribenzylsilyl, tri-p-xylylsilyl, triphenylsilyl,
diphenylmethylsilyl (DPMS), i-butylmethoxyphenylsilyl (TBMPS), formate,
benzoylformate, acetate, chloroacetate, dichloroacetate, trichloroacetate, trifluoroacetate, methoxyacetate, triphenylmethoxyacetate, phenoxyacetate, /?-chlorophenoxyacetate, 3- phenylpropionate, 4-oxopentanoate (levulinate), 4,4-(ethylenedithio)pentanoate
(levulinoyldithioacetal), pivaloate, adamantoate, crotonate, 4-methoxycrotonate, benzoate, p- phenylbenzoate, 2,4,6-trimethylbenzoate (mesitoate), methyl carbonate, 9-fluorenylmethyl carbonate (Fmoc), ethyl carbonate, 2,2,2-trichloroethyl carbonate (Troc), 2- (trimethylsilyl)ethyl carbonate (TMSEC), 2-(phenylsulfonyl) ethyl carbonate (Psec), 2- (triphenylphosphonio) ethyl carbonate (Peoc), isobutyl carbonate, vinyl carbonate, allyl carbonate, i-butyl carbonate (BOC or Boc), /?-nitrophenyl carbonate, benzyl carbonate, p- methoxybenzyl carbonate, 3,4-dimethoxybenzyl carbonate, o-nitrobenzyl carbonate, p- nitrobenzyl carbonate, S-benzyl thiocarbonate, 4-ethoxy-l-napththyl carbonate, methyl dithiocarbonate, 2-iodobenzoate, 4-azidobutyrate, 4-nitro-4-methylpentanoate, o- (dibromomethyl)benzoate, 2-formylbenzenesulfonate, 2-(methylthiomethoxy)ethyl, 4- (methylthiomethoxy)butyrate, 2-(methylthiomethoxymethyl)benzoate, 2,6-dichloro-4-
methylphenoxyacetate, 2,6-dichloro-4-( 1 , 1 ,3 ,3-tetramethylbutyl)phenoxyacetate, 2,4- bis(l,l-dimethylpropyl)phenoxyacetate, chlorodiphenylacetate, isobutyrate, monosuccinoate, (E)-2-methyl-2-butenoate, o-(methoxyacyl)benzoate, a-naphthoate, nitrate, alkyl
N,N,N',N'-tetramethylphosphorodiamidate, alkyl N-phenylcarbamate, borate,
dimethylphosphinothioyl, alkyl 2,4-dinitrophenylsulfenate, sulfate, methanesulfonate (mesylate), benzylsulfonate, and tosylate (Ts).
[00177] In certain embodiments, the substituent present on an sulfur atom is a sulfur protecting group (also referred to as a "thiol protecting group"). Sulfur protecting groups include, but are not limited to, -Raa, -N(Rbb)2, -C(=0)SRaa, -C(=0)Raa, -CO^, - C(=0)N(Rbb)2, -C(=NRbb)Raa, -C(=NRbb)ORaa, -C(=NRbb)N(Rbb)2, -S(=0)Raa, -SO^, - Si(Raa)3 -P(RCC)2, -P(RCC) , -P(=0)2Raa, -P(=0)(Raa)2, -P(=0)(ORcc)2, -P(=0)2N(Rbb)2, and - P(=0)(NRbb)2, wherein Raa, Rbb, and Rcc are as defined herein. Sulfur protecting groups are well known in the art and include those described in detail in Protecting Groups in Organic Synthesis, T. W. Greene and P. G. M. Wuts, 3rd edition, John Wiley & Sons, 1999, incorporated herein by reference.
[00178] The terms "aminooxy," or "aminooxy group," are used interchangeably herein and refer to functional groups having the general formula:
R NH2 ^ wherein R31 is optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, optionally substituted heteroaryl, or optionally substituted heterocyclyl. In some embodiments, R 31 is an amino acid, wherein the point of attachment for the oxygen is on the side chain of the amino acid. In certain embodimetns, the amino acid is withinin a polypeptide.
[00179] The term "tautomers" or "tautomeric" refers to two or more interconvertable compounds resulting from at least one formal migration of a hydrogen atom and at least one change in valency (e.g., a single bond to a double bond, a triple bond to a single bond, or vice versa). The exact ratio of the tautomers depends on several factors, including temperature, solvent, and pH. Tautomerizations (i.e., the reaction providing a tautomeric pair) may catalyzed by acid or base. Exemplary tautomerizations include keto-to-enol, amide-to-imide, lactam-to-lactim, enamine-to-imine, and enamine-to-(a different enamine) tautomerizations.
[00180] It is also to be understood that compounds that have the same molecular formula but differ in the nature or sequence of bonding of their atoms or the arrangement of their atoms in space are termed "isomers". Isomers that differ in the arrangement of their atoms in space are termed "stereoisomers".
[00181] Stereoisomers that are not mirror images of one another are termed "diastereomers" and those that are non-superimposable mirror images of each other are termed "enantiomers". When a compound has an asymmetric center, for example, it is bonded to four different groups, a pair of enantiomers is possible. An enantiomer can be characterized by the absolute configuration of its asymmetric center and is described by the R- and S-sequencing rules of Cahn and Prelog, or by the manner in which the molecule rotates the plane of polarized light and designated as dextrorotatory or levorotatory (i.e., as (+) or (-)-isomers respectively). A chiral compound can exist as either individual enantiomer or as a mixture thereof. A mixture containing equal proportions of the enantiomers is called a "racemic mixture".
[00182] The terms "carbonyl," or "carbonyl group," are used interchangeably herein and refer to functional groups composed of a carbon atom double-bonded to any oxygen atom.
32 33
wherein each of R and R independently represents hydroxyl, optionally substituted amino, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, optionally substituted heteroaryl, or optionally substituted heterocyclyl. Examples of carbonyls include, but are not limited to, aldehydes, ketones, carboxylic acids, esters, amides, enones, acyl halides, acid anhydrides, and imides. In some embodiments, a carbonyl- containing compound refers to a compound having an aldehyde group, or a compound capable of forming an aldehyde group through isomerization. For example, in some embodiments, certain sugars (e.g. , reducing sugars) such as glucose, form aldehydes through isomerization. A sugar is classified as a reducing sugar if it has an open-chain form with an aldehyde group or a free hemiacetal group. Monosaccharides which contain an aldehyde group are known as aldoses, and those with a ketone group are known as ketoses. The aldehyde can be oxidized via a redox reaction in which another compound is reduced. Thus, a reducing sugar is one that is capable of reducing certain chemicals. Sugars with ketone groups in their open chain form are capable of isomerizing via a series of tautomeric shifts to produce an aldehyde group in solution. Therefore, ketone-bearing sugars like fructose are considered reducing sugars but it is the isomer containing an aldehyde group which is reducing since ketones cannot be oxidized without decomposition of the sugar. This type of isomerization is catalyzed by the base present in solutions which test for the presence of aldehydes.
[00183] The term "hydrazide," as used herein, refers to functional groups having the general formula:
wherein R is optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, optionally substituted heteroaryl, or optionally substituted heterocyclyl. In some embodiments, R34 is an amino acid, wherein the point of attachment for the oxygen is on the side chain of the amino acid. In certain embodimetns, the amino acid is withinin a polypeptide.
[00184] The term "hydrazone," as used herein, refers to compound having the general formula:
, wherein each of R33, Rib, and RJ/ is independently optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, optionally substituted heteroaryl, or optionally substituted heterocyclyl. The term "hydrazone linkage,"
as used herein, refers to the formula:
. Hydrzones can be prepared from, for example, joining of a compound comprising a hydrazide group and a compound comprising a carbonyl.
[00185] The term "acyl," as used herein, is a subset of a substituted alkyl group, and refers to a group having the general formula -C(=0)RA, -C(=0)ORA, -C(=0)-0-C(=0)RA, - C(=0)SRA, or -C(=0)N(RA)2, wherein each instance of RAis independently hydrogen, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, optionally substituted heteroaryl, or optionally substituted heterocyclyl. Exemplary acyl groups include aldehydes (-CHO), carboxylic acids (-C02H), ketones, acyl halides, esters, amides, imines, carbonates, carbamates, and ureas. Acyl substituents include, but are not limited to, any of the substituents described herein, that result in the formation of a stable moiety.
[00186] The term "azide" or "azido," as used herein, refers to a group of the formula (-N3).
Radiolabled proteins
[00187] Aspects of the disclosure provide antibodies, or fragments thereof, (e.g., single domain antibodies) comprising a radiolabel and/or a hydrophilic polymer. It shold be appreciated that any of the linkages provided herein may be used to link proteins (e.g., antibodies) to a radiolabel and/or a hydrophilic polymer. It should also be appreciated that agents, such as the chelating moieties and radionuclides provided below may be substituted with another agents, such as any of the chelating moieties and radionuclides provided herein
[00188] Another aspect of the present invention provides radiolabeled proteins. The radiolabeled proteins can be prepared from modified proteins of Formula (I).
[00189] In certain embodiments, provided herein is a modified protein of Formula (I):
L1 is a linker comprising at least four amino acids formed by enzymatic conjugation between two enzyme recognition sequences; and
R1 comprises a reactive group capable of undergoing a click chemistry reaction.
[00190] As generally defined herein, L1 is a linker formed by enzymatic conjugation between two enzyme recognition sequences. In certain embodiments, L1 comprises at least four amino acids. In certain embodiments, L1 comprises at least five amino acids. In certain embodiments, L1 comprises at least six amino acids. In certain embodiments, L1 comprises at least seven amino acids. In certain embodiments, L1 is a linker formed by sortase-mediated transpeptidation of two sortase recognition sequences. In certain embodiments, L1 is - LPXTGGGK-, -LPXTGGG-, -NPXTGGGK-, NPXTGGG-, -LPXTAAA-, -NPXTAAA-,- LPXTGGGGG-, or -LPGAG-, wherein each instance of X is independently an amino acid. In certain embodiments, X is E. In certain embodiments, X is Q. In certain embodiments, X is K.
in embodiments, the modified protein is formed by enzymatic conjugation
and a compound of Formula (a): B— R (a), wherein each of A and B is independently an enzyme recognition sequence. In certain embodiments, the modified protein
I Protein I— A
is formed by sortase-mediated transpeptidation of ^ ' ; and the compound of
Formula (a): B— R (a), wherein A comprises a C-terminal sortase recognition sequence, and B comprises a N-terminal sortase recognition sequence; or A comprises a N-terminal sortase recognition sequence, and B comprises a C-terminal sortase recognition sequence.
[00192] In certain embodiments, A comprises LPXTX or NPXTX, and B comprises an oligoglycine or an oligoalanine sequence; wherein each instance of X is independently an amino acid. In certain embodiments, B comprises LPXTX or NPXTX, and A comprises an oligoglycine or an oligoalanine sequence; wherein each instance of X is independently an amino acid. In certain embodiments, A is LPETG, LPETA , NPQTN, or NPKTG, and B is GGG or AAA. In certain embodiments, A comprises an oligoglycine or an oligoalanine sequence, and B comprises LPXTX or NPXTX, wherein each instance of X is independently an amino acid. In certain embodiments, B is LPETG, LPETA, NPQTN, or NPKTG, and A is GGG or AAA.
[00193] As used herein, the enzyme recognition sequence is an amino acid sequence recognized by a transamidase enzyme. In certain embodiments, the transamidase recognition sequence is a sortase recognition sequence or a sortase recognition motif. In certain
embodiments, the sortase is sortase A (SrtA). In certain embodiments, the sortase is sortase B (SrtB).
[00194] As generally defined herein, R1 is a reactive group capable of undergoing a click chemistry reaction.
[00195] Click chemistry is a chemical approach introduced by Sharpies s in 2001 and describes chemistry tailored to generate substances quickly and reliably by joining small units together. See, e.g., Kolb, Finn and Sharpless Angewandte Chemie International Edition (2001) 40: 2004-2021; Evans, Australian Journal of Chemistry (2007) 60: 384-395). Exemplary coupling reactions (some of which may be classified as "Click chemistry") include, but are not limited to, formation of esters, thioesters, amides (e.g., such as peptide coupling) from activated acids or acyl halides; nucleophilic displacement reactions (e.g., such as nucleophilic displacement of a halide or ring opening of strained ring systems); azide-alkyne Huisgon cycloaddition; thiol-yne addition; imine formation; Michael additions (e.g., maleimide addition); Diels-Alder reaction and inverse electron demand Diels-Alder reaction; and [4+1] cycloadditions (e.g. between isonitriles (isocyanides) and tetrazines). In certain embodiments, the click chemistry reaction is a Diels-Alder reaction. It is to be understood that the click chemistry reaction may be followed by additional one or more chemical transformations. In certain embodiments, the click chemistry reaction is a Diels-Alder reaction followed by an retro-Diels-Alder reaction.
[00196] In certain embodiments, R1 is a reactive group capable of undergoing a [3+2] cycloaddition. In certain embodiments, R1 comprises a dipolarophile. In certain
embodiments, R1 comprises an alkynyl group. In certain embodiments, R1 comprises
comprises a 1,3-dipole. In certain embodiments, R comprises an azido. In certain
embodiments, R1 is a reactive group capable of undergoing a a Diels-Alder cycloaddition. In certain embodiments, R1 comprises a conjugated diene. In certain embodiments, R1 comprises a tetrazine or a quadricyclane. In certain embodiments, R1 comprises a tetrazine. In certain embodiments, R1 comprises an unsubstituted tetrazine. In certain embodiments, R1 comprises a substituted tetrazine.
wherein
R£ is hydrogen, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, optionally substituted heteroaryl, or optionally substituted heterocyclyl; and
Rs is a bond, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted arylene, optionally substituted heteroarylene, or optionally substituted heterocyclylene.
[00198] As generally defined herein, R£ is hydrogen, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, optionally substituted heteroaryl, or optionally substituted heterocyclyl. In certain embodiments, R£ is hydrogen. In certain embodiments, R£ is optionally substituted aliphatic. In certain embodiments, R£ is optionally substituted C1-6 alkyl. In certain embodiments, R£ is unsubstituted C1-6 alkyl. In certain embodiments, R£ is methyl or ethyl. In certain embodiments, R£ is substituted Ci_6 alkyl. In certain embodiments, R£ is optionally substituted aryl. In certain embodiments, R£ is optionally substituted phenyl. In certain embodiments, R£ is optionally substituted heteroaryl. In certain embodiments, R£ is optionally substituted pyridine.
[00199] As generally defined herein, Rs is a bond, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted arylene, optionally substituted heteroarylene, or optionally substituted heterocyclylene. In certain embodiments, Rs is a bond. In certain embodiments, Rs is optionally substituted aliphatic. In certain embodiments, Rs is optionally substituted Ci_6 alkyl. In certain embodiments, Rs is unsubstituted Ci_6 alkyl. In certain embodiments, Rs is methyl or ethyl. In certain embodiments, Rs is substituted Ci_6 alkyl. In certain embodiments, Rs is optionally substituted heteroaliphatic. In certain embodiments, Rs is optionally substituted arylene. In certain embodiments, Rs is optionally
substituted phenyl. In certain embodiments, Rs is optionally substituted heteroarylene. In certain embodiments, Rs is optionally substituted pyridine.
[00200] In certain embodiments, R1 comprises a dienophile. In certain embodiments, R1 comprises an optionally substituted alkene. In certain embodiments, R1 comprises a
embodiments, R1 comprises a substututed cyclooctene of the formula:
R is a bond, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted arylene, optionally substituted heteroarylene, or optionally substituted heterocyclylene. R1 comprises a substututed cyclooctene of the
formula: . In certain embodiments, R1 comprises a irans-cyclooctene. In iments, R1 comprises a substututed irans-cyclooctene of the formula
wherein R is as de s, R comprises a
substututed irans-cyclooctene of th R is as defined herein. In certain embodiments, R1 comprises an unsubstututed irans-cyclooctene.
[00201] Another aspect of the invention provides a radioactive protein of Formula (II)
( Protein }— L1—L2-18F ^
wherein
L1 is a linker comprising at least four amino acids formed by enzymatic conjugation between two enzyme recognition sequences; and
2
L is optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted arylene, optionally substituted heteroarylene, or optionally substituted
heterocyclylene.
[00202] In certain embodiments, the linker L is formed by a click chemistry reaction. In
2
certain embodiments, the linker L is formed by a [3+2] cycloaddition. In certain
embodiments, the linker L is formed by a Diels-Alder cycloaddition. In certain
2
embodiments, the linker L is formed by a Diels-Alder cycloaddition followed by one or more chemical transformations. In certain embodiments, the linker L is formed by a Diels- Alder cycloaddition followed by retro- Diels-Alder reaction.
[00203] As generally defined herein, L is optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted arylene, optionally substituted
heteroarylene, or optionally substituted heterocyclylene. In certain embodiments, L is optionally substituted aliphatic. In certain embodiments, L is optionally substituted heteroaliphatic. In certain embodiments, L is optionally substituted arylene. In certain
2 2 embodiments, L is optionally substituted cycloalkylene. In certain embodiments, L is optionally substituted heteroarylene.
[00204] In certain embodiments, the radioactive protein of Formula (II) is formed by a click chemistry reaction of the modified protein of Formula (I) and a compound of Formula (b):
18 F-R 2 (b), wherein R 2 is a reactive group capable of undergoing the click chemistry reaction.
[00205] As generally defined herein, R is a reactive group capable of undergoing a click chemistry reaction. In certain embodiments, R is a reactive unsaturated group capable of undergoing a [3+2] cycloaddition. In certain embodiments, R comprises a dipolarophile. In certain embodiments, R 2 comprises an alkynyl group. In certain embodiments, R 2 comprises a 1,3-dipole. In certain embodiments, R 2 comprises an azido. In certain embodiments, R 2 is a reactive group capable of undergoing a a Diels-Alder cycloaddition. In certain embodiments,
R 2 comprises a conjugated diene. In certain embodiments, R 2 comprises a tetrazine or a quadricyclane. In certain embodiments, R 2 comprises a tetrazine. In certain embodiments, R 2 comprises an unsubstituted tetrazine. In certain embodiments, R comprises a substituted tetrazine.
wherein
R£ is hydrogen, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, optionally substituted heteroaryl, or optionally substituted heterocyclyl; and
Rs is a bond, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted arylene, optionally substituted heteroarylene, or optionally substituted heterocyclylene.
[00207] In certain embodiments, R 2 comprises a dienophile. In certain embodiments, R 2 comprises an optionally substituted alkene. In certain embodiments, R comprises a cyclooctene. In certain embodiments, R comprises a irans-cyclooctene. In certain embodiments, R 2 comprises a substututed irans-cyclooctene. In certain embodiments, R 2 comprises an unsubstututed irans-cyclooctene.
wherein R^ is optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, optionally substituted heteroaryl, or optionally substituted heterocyclyl; and R^ comprises 18F. In certain embodiments, R^ is optionally substituted aliphatic. In certain embodiments, R^ is optionally substituted heteroaliphatic. In certain embodiments, R^ is -0-Ci_6alkylene, wherein the Ci_6alkylene comprises 18F.
[00210] Compounds of Formula (b- 1-a) can be prepared from a compound of Formula (b-
1-a-i):
b-l-a-i), with a proper nucleophile comprising 18F, wherein h is as defined herein, LG is a leaving group. In certain embodiments, the compounds of Formula (b-1) can be prepared according to Scheme S6 or Scheme S6-a.
[00211] The term "leaving group" is given its ordinary meaning in the art of synthetic organic chemistry and refers to an atom or a group capable of being displaced by a nucleophile. Examples of suitable leaving groups include, but are not limited to, halogen
(such as F, CI, Br, or I (iodine)), alkoxycarbonyloxy, aryloxycarbonyloxy, alkanesulfonyloxy, arenesulfonyloxy, alkyl-carbonyloxy (e.g., acetoxy), arylcarbonyloxy, aryloxy, methoxy, N,0-dimethylhydroxylamino, pixyl, and haloformates. In some cases, the leaving group is a sulfonic acid ester, such as toluenesulfonate (tosylate, -OTs), methanesulfonate (mesylate, - OMs), /?-bromobenzenesulfonyloxy (brosylate, -OBs), or trifluoromethanesulfonate (triflate, -OTf). In some cases, the leaving group is a brosylate, such as /?-bromobenzenesulfonyloxy. In some cases, the leaving group is a nosylate, such as 2-nitrobenzenesulfonyloxy. In some embodiments, the leaving group is a sulfonate-containing group. In some embodiments, the leaving group is a tosylate group. The leaving group may also be a phosphineoxide (e.g. , formed during a Mitsunobu reaction) or an internal leaving group such as an epoxide or cyclic sulfate. Other non-limiting examples of leaving groups are water, ammonia, alcohols, ether moieties, thioether moieties, zinc halides, magnesium moieties, diazonium salts, and copper moieties. In certain embodiments, LG is -OTs.
compound of Formula (b) is of Formula (b-l-b):
L4 and Y are as defined herein.
compound of Formula (b) is of Formula (b-l-c):
l-c), wherein L4, M, La, Lb, and Lc are as defined herein, and— indicates a coordination bond or absent, as valency permits. In certain embodiments, — is a single coordination bond. In certain embodiments,— is absent.
[00214] In certain embodiments, a compound of Formula (b) is of the formula:
18 2
[00215] In certain embodiments, a compound of Formula (b): F-R (b), is of Formula (b-
wherein Rs and R£ are as defined herein.
wherein R£, Rp, and p are as defined herein.
[00217] In certain embodiments a compound of Formula (b) is of Formula (b-2-al):
wherein R£, RN1, L3, Rql, and ql are as defined herein; and R is an optionally substituted
Q
carbohydrate group; provided that R comprises
[00218] A "carbohydrate group" or a "carbohydrate" refers to a monosaccharide or a polysaccharide (e.g. , a disaccharide or oligosaccharide). Exemplary monosaccharides include, but are not limited to, natural sugars, such as allose, altrose, glucose, mannose, gulose, idose, galactose, talose, ribose, arabinose, xylose, and lyxose. Disaccharides are two joined monosaccharides. Exemplary disaccharides include, but are not limited to, sucrose, maltose, cellobiose, and lactose. Typically, an oligosaccharide includes between three and ten monosaccharide units (e.g. , raffinose, stachyose). The carbohydrate group may be a natural sugar or a modified sugar. Exemplary modified sugars include, but are not limited to, sugars where the hydroxyl group is replaced with an amino group and/or alkyl group (e.g., such as desosamine), 2'-deoxyribose wherein a hydroxyl group is removed, 2 '-fluororibose wherein a hydroxyl group is replace with a fluorine, or N-acetylglucosamine, or a nitrogen- containing form of glucose (e.g. , 2'-fluororibose, deoxyribose, and hexose), and the like. Various carbohydrates are further described below and herein. Carbohydrates may exist in many different forms, for example, conformers, cyclic forms, acyclic forms, stereoisomers, tautomers, anomers, and isomers. In certain embodiments, R is an optionally substituted glucose.
[00219] In certain embodiments a compound of Formula (b) is of Formula (b-2-a2):
wherein R£, RN1 are as defined herein; and RG1 is an optionally substituted carbohydrate group or a fragment thereof; provided that R Gl comprises 18 F.
[00220] The oxime com ounds of Formula (b-2-a2)
can be prepared from optionally substituted tetrazine-aminooxy and a radiolabeled optionally substituted aldehyde of the formula Ras-CHO, wherein Ras is optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, optionally substituted heteroaryl, or optionally substituted heterocyclyl (Scheme S I). In certain embodiments, Ras is an optionally substituted carbohydrate group or a fragment thereof. In certain embodiments, Ras is an optionally substituted glucose or a fragment thereof. In certain embodiments, the reaction is carried out in the presence of a catalyst. In certain embodiments, the catalyst is m- phenylenediamine, p-phenylenediamine, or p-anisidine. In certain embodiments, the catalyst is m-phenylenediamine. In certain embodiments, the molar ratio of the optionally substituted tetrazine-aminooxy to the catalyst is from about 10: 1 to 1: 10. In certain embodiments, the molar ratio of the optionally substituted tetrazine-aminooxy to the catalyst is from about 1: 1 to 1:8. In certain embodiments, the molar ratio of the optionally substituted tetrazine- aminooxy to the catalyst is from about 1: 1 to 1:6. In certain embodiments, the molar ratio of the optionally substituted tetrazine-aminooxy to the catalyst is from about 1:2 to 1:4. In certain embodiments, the molar ratio of the optionally substituted tetrazine-aminooxy to the catalyst is about 1:4.
Scheme S I.
[00221] In certain embodiments, Ras is an optionally substituted carbohydrate group or a fragment thereof, provided Ras comprises 18F. In certain embodiments, Ras is an optionally substituted glucose or a fragment thereof. In certain embodiments, Ras is 18F-FDG of a fragment thereof.
[00222] As provided in Scheme S I, the resulting oxime product can be easily purified from the reaction mixture to the change in hydrophilicity.
[00223] In certain embodimetns of Scheme S I, the excess of tetrazine-aminooxy can be captured by reacting with another water soluble carbohydrate. In certain embodiments, the water soluble carbohydrate is glucosamine 6-sulfate.
[00224] In certain embodiments a compound of Formula (b) is of Formula (b-2-a2):
wherein R£, RN1, L3, Rsl, Rs2, Rs3, and Rs4 are as defined herein.
[00225] In certain embodiments a compound of Formula (b) is of Formula (b-2-a3):
wherein R£, RN1, L3, Rsl, Rs2, Rs3, and Rs4 are as defined herein.
[00226] In certain embodiments, a compound of Formula (b) is of Formula (b-2-b):
wherein R RN1 , L3, RQL , and ql are as defined herein.
[00227] In certain embodiments, a compound of Formula (b) is of Formula (b-2-bl):
wherein R L4, and Y are as defined herein.
[00229] In certain embodiments, a compound of Formula (b) is of Formula (b-3-a):
wherein R L4, La, Lb, and Lc are as defined herein.
[00230] In certain embodiments, a compound of Formula (b) is of the following formula:
2
[00231] In certain embodiments the linker L is of Formula (ii):
wherein
R£ is hydrogen, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, optionally substituted heteroaryl, or optionally substituted heterocyclyl;
Rs is a bond, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted arylene, optionally substituted heteroarylene, or optionally substituted heterocyclylene;
each instance of Rcl is hydrogen, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, optionally substituted heteroaryl, or optionally substituted heterocyclyl; or optionally two Rcl taken with the intervening atoms to form an optionally substituted carbocyclyl or optionally substituted heterocyclyl ring;
Rc2 is a bond, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted arylene, optionally substituted heteroarylene, or optionally substituted heterocyclylene;
m is 0, 1, 2, 3, 4, 5, 6, 7, or 8, as valency permits;
a indicates point of attachment to L1; and
b indicates point of attachment to 18 F.
[00232] In certain embodiments, m is 0. In certain embodiments, m is 1. In certain embodiments, m is 2. In certain embodiments, m is 3. In certain embodiments, m is 4.
[00233] As generally defined herein, each instance of Rcl is independently hydrogen, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, optionally substituted heteroaryl, or optionally substituted heterocyclyl. In certain embodiments, Rcl is hydrogen. In certain embodiments, Rcl is optionally substituted aliphatic. In certain embodiments, Rcl is optionally substituted alkyl. In certain embodiments, Rcl is optionally substituted heteroaliphatic. In certain embodiments, two Rcl taken with the intervening atoms to form an optionally substituted carbocyclyl. In certain embodiments, two Rcl taken with the intervening atoms to form an optionally substituted cyclopropyl.
[00234] As generally defined herein, Rc2 is a bond, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted arylene, optionally substituted heteroarylene, or optionally substituted heterocyclylene. In certain embodiments, Rc2 is a bond. In certain embodiments, Rc2 is optionally substituted aliphatic. In certain embodiments, Rc2 is optionally substituted alkyl. In certain embodiments, Rc2 is optionally substituted heteroaliphatic. In certain embodiments, Rc2 is optionally substituted alkoxy. In certain embodiments, Rc2 is an optionally substituted amino group.
[00235] In certain embodiments the linker L is of Formula (ii-a):
wherein n is an integer between 1 and 8, inclusive.
[00236] In certain embodiments, n is 1. In certain embodiments, n is 2. In certain embodiments, n is 3. In certain embodiments, n is 4. In certain embodiments, n is 5. In embodiments, n is 6. In certain embodiments, n is 7. In certain embodiments, n is 8.
wherein n is an integer between 1 and 8, inclusive.
[00238] In certain embodiments the linker L is of Formula (iii):
wherein
R£ is hydrogen, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, optionally substituted heteroaryl, or optionally substituted heterocyclyl;
Rs is a bond, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted arylene, optionally substituted heteroarylene, or optionally substituted heterocyclylene;
each instance of Rcl is hydrogen, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, optionally substituted heteroaryl, or optionally substituted heterocyclyl;
Rc2 is a bond, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted arylene, optionally substituted heteroarylene, or optionally substituted heterocyclylene;
m is 0, 1, 2, 3, 4, 5, 6, 7, or 8, as valency permits;
a indicates point of attachment to L1; and
b indicates point of attachment to 18 F.
a
(iii-a).
[00240] In certain embodiments wherein -L 2 -F 18 is of Formula (iii-b):
wherein
each instance of Rp is independently hydrogen, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted heterocyclyl, hydroxyl, or optionally substituted amino; provided at least one R Όp is not hydrogen and comprises F 18 ; and
p is 1, 2, 3, 4, or 5.
[00241] In certain embodiments, p is 1. In certain embodiments, p is 2. In certain embodiments, p is 3. In certain embodiments, p is 4. In certain embodiments, p is 3. In certain embodiments, p is 5.
[00242] As generally defined herein, Rp is hydrogen, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted heterocyclyl, hydroxyl, or optionally substituted amino; wherein at least one Rp is not hydrogen and comprises F18. In certain embodiments, Rp is hydrogen. In certain embodiments, Rp is optionally substituted aliphatic. In certain embodiments, Rp is optionally substituted Ci_6 alkyl. In certain embodiments, Rp is unsubstituted Ci_6 alkyl. In certain embodiments, Rp is methyl or ethyl. In certain
embodiments, Rp is substituted Ci_6 alkyl. In certain embodiments, Rp is optionally substituted aryl. In certain embodiments, Rp is optionally substituted phenyl. In certain embodiments, Rp is optionally substituted heteroaryl. In certain embodiments, Rp is
optionally substituted pyridine. In certain embodiments, least one Rp is not hydrogen and comprises F .
2 18
[00243] In certain embodiments wherein -L -F is of Formula (iii-bl):
wherein
L is a bond, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted arylene, optionally substituted heteroarylene, or optionally substituted heterocyclylene;
RN1 is independently hydrogen, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, or optionally substituted heteroaryl, or a nitrogen protecting group; and
each of Rsl, Rs2, Rs3, and Rs4 is independently hydrogen, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, or optionally substituted heteroaryl, or an oxygen protecting group.
[00244] As generally defined herein, L is a bond, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted arylene, optionally substituted heteroarylene, or optionally substituted heterocyclylene. In certain embodiments, L is a bond. In certain embodiments, L is optionally substituted aliphatic. In certain embodiments,
3 3
L is optionally substituted heteroaliphatic. In certain embodiments L comprises an oxime
moiety. In certain embodiments, L is of the formula , wherein c indicates the point of attachment to -N-R -; d indicates the point of attachment to -CH F-; and u is 1, 2, 3, 4, or 5. In certain embodiments, L is C=0.
[00245] In certain embodiments, RN1 is independently hydrogen. In certain embodiments, RN1 is optionally substituted aliphatic. In certain embodiments, RN1 is optionally substituted alkyl. In certain embodiments, RN1 is an amino protectin group.
[00246] In certain embodiments, Rsl is independently hydrogen. In certain embodiments, Rsl is optionally substituted aliphatic. In certain embodiments, Rsl is optionally substituted alkyl. In certain embodiments, Rsl is an oxygen protectin group. In certain embodiments, Rs is acyl (e.g. acetyl).
[00247] In certain embodiments, Rs2 is independently hydrogen. In certain embodiments, Rs2 is optionally substituted aliphatic. In certain embodiments, Rs2 is optionally substituted alkyl. In certain embodiments, Rs2 is an oxygen protectin group. In certain embodiments, Rs is acyl (e.g. acetyl).
[00248] In certain embodiments, Rs3 is independently hydrogen. In certain embodiments, Rs3 is optionally substituted aliphatic. In certain embodiments, Rs3 is optionally substituted alkyl. In certain embodiments, Rs3 is an oxygen protectin group. In certain embodiments, Rs is acyl (e.g. acetyl).
[00249] In certain embodiments, Rs4 is independently hydrogen. In certain embodiments, Rs4 is optionally substituted aliphatic. In certain embodiments, Rs4 is optionally substituted alkyl. In certain embodiments, Rs4 is an oxygen protectin group. In certain embodiments, Rs is acyl (e.g. acetyl).
[00250] In certain embodiments, Rsl, Rs2, Rs3, and R54 are all hydrogen.
[00251] In certain embodiments, RN1, Rsl, Rs2, Rs3, and Rs4 are all hydrogen.
[00252] In certain embodiments, RN1, Rsl, Rs2, Rs3, and Rs4 are all hydrogen; and R£ is optionally substituted aliphatic. In certain embodiments, RN1, Rsl, Rs2, Rs3, and Rs4 are all hydrogen; and R£ is optionally substituted Ci_6 alkyl. In certain embodiments, RN1, Rsl, Rs2, Rs3, and Rs4 are all hydrogen; and R£ is methyl or ethyl.
[00253] In certain embodiments wherein -L 2 -F 18 is of the formula:
wherein
L is a bond, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted arylene, optionally substituted heteroarylene, or optionally substituted heterocyclylene;
RN1 is independently hydrogen, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, or optionally substituted heteroaryl, or a nitrogen protecting group;
each instance of Rql is independently hydrogen, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted heterocyclyl, hydroxyl, or optionally substituted amino; and ql is 0, 1, 2, 3, or 4.
[00255] In certain embodiments, R£ is optionally substituted aliphatic and Rql is h drogen.
In certain embodiments, R£ is optionally substituted C1-6 alkyl; L3 is
is 1; and Rql is hydrogen.
[00256] In certain embodiments, -L 2 -F 18 is of the formula:
wherein
RN1 is independently hydrogen, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, or optionally substituted heteroaryl, or a nitrogen protecting group; and
each instance of Rq2 is independently hydrogen, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, optionally substituted carbocyclyl, optionally substituted heteroaryl, optionally substituted heterocyclyl, hydroxyl, or optionally substituted amino; and
q2 is 0, 1, 2, 3, or 4.
[00258] In certain embodiments, q2 is 0. In certain embodiments, q2 is 1. In certain embodiments, ql is 2. In certain embodiments, q2 is 3. In certain embodiments, q2 is 4.
[00259] In certain embodiments, Rq2 is hydrogen. In certain embodiments, Rq2 is optionally substituted aliphatic. In certain embodiments, Rq2 is optionally substituted Ci_6 alkyl.
[00260] In certain embodiments, R£ is optionally substituted aliphatic and Rq2 is hydrogen.
[00261] In certain embodiments -L 2 -F 18 is of the formula:
wherein
L is a bond, optionally substituted aliphatic, optionally substituted hetero aliphatic, optionally substituted arylene, optionally substituted heteroarylene, or optionally substituted heterocyclylene;
RN1 is independently hydrogen, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, or optionally substituted heteroaryl, or a nitrogen protecting group; and
R is independently hydrogen, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, or optionally substituted heteroaryl, wherein RZ comprise F.
[00263] In certain embodiments, wherein -L 2 -F 18 is of Formula (iii-b4-a):
(Hi-b4-a)
[00264] In certain embodiments, R is an optionally substituted thiol.
[00265] In certain embodiments, -L 2 -F 18 is of Formula (iii-c):
(iii-c)
wherein
Y is a ligand capable of chelating to a pharmaceutically acceptable metal complex comprising F18; and
L4 is is a bond, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted arylene, optionally substituted cycloalkylene, optionally substituted heteroarylene, or optionally substituted heterocyclylene.
[00266] As generally defined herein, Y is a ligand capable of chelating to a
18
pharmaceutically acceptable metal complex comprising F . As used herein, a ligand refers to an ion or molecule (functional group) that binds to a central metal atom to form a
coordination complex. The bonding between metal and ligand generally involves formal donation of one or more of the ligand 's electron pairs. The nature of metal-ligand bonding can range from covalent to ionic. Exemplary monodentate ligands include, but are not limited to, CO, organonitriles (e.g., CH3CN, CH3CH2CN), monosubstituted amines, disubstituted amines, trisubstituted amines, heterocyclyls (e.g., pyridine, piperidine), dialkylcyanamides, triphenylphosphine oxide, THF, DMF, or NMF. Exemplary bidentate ligands include, but are not limited to, 1,5-cyclooctadiene, norbornadiene, 1,2-ethylenediamine,
tetramethylethylenediamine, 1,2-dimethoxyethane, diglyme, or 2,5-dithiahexane. Exemplary tridentate ligands include, but are not limited to, conjugated cyclic triene (e.g. ,
cycloheptatriene), conjugated acyclic triene, arenes (e.g., benzene, toluene, xylene, mesitylene, naphthalene), tetraazamacrocyles (e.g., tetraazacyclododecane), polyamines (e.g., diethylenetriamine), and trithiocylononane. In certain embodiments, the ligand is a polydentate ligand. In certain embodiments, the ligand comprises 1,4,7-triazacyclononane- triacetic acid (NOT A), 1,4,7, 10-tetraazacyclododecane-tetraacetic acid (DOT A), or triazacyclononane-phosphinate (TRAP).
[00267] The phrase "pharmaceutically acceptable" means that the metal complex is suitable for administration to a subject. In certain embodiments, the metal complex is a halide metal complex. In certain embodiments, the metal is a pharmaceutically acceptable metal. In certain embodiments, the metal is IIA or IDA group metal. In certain embodiments, the metal is an early transition metal. In certain embodiments, the metal is Al.
[00268] In certain embodiments, L4 is a bond. In certain embodiments, L4 is an optionally substituted aliphatic. In certain embodiments, L4 is an optionally substituted heteroaliphatic.
2 18
[00269] In certain embodiments, -L -F is of Formula (iii-cl):
(iii-cl)
wherein
M is a pharmaceutically acceptable metal;
each of La, Lb, and Lc is independently optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted arylene, optionally substituted
cycloalkylene, optionally substituted heteroarylene, or optionally substituted heterocyclylene; and
"— " indicates a coordination bond or absend, as valency permits.
[00270] In certain embodiments, La is optionally substituted aliphatic. In certain
embodiments, La is optionally substituted heteroaliphatic. In certain embodiments, La is optionally substituted heteroalkylene. In certain embodiments, La is -(CH2)i-3-C(=0)0-, wherein the chelation point to M is O. In certain embodiments, La is -CH2-C(=0)0-. In certain embodiments, La is -(CH2)i_3-C(=0)OH, wherein the chelation point to M is O. In certain embodiments, La is -CH2-C(=0)OH.
[00271] In certain embodiments, Lb is optionally substituted aliphatic. In certain
embodiments, Lb is optionally substituted heteroaliphatic. In certain embodiments, Lb is optionally substituted heteroalkylene. In certain embodiments, Lb is -(CH2)i_3-C(=0)0- wherein the chelation point to M is O. In certain embodiments, Lb is -CH2-C(=0)0-. In certain embodiments, Lb is -(CH2)i-3-C(=0)OH, wherein the chelation point to M is O. In certain embodiments, Lb is -CH2-C(=0)OH.
[00272] In certain embodiments, Lc is optionally substituted aliphatic. In certain
embodiments, Lc is optionally substituted heteroaliphatic. In certain embodiments, Lc is optionally substituted heteroalkylene. In certain embodiments, Lc is -(CH2)i-3-C(=0)0- wherein the point of attachment to M is O. In certain embodiments, Lc is -CH2-C(=0)0-. In certain embodiments, Lc is -(CH2)i_3-C(=0)OH, wherein chelation point to M is O. In certain embodiments, Lc is -CH2-C(=0)OH.
[00273] As generally defined herein, "— " indicates the chelation formed between M and the ligand, as valency permits. In certain embodiments, M forms one chelating bond with the ligand. In certain embodiments, M forms two chelating bonds with the ligand. In certain embodiments, M forms three chelating bonds with the ligand.
[00274] In certain embodiments, -L 2 -F 18 is of Formula (iii-c2):
00275] In certain embodiments, the radioactive protein is one of the following formulae:
[00276] In certain embodiments the linker L is of one of the followin formulae:
wherein Rs, R£, Rcl, Rc2, and m are as de .ffiinneedd hheerreeiinn..
[00277] In certain embodiments, provided herein is a radioactive protein of Formula (III)
( Protein )— L1-R3
(III)
wherein
L1 is as defined herein; and
R comprises a ligand capable of chelating to a pharmaceutically acceptable radioactive metal complex.
[00278] In certain embodiments, L 1 -R 3 is of the following formula:
, wherein R22 is optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, or optionally substituted heteroaryl, or a nitrogen protecting group; wherein R comprises a ligand capable of chelating to a pharmaceutically acceptable radioactive metal complex.
[00279] In certain embodiments, R comprises mono-dentecate ligand. In certain embodiments, R 3 comprises a polydentecate ligand. In certain embodiments, R 3 comprises 1,4,7-triazacyclononane-triacetic acid (NOTA), 1,4,7, 10-tetraazacyclododecane-tetraacetic acid (DOT A), or triazacyclononane-phosphinate (TRAP).
[00280] In certain embodiments, the metal is ^Cu2"1". In certain embodiments, the metal is 68Ga3+.
[00281] In certain embodiments,, the radioactive protein is one of the following formulae:
f Protein ]— LPXTGGG— 64Cu— NOTA
' , or
( Protein )— LPXTGGG— 68Ga— NOTA
[00282] In certain embodiments, provided herein is a radioactive protein of Formula (IV)
( Protein )-L1-R4 (p wherein
L1 is a linker comprising at least four amino acids formed by enzymatic conjugation between two enzyme recognition sequences;
R4 comprises a radioactive optionally substituted carbohydrate; and
R4 is linked to the C-terminus of the adjacent amino acid in L1.
[00283] As generally defined herein, R4 comprises a radioactive optionally substituted carbohydrate. In certain embodiments, R4 comprises a radioactive optionally substituted glucose. In certain embodiments, R 4 comprises a radioactive glucose comprising 18 F. In certain embodiments, R 4 comprises an optionally substituted glucose comprising 18 F. In certain embodiments, R4 is linked to the C-terminus of the adjacent amino acid in L1. In certain embodiments, R4 is linked to the side chain of the adjacent amino acid in L1.
wherein
v is 1, 2, 3, 4, or 5; and
each of Rs5, Rs6, Rs7, and RsS is independently hydrogen, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, or optionally substituted heteroaryl, or an oxygen protecting group.
[00285] In certain embodiments, Rs5 is independently hydrogen. In certain embodiments, Rs5 is optionally substituted aliphatic. In certain embodiments, Rs5 is optionally substituted alkyl. In certain embodiments, Rs5 is an oxygen protectin group. In certain embodiments, R1 is acyl (e.g. acetyl).
[00286] In certain embodiments, Rs6 is independently hydrogen. In certain embodiments, Rs6 is optionally substituted aliphatic. In certain embodiments, Rs6 is optionally substituted alkyl. In certain embodiments, Rs6 is an oxygen protectin group. In certain embodiments, R1 is acyl (e.g. acetyl).
[00287] In certain embodiments, Rs7 is independently hydrogen. In certain embodiments, Rs7 is optionally substituted aliphatic. In certain embodiments, Rs7 is optionally substituted alkyl. In certain embodiments, Rs7 is an oxygen protectin group. In certain embodiments, R1 is acyl (e.g. acetyl).
[00288] In certain embodiments, RsS is independently hydrogen. In certain embodiments, RsS is optionally substituted aliphatic. In certain embodiments, RsS is optionally substituted alkyl. In certain embodiments, RsS is an oxygen protectin group. In certain embodiments, R1 is acyl (e.g. acetyl).
[00289] In certain embodiments, R4 is of the formula:
wherein Rs5, Rs6, Rs7, and Rs8 are as defined herein; and LG is optionally substituted aliphatic or optionally substituted heteroaliphatic.
[00291] In certain embodiments, L is optionally substituted aliphatic. In certain
embodiments, L G is optionally substituted Ci_io alkyl. In certain embodiments, L G is optionally substituted heteroaliphatic. In certain embodiments, L is of the formula:
wherein e indicates the point of attachment to oxygen and/indicates the point of attachment to the alpha carbon of the amino acid.
00292] In certain embodiments, the radioactive protein is of the following formula:
I P ote in J
[00293] In certain embodiments, ^ ' is an antibody, a nuclear factor, a neuropeptide, a receptor protein, an enzyme, a structural protein, or a fragment thereof. In certain
I Protein J
embodiments, ' is an antibody or a fragment thereof. In certain embodiments,
(■ rote'n J is VHH or a fragment thereof.
Synthesis of intermediates and radiolabeled proteins
can be prepared from optionally substituted tetrazine-aminooxy and a radiolabeled optionally substituted aldehyde or optionally substituted ketone of the formula Ras-CO-Rbs, wherein RG1 is as defined herein; each of Ras and Rbs is independently hydrogen, optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted aryl, optionally substituted heteroaryl, or optionally substituted heterocyclyl; provided Ras and Rbs are not both hydrogen (Scheme S I).
Scheme S 1.
[00295] In certain embodiments, Ras is an optionally substituted carbohydrate group or a fragment thereof. In certain embodiments, Ras is an optionally substituted glucose or a fragment thereof. In certain embodiments, the reaction is carried out in the presence of a catalyst. In certain embodiments, the catalyst is m-phenylenediamine, p-phenylenediamine, or p-anisidine. In certain embodiments, the catalyst is m-phenylenediamine. In certain embodiments, the molar ratio of the optionally substituted tetrazine-aminooxy to the catalyst is from about 10: 1 to 1: 10. In certain embodiments, the molar ratio of the optionally substituted tetrazine-aminooxy to the catalyst is from about 1: 1 to 1:8. In certain
embodiments, the molar ratio of the optionally substituted tetrazine-aminooxy to the catalyst is from about 1: 1 to 1:6. In certain embodiments, the molar ratio of the optionally substituted tetrazine-aminooxy to the catalyst is from about 1:2 to 1:4. In certain embodiments, the molar ratio of the optionally substituted tetrazine-aminooxy to the catalyst is about 1:4.
Ill
[00296] In certain embodiments, Ras is an optionally substituted carbohydrate group or a fragment thereof, provided Ras comprises 18F. In certain embodiments, Ras is an optionally substituted glucose or a fragment thereof. In certain embodiments, Ras is 18F-FDG of a fragment thereof.
[00297] As provided in Scheme S I, the resulting oxime product can be easily purified from the reaction mixture to the change in hydrophilicity.
[00298] In certain embodimetns of Scheme S I, the excess of tetrazine- aminooxy can be captured by reacting with another water soluble carbohydrate. In certain embodiments, the water soluble carbohydrate is glucosamine 6-sulfate.
[00299] The compound of Formula (b-2-b)
can be prepared from reacting an optionally substituted tetrazine comprising a nucleophic group with an electrophile comprising 18F such as 18F-SFB. Exemplary synthesis of Formula (b-2-b is provided in Scheme S2.
Scheme S2
[00300] In certain embodiments, the Nu is an amino group. In certain embodiments, the electrophile is an optionally substituted N-succinimidyl comprising 18 F. In certain
embodiments the optionally substituted N-succinimidyl is 18 F-SFB of the formula
[00301] The radioactive protein of Formula (II) can be prepared from a modified protein of
Formula (I) with a compound of Formula (b): 18 F-R 2 (b), wherein R 2 is a reactive group capable of under oing the click chemistry reaction (Scheme S3):
Scheme S3.
[00302] In certain embodiments, R 1 is the first click chemistry handle and R 2 is the second
2
click chemistry handle. In certain embodiments, R is the first click chemistry handle and R is the second click chemistry handle.
[00303] Click chemistry should be modular, wide in scope, give high chemical yields, generate inoffensive byproducts, be stereospecific, be physiologically stable, exhibit a large thermodynamic driving force ( e.g., > 84 kJ/mol to favor a reaction with a single reaction product), and/or have high atom economy. Several reactions have been identified which fit this concept:
(1) The Huisgen 1,3-dipolar cycloaddition ( e.g., the Cu(I)-catalyzed stepwise variant, often referred to simply as the "click reaction"; see, e.g., Tornoe et ah, Journal of Organic Chemistry (2002) 67: 3057-3064). Copper and ruthenium are the commonly used catalysts in the reaction. The use of copper as a catalyst results in the formation of 1,4-regioisomer whereas ruthenium results in formation of the 1,5- regioisomer;
(2) Other cycloaddition reactions, such as the Diels-Alder cycloaddition;
(3) Nucleophilic addition to small strained rings like epoxides and aziridines;
(4) Nucleophilic addition to activated carbonyl groups; and
(4) Addition reactions to carbon-carbon double or triple bonds.
[00304] In certain embodiments, the click chemistry is a Diels-Alder cycloaddition.
Exemplary Diels-Alder cycloadditions can be found in U.S. Patent Publication No.
20130266512, which is incorporated by reference herein;
[00305] The radioactive protein of Formula (III) can be prepared from a compound comprising an aminooxy moiety with an optionally substituted aldehyde (Scheme S4):
radioactive metal
f \ „ sortase , v .
( Protein)— LPXTG + GGG-R *~ ( Protein )— LPXT-GGG-R3 comPlex
( Protein )— LPXT-GGG-R3
Metal complex
Scheme S4.
[00306] The radioactive protein of Formula (IV) can be prepared from a compound comprising an aminooxy moiety with an optionally substituted aldehyde or an optionally substituted ketone (Scheme S5), wherein L is as defined herein.
-NH2
O catalyst V, I
GGNHCHs-^-N CONH2 + Ras— CHO *~ ΟΟΝΗΟΗ2-"-Ν CONH2
H H
Scheme S5.
[00307] In certain embodiments, the aldehyde is an optionally substituted carbohydrate comprising an aldehyde group or is capable of forming one through isomerism. In certain embodiments, the optionally substituted aldehyde is an optionally substituted
monosaccharide. In certain embodiments, the optionally substituted aldehyde is optionally substituted glucose, optionally substituted glyceraldehyde, or optionally substituted galactose. In certain embodiments, the optionally substituted aldehyde is optionally substituted glucose.
[00308] In certain embodiments, the catalyst is m-phenylenediamine (mPDA), o- phenylenediamine, /?-phenylenediamine, o-aminophenol, m-aminophenol, /?-aminophenol, o-
aminobenzoic acid, 5-methoxyanthranilic acid, 3,5-diaminobenzoic acid or aniline. In certain embodiments, the catalyst is m-phenylenediamine (mPDA).
[00309] In certain embodiments, the radioactive optionally substituted cyclooctene is synthesized by a nucleophilic reaction with an 18 F anion with a substituted cyclooctene comprising a leaving group LG (Scheme S6), wherein LG is as defined herein and L61 is optionally substituted aliphatic, optionally substituted heteroaliphatic, optionally substituted arylene, optionally substituted heteroarylene, or optionally substituted heterocyclylene.
Scheme S6
[00310] In certain embodiments, L is optionally substituted hereo aliphatic. In certain embodiments, L61 is straight chain heteroaliphatic. In certain embodiments, L61 is -0-Ci_ 8alkylene. In certain embodiments, L61 is -0-(CH2)i-8-.
[00311] In certain embodiments, the radioactive optionally substituted cyclooctene is synthesized as shown in Scheme S6-a, wherein L61 is as defined herein.
Scheme S6-a
[00312] In certain embodiemnts, the 18 F -" anion is from an inorganic salt comprising 18 F -"
18 - 18
anion. In certain embodiments, the F" anion is from a metal salt comprising F" anion. In certain embodiments, the 18 F" anion is from IA, IIA, or IIIA metal fluoride. In certain
18 - 18 embodiments, the F" anion is from transition metal complex comprising F".
[00313] In certain embodiments, the enzymatic conjugation is a modification using a formylglycine generating enzyme (FGE). In certain embodiments, the protein is an antibody. In certain embodiments, the enzyme is FGE. In certain embodiments, the FGE recognition sequence is CXPXR. In certain embodiments, the FGE recognition sequence is
LCTPSRGSLFTGR. In certain embodiments, the radioactive protein is prepared according to Scheme El.
Formylglycine
Generating
, v Enzyme (FGE)
R is a reactive group capable of undergoing a click chemistry reaction, comprising a radioactive optionally substituted carbohydrate, or comprising a ligand capable of chelating to a pharmaceutically acceptable radioactive metal complex.
X = an independently amino acid.
Scheme El
[00314] It is to be understood that the -CHO group generated from the FGE modification can undergo any suitable reaction to incorporate a radioactive label, for example, a click chemistry handle, a radioactive carbohydrate, or a ligand capable of chelating to a
pharmaceutically acceptable radioactive metal complex. Exemplary transformations such as reacting with hydrazine or hydroxylamine are shown in the Scheme El.
[00315] In certain embodiments, the enzymatic conjugation is a modification using
sialyltransferases. In certain embodiments, the protein is a cell surface polypeptide. In certain embodiments, the protein is a glycan. An exemplary sialylation is shown in Scheme E2, wherein R4 is as defined herein.
Sialyltransferase
R comprises a radioactive optionally substituted carbohydrate
Scheme E2
[00316] In certain embodiments, R4 comprises radioactive optionally substituted glucose. In certain embodiments, R4 comprises 18F-FDG. In certain embodiments, R4 comprises
radioactive optionally substituted aldolase. In certain embodiments, R comprises radioactive optionally substituted mannose.
[00317] In certain embodiments, the enzymatic conjugation is a modification using phosphopantetheinyltransferases (PPTases). In certain embodiments, the protein is peptide carrier protein (PCP). In certain embodiments, the protein is acyl carrier protein (ACP). In certain embodiments, the PPT recognition sequence comprises a serine residue. In certain embodiments, the PPTase recognition sequence is DSLEFIASKLA, VLDSLEFIASKLA, or GSQD VLDSLEFIASKLA. In certain embodiments, the phosphopantetheinyltransferase is Sfp. An exemplary modification using PPTase is shown in Scheme E3, wherein R is as defined herein.
Scheme E3
[00318] In certain embodiments, the enzymatic conjugation is a modification using polypeptidyltransferases (OGTases). In certain embodiments, the protein is nuclear pore protein. In certain embodiments, the OGTase is UDP-Glc-NAc. In certain embodiments, the OGTase recognition sequence comprises a serine residue or threonine residue. Exemplary modifications using polypeptidyltransferases are shown in Scheme E4, wherein R is as defined herein.
each of Rvl, Rv2, Rv3, Rv4, Rv5, Rv(5, and Rv7 is independently H, optionally substituted CI -6 alkyl, or an oxygen protecting group
Scheme E4
[00319] In certain embodiments, the enzymatic conjugation is a modification using transglutaminase (TGases). In certain embodiments, the protein is an antibody. In certain embodiments, the TGase recognition sequence comprises a glutamine (Q) residue. In certain embodiments, the TGase recognition sequence comprises XXQXX. In certain embodiments, the protein recognition sequence is GGGSLLQG, PNPQLPF, PKPQQFM, or GQQQLG. In certain embodiments, the protein recognition sequence comprises a lysine (K) residue. In certain embodiments, the protein recognition sequence is MRHKGS. An exemplary
Scheme E5
[00320] In certain embodiments, the enzymatic conjugation is a modification using protein farnesyltransferase (PFTase). In certain embodiments, the protein is an antibody. In certain embodiments, the PFTase recognition sequence comprises CaaX, wherein each instance of a is independently an aliphatic amino acid and X is as defined herein. Exemplary modifications using PFTases are shown in Scheme E6, wherein RF is as defined herein.
( Protein
Scheme E6
[00321] In certain embodiments, the enzymatic conjugation is a modification using biotin ligases. In certain embodiments, the protein is an antibody. In certain embodiments, the biotin ligase recognition sequence comprises lysine (K). In certain embodiments, the biotin ligase recognition sequence comprises GLNDIFEAQKIEWHE. In certain embodiments, the enzyme is E.coli biotin ligase, BirA. An exemplary modification using biotin ligases is shown in Scheme E7, wherein R is as defined herein
streptavidin-RF
BirA, ATP, biotin
( Protein ) n
— AP ( Protein )— AP Bioti *- ( Protein )— AP Biotin Streptavidin
\
AP = acceptor peptide comprising lysine
Scheme E7
[00322] In certain embodiments, the enzymatic conjugation is a modification using lipoic acid ligases (LplAs). In certain embodiments, the protein is an antibody. In certain
embodiments, the protein is a growth factor receptor. In certain embodiments, the LplA recognition sequence comprises GFEIDKVWYDLDA. In certain embodiments, the enzyme is E.coli Lpl. An exemplary modification using LplAs is shown in Scheme E8, wherein R is as defined herein.
Scheme E8
[00323] In certain embodiments, the enzymatic conjugation is a modification using N- myristoyltransferase (NMT). In certain embodiments, the protein is an antibody. In certain embodiments, the protein is a tyrosine kinase. In certain embodiments, the protein is a HIV-1
matrix protein. In certain embodiments, the protein is a HIV Gag. In certain embodiments, the protein is an ADP-ribosylating factor. In certain embodiments, the NMT recognition sequence comprises GXXXS/T, wherein X is any amino acid. An exemplary modification using NMT is shown in Scheme E9, wherein R is as defined herein.
Scheme E9
[00324] In certain embodiments, R is a reactive group capable of undergoing a click
p 1
chemistry reaction. In certain embodiments, R is R as defined herein. In certain
p p embodiments, R is optionally substituted tetrazine. In certain embodiments, R is optionally substituted tetrazine comprising 18 F. In certain embodiments, R F is optionally substituted tetrazine comprising 18 F-FDG or a fragment thereof. In certain embodiments, R F is optionally substituted tetrazine comprising 18 F-SFB or a fragment thereof. In certain embodiments, R F is p
optionally substituted cyclooctene. In certain embodiments, R is optionally substituted trans- p
cyclooctene. In certain embodiments, R is optionally substituted trans-cyclooctene comprising 18 F. In certain embodiments, R F is comprises a ligand capable of chelating to a pharmaceutically acceptable radioactive metal complex. In certain embodiments, R F is R 3 as p
defined herein. In certain embodiments, R comprises a ligand capable of chelating to a pharmaceutically acceptable metal complex comprising F 18. In certain embodiments, R F is Y p
as defined herein. In certain embodiments, R comprises a radioactive optionally substituted carbohydrate. In certain embodiments, R F is R 4 as defined herein. In certain embodiments, R F comprises 18 F-FDG or a fragment thereof.
Kits
[00325] Some aspects of this invention provide kits useful for labeling proteins with radioactive agents and/or hydrophilic polymers, and/or for generating radiolabeled sortase substrate peptides.
[00326] In some embodiments, the kit comprises a radiolabeled protein generated according to an inventive method provided herein. In some embodiments, the kit comprises (i) a single domain antibody comprising a sortase recognition sequence, (ii) a sortase substrate comprising a first click chemistry handle, and (iii) a hydrophilic polymer conjugated to a second click chemistry handle. In some embodiments, the kit comprises (i) a
first single domain antibody comprising a first click chemistry handle, and (ii) a second single domain antibody comprising a second click chemistry handle. In some embodiments, the kit comprises (i) a first single domain antibody comprising a sortase recognition sequence, (ii) a first sortase substrate, wherein the first sortase substrate comprises a first click chemistry handle, (iii) a second single domain antibody comprising a sortase
recognition sequence, and (iv) a second sortase substrate, wherein the second sortase substrate comprises a second click chemistry handle. In some embodiments, the kit further comprises a radionuclide. In some embodiments, the radionuclide is carbon- 11, carbon- 14, nitrogen-13, oxygen-15, fluorine-18, rubidium-82, copper-61, copper-62, copper-64, yttrium- 86, gallium-68, zirconium-89, or iodine- 124. In some embodiments, the kit further comprises a sortase A from Staphylococcus aureus (SrtAaureus), sortase A from Streptococcus pyogenes (SrtApyogenes), sortase B from S. aureus (SrtBaureus), sortase B from Bacillus anthracis (SrtBanthracis), or sortase B from Listeria monocytogenes (SrtBmonocytogenes).
[00327] In some embodiments, the kit further comprises a buffer or reagent useful for carrying out a sortase-mediated transpeptidation reaction.
EXAMPLES
[00328] In order that the invention described herein may be more fully understood, the following examples are set forth. The examples described in this application are offered to illustrate the methods, compositions, and systems provided herein and are not to be construed in any way as limiting their scope.
Example 1. Enzyme-Mediated Dual-labeling of Antibodies for Multimodal Imaging and to Manipulate their Characteristics.
[00329] Structures of VHHs show that their C-terminus is positioned away from the antigen binding site[13]. Therefore a chemical approach was chosen to link two fully functional VHHs via their C-termini to ensure that their antigen binding capacity would not be compromised by modification of one of the N-termini in the resulting fusion, and that the two binding sites thus created would be equivalent, which may be more difficult to ascertain for genetic fusions.
[00330] Four sortase substrates were designed and synthesized for production of dimers or PEGylated VHHs (Figure 1). The substrates either contain two bioorthogonal handles or a handle and a flourophore. The Alexa647-labeled substrate was designed such that the reaction products could be used in FACS experiments to estimate relative in vitro binding
affinities. The Texas Red-modified substrate was designed to enable two-photon microscopy and to estimate relative in vivo binding affinities; the TCO-modified substrate was produced to allow rapid installation of a tetrazine-functionalized radioactive tag for PET, in this case an isotopically labelled 18 F-labeled-tetrazine radioactive tag for PET (tl/2=l 10 min.18F tl/2<2 h). The dimers were produced as exemplified in Figure 2. For DC8 (anti Class II), splenocytes were stained with different concentrations of monomers and dimers and analyzed by FACS. For DC13 (anti CDl lb), the CDl lb+ mutuDC dendritic cell line was used. For Class II MHC and CDl lb, VHH dimers bind approximately 3.3 and 2.3-fold better than their corresponding monomers respectively (Figure 3). The in vivo binding characteristics of the VHH dimers versus monomers were evaluated. Due to the more abundant expression of Class II MHC molecules on splenocytes compared to that of CDl lb, the in vivo binding affinity for anti-Class II dimers was explored. Mice were injected i.v. with equal amounts of monomers and dimers (0.25 nmol) of DC8. 2 h p.L, mice were euthanized and lymphoid organs were excised for examination. Monomers and dimers yielded different staining patterns (Figure 3B), with the dimer showing interspersed yet more pronounced staining than the monomer, corroborating the FACS results. To render monomers and dimers suitable for immuno-PET, dimer VHHs were produced using substrate 4. To produce the 18 F-tetrazine, a method was applied that was automated in its key steps to minimize operator radiation exposure in the course of preparation (Figure 4A). The 18 F-labeled anti Class II and anti CDl lb dimers were produced and applied them to PET imaging (Figure 4). PET showed that both the dimers stained lymphoid organs (Figure 4). The anti Class II MHC dimer showed stronger staining of lymphoid organs, particularly the spleen, compared to the anti CDl lb dimer (Figures 4D and 4F). This may be attributed to the fact that in spleen there are fewer CDl lb+ cells compared to Class II MHC+ cells and less CDl lb expressed per cell.
Specificity was established by blocking the targets of these VHHs by introduction of unlabeled VHHs as competitors prior to imaging. PET imaging conducted 2 h p.i. of 18 F- labeled VHHs showed effective blocking of signal in the lymphoid organs, further underlining the specificity of the signals (Figure 5C). To further confirm the specificity of the dimers in the absence of competing VHHs, MHC IT7" and CDl lb_/~ mice were imaged. No PET signals were detected in lymphoid organs, further confirming the specificity of both dimers (Figures 4E-4G). Monomers and dimers do not differ in uptake in kidneys and intestine, organs commonly targeted non-specific ally by VHHs in the course of their clearance[14]. These experiments helped set the stage to explore ability of VHH dimers to image tumors. Two types of tumors were imaged with the developed bivalent VHHs by
engraftment of mice with the B 16 melanoma or the pancreatic tumor cell line panc02. Both the dimers readily detected the lymphoid organs as well as the B 16 melanoma tumor or the panc02 graft. Upon excision, the panc-tumors were no more than -1-2 mm in diameter, showing the method to be sensitive. Postmortem biodistribution analysis correlated well with the FACS and two-photon results as well (Figures 5A-5B). It was examined whether circulatory half-life could be manipulated to further improve the signal to noise ratio.
PEGylation of VHHs results in increased circulatory half-life, where the increase correlates with the size of the attached PEG group[15]. VHHs sortagged with substrate 2 or 3 were reacted with DBCO-functionalized PEG (5 kDa, 10 kDa or 20 kDa) to yield the final PEGylated VHHs (Figures 2E-2F). B6 mice received 5 μg of PEGylated VHH and were euthanized 3 h later, followed by dissection of lymph nodes and spleen for FACS and two- photon microscopy. FACS showed a significant increase in staining of the PEGylated DC8- Alexa647 versus the non-PEGylated DC8. An approximate 30%, 100%, and 220% increase in staining was observed for 5 kDa, 10 kDa, or 20 kDa PEG-conjugated DC8, respectively, establishing a correlation between the size of the attached PEG moiety and their staining efficiency (Figure 3D). When DC8-Alexa647-PEG-20kDa were injected, which showed the strongest binding in vivo, into a MHC ΙΓ/_ mouse, FACS analysis showed no staining in the spleen (Figure 3D). This confirmed that PEGylation does not affect the specificity of the VHHs.
[00331] The PEGylated VHHs were explored for their suitability in PET imaging. VHH
18
DC8 was PEGylated and modified with an F radionuclide. PEGylated VHHs showed increased staining of the lymphoid organs, confirming FACS and two-photon microscopy (Figure 5D). The longer circulatory half-life of PEGylated VHHs may increase the likelihood of a VHH binding to its target, as long as target accessibility is not compromised by
PEGylation. The 18F-labeled-DC8-PEG-20 kDa had the highest PET signal in blood at the time of imaging (3 h p.i) (Figure 5D). While the larger 20 kDa PEG can significantly increase the staining efficiency in lymphoid organs, it can delay circulatory clearance, a factor to consider when isotopes with short half-lives, such as as 18F or 11C, are being used. However, a 10 kDa or a 5 kDa PEG-modified VHH can still significantly increase staining efficiency and yet be rapidly cleared. For labeling of VHHs, the use of isotopes with longer half-lives, such as 89Zr or 64Cu, the use of a 20 kDa PEG moiety may improve staining.
[00332] In summary, the methods provided herein may produce site- specifically PEGylated
18 or bivalent single domain antibodies equipped with a fluorophore and/or radionuclide ( F) for the different imaging modalities. The reaction conditions are compatible with full
retention of biological activity of the fusion partners. By cytofluorimetry, dimers bind approximately 3 times more avidly to their targets. Two-photon microscopy demonstrated that Texas Red-labeled bivalent single domain derivatives bind more efficiently to their targets. PEGylated fluorescent VHHs showed improved staining in vivo, with larger PEG substituents giving stronger signals in FACS. In immuno-PET experiments, bivalent 18 F- labeled VHHs better stained lymphoid organs in vivo than monomers. 18 F-labeled PEGylated VHHs showed improved staining, with higher MW PEG substituents giving stronger signals. Finally, immuno-PET of two different models of tumor-bearing mice, showed that the DC8- dimer and DC13-dimer detected not only lymphoid organs, but also showed the location of ectopic melanoma and pancreatic tumor grafts as small as about 1 mm in size. Overall, these data provide support that derivatives of single domain antibodies are a valuable addition to the current imaging and radiodiagnostic approaches.
References
[1] T. Olafsen, S. J. Sirk, S. Olma, C. K.-F. Shen, A. M. Wu, Tumor Biol. 2012, 33, 669- 677.
[2] E. J. Lipson, W. H. Sharfman, C. G. Drake, I. Wollner, J. M. Taube, R. A. Anders, H. Xu, S. Yao, A. Pons, L. Chen, et al., Clin. Cancer Res. Off. J. Am. Assoc. Cancer Res. 2013, 19, 462-468.
[3] T. R. Simpson, F. Li, W. Montalvo-Ortiz, M. A. Sepulveda, K. Bergerhoff, F. Arce, C. Roddie, J. Y. Henry, H. Yagita, J. D. Wolchok, et al., J. Exp. Med. 2013, 210, 1695-1710.
[4] R. Boellaard, M. J. O'Doherty, W. A. Weber, F. M. Mottaghy, M. N. Lonsdale, S. G. Stroobants, W. J. G. Oyen, J. Kotzerke, O. S. Hoekstra, J. Pruim, et al., Eur. J. Nucl. Med. Mol. Imaging 2010, 37, 181-200.
[5] M. Rashidian, E. J. Keliher, A. M. Bilate, J. N. Duarte, G. R. Wojtkiewicz, J. T.
Jacobsen, J. Cragnolini, L. K. Swee, G. D. Victora, R. Weissleder, et al., Proc. Natl. Acad. Sci. U. S. A. 2015, DOI 10.1073/pnas.1502609112.
[6] R. Tavare, M. N. McCracken, K. A. Zettlitz, S. M. Knowles, F. B. Salazar, T.
Olafsen, O. N. Witte, A. M. Wu, Proc. Natl. Acad. Sci. 2014, 111, 1108-1113.
[7] M. Rashidian, E. J. Keliher, M. Dougan, P. K. Juras, M. Cavallari, G. R. Wojtkiewicz,
J. T. Jacobsen, J. G. Edens, J. M. J. Tas, G. Victora, et al., ACS Cent. Sci. 2015,
150603073029009.
[8] E. C. Dijkers, T. H. Oude Munnink, J. G. Kosterink, A. H. Brouwers, P. L. Jager, J. R. de Jong, G. A. van Dongen, C. P. Schroder, M. N. Lub-de Hooge, E. G. de Vries, Clin.
Pharmacol. Ther. 2010, 87, 586-592.
[9] M. Rashidian, E. J. Keliher, A. M. Bilate, J. Doarte, G. Wojtkiewicz, J. Jacobsen, G.
Victora, R. Weissleder, H. L. Ploegh, Proc. Natl. Acad. Sci. U.S.A. 2015.
[10] T. De Meyer, S. Muyldermans, A. Depicker, Trends Biotechnol. 2014, 32, 263-270.
[11] P. Holliger, T. Prospero, G. Winter, Proc. Natl. Acad. Sci. U. S. A. 1993, 90, 6444-
6448.
[12] H. Schellekens, W. E. Hennink, V. Brinks, Pharm. Res. 2013, 30,1729-1734.
[13] E. De Genst, K. Silence, K. Decanniere, K. Conrath, R. Loris, J. Kinne, S.
Muyldermans, L. Wyns, Proc. Natl. Acad. Sci. U. S. A. 2006, 103, 4586-4591.
[14] V. Cortez-Retamozo, M. Lauwereys, G. Hassanzadeh Gh, M. Gobert, K. Conrath, S. Muyldermans, P. De Baetselier, H. Revets, Int. J. Cancer J. Int. Cancer 2002, 98, 456-462.
[15] Y. Vugmeyster, C. A. Entrican, A. P. Joyce, R. F. Lawrence-Henderson, B. A. Leary, C. S. Mahoney, H. K. Patel, S. W. Raso, S. H. Olland, M. Hegen, et al., Bioconjug. Chem. 2012, 23, 1452-1462.
Example 2. Materials and Methods
Synthesis of (Gly)3-PEGi2-Cys(TCO)-PEG5-Lys(azide).
[00333] The peptide (Gly)3-PEGi2-Cys-PEG5-Lys(azide) was synthesized by standard solid phase peptide synthesis. Maleimide-TCO (from Conju-bio) was dissolved in 0.05 M NaHC03 buffer pH 8.3. The peptide was added and left to stir at room temperature for 1 h until LC-MS indicated near-complete conversion to the product. The solution was filtered and purified by reverse phase-HPLC with a semi-preparative column (Phenomenex, C18 column , Gemini, 5 μηι, 10x250 mm) at a flow rate of 5.0 mL/min.; solvent A: 0.1% formic acid in H20, solvent B: 0.1% formic acid in CH3CN. Product eluted at 35-40% solvent B. Fractions containing
pure product were collected and lyophilized. LC-MS calculated for C83Hi5iNi4034S [M+H]+ 1920.0, found 1919.0.
Synthesis of ( -PEGi2-Cys(Texas Red)-PEG5-Lys(azide).
[00334] The peptide (Gly)3-PEGi2-Cys-PEGs-Lys(azide) was synthesized by standard solid phase peptide synthesis and was dissolved in 0.05 M NaHCCh buffer pH 8.3. Maleimide- Texas Red (from Vector Labs) was dissolved in DMSO and then was added to the solution and left to stir at room temperature for 1 h until LC-MS indicated near-complete conversion to the product. The solution was filtered and purified by reverse phase-HPLC with a semi- preparative column (Phenomenex, C18 column, Gemini, 5 μιη, 10x250 mm) at a flow rate of 5.0 mL/min.; solvent A: 0.1% TFA in H20, solvent B: 0.1% TFA in CH3CN. Product eluted at 40-45% solvent B. Fractions containing pure product were collected and lyophilized. LC- MS calculated for C92Hi42Ni5032S3 [M+H]+ 2064.9, found 2063.9.
Synthesis of (Gly)3-PEGi2-Cys(Alexa647)-PEG5-Lys(azide).
[00335] The peptide (Gly)3-PEGi2-Cys-PEG5-Lys(azide) was synthesized by standard solid phase peptide synthesis. Maleimide-Alexa647 (from Life Technology) was dissolved in 0.05 M NaHC03 buffer pH 8.3. The peptide was added and left to stir at room temperature for 1 h until LC-MS indicated near-complete conversion to the product. The solution was filtered and purified by reverse phase-HPLC with a semi-preparative column (Phenomenex, C18 column, Gemini, 5 μιη, 10x250 mm) at a flow rate of 5.0 mL/min.; solvent A: 0.1% TFA in H20, solvent B: 0.1% TFA in CH3CN. Product eluted at 30-35% solvent B. Fractions containing pure product were collected and lyophilized. LC-MS calculated for
C97Hi58Ni5039S5 [M+H]+ 2317.9, found 2318.4.
Synthesis of (Gly)3-
[00336] The tetrapeptide (Gly)3-Cys (SEQ ID NO: 12) was synthesized by standard solid phase peptide synthesis and was dissolved in 0.05 M NaHC03 buffer pH 8.3. Maleimide- DBCO (from Click Chemistry Tools) was dissolved in DMSO and then was added to the solution and left to stir at room temperature for 1 h until LC-MS indicated near-complete conversion to the product. The solution was filtered and purified by reverse phase-HPLC with
a semi-preparative column (Phenomenex, C18 column, Gemini, 5 μιη, 10x250 mm) at a flow rate of 5.0 mL/min.; solvent A: 0.1% TFA in H20, solvent B: 0.1% TFA in CH3CN. Product eluted at 35-40% solvent B. Fractions containing pure product were collected and
lyophilized. LC-MS calculated for C45H6oN9Oi3S [M+H]+ 966.4, found 966.4.
Enzymatic incorporation of substrates into proteins using sortase.
[00337] The penta-mutant sortase A, with an improved kcat, was used (1). Reaction mixtures (1 mL) contained Tris-HCl (50 mM, pH 7.5), CaCl2 (10 mM), NaCl (150 mM), triglycine-containing probe (500 μΜ), LPETG-containing (SEQ ID NO: 11) substrate (100 μΜ), and sortase (5 μΜ) (2, 3). After incubation at 4 °C with agitation for 2 h, reaction products were analyzed by LC-MS. Yields were generally >90%. When the yield was below 90%, the reaction was allowed to proceed for an additional two hours, with addition of sortase to 10 μΜ and triglycine-containing probe to 1 mM. Ni-NTA beads were added to the reaction mixture with agitation for 5 min at 25 °C followed by centrifugation to remove sortase and any remaining unreacted His-tagged substrate. The final product was purified by size exclusion chromatography in PBS or Tris*HCl (50 mM, pH 7.5). The labeled protein was stored at -80 °C with 5% glycerol for up to six months.
Dimerization of VHHs.
[00338] The general procedure was as follows: the DBCO-VHH (1.3 eq, in PBS) was added to the azide-X-VHH (where X is either TCO, Texas Red or Alexa647) and the reaction was left to proceed at room temperature for -1-3 hours with constant agitation, where LC-MS analysis revealed (generally) above 80% conversion to the corresponding dimer. The dimer was then purified via size exclusion chromatography (FPLC) using PBS as the eluting solvent. The labeled dimer was stored at -80 °C with 5% glycerol for up to six months.
PEGylation of VHHs.
[00339] The general procedure was as follows: the DBCO-PEG (4 eq, in PBS) was added to the azide-X-VHH (where X is either TCO, Texas Red or Alexa647) and the reaction was left to proceed at room temperature for -1-2 hours with constant agitation, where SDS-PAGE analysis revealed (generally) above 80% conversion to the corresponding PEGylated product. The final PEGylated product was purified via size exclusion chromatography (FPLC) using PBS as the eluting solvent. The labeled PEGylated protein was stored at -80 °C with 5% glycerol for up to six months.
Two-photon imaging.
[00340] Two-photon imaging was performed with Olympus BX61 upright microscope (Olympus 25X 1.05 NA Plan Objective), fitted with a SpectraPysics MaiTai DeepSee laser. Images were acquired using 910 nm excitation and following filters; CFP (460-510), GFP (495-540) and a third filter (575-630) for the Texas Red signal. Second harmonics (collagen) were also detected in the CFP filter. Images were acquired with 5 μιη Z-resolution with Olympus FluoView FC1000 software. Tile images were saved as JPEG files. Images were processed to obtain a scale bar in Imaris v 7.4.0; no intensity or contrast adjustments were made.
2
[00341] tert- butyl (4-cyanobenzyl)carbamate (2): 4-(Aminomethyl)benzonitrile hydrochloride 1 (2.82 g, 16.7 mmol) and triethylamine (4.7 mL, 33.7 mmol) were dissolved in anhydrous CH2CI2 (50 mL) at 0 C. To this stirred solution was added di-ie/ -butyl dicarbonate (4.38 g, 20.1 mmol), and the reaction allowed to warm to room temperature and stirred for 16 hours. The reaction mixture was evaporated in vacuo, and the residue was re- dissolved in diethyl ether (50 mL), which was washed successively with 0.5 M aq. HC1 (2 x 25 mL), saturated NaHC03 (2 x 25 mL) and brine (25 mL). The organic layer was dried with MgS04, filtered and evaporated in vacuo to give an off-white solid. The residue was purified by flash column chromatography (Hexanes/EtOAc = 10/1) to afford tert-buty\ (4- cyanobenzyl) carbamate 2 (3.69 g, yield 95 %) as a colorless solid. It was further characterized according to the literature procedure (4 J. Figures 13A-13B show 1H-NMR and
13 C-NMR spectra, respectively.
2 3
[00342] tert-butyl (4-(6-methyl-l,2,4,5-tetrazin-3-yl)benzyl) carbamate (3): A stirred mixture of carbamate 2 (1.5 g, 6.46 mmol), MeCN (3.4 mL, 64.6 mmol) and anhydrous NiCl2 (418 mg, 3.23 mmol) was treated dropwise with hydrazine (5 mL, 161.5 mmol). The purple reaction mixture was stirred at 60 C for 24 hours. Afterwards a solution of NaN02 (8.8 g, 127 mmol) in H20 (65 mL) was carefully added. HC1 (2 N solution) was added until the evolution of nitrous oxides ceased. The dark red solution was extracted with ethyl acetate (3 x 60 mL). The extract was combined and dried over MgS04 and concentrated. The residue was purified by column chromatography (Hexanes/EtOAc = 8/1) to afford ie/ -butyl (4-(6- methyl-l,2,4,5-tetrazin-3-yl)benzyl) carbamate 3 (1.22 g, yield 63 %) as a red solid. It was further characterized according to the literature (5).
3 4
[00343] (4-(6-methyl-l,2,4,5-tetrazin-3-yl)phenyl)methanamine (4): In a 100 mL reaction vessel was charged the solution of tetrazine 3 (301 mg, 1.0 mmol) in DCM (12 mL). Trifluoroacetic acid (12 mL) was added dropwise. The mixture was stirred at room
temperature for 2 h. Afterwards the mixture was evaporated and suspended into Et20 (20 mL) for recrystallization at -20 C. The supernatant was decanted and the residue was dried under vacuum for 2 hours to afford (4-(6-methyl-l,2,4,5-tetrazin-3-yl)phenyl)methanamine 4 (200 mg, yield 99%) as red solid. The product was further characterized according to the literature (6).
[00344] 4-fluoro-N-(4-(6-methyl-l,2,4,5-tetrazin-3-yl)benzyl)benzamide (5): A solution of the tetrazine amine TFA salt 4 (50 mg, 0.25 mmol) in anhydrous DMF (3.5 mL) was added 2,5-dioxopyrrolidin-l-yl 4-fluorobenzoate (50 mg, 0.223 mmol) and Et3N (0.35 mL, 2.5
mmol). The resulting solution was then stirred at room temperature overnight under argon gas. The reaction mixture was quenched with water (15 mL), and then extracted with ethyl ether (10 mL x 3). The organic layers were combined, washed with brine, dried over MgS04, filtered and evaporated under reduced pressure. The crude product was purified by flash chromatography (Hexanes/EtOAc=7/l) to afford 4-fluoro-N-(4-(6-methyl- 1,2,4, 5-tetrazin-3- yl)benzyl)benzamide 5 (29 mg, 36%) as a red solid powder.
[00345] 1H NMR (300 MHz, DMSO) δ 9.18 (t, 7 = 6.1 Hz, 1H), 8.43 (d, 7 = 8.4 Hz, 2H), 7.99 (dd, 7 = 5.5, 3.3 Hz, 2H), 7.58 (d, 7 = 8.2 Hz, 2H), 7.31 (t, 7 = 7.8 Hz, 2H), 4.60 (d, 7 = 6.1 Hz, 2H), 2.97 (s, 3H); 13C NMR (75 MHz, DMSO) δ 167.5, 165.9 (d, J = 23.3 Hz), 163.6, 162.8, 144.8, 131.0 (d, 7 = 3.1 Hz), 130.8, 130.3 (d, 7 = 8.9 Hz), 128.5, 127.9, 115.7 (d, 7 = 21.7 Hz), 43.0, 21.3.; HRMS calc'd for Ci7Hi5FN50+ [M+H]+, 324.1261; found 324.1265.
Radiochemical synthesis of [18F]-Tetrazine ([18F]-5).
[00346] General methods for radioisotope production: a GE PETtrace 16.5 MeV cyclotron was used for [ 18 F]fluoride production by the 18 Ο(ρ,η) 18 F nuclear reaction to irradiate 18 O- enriched water. [ 18 F] fluoride was delivered to a lead- shielded hot cell in 18 O-enriched water by nitrogen gas pressure.
[00347] General methods for analysis of radiofluorination reactions: radioactivity was quantified using a Capintec Radioisotope Calibrator (CRC-712M) ion chamber.
Radiochemical incorporation yields were determined by radioTLC. EMD TLC Silica gel 60 plates (10 x 2 cm) were spotted with an aliquot (1-5 μί) of crude reaction mixture
approximately 1.5 cm from the bottom of the plate (baseline). TLC plates were developed in a chamber containing ethyl acetate until within 2 cm of the top of the plate (front). Analysis was performed using a Bioscan AR-2000 radio-TLC imaging scanner and WinScan software. Radiochemical identity and purity were determined by radioHPLC. A Phenomenex Luna C18, 250 x 4.6 mm, 5 μιη HPLC column was used with a Waters 1515 Isocratic HPLC Pump equipped with a Waters 2487 Dual λ Absorbance Detector, a Bioscan Flow-Count equipped with a Nal crystal, and Breeze software.
Manual radiolabeling.
CONTROL:
[18F]-7
£L 0 [18F]fluoride, TEAB Γ Pr4N 0H
EXPERIMENT: EtC^C-^ N)-NMe3- OTf r. . Qn op Et02C^7 \— 8P 4
ACN, 90 °C
10 min w ACN, 120
3 min
10 [l aF]-SFB
[00348] [ F]Fluoride was prepared for radiofluorination by the following method: a solution of base (tetraethylammonium bicarbonate (TEAB), 6 mg) in acetonitrile and water (1 mL, v/v 7:3) was added to an aliquot of target water (< 1 mL) containing the appropriate amount of [ 18 F]fluoride in a V-shaped vial sealed with a teflon-lined septum. The vial was heated to 110 °C while nitrogen gas was passed through a P205-Drierite™ column followed by the vented vial. When no liquid was visible in the vial, it was removed from heat, anhydrous acetonitrile (1 mL) was added, and the heating was resumed until dryness. This step was repeated an additional three times. The vial was then cooled at room temperature under nitrogen pressure. The contents were resolubilized in CH3CN (0.6 mL). A solution of
TEA[ 18 F] (0.2 mL) was added into another V-shaped vial charged with 1,4-dinitrobenzene 6 o
(2 mg) and CH3CN (0.2 mL). The mixture was heated at 90 C for 5 min, and then quenched with HPLC mobile phase (40% CH3CN, 60% 0.1 M NH4 HC02(aq), 0.2 mL). TLC plate was spotted with crude mixture (2 μί) and developed with 100% EtOAc to determine the radiochemical conversion. The RCC value (92%) revealed that the TEA[ 18 F] solution was ready for radiolabeling. (total time: 8 min)
[00349] Note: The quality of TEA[ 18 F] is crucial for the following radiolabeling, thus the control is necessary to evaluate the quality.
[00350] Ethyl 4-(trimethylammonium triflate)benzoate 8 (4.8 mg) in anhydrous MeCN (0.6 mL) was added to the above dried TEA[ 18 F] solution (0.4 mL) and the mixture was heated at
Q
90 C for 10 min to produce ethyl 4-[ F]fluorobenzoate 9. The ethyl ester was subsequently hydrolyzed to form 10 using tetrapropylammonium hydroxide (20 μί, 1.0 M in water) at 120
C for 3 min, and then the mixture azeotropically dried using MeCN (1 mL). Subsequently, a solution of N,N,N',N'-Tetramethyl-0-(N-succinimidyl) uronium tetrafluoroborate (10 mg) in
DMF (0.3 mL) was added and the solution heated at 90 C for 5 min. The mixture was cooled down to ambient temperature. Afterwards a solution of tetrazine amine TFA salt 4 (1.7 mg) in DMF (0.3 mL) was added into the mixture, followed by addition of Et3N (20 μί). Then the reaction was heated at 60 C for 7 min, quenched with HPLC mobile phase (60% CH3CN, 40% 0.1 M NH4 HC02(aq), 2 mL). The solution was diluted with water (15 mL), passed through C18 cartridge, washed with water (10 mL), and eluted with acetonitrile (1.5 mL) to determine the radiochemical yield (RCY) and identity via co-injection with standard [19F]-5. Figure 8 shows a table of radiochemical yield (non-decay corrected) and a radioHPLC chromatogram. The column was luna 5u C18 100 A 250 x 4.6 mm, the mobile phase was 60% CH3CN, 40% 0.1 M NH4-HC02(aq), and the flow rate was lmL/min.
Automated synthesis by GE TracerLab FXFN method.
pletion of bombardment, the [ 18
[00351] Following com F]fluoride was transferred to the GE TRACERlab™ FXFN radiosynthesis module via helium gas overpressure. A schematic diagram of the GE medical systems commercial TRACERlab™ FXFN radiosynthesis module used for the synthesis of [ 18
F]-5 is shown in Figure 9.
Automated synthesis involves the following: (1) azeotropic drying of [ 18
[00352] F]fluoride;
(2) [ 18 F]fluorination; and (3) HPLC purification, followed by solid-phase formulation of the final product. The synthesis module was operated in the following sequences with numerical references to Figure 9.
• [ 1180F]Fluoride was produced by the 18 Ο(ρ,η) 18 F nuclear reaction using a GE
cyclotron and delivered to the radiosynthesis module via 10. The [ 18 F]fluoride was quantitatively trapped on a QMA carbonate ion exchange solid phase extraction (SPE) light cartridge (Waters; activated with 6 mL of trace grade H20).
• Automated synthesis began with the elution of resin-bound [ 18 F]fluoride using a solution of tetraethylammonium bicarbonate (6 mg in 500 μΐ^ H20 and 500 μΐ^ CH3CN), pre-loaded into 1 and delivered to the reactor (12).
The reaction mixture (12) was dried azeotropically at 85 °C under N2 flow and vacuum over 5 min, then at 110 °C under N2 flow and vacuum for 2 min, then cooled down to 90 °C.
Ethyl 4-(trimethylammonium triflate)benzoate 8 (5 mg in 1.0 mL CH3CN) preloaded into 3 was added to 12. The reactor was sealed via the closure of valve V13, V20 and V24 and the reaction mixture was maintained at 90 °C for 10 min.
The reaction mixture was then cooled to 40 °C, vented via valve V24, and tetrapropylammonium hydroxide (1.0 M in water, 20 μΐ^ in 0.5 mL CH3CN) preloaded into 4 was added to 12. The reactor was sealed via the closure of valve V24 and the reaction mixture was heated to 120 °C and this temperature was maintained for 3 min, then cooled down to 70 °C.
The reaction mixture (12) was dried azeotropically by addition of 1 mL anhydrous CH3CN, preloaded into 5, at 70 °C under N2 flow and vacuum over 6 min.
N,N,N',N'-Tetramethyl-0-(N-succinimidyl) uronium tetrafluoroborate (TSTU, 10 mg) in DMF (0.5 mL) pre-loaded into 6 was added to 12. The reactor was sealed via the closure of valve V24 and the reaction mixture was heated to 90 °C and this temperature was maintained for 5 min, then cooled down to 60 °C.
A mixture of tetrazine amine TFA salt 4 (6.0 mg) and Et N (40 uL) in DMF (0.5 mL) pre-loaded into 2 was added to 12. The reaction mixture was maintained at 60 °C for 7 min.
The crude reaction mixture was eluted into 14, which was preloaded with 20:80 CH3CN/ 0.1 M ammonium formate solution (3 mL). The contents of 14 were transferred to the HPLC loop via N2 pressure using a fluid detector, injected onto a semi-preparative column (Luna C18 semi-preparative, 250 x 10.00 mm, 5μ), and eluted with 40:60 CH3CN/ 0.1 M ammonium formate by volume at a flow rate of 5 niL/min. The eluent was monitored by UV (λ = 254 nm) and radiochemical detectors connected in series.
A typical semi-preparative HPLC chromatogram is shown in Figure 10. The fraction containing the major radiochemical product (tR = 20.1 min) was collected, via valve 18, into a large dilution vessel (15), which was preloaded with 23 mL of sterile water for injection (United States Pharmacopeia (USP); Hospira).
The diluted HPLC fraction was then loaded onto a C18 SPE cartridge (16) (Waters; preactivated with 5 mL EtOH followed by 10 mL H20).
• Cartridge 16 was washed with 10 niL sterile water for injection, USP, preloaded into 7, to remove traces of salts, HPLC mobile phase, and [ 18 F]fluoride. Then 16 was eluted with 1.5 mL CH3CN, preloaded in 8, into collection vial 17.
[00353] Analyses of radioactive mixtures were performed by HPLC with an in-line UV (λ = 254 nm) detector in series with a Csl PIN diode radioactivity detector. Uncorrected radiochemical yields of [ 18 F]-5 were 10 + 3% (n = 8) relative to starting [ 18 F]fluoride. Synthesis and characterization of [18F]-VHHs.
[00354] General procedure: the solution of [ 18 F]-Tetrazine 5 obtained from FXFN was concentrated at 70 °C under N2 flow for 10 min, then cooled down to room temperature. A centrifuge tube (1.5 mL) was loaded with PBS (150 μί) and a solution of [ 18 F]-Tetrazine 5 in CH3CN (50 μί), then the radioactivity was measured by a dose calibrator (10-15 mCi). VHH-TCO (either monomer or dimer) in PBS (100 μί) was added into the centrifuge tube at the last step. The reaction was allowed to proceed with constant agitation at room
temperature for -20 min. The mixture was analyzed by radio-TLC (100% EtOAc, 18
R/f^FJ-Tz
5 = 0.6, Rf [ 1180F]-VHHs = 0.0) showing more than 80% radiochemical conversion. The reaction mixture was loaded onto a PD-10 size-exclusion cartridge (GE Healthcare), and PBS (2 x 500 μί) was used to assist transfer. Afterwards the activity of the reaction centrifuge tube was measured by the dose calibrator (< 50 μθ), confirming a complete transfer. The PD-10 cartridge was eluted with PBS (10 x 500 μί), and each fragment was collected into a new 1.5 mL tube. The desired product [ 18 F]-VHHs usually eluted at tubes #4-7.
Characterization (using [ 18 F]-DC8-dimer as an example): rTLC chromatography (Figure 11
(left panel) [ 18 F]-Tz 5; Figure 11 (right) [ 18 F]-DC8-dimer; at 20 min). Fragments collection through PD-10 cartridge can be found in Figure 12. After size-exclusion chromatography, a 47 + 9% (n = 5, non-decay corrected) radiochemical yield was obtained.
MicroPET Imaging Studies.
[00355] All procedures and animal protocols were approved by the Massachusetts General
Hospital subcommittee on research animal care. [ 1180F]VHHs (20-40 μθ) was injected into the tail-vein of each animal. Mice were serially imaged using a microPET (Sofie, G4-PET). For all imaging experiments, mice were anesthetized using 2% isoflurane in 02 at a flow rate of ~ 1.5 L/min, positioned in a prone position along the long axis of the microPET scanner and imaged. Images were reconstructed using a filtered back projection reconstruction algorithm.
For image analysis, cylindrical regions of interest (ROIs) were manually drawn from three dimensional filtered back projection (FBP) reconstructed PET images using AMIDE software. Regional radioactivity was expressed as the percentage standardized uptake value [% SUV = % ID/mL x body weight (g)]. Two- and three-dimensional visualizations were produced using the DICOM viewer OsiriX (© Pixmeo SARL, 2003-2014).
Sequences of DC8, and DC13
DC8:
[00356] Nucleic Acid:
CAGGTGCAGCTGCAGGAGTCAGGGGGAGGATTGGTGCAGCCTGGGGGGTCTCTG
AGACTCTCCTGTACAGCCTCTGGATTCACATTCAGTACTTACTACATGAGCTGGG
TCCGCAAGGCTCCAGGGAAGGGGCCCGAGTGGGTCTCAGTTATGAATAGTAGTG
GTGGTGACACAAGGTATGCAGACTTCGTGAAGGGCCGATTCACCATCTCCAGAG
ACAACGCCAAGAACACACTGTATCTCCAAATGAACAGCCTGAAACCTGAGGATA
CGGCCCTGTATTACTGTGCGCAAGGTAGATCAGATATATACCCAACCTTCACGCG
GGGCCAGGGGACCCAGGTCACCGTCTCCTCAGGAGGACTGCCGGAAACCGGC
(SEQ ID NO: 1)
[00357] Peptide:
Q VQLQES GGGLVQPGGS LRLS CT AS GFTFS T Y YMS W VRKAPGKGPE W VS VMNS S G GDTRYADFVKGRFTISRDNAKNTLYLQMNSLKPEDTALYYCAQGRSDIYPTFTRGQ GTQ VT VS S GS LPETGGHHHHHH (SEQ ID NO: 2)
DC13:
[00358] Nucleic Acid:
CAGGTTCAACTGCAAGAGAGTGGCGGGGGCCTGGTTCAGACCGGTGGTTCTCTCC
GGCTCTCGTGTGCCGCAAGTGGAGTAGATTTTAACTGGTATAGCATGGGTTGGTT
CAGGCAAGCCCCTGGCAAAGAGCGGGAGTATGTGGCTTCGATTGACCAGGGAGG
CGAGTTGGATTACGCAATATCAGTAAAGGGCAGATTCACGATCTCCCGAGACAA
CGCGAAGAATATGGTGTATCTCCAGATGAATTCGTTAAAGCCCGAAGACACCGC
TGTATACTACTGTGCCGCAGATTTTTCCGGCCGGGGTGCGTCAAACCCTGACAAG
TATAAATATTGGGGACAGGGAACCCAAGTGACCGTCAGCAGCGGTGGGTTGCCC
GAAACTGGAGGACACCATCACCATCACCAT (SEQ ID NO: 3)
[00359] Peptide:
QVQLQESGGGLVQTGGSLRLSCAASGVDFNWYSMGWFR
QAPGKEREYVASIDQGGELDYAISVKGRFTISRDNAKNMVYLQMNSLKPEDTAVYY C AADFS GRGASNPDKYKYWGQGTQVT VS S GGLPETGGHHHHHH (SEQ ID NO: 4)
References
1. Chen I, Dorr BM, Liu DR (2011) A general strategy for the evolution of bond- forming enzymes using yeast display. Proc Natl Acad Sci U SA 108(28): 11399-11404.
2. Theile CS, et al. (2013) Site-specific N-terminal labeling of proteins using sortase- mediated reactions. Nat Protoc 8(9): 1800-1807.
3. Witte MD, et al. (2012) Preparation of unnatural N-to-N and C-to-C protein fusions. Proc Natl Acad Sci 109(30): 11993-11998.
4. Mok NY, Chadwick J, Kellett KAB, Casas-Arce E, Hooper NM, Johnson AP, Fishwick CWG (2013) Discovery of biphenylacetamide -derived inhibitors of BACE1 using de novo structure-based molecular design. J Med Chem 56(5): 1843-1852.
5. Yang J, Karver MR, Li W, Sahu S, Devaraj NK (2012) Metal-catalyzed one -pot synthesis of tetrazines directly from aliphatic nitriles and hydrazine. Angew Chem Int Ed 51(21): 5222- 5225.
6. Evans HL, Carroll L, Aboagye EO, Spivey AC (2014) Bioorthogonal chemistry for 68Ga radiolabelling of DOTA-containing compounds. J Label Compd Radiopharm 57(4):291-297.
Example 3. Immuno-PET of tumor cells in vivo.
[00360] Immunotherapy using checkpoint-blocking antibodies against targets such as CTLA4 and PD-1 can be used to treat melanoma and non-small cell lung cancer in a subset of patients. The presence of T cells in a tumor correlates with improved survival. Immuno- positron emission tomography (immunoPET) was shown to visualize tumors by detecting infiltrating lymphocytes, which can be used to distinguish subjects that respond to checkpoint
QQ
inhibitors from subjects that do not respond, or respond poorly, to checkpoint inhibitors. Zr- labeled PEGylated single domain antibody fragments (VHHs) specific for the T cell marker MHC II were used to track the presence of intratumoral T cells by immunoPET. Exemplary methods and compositions for generating such labels are shown in Figure 15A and 15B. Such Zr-labeled PEGylated single domain antibody fragments may be used to detect/assess tumor infiltrating lymphocytes, e.g., in response to checkpoint blockade in a subject {e.g., a patient), or a biological model of tumor progression (e.g., a B 16 melanoma model). Zr- labeled PEGylated-anti-MHC II VHH (VHH7) detected thymus and secondary lymphoid
structures as well as intratumoral MHC II positive T cells (Figures 16A and 16B). Wild-type B6 mice were injected with 0.5 million B 16 melanoma cells (Figure 16A) and injected with
QQ
Zr-labeled PEGylated-anti-MHC II VHH 7 days following injection of the melanoma cells. PEG was 20kDa in size. PET images were acquired 24 hours post injection with the Zr- labeled PEGylated-anti-MHC II VHH. The notation shown in figure 16A refers to the following: C-LNs: cervical lymph nodes; Ax: axillary, Br: brachial; KD: kidneys; SP: spleen; BM: bone marrow. As a control, wild-type B6 mice that were not injected with B6 cells were injected with 89Zr-labeled PEGylated-anti-MHC II VHH (Figure 16B). PEG was 20kDa in size. PET images were acquired 24 hours post injection with the Zr-labeled PEGylated- anti-MHC II VHH. The notation shown in figure 16B refers to the following: C-LNs:
cervical lymph nodes; Ax: axillary, Br: brachial; KD: kidneys; SP: spleen; BM: bone marrow. The 89Zr-PEGylated-VHH7 was capable of detecting the B6 tumor cells in the mouse by detecting infiltrating lymphocytes into the tumor (Figure 16A).
[00361] Immune responses occur in organized lymphoid structures, where professional antigen presenting cells interact with T and B lymphocytes to protect from infectious disease or cancer. Short of relying on survival, immune responses -whether harmful or protective- are commonly assessed by taking blood samples and measuring the levels of circulating lymphocytes and their products, such as cytokines and immunoglobulins. In humans, access to bone marrow, spleen and lymph nodes requires surgical interventions such as biopsies or sampling at autopsy, methods difficult to apply on a large scale. Similar limitations apply to the sampling of lymphoid organs in live animals, but at least animal models afford the possibility of euthanasia and examination at necropsy of any organ or tissue of interest. Most of mouse immunology thus relies on methods that do not provide longitudinal information for individual animals. The assessment of immune responses over time therefore remains a challenge. Intravital multi-photon microscopy can show migration of T, B cells and other immunocytes in real time and has clarified our understanding of, for example, the germinal center reaction. Nonetheless, such mapping of the movement of various lymphocyte and other cell subsets requires complicated invasive procedures. Tracking a cellular immune response in a living animal over time remains an unsolved challenge.
[00362] The field of tumor immunology has made great progress, in particular in the areas of antibodies used as checkpoint blockade and for cell-based therapies such as chimeric antigen receptor-expressing T cells (CAR-T cells). For certain cancers (melanoma, non-small cell lung cancer, acute lymphoblastic leukemia) immunotherapy has revolutionized clinical treatment and even produced cures, but the failure of a significant fraction of patients to
respond -even in these treatable types of cancer- remains an issue. To follow and visualize immune responses longitudinally for prognosis would thus be highly desirable.
[00363] If it were possible to stratify patients into those who might benefit from certain forms of immunotherapy and separate them from those less likely to do so, expensive treatments with potentially severe side effects might be allocated to those individuals with a high probability of response. Positron emission tomography (PET) using labeled antibodies or antibody fragments (immuno-PET) may achieve this goal.
[00364] To achieve the goal of non-invasively monitoring the distribution of T cells, a small molecular weight antibody-derived format that retains antigen-binding capability, the variable region segment of camelid heavy chain-only antibodies, also referred to as VHHs or nanobodies, were used. These fragments are typically about 14 kDa in size and readily lend themselves to sortase-catalyzed enzymatic transformations for a variety of purposes, including the installation of radioisotopes for PET imaging.
EQUIVALENTS AND SCOPE
[00365] In the claims articles such as "a," "an," and "the" may mean one or more than one unless indicated to the contrary or otherwise evident from the context. Claims or descriptions that include "or" between one or more members of a group are considered satisfied if one, more than one, or all of the group members are present in, employed in, or otherwise relevant to a given product or process unless indicated to the contrary or otherwise evident from the context. The invention includes embodiments in which exactly one member of the group is present in, employed in, or otherwise relevant to a given product or process. The invention includes embodiments in which more than one, or all of the group members are present in, employed in, or otherwise relevant to a given product or process.
[00366] Furthermore, the invention encompasses all variations, combinations, and permutations in which one or more limitations, elements, clauses, and descriptive terms from one or more of the listed claims is introduced into another claim. For example, any claim that is dependent on another claim can be modified to include one or more limitations found in any other claim that is dependent on the same base claim. Where elements are presented as lists, e.g. , in Markush group format, each subgroup of the elements is also disclosed, and any element(s) can be removed from the group. It should it be understood that, in general, where the invention, or aspects of the invention, is/are referred to as comprising particular elements and/or features, certain embodiments of the invention or aspects of the invention consist, or consist essentially of, such elements and/or features. For purposes of simplicity, those
embodiments have not been specifically set forth in haec verba herein. It is also noted that the terms "comprising" and "containing" are intended to be open and permits the inclusion of additional elements or steps. Where ranges are given, endpoints are included. Furthermore, unless otherwise indicated or otherwise evident from the context and understanding of one of ordinary skill in the art, values that are expressed as ranges can assume any specific value or sub-range within the stated ranges in different embodiments of the invention, to the tenth of the unit of the lower limit of the range, unless the context clearly dictates otherwise.
[00367] This application refers to various issued patents, published patent applications, journal articles, and other publications, all of which are incorporated herein by reference. If there is a conflict between any of the incorporated references and the instant specification, the specification shall control. In addition, any particular embodiment of the present invention that falls within the prior art may be explicitly excluded from any one or more of the claims. Because such embodiments are deemed to be known to one of ordinary skill in the art, they may be excluded even if the exclusion is not set forth explicitly herein. Any particular embodiment of the invention can be excluded from any claim, for any reason, whether or not related to the existence of prior art.
[00368] Those skilled in the art will recognize or be able to ascertain using no more than routine experimentation many equivalents to the specific embodiments described herein. The scope of the present embodiments described herein is not intended to be limited to the above Description, but rather is as set forth in the appended claims. Those of ordinary skill in the art will appreciate that various changes and modifications to this description may be made without departing from the spirit or scope of the present invention, as defined in the following claims.
Claims
1. A method for site-specifically conjugating a hydrophilic polymer to a single domain antibody comprising:
contacting the single domain antibody comprising a sortase recognition sequence with a sortase substrate, wherein the sortase substrate is bound to the hydrophilic polymer, in the presence of a sortase to yield a site- specifically modified single domain antibody.
2. A method for site specifically conjugating a hydrophilic polymer to a single domain antibody comprising:
contacting the single domain antibody comprising a first click chemistry handle with a hydrophilic polymer, wherein the hydrophilic polymer comprises a second click chemistry handle, under conditions suitable to yield a single domain antibody conjugate to the hydrophilic polymer.
3. A method for site-specifically conjugating a hydrophilic polymer to a single domain antibody comprising:
(i) contacting a single domain antibody comprising a sortase recognition sequence with a sortase substrate, wherein the sortase substrate comprises a first click chemistry handle, in the presence of a sortase to yield a site- specifically modified single domain antibody; and
(ii) contacting the site-specifically modified single domain antibody of step (i) with a hydrophilic polymer conjugated to a second click chemistry handle under conditions suitable to yield a single domain antibody conjugated to the hydrophilic polymer.
3a. The method of any one of claims 1-3, wherein the hydrophilic polymer is a synthetic polymer.
3b. The method of any one of claim 1-3, wherein the hydrophilic polymer is not a polypeptide or polynucleotide.
4. The method of any one of claims l-3b, wherein the a hydrophilic polymer is selected from the group consisting of polyethylene glycol (PEG), polyvinyl pyrrolidone (PVP), polyvinyl alcohol (PVA), polyacrylic acid (PAA), polyacrylamide, N-(2-hydroxypropyl) methacrylamide (HPMA), divinyl ether-maleic anhydride (DIVEMA), polyoxazoline, polyphosphoester (PPE), polyethyleneimine (PEI), and polyphosphazene.
5. The method of any one of claims 1-4, wherein the hydrophilic polymer is polyethylene glycol (PEG), or polyoxazoline.
6. The method of any one of claims 1-5, wherein the hydrophilic polymer is polyethylene glycol (PEG).
7. The method of any one of claims 1-6, wherein the molecular weight of the hydrophilic polymer ranges from 2 kDa to 50 kDa.
8. The method of any one of claims 1-7, wherein the molecular weight of the hydrophilic polymer ranges from 5 kDa to 40 kDa.
9. The method of any one of claims 1-8, wherein the molecular weight of the hydrophilic polymer ranges from 5kDa to 30 kDa.
10. The method of any one of claims 1-9, wherein the molecular weight of the hydrophilic polymer ranges from 10 kDa to 30 kDa.
11. The method of any one of claims 1-10, wherein the molecular weight of the hydrophilic polymer ranges from 15 kDa to 25 kDa.
12. The method of any one of claims 1-11, wherein the molecular weight of the hydrophilic polymer is approximately 20 kDa.
12a. The method of claim 6, wherein the PEG ranges from 2 kDa to 50 kDa, 5 kDa to 40 kDa, 5kDa to 30 kDa, 10 kDa to 30 kDa, 15 kDa to 25 kDa, or 15 kDa to 25 kDa.
13. A method for producing a site-specifically conjugated bivalent single domain antibody comprising contacting:
a first single domain antibody comprising a first click chemistry handle, with a second single domain antibody comprising a second click chemistry handle, under suitable conditions to yield the site- specifically conjugated bivalent single domain antibody.
14. The method of claim 13, wherein the first click chemistry handle is conjugated to the C-terminal amino acid residue of the first single domain antibody.
15. The method of claim 13 or 14, wherein the second click chemistry handle is conjugated to the C-terminal amino acid residue of the second single domain antibody.
16. A method for producing a site-specifically conjugated bivalent single domain antibody comprising:
(i) contacting a first single domain antibody comprising a sortase recognition sequence with a first sortase substrate, wherein the first sortase substrate comprises a first click chemistry handle, in the presence of a sortase to yield a first site-specifically modified single domain antibody;
(ii) contacting a second single domain antibody comprising a sortase recognition sequence with a second sortase substrate, wherein the second sortase substrate comprises a second click chemistry handle, in the presence of a sortase, to yield a second site- specifically modified single domain antibody; and
(iii) contacting the first site-specifically modified single domain antibody of step (i) with the second site- specifically modified single domain antibody of step (ii) under suitable conditions to yield the site- specifically conjugated bivalent single domain antibody.
17. The method of claim 16, wherein the first and/or second sortase substrate further comprises a detectable label.
18. The method of any one of claims 2-17, wherein the first click chemistry handle comprises any one of the click chemistry handles in Table 1 or Table 2.
19. The method of any one of claims 2-18, wherein the first click chemistry handle comprises a conjugated diene, an optionally substituted tetrazine, an optionally substituted
alkene, an optionally substituted trans-cyclooctene (TCO), an aldehyde, a ketone, a hydrazine, or an aminooxy functionality.
20. The method of any one of claims 2-19, wherein the second click chemistry handle comprises any one of the click chemistry handles in Table 1 or Table 2.
21. The method of any one of claims 2-20, wherein the second click chemistry handle comprises a conjugated diene, an optionally substituted tetrazine, an optionally substituted alkene, an optionally substituted trans-cyclooctene (TCO), an aldehyde, a ketone, a hydrazine, or an aminooxy functionality.
22. The method of any one of claims 2-21, wherein the second click chemistry handle is DBCO.
23. The method of any one of claims 2-22, wherein the first click chemistry handle is compound 1, 2, 3, or 4 from Figure 2B.
24. The method of any one of claims 2-23, wherein the first and/or the second click chemistry handle comprises a fluorophore.
25. The method of claim 24, wherein the fluorophore is Alexa647 or Texas Red.
26. The method of any one of claims 1-25, wherein the first sortase substrate and/or the second sortase substrate comprises a peptide.
27. The method of claim 26, wherein the peptide comprises the amino acid sequence GGG.
28. The method of any one of claims 1-25, wherein the sortase substrate comprises an alkylamine group.
29. The method of any one of claims 1-28, wherein the sortase substrate comprises a linker.
30. The method of any one of claims 1-29, wherein the first click chemistry handle, or the first sortase substrate comprises a linker.
31. The method of any one of claims 1-30, wherein the second click chemistry handle, or the second sortase substrate comprises a linker.
32. The method of any one of claims 1-31, wherein the first click chemistry handle, or the first sortase substrate comprises a radionuclide.
33. The method of any one of claims 1-32, wherein the second click chemistry handle, or the second sortase substrate comprises a radionuclide.
34. The method of claim 32 or 33, wherein the radionuclide is carbon-11, carbon-14, nitrogen-13, oxygen-15, fluorine-18, rubidium-82, copper-61, copper-62, copper-64, yttrium- 86, gallium-68, zirconium- 89, or iodine- 124.
35. The method of any one of claims 32-34, wherein the radionuclide is fluorine-18.
36. The method of any one of claims 32-34, wherein the radionuclide is zirconium-89.
37. The method of any one of claims 32-34, wherein the radionuclide is bound by a chelating moiety.
38. The method of claim 37, wherein the chelating moiety is 1,4,7-triazacyclononane- triacetic acid (NOT A), 1,4,7, 10-tetraazacyclododecane-tetraacetic acid (DOT A),
triazacyclononane-phosphinate (TRAP), or desferoxamine (DFO).
39. The method of claim36, wherein the zirconium-89 is bound by a desferoxamine (DFO) chelating moiety.
40. The method of any one of claims 1-39, wherein the first or second click chemistry handle, or first or second sortase substrate comprises 18 F-tetrazine or 18 F-FDG conjugated to tetrazine.
41. The method of any one of claims 1-40, wherein the single domain antibody is a VHH single domain antibody, or a single chain Fv fragment (scFv).
42. The method of claim 41 , wherein the VHH is DC8 or DC 13
43. The method of any one of claims 13-42, wherein the first single domain antibody binds CDl lb, Class II MHC, CTLA4, CD8, Cd4, CD19, IL2, IL10, CXCLIO, or CXCL5.
44. The method of any one of claims 13-43, wherein the first single domain antibody and the second single domain antibody are directed to bind a different antigen or epitope.
45. The method of any one of claims 13-43, wherein the first single domain antibody and the second single domain antibody are directed to bind the same antigen or epitope.
46. The method of any one of claims 1-12, wherein the sortase substrate comprises a peptide.
47. The method of claim 46, wherein the peptide is an N-terminal peptide.
48. The method of claim 46 or 47, wherein the sortase substrate comprises an oligoglycine or an oligoalanine sequence.
49. The method of claim 48, wherein the oligoglycine or oligoalanine comprises 1-10 N- terminal glycine residues or 1-10 N-terminal alanine residues, respectively.
50. The method of any one of claims 46-49, wherein the N-terminal sortase substrate comprises the sequence GGG.
51. The method of any one of claims 1-12, wherein the sortase substrate comprises an alkylamine group.
52. The method of any one of claims 16-45, wherein the first sortase substrate and/or the second sortase substrate comprises a peptide.
53. The method of claim 52, wherein the peptide is an N-terminal peptide.
54. The method of claim 52 or 53, wherein the first sortase substrate and/or the second sortase substrate comprises an oligoglycine or an oligoalanine sequence.
55. The method of claim 54, wherein the oligoglycine and/or the oligoalanine comprises 1-10 N-terminal glycine residues or 1-10 N-terminal alanine residues, respectively.
56. The method of any one of claims 52-55, wherein the N-terminal sortase substrate comprises the sequence GGG.
57. The method of any one of claims 16-45, wherein the first sortase substrate and/or the second sortase substrate comprises an alkylamine group.
58. The method of any one of claims 1-57, wherein the sortase recognition sequence is selected from the group consisting of LPXTX (SEQ ID NO: 15), NPXTX (SEQ ID NO: 16) and LPXAG (SEQ ID NO: 17), wherein each instance of X independently represents any amino acid residue.
59. The method of any of claims 1-57, wherein the enzyme recognition sequence is LPETG (SEQ ID NO: 11), LPETA (SEQ ID NO: 18), NPQTN (SEQ ID NO: 19), NPKTG (SEQ ID NO: 20), LPSTG (SEQ ID NO: 21), or LPXAG(SEQ ID NO: 17).
60. The method of any of claims 1-59, wherein the sortase is sortase A from
Staphylococcus aureus (SrtAaureus), sortase A from Streptococcus pyogenes
(SrtApyogenes), sortase B from S. aureus (SrtBaureus), sortase B from Bacillus anthracis (SrtB anthracis), or sortase B from Listeria monocytogenes (SrtB monocytogenes).
61. A radiolabeled binding protein comprising:
(i) a single domain antibody,
(ii) a hydrophilic polymer, and
(iii) a radiolabeled agent.
62. The radiolabeled binding protein of claim 61, wherein the single domain antibody is a VHH or an scFv.
63. The radiolabeled binding protein of claim 61 or 62, wherein the single domain antibody binds to a tumor cell, a tumor-associated cell, or a tumor antigen.
64. The radiolabeled binding protein of claim 61 or 62, wherein the single domain antibody binds to an immune cell.
65. The radiolabeled binding protein of claim 64, wherein the lymphocyte is a T lymphocyte.
66. The radiolabeled binding protein of claim 64, wherein the lymphocyte is a B lymphocyte.
67. The radiolabeled binding protein of claim 63, wherein the tumor antigen is selected from the group consisting of CA-125, MUC-1, and MAGE.
68. The radiolabeled binding protein of claim 63, wherein the tumor cell, or tumor- associated cell is selected from the group consisting of a melanoma cell, a breast cancer cell, and a lung cancer cell.
69. The radiolabeled binding protein of claim 61 or 62, wherein the single domain antibody binds to a marker of inflammation.
70. The radiolabeled binding protein of claim 69, wherein the marker of inflammation is selected from the group consisting of CDl lb, CDl lc, CD13, CD15, CD66, CD14, CD64, CD66b, CD18, CD16, CD62L, and CD67.
71. The radiolabeled binding protein of claim 61 or 62, wherein the single domain antibody binds to a cytokine.
72. The radiolabeled binding protein of claim 71, wherein the cytokine is IL2, IL10, CXCL10, CXCL5, (TNF)-a, IL-6, IL-1 beta, IL-8, IL-12, IL-16, orIL-18.
73. The radiolabeled binding protein of claim 30 or 31, wherein the single domain antibody binds to CD8, CTLA4, MHC class II, or CDl lb, CD4, CD19, IL2, IL10, CXCLIO, or CXCL5.
74. The radiolabeled binding protein of any one of claims 61-73, wherein the single domain antibody is from 10 kDa to 40 kDa in size.
75. The radiolabeled binding protein of any one of claims 61-74, wherein the single domain antibody is from 10 kDa to 20 kDa in size.
76. The radiolabeled binding protein of any one of claims 61-75, wherein the single domain antibody is from 10 kDa to 18 kDa in size.
77. The radiolabeled binding protein of any one of claims 61-76, wherein the single domain antibody comprises a sortase recognition sequence.
78. The radiolabeled binding protein of any one of claims 61-77, wherein the single domain antibody comprises a C-terminal sortase recognition sequence.
79. The radiolabeled binding protein of claim 77 or 78, wherein the sortase recognition sequence is LPXTX (SEQ ID NO: 15), wherein each instance of X independently represents any amino acid residue.
80. The radiolabeled binding protein of claim 77 or 78, wherein the sortase recognition sequence is LPETG (SEQ ID NO: 11) or LPETA (SEQ ID NO: 18).
81. The radiolabeled binding protein of claim 77 or 78, wherein the sortase recognition motif is NPXTX (SEQ ID NO: 16), wherein each instance of X independently represents any amino acid residue.
82. The radiolabeled binding protein of claim 77 or 78, wherein the sortase recognition motif is NPQTN (SEQ ID NO: 19) or NPKTG (SEQ ID NO: 20).
82a. The radiolabeled binding protein of any one of claims 61-82, wherein the hydrophilic polymer is selected from the group consisting of polyethylene glycol (PEG), polyvinyl pyrrolidone (PVP), polyvinyl alcohol (PVA), polyacrylic acid (PAA), polyacrylamide, N-(2- hydroxypropyl) methacrylamide (HPMA), divinyl ether-maleic anhydride (DIVEMA), polyoxazoline, polyphosphoester (PPE), polyethyleneimine (PEI), and polyphosphazene.
83. The radiolabeled binding protein of any one of claims 61 -82a, wherein the hydrophilic polymer is a polyethylene glycol (PEG) or polyoxazoline.
84. The radiolabeled binding protein of any one of claims 61-83, wherein the hydrophilic polymer is a polyethylene glycol (PEG).
85. The radiolabeled binding protein of any one of claims 61-84, wherein the molecular weight of the hydrophilic polymer ranges from 2 kDa to 50 kDa.
86. The radiolabeled binding protein of any one of claims 61-85, wherein the molecular weight of the hydrophilic polymer ranges from 5 kDa to 40 kDa.
87. The radiolabeled binding protein of any one of claims 61-86, wherein the molecular weight of the hydrophilic polymer ranges from 10 kDa to 30 kDa.
88. The radiolabeled binding protein of any one of claims 61-87, wherein the molecular weight of the hydrophilic polymer ranges from 15 kDa to 25 kDa.
89. The radiolabeled binding protein of any one of claims 61-88, wherein the molecular weight of the hydrophilic polymer is approximately 20 kDa.
90. The radiolabeled binding protein of any one of claims 61-89, wherein the radiolabeled agent comprises a radionuclide that is carbon-11, carbon-14, nitrogen-13, oxygen-15, fluorine- 18, rubidium-82, copper-61, copper-62, copper-64, yttrium-86, gallium-68, zirconium-89, or iodine- 124.
91. The radiolabeled binding protein of claim 90, wherein the radiolabeled agent comprises a radionuclide that is zirconium-89, fluorine-18, coper-64, or gallium-68.
92. The radiolabeled binding protein of claim 90, wherein the radiolabeled agent comprises a radionuclide that is zirconium-89.
93. The radiolabeled binding protein of claim 90, wherein the radiolabeled agent comprises a radionuclide that is fluorine-18.
94. The radiolabeled binding protein of any one of claims 61-90, wherein the radiolabeled agent is fludeoxyglucose ( 18 F-FDG).
95. The radiolabeled binding protein of any one of claims 61-90, wherein the radiolabeled agent comprises 18F.
96. The radiolabeled binding protein of any one of claims 61-95 further comprising a chelating moiety.
97. The radiolabeled binding protein of claim 58, wherein the chelating moiety is 1,4,7- triazacyclononane-triacetic acid (NOT A), 1,4,7, 10-tetraazacyclododecane-tetraacetic acid (DOTA), or triazacyclononane-phosphinate (TRAP), or desferoxamine (DFO).
98. The radiolabeled binding protein of claim 97 or 96, wherein the radionuclide is bound by the chelating moiety.
99. A single domain antibody produced by the method of any one of claims 1-60.
100. A method of diagnosing, monitoring, imaging, or treating a subject comprising: (a) administering the radiolabeled binding protein of any one of claims 61-98, or the single domain antibody of claim 99, to the subject; and (b) detecting the radiolabel in the subject.
101. The method of claim 100, wherein the subject has, has had, or is suspected of having cancer.
102. The method of claim 100, wherein the subject has, has had, or is suspected of having an inflammatory disease or disorder.
103. The method of any one of claims 100-102, wherein step (b) is performed using positron emission tomography (PET).
104. A method of obtaining a radiologic image of a subject, comprising:
(i) administering the radiolabeled binding protein of any one of claims 61-98, or the single domain antibody of claim 99, to the subject; and
(ii) obtaining the radiologic image of the subject by capturing the radiation emitted.
105. The method of claim 104, wherein a tissue, an organ, or a tumor of the subject is imaged.
106. A method of obtaining a radiologic image of a biological sample, comprising:
(i) contacting the biological sample with the radiolabeled binding protein of any one of claims 61-98, or the single domain antibody of claim 99, to the subject; and
(ii) obtaining the radiologic image of the biological sample by capturing the radiation emitted.
107. The method of claim 106, wherein the biological sample is ex vivo or in vitro.
108. The method of claim 106 or 107, wherein the biological sample is a tumor.
109. A method of treating a subject having a tumor, the method comprising:
(i) administering the radiolabeled binding protein of any one of claims 61-98, or the single domain antibody of claim 99, to the subject;
(ii) obtaining a radiologic image of the tumor;
(iii) determining an intensity or a pattern of the radiologic image;
(iv) administering an immune checkpoint inhibitor to the subject based on the intensity or the pattern of the radiologic image determined in step (iii).
110. The method of claim 109, wherein the immune checkpoint inhibitor is administered to the subject only if the intensity of the radiologic image is above a threshold.
111. The method of claim 109, wherein the immune checkpoint inhibitor is administered to the subject only if the intensity of the radiologic image is greater than the intensity of a suitable control.
112. The method of claim 109, wherein the immune checkpoint inhibitor is administered to the subject only if greater than 40%, 50%, 60%, 70%, 80%, 90%, or 95% of the tumor is detected by the radiolabeled binding protein of any one of claims 61-98, or the single domain antibody of claim 99.
113. The method of any one of claims 109-112, wherein the tumor is from a melanoma, a non-small cell lung cancer, a kidney cancer, a head and neck cancer, or a Hodgkin's lymphoma.
114. The method of any one of claims 109-113, wherein the immune checkpoint inhibitor is an inhibitor of PD-1, PD-L1, CTLA4, B7-1, or B7-2.
115. The method of any one of claims 109-114, wherein the immune checkpoint inhibitor is an antibody that binds to PD-1, PD-L1, CTLA4, B7-1, or B7-2.
116. The method of any one of claims 109-115, wherein the immune checkpoint inhibitor is ipilimumab, pembrolizumab, atezolizumab, or nivolumab.
117. The method of any one of claims 109-116 further comprising administering a chemotherapeutic agent to the subject.
118. A composition comprising the radiolabeled binding protein of any one of claims 61- 98, or the single domain antibody of claim 99, and an excipient.
119. A pharmaceutical composition comprising the radiolabeled binding protein of any one of claims 61-98, or the single domain antibody of claim 99, and a pharmaceutically acceptable carrier.
120. A method of diagnosing, monitoring, imaging, or treating a subject comprising: (a) administering the composition of claim 118 or 119 to the subject; and (b) detecting the radiolabel in the subject.
121. The method of claim 120, wherein the subject has, has had, or is suspected of having cancer.
122. The method of claim 120, wherein the subject has, has had, or is suspected of having an inflammatory disease or disorder.
123. The method of any one of claims 120 or 122, wherein step (b) is performed using positron emission tomography (PET).
124. A kit for site-specifically conjugating a hydrophilic polymer to a single domain antibody comprising:
(i) a single domain antibody comprising a sortase recognition sequence, and
(ii) a sortase substrate, wherein the sortase substrate is bound to the hydrophilic polymer.
125. The kit of claim 124, wherein the kit further comprises a sortase.
126. A kit for site-specifically conjugating a hydrophilic polymer to a single domain antibody comprising:
(i) a single domain antibody comprising a first click chemistry handle, and
(ii) a hydrophilic polymer, wherein the hydrophilic polymer is conjugated to a second click chemistry handle.
127. A kit for site-specifically conjugating a hydrophilic polymer to a single domain antibody comprising:
(i) a single domain antibody comprising a sortase recognition sequence,
(ii) a sortase substrate comprising a first click chemistry handle, and
(iii) a hydrophilic polymer conjugated to a second click chemistry handle.
128. The kit of claim 127, wherein the kit further comprises a sortase.
129. A kit for producing a site-specifically conjugated bivalent single domain antibody comprising:
(i) a first single domain antibody comprising a first click chemistry handle, and
(ii) a second single domain antibody comprising a second click chemistry handle.
130. A kit for producing a site-specifically conjugated bivalent single domain antibody comprising:
(i) a first single domain antibody comprising a sortase recognition sequence,
(ii) a first sortase substrate, wherein the first sortase substrate comprises a first click chemistry handle,
(iii) a second single domain antibody comprising a sortase recognition sequence, and
(iv) a second sortase substrate, wherein the second sortase substrate comprises a second click chemistry handle.
131. The kit of claim 130 further comprising a sortase.
132. The kit of any one of claims 124-131 further comprising a radionuclide.
133. The kit of claim 132, wherein the radionuclide is carbon-11, carbon-14, nitrogen-13, oxygen-15, fluorine-18, rubidium-82, copper-61, copper-62, copper-64, yttrium-86, gallium- 68, zirconium-89, or iodine- 124.
134. The kit of any one of claims 124-133 further comprising sortase A from
Staphylococcus aureus (SrtAaureus), sortase A from Streptococcus pyogenes
(SrtApyogenes), sortase B from S. aureus (SrtBaureus), sortase B from Bacillus anthracis (SrtB anthracis), or sortase B from Listeria monocytogenes (SrtBmonocytogenes).
Priority Applications (5)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| ES16852806T ES2941968T3 (en) | 2015-10-01 | 2016-10-01 | Antibody labeling |
| US15/764,087 US12048753B2 (en) | 2015-10-01 | 2016-10-01 | Labeling of antibodies |
| EP16852806.5A EP3359573B1 (en) | 2015-10-01 | 2016-10-01 | Labeling of antibodies |
| EP22216826.2A EP4218833A1 (en) | 2015-10-01 | 2016-10-01 | Labeling of antibodies |
| US18/737,555 US20240325575A1 (en) | 2015-10-01 | 2024-06-07 | Labeling of antibodies |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201562236117P | 2015-10-01 | 2015-10-01 | |
| US62/236,117 | 2015-10-01 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US15/764,087 A-371-Of-International US12048753B2 (en) | 2015-10-01 | 2016-10-01 | Labeling of antibodies |
| US18/737,555 Continuation US20240325575A1 (en) | 2015-10-01 | 2024-06-07 | Labeling of antibodies |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2017059397A1 true WO2017059397A1 (en) | 2017-04-06 |
Family
ID=58428000
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2016/055074 Ceased WO2017059397A1 (en) | 2015-10-01 | 2016-10-01 | Labeling of antibodies |
Country Status (4)
| Country | Link |
|---|---|
| US (2) | US12048753B2 (en) |
| EP (2) | EP3359573B1 (en) |
| ES (1) | ES2941968T3 (en) |
| WO (1) | WO2017059397A1 (en) |
Cited By (24)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2019040244A1 (en) * | 2017-08-22 | 2019-02-28 | Albert Einstein College Of Medicine, Inc. | High resolution intravital imaging and uses thereof |
| CN110118847A (en) * | 2019-05-17 | 2019-08-13 | 重庆派金生物科技有限公司 | Determine the analysis method in multidigit point PEG modification protein modification site |
| WO2019166622A1 (en) | 2018-03-01 | 2019-09-06 | Vrije Universiteit Brussel | Human pd-l1-binding immunoglobulins |
| WO2019228509A1 (en) * | 2018-06-01 | 2019-12-05 | Tayu Huaxia Biotech Medical Group Co., Ltd. | Compositions and methods for imaging |
| CN110691510A (en) * | 2017-05-30 | 2020-01-14 | 谷万达公司 | Immunomodulatory transgenic plants and related methods |
| US10730944B2 (en) | 2017-07-24 | 2020-08-04 | Regeneron Pharmaceuticals, Inc. | Anti-CD8 antibodies and uses thereof |
| US10736976B2 (en) | 2016-12-01 | 2020-08-11 | Regeneron Pharmaceuticals, Inc. | Radiolabeled anti-PD-L1 antibodies for immuno-PET imaging |
| US10905784B2 (en) | 2017-02-10 | 2021-02-02 | Regeneron Pharmaceuticals, Inc. | Radiolabeled anti-LAG3 antibodies for immuno-PET imaging |
| WO2021034924A1 (en) * | 2019-08-20 | 2021-02-25 | Biogen Ma Inc. | Trans-cyclooctene labeled antisense oligonucleotides, radio labeled tetrazine and methods |
| CN112638415A (en) * | 2018-07-26 | 2021-04-09 | 大有华夏生物医药集团有限公司 | Compositions and methods for imaging |
| WO2021118885A1 (en) * | 2019-12-10 | 2021-06-17 | Eli Lilly And Company | Pre-targeting imaging agents |
| WO2022132924A1 (en) | 2020-12-16 | 2022-06-23 | Eli Lilly And Company | Pretargeting imaging agents |
| JP2022547483A (en) * | 2019-09-04 | 2022-11-14 | ジェネンテック, インコーポレイテッド | CD8 binding agents and uses thereof |
| US11730836B2 (en) | 2018-01-12 | 2023-08-22 | Prolynx Llc | Synergistic cancer treatment |
| WO2023170164A1 (en) | 2022-03-08 | 2023-09-14 | University Of Copenhagen | Method for providing a labeled single isomeric chemical entity targeting vector based on the use of a symmetrical diene |
| US11987629B2 (en) | 2018-06-01 | 2024-05-21 | Tayu Huaxia Biotech Medical Group Co., Ltd. | Compositions and uses thereof for treating disease or condition |
| WO2024156888A1 (en) | 2023-01-27 | 2024-08-02 | Vib Vzw | Cd163-binding conjugates |
| WO2024156881A1 (en) | 2023-01-27 | 2024-08-02 | Vib Vzw | CD8b-BINDING POLYPEPTIDES |
| WO2024231348A1 (en) | 2023-05-11 | 2024-11-14 | Vib Vzw | Slc4a4/nbce1 inhibitors |
| EP4520751A1 (en) | 2023-09-05 | 2025-03-12 | University of Copenhagen | Method for rapid oxidation of dihydropyridazines to pyridazines |
| US12263234B2 (en) | 2019-01-23 | 2025-04-01 | Tayu Huaxia Biotech Medical Group Co., Ltd. | Anti-PD-L1 diabodies and the use thereof |
| US12453785B2 (en) | 2019-05-10 | 2025-10-28 | Janssen Biotech, Inc. | Macrocyclic chelators and methods of use thereof |
| EP4653425A1 (en) | 2024-05-21 | 2025-11-26 | Tetrakit Technologies ApS | Method for rapidly providing pyridazines from tetrazines and cis-dienophiles |
| US12605473B2 (en) | 2019-09-16 | 2026-04-21 | Regeneron Pharmaceuticals, Inc. | Methods for making radiolabeled anti-MET binding proteins |
Families Citing this family (14)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| KR20150131208A (en) | 2013-03-13 | 2015-11-24 | 이미지냅 인코포레이티드 | Antigen binding constructs to cd8 |
| EP2994491A4 (en) | 2013-05-10 | 2016-12-07 | Whitehead Inst Biomedical Res | IN VITRO PRODUCTION OF RED GLOBULES WITH PROTEINS THAT CAN BE MEDIATED BY SORTASE |
| WO2014183066A2 (en) | 2013-05-10 | 2014-11-13 | Whitehead Institute For Biomedical Research | Protein modification of living cells using sortase |
| US10556024B2 (en) | 2013-11-13 | 2020-02-11 | Whitehead Institute For Biomedical Research | 18F labeling of proteins using sortases |
| US11254744B2 (en) | 2015-08-07 | 2022-02-22 | Imaginab, Inc. | Antigen binding constructs to target molecules |
| EP3923974A4 (en) * | 2019-02-06 | 2023-02-08 | Synthorx, Inc. | IL-2 CONJUGATES AND METHODS OF USE THEREOF |
| EP4041297A4 (en) * | 2019-10-11 | 2024-02-28 | The Trustees of The University of Pennsylvania | COMPOSITIONS AND METHODS FOR TARGETING CD13 AND TIM-3 WITH CAR-T CELLS IN THE TREATMENT OF ACUTE MYELOID LEUKEMIA (AML) |
| CN110755647B (en) * | 2019-11-19 | 2022-03-15 | 江苏省原子医学研究所 | CAR-T cell in vivo proliferation monitoring tracer, preparation method thereof and CAR-T cell in vivo proliferation quantitative method |
| EP4073064A4 (en) * | 2019-12-11 | 2024-01-24 | The General Hospital Corporation | CELL IMAGING PROCESSES |
| JP7605555B2 (en) * | 2020-03-25 | 2024-12-24 | 積水メディカル株式会社 | Immunological analysis method and immunological analysis reagent kit |
| CN113264967B (en) * | 2021-05-17 | 2023-04-18 | 江苏省原子医学研究所 | Programmed death ligand-1 targeted compound and preparation method and application thereof |
| AU2023375377A1 (en) * | 2022-11-07 | 2025-05-29 | Tessera Therapeutics, Inc. | Lipid nanoparticle drug conjugates |
| WO2024158813A2 (en) * | 2023-01-24 | 2024-08-02 | Providence Health & Services - Oregon | Pet tracer for detection of transforming growth factor beta |
| DE102024129442A1 (en) | 2024-10-11 | 2026-04-16 | Universität Potsdam, Körperschaft des öffentlichen Rechts | POLYMER-COUPLED ANTIBODIES AND ANTIBODIE FRAGMENTS |
Citations (23)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5670132A (en) | 1994-09-20 | 1997-09-23 | Immunomedics, Inc. | Modified radioantibody fragments for reduced renal uptake |
| US20040213795A1 (en) | 2002-12-23 | 2004-10-28 | Wyeth | Antibodies against PD-1 and uses therefor |
| WO2005086654A2 (en) | 2004-02-27 | 2005-09-22 | The Trustees Of Princeton University | Self-cleaving affinity tags and methods of use |
| US20060034845A1 (en) | 2002-11-08 | 2006-02-16 | Karen Silence | Single domain antibodies directed against tumor necrosis factor alpha and uses therefor |
| WO2006079372A1 (en) | 2005-01-31 | 2006-08-03 | Ablynx N.V. | Method for generating variable domain sequences of heavy chain antibodies |
| WO2010078376A2 (en) | 2008-12-30 | 2010-07-08 | Ventana Medical Systems, Inc. | Fc-specific polymer-conjugated antibodies and their diagnostic use |
| WO2010087994A2 (en) | 2009-01-30 | 2010-08-05 | Whitehead Institute For Biomedical Research | Methods for ligation and uses thereof |
| US20110195068A1 (en) | 2008-08-25 | 2011-08-11 | Solomon Langermann | Pd-1 antagonists and methods of use thereof |
| US20110195021A1 (en) | 2010-02-10 | 2011-08-11 | Immunogen Inc. | Cd20 antibodies and uses thereof |
| WO2011133704A2 (en) | 2010-04-20 | 2011-10-27 | Whitehead Institute For Biomedical Researh | Modified polypeptides and proteins and uses thereof |
| US20120039906A1 (en) | 2009-02-09 | 2012-02-16 | INSER (Institut National de la Recherche Medicale) | PD-1 Antibodies and PD-L1 Antibodies and Uses Thereof |
| US20120114649A1 (en) | 2008-08-25 | 2012-05-10 | Amplimmune, Inc. Delaware | Compositions of pd-1 antagonists and methods of use |
| WO2013003555A1 (en) | 2011-06-28 | 2013-01-03 | Whitehead Institute For Biomedical Research | Using sortases to install click chemistry handles for protein ligation |
| WO2013024059A2 (en) | 2011-08-17 | 2013-02-21 | Glaxo Group Limited | Modified proteins and peptides |
| US20130095098A1 (en) | 2010-03-11 | 2013-04-18 | Ucb Pharma S.A. | Pd-1 antibody |
| US20130109843A1 (en) | 2007-06-18 | 2013-05-02 | Mds Oss B.V. | Antibodies to human programmed death receptor pd-1 |
| US20130237580A1 (en) | 2012-03-07 | 2013-09-12 | Aurigene Discovery Technologies Limited | Peptidomimetic compounds as immunomodulators |
| US20130266512A1 (en) | 2010-07-23 | 2013-10-10 | University Of Southern California | Tetrazine-trans-cyclooctene Ligation for the Rapid Construction of Radionuclide Labeled Probes |
| US20130291136A1 (en) | 2008-09-26 | 2013-10-31 | Emory University | Human anti-pd-1, pd-l1, and pd-l2 antibodies and uses therefor |
| WO2014183066A2 (en) | 2013-05-10 | 2014-11-13 | Whitehead Institute For Biomedical Research | Protein modification of living cells using sortase |
| WO2014183006A1 (en) * | 2013-05-10 | 2014-11-13 | Clean Diesel Technologies, Inc. | Zpgm diesel oxidation catalysts and methods of making and using same |
| US20150086576A1 (en) | 2012-04-13 | 2015-03-26 | Whitehead Institute For Biomedical Research | Sortase-modified vhh domains and uses thereof |
| WO2015073746A2 (en) | 2013-11-13 | 2015-05-21 | Whitehead Institute For Biomedical Research | 18f labeling of proteins using sortases |
Family Cites Families (78)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4469863A (en) | 1980-11-12 | 1984-09-04 | Ts O Paul O P | Nonionic nucleic acid alkyl and aryl phosphonates and processes for manufacture and use thereof |
| US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
| US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5198346A (en) | 1989-01-06 | 1993-03-30 | Protein Engineering Corp. | Generation and selection of novel DNA-binding proteins and polypeptides |
| US5096815A (en) | 1989-01-06 | 1992-03-17 | Protein Engineering Corporation | Generation and selection of novel dna-binding proteins and polypeptides |
| US5143854A (en) | 1989-06-07 | 1992-09-01 | Affymax Technologies N.V. | Large scale photolithographic solid phase synthesis of polypeptides and receptor binding screening thereof |
| US6316003B1 (en) | 1989-12-21 | 2001-11-13 | Whitehead Institute For Biomedical Research | Tat-derived transport polypeptides |
| US5321131A (en) | 1990-03-08 | 1994-06-14 | Hybridon, Inc. | Site-specific functionalization of oligodeoxynucleotides for non-radioactive labelling |
| US5608039A (en) | 1990-10-12 | 1997-03-04 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Single chain B3 antibody fusion proteins and their uses |
| US6099842A (en) | 1990-12-03 | 2000-08-08 | The United States Of America As Represented By The Department Of Health And Human Services | Recombinant immunotoxin composed of a single chain antibody reacting with the human transferrin receptor and diptheria toxin |
| DK51092D0 (en) | 1991-05-24 | 1992-04-15 | Ole Buchardt | OLIGONUCLEOTIDE ANALOGUE DESCRIBED BY PEN, MONOMERIC SYNTHONES AND PROCEDURES FOR PREPARING THEREOF, AND APPLICATIONS THEREOF |
| US5719262A (en) | 1993-11-22 | 1998-02-17 | Buchardt, Deceased; Ole | Peptide nucleic acids having amino acid side chains |
| US5700922A (en) | 1991-12-24 | 1997-12-23 | Isis Pharmaceuticals, Inc. | PNA-DNA-PNA chimeric macromolecules |
| US5296703A (en) | 1992-04-01 | 1994-03-22 | The Regents Of The University Of California | Scanning confocal microscope using fluorescence detection |
| ATE162198T1 (en) | 1992-07-27 | 1998-01-15 | Hybridon Inc | OLIGONUCLEOTIDE ALKYLPHOSPHONOTHIATE |
| US5283433A (en) | 1992-10-05 | 1994-02-01 | The Regents Of The University Of California | Scanning confocal microscope providing a continuous display |
| AU684748B2 (en) | 1993-01-21 | 1998-01-08 | Hybridon, Inc. | Foldback triplex-forming oligonucleotides |
| US5637684A (en) | 1994-02-23 | 1997-06-10 | Isis Pharmaceuticals, Inc. | Phosphoramidate and phosphorothioamidate oligomeric compounds |
| US5707622A (en) | 1994-03-03 | 1998-01-13 | Genentech, Inc. | Methods for treating ulcerative colitis |
| DE69535243T2 (en) | 1994-07-13 | 2007-05-10 | Chugai Seiyaku K.K. | AGAINST HUMAN INTERLEUKIN-8 DIRECTED, RECONSTITUTED HUMAN ANTIBODY |
| US5728369A (en) | 1994-10-05 | 1998-03-17 | Immunomedics, Inc. | Radioactive phosphorus labeling of proteins for targeted radiotherapy |
| US5955599A (en) | 1995-06-01 | 1999-09-21 | Hybridon, Inc. | Process for making oligonucleotides containing o- and s- methylphosphotriester internucleoside linkages |
| US6140482A (en) | 1995-06-01 | 2000-10-31 | Hybridon, Inc. | Primary phosphoramidate internucleoside linkages and oligonucleotides containing the same |
| US5614622A (en) | 1995-06-01 | 1997-03-25 | Hybridon, Inc. | 5-pentenoyl moiety as a nucleoside-amino protecting group, 4-pentenoyl-protected nucleotide synthons, and related oligonucleotide syntheses |
| US5962674A (en) | 1995-06-01 | 1999-10-05 | Hybridon, Inc. | Synthesis of oligonucleotides containing alkylphosphonate internucleoside linkages |
| US5637683A (en) | 1995-07-13 | 1997-06-10 | Cornell Research Foundation, Inc. | Nucleic acid analog with amide linkage and method of making that analog |
| US5652356A (en) | 1995-08-17 | 1997-07-29 | Hybridon, Inc. | Inverted chimeric and hybrid oligonucleotides |
| US6022688A (en) | 1996-05-13 | 2000-02-08 | Sequenom, Inc. | Method for dissociating biotin complexes |
| US5766905A (en) | 1996-06-14 | 1998-06-16 | Associated Universities Inc. | Cytoplasmic bacteriophage display system |
| CN1173776C (en) | 1996-06-28 | 2004-11-03 | 卡钳技术有限公司 | High Throughput Screening Analysis System in Microscale Fluidic Devices |
| WO1998008858A1 (en) | 1996-08-26 | 1998-03-05 | Hybridon, Inc. | Improved reagents and process for synthesis of oligonucleotides containing phosphorodithioate internucleoside linkages |
| US5886165A (en) | 1996-09-24 | 1999-03-23 | Hybridon, Inc. | Mixed backbone antisense oligonucleotides containing 2'-5'-ribonucleotide- and 3'-5'-deoxyribonucleotides segments |
| US6133436A (en) | 1996-11-06 | 2000-10-17 | Sequenom, Inc. | Beads bound to a solid support and to nucleic acids |
| US5900481A (en) | 1996-11-06 | 1999-05-04 | Sequenom, Inc. | Bead linkers for immobilizing nucleic acids to solid supports |
| US6447727B1 (en) | 1996-11-19 | 2002-09-10 | Caliper Technologies Corp. | Microfluidic systems |
| US6090919A (en) | 1997-01-31 | 2000-07-18 | The Board Of Trustees Of The Leland Stanford Junior University | FACS-optimized mutants of the green fluorescent protein (GFP) |
| WO1998033809A1 (en) | 1997-01-31 | 1998-08-06 | The General Hospital Corporation | Compositions and methods for imaging gene expression |
| US6235471B1 (en) | 1997-04-04 | 2001-05-22 | Caliper Technologies Corp. | Closed-loop biochemical analyzers |
| US5739314A (en) | 1997-04-25 | 1998-04-14 | Hybridon, Inc. | Method for synthesizing 2'-O-substituted pyrimidine nucleosides |
| US6100541A (en) | 1998-02-24 | 2000-08-08 | Caliper Technologies Corporation | Microfluidic devices and systems incorporating integrated optical elements |
| US6455263B2 (en) | 1998-03-24 | 2002-09-24 | Rigel Pharmaceuticals, Inc. | Small molecule library screening using FACS |
| US6461813B2 (en) | 1998-09-21 | 2002-10-08 | Rigel Pharmaceuticals, Inc. | Multiparameter FACS assays to detect alterations in cell cycle regulation |
| EP1233780A4 (en) | 1999-04-15 | 2004-09-22 | Univ California | IDENTIFICATION OF THE SORTASEGEN |
| US7101692B2 (en) | 1999-04-15 | 2006-09-05 | The Regents Of The University Of California | Identification of sortase gene |
| US6342219B1 (en) | 1999-04-28 | 2002-01-29 | Board Of Regents, The University Of Texas System | Antibody compositions for selectively inhibiting VEGF |
| US6593292B1 (en) | 1999-08-24 | 2003-07-15 | Cellgate, Inc. | Compositions and methods for enhancing drug delivery across and into epithelial tissues |
| US20030104622A1 (en) | 1999-09-01 | 2003-06-05 | Robbins Paul D. | Identification of peptides that facilitate uptake and cytoplasmic and/or nuclear transport of proteins, DNA and viruses |
| US6451602B1 (en) | 2000-03-02 | 2002-09-17 | Isis Pharmaceuticals, Inc. | Antisense modulation of PARP expression |
| CA2413538A1 (en) * | 2000-07-06 | 2002-01-17 | Bristol-Myers Squibb Pharma Company | Stable radiopharmaceutical compositions and methods for preparation thereof |
| US7279304B2 (en) | 2000-12-18 | 2007-10-09 | President And Fellows Of Harvard College | Methods for preparation of macrocyclic molecules and macrocyclic molecules prepared thereby |
| US6451538B1 (en) | 2000-12-22 | 2002-09-17 | Isis Pharmaceuticals, Inc. | Antisense modulation of CHK2 expression |
| US6455307B1 (en) | 2001-02-08 | 2002-09-24 | Isis Pharmaceuticals, Inc. | Antisense modulation of casein kinase 2-alpha prime expression |
| US6455308B1 (en) | 2001-08-01 | 2002-09-24 | Isis Pharmaceuticals, Inc. | Antisense modulation of serum amyloid A4 expression |
| AU2002357932A1 (en) | 2001-12-18 | 2003-06-30 | Whitehead Institute For Biomedical Research | Fusion partner cells and uses thereof |
| US6960473B2 (en) | 2003-02-27 | 2005-11-01 | Istituto Superiore Di Sanita | In vitro mass production of human erythroid cells from the blood of normal donors and thalassemic patients |
| DE10335584B4 (en) | 2003-07-31 | 2006-06-29 | Philipps-Universität Marburg | Process for the preparation of cyclic molecules |
| WO2005051976A2 (en) | 2003-11-20 | 2005-06-09 | Ansata Therapeutics, Inc. | Protein and peptide ligation processes and one-step purification processes |
| EP1753859B1 (en) | 2004-06-04 | 2014-07-30 | Université Pierre et Marie Curie (Paris 6) | A method for producing red blood cells |
| US7625564B2 (en) | 2006-01-27 | 2009-12-01 | Novagen Holding Corporation | Recombinant human EPO-Fc fusion proteins with prolonged half-life and enhanced erythropoietic activity in vivo |
| WO2007108013A2 (en) | 2006-03-22 | 2007-09-27 | National Institute Of Immunology | Novel bioconjugates as therapeutic agent and synthesis thereof |
| US8398956B2 (en) * | 2007-01-11 | 2013-03-19 | Immunomedics, Inc. | In vivo copper-free click chemistry for delivery of therapeutic and/or diagnostic agents |
| WO2008148143A1 (en) | 2007-06-06 | 2008-12-11 | University Of Wollongong | Diagnostics in a monoplex/multiplex format |
| US8865875B2 (en) * | 2007-08-22 | 2014-10-21 | Medarex, L.L.C. | Site-specific attachment of drugs or other agents to engineered antibodies with C-terminal extensions |
| US8211656B2 (en) | 2008-08-13 | 2012-07-03 | The Invention Science Fund I, Llc | Biological targeting compositions and methods of using the same |
| US20110070154A1 (en) | 2008-08-13 | 2011-03-24 | Hyde Roderick A | Artificial cells |
| WO2010033913A1 (en) * | 2008-09-22 | 2010-03-25 | Icb International, Inc. | Antibodies, analogs and uses thereof |
| JP2010115136A (en) | 2008-11-12 | 2010-05-27 | Teruyuki Nagamune | Method for creating membrane protein with labelled n-terminal end, and cell having membrane protein with labelled n-terminal end in its outer layer |
| PL2539441T3 (en) | 2010-02-22 | 2017-06-30 | Université Pierre Et Marie Curie (Paris 6) | Cell culture medium for the growth and differentiation of cells of the hematopoietic lineage |
| WO2012142659A1 (en) | 2011-04-19 | 2012-10-26 | Baker Idi Heart And Diabetes Institute Holdings Limited | Site-selective modification of proteins |
| CN102559600A (en) | 2011-12-29 | 2012-07-11 | 上海交通大学医学院 | Artificial antigen presenting cell and application thereof in NK (natural killer) cell amplification |
| US20140030697A1 (en) | 2012-06-14 | 2014-01-30 | Massachusetts Institute Of Technology | Sortase-mediated modification of viral surface proteins |
| US9267127B2 (en) | 2012-06-21 | 2016-02-23 | President And Fellows Of Harvard College | Evolution of bond-forming enzymes |
| EP2994491A4 (en) | 2013-05-10 | 2016-12-07 | Whitehead Inst Biomedical Res | IN VITRO PRODUCTION OF RED GLOBULES WITH PROTEINS THAT CAN BE MEDIATED BY SORTASE |
| WO2015051188A1 (en) * | 2013-10-02 | 2015-04-09 | Washington University | Heterocyclic molecules for biomedical imaging and therapeutic applications |
| US9878045B2 (en) | 2013-10-15 | 2018-01-30 | Regents Of The University Of Minnesota | Triorthogonal reagents for dual protein conjugation |
| GB201417386D0 (en) | 2014-10-01 | 2014-11-12 | Nofima As | Sugar-depleted fruit or vegetable juice product, method of producing the same and use thereof to maintain health and treat and to prevent medical ailments |
| US10053683B2 (en) | 2014-10-03 | 2018-08-21 | Whitehead Institute For Biomedical Research | Intercellular labeling of ligand-receptor interactions |
| CA3141315A1 (en) | 2019-05-24 | 2020-12-03 | Rubius Therapeutics, Inc. | Methods of generating enucleated erythroid cells |
-
2016
- 2016-10-01 US US15/764,087 patent/US12048753B2/en active Active
- 2016-10-01 ES ES16852806T patent/ES2941968T3/en active Active
- 2016-10-01 EP EP16852806.5A patent/EP3359573B1/en active Active
- 2016-10-01 WO PCT/US2016/055074 patent/WO2017059397A1/en not_active Ceased
- 2016-10-01 EP EP22216826.2A patent/EP4218833A1/en active Pending
-
2024
- 2024-06-07 US US18/737,555 patent/US20240325575A1/en active Pending
Patent Citations (26)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5670132A (en) | 1994-09-20 | 1997-09-23 | Immunomedics, Inc. | Modified radioantibody fragments for reduced renal uptake |
| US20060034845A1 (en) | 2002-11-08 | 2006-02-16 | Karen Silence | Single domain antibodies directed against tumor necrosis factor alpha and uses therefor |
| US20040213795A1 (en) | 2002-12-23 | 2004-10-28 | Wyeth | Antibodies against PD-1 and uses therefor |
| WO2005086654A2 (en) | 2004-02-27 | 2005-09-22 | The Trustees Of Princeton University | Self-cleaving affinity tags and methods of use |
| WO2006079372A1 (en) | 2005-01-31 | 2006-08-03 | Ablynx N.V. | Method for generating variable domain sequences of heavy chain antibodies |
| US20130109843A1 (en) | 2007-06-18 | 2013-05-02 | Mds Oss B.V. | Antibodies to human programmed death receptor pd-1 |
| US20130108651A1 (en) | 2007-06-18 | 2013-05-02 | Msd Oss B.V. | Antibodies to human programmed death receptor pd-1 |
| US20120114649A1 (en) | 2008-08-25 | 2012-05-10 | Amplimmune, Inc. Delaware | Compositions of pd-1 antagonists and methods of use |
| US20110195068A1 (en) | 2008-08-25 | 2011-08-11 | Solomon Langermann | Pd-1 antagonists and methods of use thereof |
| US20130291136A1 (en) | 2008-09-26 | 2013-10-31 | Emory University | Human anti-pd-1, pd-l1, and pd-l2 antibodies and uses therefor |
| WO2010078376A2 (en) | 2008-12-30 | 2010-07-08 | Ventana Medical Systems, Inc. | Fc-specific polymer-conjugated antibodies and their diagnostic use |
| WO2010087994A2 (en) | 2009-01-30 | 2010-08-05 | Whitehead Institute For Biomedical Research | Methods for ligation and uses thereof |
| US20120039906A1 (en) | 2009-02-09 | 2012-02-16 | INSER (Institut National de la Recherche Medicale) | PD-1 Antibodies and PD-L1 Antibodies and Uses Thereof |
| US20110195021A1 (en) | 2010-02-10 | 2011-08-11 | Immunogen Inc. | Cd20 antibodies and uses thereof |
| US20130095098A1 (en) | 2010-03-11 | 2013-04-18 | Ucb Pharma S.A. | Pd-1 antibody |
| WO2011133704A2 (en) | 2010-04-20 | 2011-10-27 | Whitehead Institute For Biomedical Researh | Modified polypeptides and proteins and uses thereof |
| US20130266512A1 (en) | 2010-07-23 | 2013-10-10 | University Of Southern California | Tetrazine-trans-cyclooctene Ligation for the Rapid Construction of Radionuclide Labeled Probes |
| WO2013003555A1 (en) | 2011-06-28 | 2013-01-03 | Whitehead Institute For Biomedical Research | Using sortases to install click chemistry handles for protein ligation |
| US20140249296A1 (en) * | 2011-06-28 | 2014-09-04 | Whitehead Institute For Biomedical Research | Using sortases to install click chemistry handles for protein ligation |
| WO2013024059A2 (en) | 2011-08-17 | 2013-02-21 | Glaxo Group Limited | Modified proteins and peptides |
| US20130237580A1 (en) | 2012-03-07 | 2013-09-12 | Aurigene Discovery Technologies Limited | Peptidomimetic compounds as immunomodulators |
| US20150086576A1 (en) | 2012-04-13 | 2015-03-26 | Whitehead Institute For Biomedical Research | Sortase-modified vhh domains and uses thereof |
| WO2014183066A2 (en) | 2013-05-10 | 2014-11-13 | Whitehead Institute For Biomedical Research | Protein modification of living cells using sortase |
| WO2014183006A1 (en) * | 2013-05-10 | 2014-11-13 | Clean Diesel Technologies, Inc. | Zpgm diesel oxidation catalysts and methods of making and using same |
| US20160122707A1 (en) | 2013-05-10 | 2016-05-05 | Whitehead Institute For Biomedical Research | Protein modification of living cells using sortase |
| WO2015073746A2 (en) | 2013-11-13 | 2015-05-21 | Whitehead Institute For Biomedical Research | 18f labeling of proteins using sortases |
Non-Patent Citations (88)
| Title |
|---|
| "Drug Discovery Series", 2005, CRC PRESS, article "Phage Display in Biotechnology and Drug Discovery" |
| "GenBank", Database accession no. AAD48437 |
| "Methods in Molecular Biology", 2009, HUMANA PRESS, article "Antibody Phage Display: Methods and Protocols" |
| AHLGRE: "Targeting of HER2-expressing tumors with a site-specifically 99mTc-labeled recombinant affibody molecule, ZHER2:2395, with C-terminally engineered cysteine", J. NUCL. MED., vol. 50, no. 5, 2009, pages 781 - 789, XP055282969, DOI: 10.2967/jnumed.108.056929 |
| BARNETT, TCSCOTT, JR: "Differential Recognition of Surface Proteins in Streptococcus pyogenes by Two Sortase Gene Homologs", JOURNAL OF BACTERIOLOGY, vol. 184, no. 8, 2002, pages 2181 - 2191, XP055063077, DOI: 10.1128/JB.184.8.2181-2191.2002 |
| BECERHOOGENBOOMSCHUBERT: "Click Chemistry beyond Metal-Catalyzed Cycloaddition", ANGEWANDTE CHEMIE INTERNATIONAL EDITION, vol. 48, 2009, pages 4900 - 4908, XP055215368, DOI: 10.1002/anie.200900755 |
| BLACKMAN: "The Tetrazine Ligation: Fast Bioconjugation based on Inverse-electron-demand Diels-Alder Reactivity", J. AM. CHEM. SOC., vol. 130, 2008, pages 13518 - 13519, XP002544618, DOI: 10.1021/JA8053805 |
| BORJESSON ET AL.: "Radiation dosimetry of Zr-labeled chimeric monoclonal antibody U36 as used for immuno-PET in head and neck cancer patients", J. NUCL. MED., vol. 50, 2009, pages 1828 - 1836 |
| CARRASQUILLO ET AL.: "1-huA33 antibody PET of colorectal cancer", J. NUCL. MED., vol. 52, 2011, pages 1173 - 1180, XP055295482, DOI: 10.2967/jnumed.110.086165 |
| CARRUTHERS: "Some Modern Methods of Organic Synthesis", 1987, CAMBRIDGE UNIVERSITY PRESS |
| CHANG ET AL.: "Development and characterization of '9Zr-labeled panitumumab for immuno-positron emission tomographic imaging of the epidermal growth factor receptor", MOL. IMAGING., vol. 12, 2013, pages 17 - 27 |
| CHEN I. ET AL.: "A general strategy for the evolution of bond-forming enzymes using yeast display", PROC NATL ACAD SCI USA., vol. 108, no. 28, 12 July 2011 (2011-07-12), pages 11399, XP055299966, DOI: 10.1073/pnas.1101046108 |
| CHEN IDORR BMLIU DR: "A general strategy for the evolution of bond-forming enzymes using yeast display", PROC NATL ACAD SCI USA, vol. 108, no. 28, 2011, pages 11399 - 11404, XP055299966, DOI: 10.1073/pnas.1101046108 |
| CHEN, I. ET AL., PNAS, vol. 108, no. 28, 2011, pages 11399 - 11404 |
| CHUDAKOV, DM ET AL., PHYSIOL REV., vol. 90, no. 3, 2010, pages 1103 - 63 |
| CLARK, W.R.: "The Experimental Foundations of Modern Immunology", 1986, WILEY & SONS, INC. |
| COMFORT DCLUBB RT: "A comparative genome analysis identifies distinct sorting pathways in gram-positive bacteria", INFECT IMMUN., vol. 72, no. 5, 2004, pages 2710 - 22 |
| DE MEYER ET AL., TRENDS BIOTECHNOL, vol. 32, 2014, pages 263 - 270 |
| DIJKERS ET AL.: "Biodistribution of Zr-trastuzumab and PET imaging of HER2-positive lesions in patients with metastatic breast cancer", CLIN. PHARMACOL. THER., vol. 87, 2010, pages 586 - 592, XP008144583, Retrieved from the Internet <URL:www.cancer.gov/clinicaltrials/search/results7protocolsearchid511815785> DOI: 10.1038/clpt.2010.12 |
| DIVGI ET AL.: "Positron emission tomography/computed tomography identification of clear cell renal cell carcinoma: results from the REDECT Trial", J. CLIN. ONCOL., vol. 31, 2013, pages 187 - 194 |
| DORR, B. M. ET AL.: "Reprogramming the specificity of sortase enzymes", PROC. NATL. ACAD. SCI. U.S.A., vol. 111, 2014, pages 13343 - 13348, XP055340492, DOI: 10.1073/pnas.1411179111 |
| DRAMSI STRIEU-CUOT PBIERNE H: "Sorting sortases: a nomenclature proposal for the various sortases of Gram-positive bacteria", RES MICROBIOL., vol. 156, no. 3, 2005, pages 289 - 97, XP025305736, DOI: 10.1016/j.resmic.2004.10.011 |
| E. C. DIJKERST. H. OUDE MUNNINKJ. G. KOSTERINKA. H. BROUWERSP. L. JAGERJ. R. DE JONGG. A. VAN DONGENC. P. SCHRODERM. N. LUB-DE HOO, CLIN. PHARMACOL. THER., vol. 87, 2010, pages 586 - 592 |
| E. DE GENSTK. SILENCEK. DECANNIEREK. CONRATHR. LORISJ. KINNES. MUYLDERMANSL. WYNS, PROC. NATL. ACAD. SCI. U. S. A., vol. 103, 2006, pages 4586 - 4591 |
| E. J. LIPSONW. H. SHARFMANC. G. DRAKEI. WOLLNERJ. M. TAUBER. A. ANDERSH. XUS. YAOA. PONSL. CHEN ET AL., CLIN. CANCER RES. OFF. J. AM. ASSOC. CANCER RES., vol. 19, 2013, pages 462 - 468 |
| ELIEL, E.L.: "Stereochemistry of Carbon Compounds", 1962, MCGRAW-HILL |
| ENGFELDT: "Chemical synthesis of triple-labeled three-helix bundle binding proteins for specific fluorescent detection of unlabeled protein", CHEM. BIOCHEM., vol. 6, no. 6, 2005, pages 1043 - 1050 |
| EVANS HLCARROLL LABOAGYE EOSPIVEY AC: "Bioorthogonal chemistry for 68Ga radiolabelling of DOTA-containing compounds", J LABEL COMPD RADIOPHARM, vol. 57, no. 4, 2014, pages 291 - 297 |
| EVANS, AUSTRALIAN JOURNAL OF CHEMISTRY, vol. 60, 2007, pages 384 - 395 |
| GEBAUERSKERRA: "Engineered protein scaffolds as next-generation antibody therapeutics", CURRENT OPINION IN CHEMICAL BIOLOGY, vol. 13, no. 3, 2009, pages 245 - 55 |
| GOLDENBERG D. M. ET AL.: "Novel radiolabeled antibody conjugates", ONCOGENE, vol. 26, 2007, pages 3734 - 3744, XP055007575, DOI: 10.1038/sj.onc.1210373 |
| H. C. KOLBM. G. FINNK. B. SHARPLESS: "Click Chemistry: Diverse Chemical Function from a Few Good Reactions", ANGEWANDTE CHEMIE INTERNATIONAL EDITION, vol. 40, no. 11, 2001, pages 2004 - 2021 |
| H. SCHELLEKENSW. E. HENNINKV. BRINKS, PHARM. RES., vol. 30, 2013, pages 1729 - 1734 |
| HOLM ET AL.: "Electrophilic Affibodies Forming Covalent Bonds to Protein Targets", THE JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 284, no. 47, 2009, pages 32906 - 13, XP055101288, DOI: 10.1074/jbc.M109.034322 |
| JACQUES ET AL.: "Enantiomers, Racemates and Resolutions", 1981, WILEY INTERSCIENCE |
| KNOWLES ET AL.: "Advances in immuno-positron emission tomography: antibodies for molecular imaging in oncology", J CLIN ONCOL., vol. 30, 2012, pages 3884 - 3892, XP055255271, DOI: 10.1200/JCO.2012.42.4887 |
| KOLBFINNSHARPLESS, ANGEWANDTE CHEMIE INTERNATIONAL EDITION, vol. 40, 2001, pages 2004 - 2021 |
| LAROCK: "Comprehensive Organic Transformations", 1989, VCH PUBLISHERS, INC. |
| LIU X.: "A Brief Review of Chelators for Radiolabeling Oligomers", MATERIALS, vol. 3, 2010, pages 3204 - 3217 |
| LUNDBERG ET AL.: "Site-specifically conjugated anti-HER2 Affibody molecules as one-step reagents for target expression analyses on cells and xenograft samples", J. IMMUNOL. METHODS, vol. 319, no. 1-2, 2007, pages 53 - 63, XP005835608, DOI: 10.1016/j.jim.2006.10.013 |
| M. RASHIDIANE. J. KELIHERA. M. BILATEJ. DOARTEG. WOJTKIEWICZJ. JACOBSENG. VICTORAR. WEISSLEDERH. L. PLOEGH, PROC. NATL. ACAD. SCI. U.S.A., 2015 |
| M. RASHIDIANE. J. KELIHERA. M. BILATEJ. N. DUARTEG. R. WOJTKIEWICZJ. T. JACOBSENJ. CRAGNOLINIL. K. SWEEG. D. VICTORAR. WEISSLEDER , PROC. NATL. ACAD. SCI. U. S. A., 2015 |
| M. RASHIDIANE. J. KELIHERM. DOUGANP. K. JURASM. CAVALLARIG. R. WOJTKIEWICZJ. T. JACOBSENJ. G. EDENSJ. M. J. TASG. VICTORA ET AL., ACS CENT. SCI., 2015, pages 150603073029009 |
| MARISCOTTI JFGARCIA-DEL PORTILLO FPUCCIARELLI MG: "The listeria monocytogenes sortase-B recognizes varied amino acids at position two of the sorting motif", J BIOL CHEM., 7 January 2009 (2009-01-07) |
| MARRAFFINI, L.SCHNEEWIND, O., JOURNAL OF BACTERIOLOGY, vol. 189, no. 17, 2007, pages 6425 - 6436 |
| MOK NYCHADWICK JKELLETT KABCASAS-ARCE EHOOPER NMJOHNSON APFISHWICK CWG: "Discovery of biphenylacetamide-derived inhibitors of BACE1 using de novo structure-based molecular design", J MED CHEM, vol. 56, no. 5, 2013, pages 1843 - 1852 |
| NAYAK ET AL.: "PET and MR imaging of metastatic peritoneal and pulmonary colorectal cancer in mice with human epidermal growth factor receptor 1-targeted Zr-Labeled panitumumab", J. NUCL. MED., vol. 53, 2012, pages 113 - 120 |
| NORD ET AL.: "A combinatorial library of an a-helical bacterial receptor domain", PROT. ENG., vol. 8, no. 6, 1995, pages 601 - 608 |
| NORD: "Binding proteins selected from combinatorial libraries of an a-helical bacterial receptor domain", NATURE BIOTECHNOL., vol. 15, no. 8, 1997, pages 772 - 777, XP002149252 |
| NORD: "Recombinant human factor VIII-specific affinity ligands selected from phage-displayed combinatorial libraries of protein A", EUR. J. BIOCHEM., vol. 268, no. 15, 2001, pages 1 - 10, XP055619756, DOI: 10.1046/j.1432-1327.2001.02344.x |
| ORLOVA ET AL.: "Tumor imaging using a picomolar affinity HER2 binding affibody molecule", CANCER RES., vol. 66, no. 8, 2006, pages 4339 - 48, XP002488605, DOI: 10.1158/0008-5472.CAN-05-3521 |
| ORLOVA: "Evaluation of [(111/114m)In]CHX-A''-DTPA-ZHER2:342, an affibody ligand conjugate for targeting of HER2-expressing malignant tumors", Q. J. NUCL. MED. MOL. IMAGING., vol. 51, no. 4, 2007, pages 314 - 23 |
| P. HOLLIGERT. PROSPEROG. WINTER, PROC. NATL. ACAD. SCI. U. S. A., vol. 90, 1993, pages 6444 - 6448 |
| PALLEN, M. J.LAM, A. C.ANTONIO, M.DUNBAR, K., TRENDS IN MICROBIOLOGY, vol. 9, no. 3, 2001, pages 97 - 101 |
| PARDOLL, DM: "The blockade of immune checkpoints in cancer immunotherapy", NAT REV CANCER, vol. 12, no. 4, 2012, pages 252 - 64, XP055415943, DOI: 10.1038/nrc3239 |
| R. BOELLAARDM. J. O'DOHERTYW. A. WEBERF. M. MOTTAGHYM. N. LONSDALES. G. STROOBANTSW. J. G. OYENJ. KOTZERKEO. S. HOEKSTRAJ. PRUIM E, EUR. J. NUCL. MED. MOL. IMAGING, vol. 37, 2010, pages 181 - 200 |
| R. TAVAREM. N. MCCRACKENK. A. ZETTLITZS. M. KNOWLESF. B. SALAZART. OLAFSENO. N. WITTEA. M. WU, PROC. NATL. ACAD. SCI., vol. 777, 2014, pages 1108 - 1113 |
| RACE, PR ET AL., JBIOL CHEM., vol. 284, no. 11, 2009, pages 6924 - 33 |
| RASHIDIAN, M. ET AL.: "Enzymatic Labeling of Proteins: Techniques and Approaches", BIOCONJUGATE CHEM., vol. 24, 2013, pages 1277 - 1294, XP055147355, DOI: 10.1021/bc400102w |
| RENBERG ET AL.: "Affibody molecules in protein capture microarrays: evaluation of multidomain ligands and different detection formats", J. PROTEOME RES., vol. 6, no. 1, 2007, pages 171 - 179 |
| ROITT, I.: "Essential Immunology", 1991, BLACKWELL SCIENTIFIC PUBLICATIONS |
| RONNMARK ET AL.: "Affibody-beta-galactosidase immunoconjugates produced as soluble fusion proteins in the Escherichia coli cytosol", J. IMMUNOL. METHODS., vol. 281, no. 1-2, 2003, pages 149 - 160, XP004468187, DOI: 10.1016/j.jim.2003.06.001 |
| RONNMARK ET AL.: "Construction and characterization of affibody-Fc chimeras produced in Escherichia coli", J. IMMUNOL. METHODS., vol. 261, no. 1-2, 2002, pages 199 - 211, XP004341280, DOI: 10.1016/S0022-1759(01)00563-4 |
| S. CROTTY: "Follicular helper CD4 T cells (TFH", ANNU. REV. IMMUNOL., vol. 29, 2011, pages 621 - 663 |
| SALSANOTREGLIA: "PET imaging using radiolabeled antibodies: future direction in tumor diagnosis and correlate applications", RESEARCH AND REPORTS IN NUCLEAR MEDICINE, vol. 3, 2013, pages 9 - 17 |
| See also references of EP3359573A4 |
| SIONTOROU C.: "Nanobodies as novel agents for disease diagnosis and therapy", INT. J. NANOMEDICINE, vol. 8, 2013, pages 4215 - 4227 |
| SPICER ET AL.: "Selective chemical protein modification", NATURE COMMUNICATIONS, vol. 5, 2014, pages 4740 |
| STAHL: "The use of gene fusions to protein A and protein G in immunology and biotechnology", PATHOL. BIOL. (PARIS, vol. 45, no. 1, 1997, pages 66 - 76, XP002339367 |
| T. DE MEYERS. MUYLDERMANSA. DEPICKER, TRENDS BIOTECHNOL., vol. 32, 2014, pages 263 - 270 |
| T. OLAFSENS. J. SIRKS. OLMAC. K.-F. SHENA. M. WU, TUMOR BIOI., vol. 33, 2012, pages 669 - 677 |
| T. R. SIMPSONF. LIW. MONTALVO-ORTIZM. A. SEPULVEDAK. BERGERHOFFF. ARCEC. RODDIEJ. Y. HENRYH. YAGITAJ. D. WOLCHOK ET AL., J. EXP. MED., vol. 210, 2013, pages 1695 - 1710 |
| T. W. GREENEP. G. M. WUTS: "Protecting Groups in Organic Synthesis", 1999, UNIVERSITY SCIENCE BOOKS |
| THEILE CS ET AL.: "Site-specific N-terminal labeling of proteins using sortase-mediated reactions", NAT PROTOC, vol. 8, no. 9, 2013, pages 1800 - 1807 |
| TOLMACHEV ET AL.: "Radionuclide therapy of HER2-positive microxenografts using a 177Lu-labeled HER2-specific Affibody molecule", CANCER RES., vol. 67, no. 6, 2007, pages 2773 - 82, XP002488609, DOI: 10.1158/0008-5472.CAN-06-1630 |
| TORNOE ET AL., JOURNAL OF ORGANIC CHEMISTRY, vol. 67, 2002, pages 3057 - 3064 |
| TRAN ET AL.: "99m)Tc-maEEE-Z(HER2:342), an Affibody molecule-based tracer for the detection of HER2 expression in malignant tumors", BIOCONJUG. CHEM., vol. 18, no. 6, 2007, pages 1956 - 64, XP002488608, DOI: 10.1021/bc7002617 |
| V. CORTEZ-RETAMOZOM. LAUWEREYSG. HASSANZADEH GHM. GOBERTK. CONRATHS. MUYLDERMANSP. DE BAETSELIERH. REVETS, INT. J. CANCER J. INT. CANCER, vol. 98, 2002, pages 456 - 462 |
| VEERAN, G. K.: "Water Soluble Polymers for Pharmaceutical Applications", POLYMERS, vol. 3, 2011, pages 1972 - 2009, XP055386969, DOI: 10.3390/polym3041972 |
| VINCKE ET AL., J. BIOL. CHEM., vol. 284, 2009, pages 3273 - 3284 |
| WILEN ET AL.: "Tetrahedron", vol. 33, 1977, pages: 2725 |
| WILEN, S.H.: "Tables of Resolving Agents and Optical Resolutions", 1972, UNIV. OF NOTRE DAME PRESS, pages: 268 |
| WITTE MD ET AL.: "Preparation of unnatural N-to-N and C-to-C protein fusions", PROC NATL ACAD SCI, vol. 109, no. 30, 2012, pages 11993 - 11998, XP002686964, DOI: 10.1073/PNAS.1205427109 |
| WRIGHTLAPI: "Designing the magic bullet? The advancement of immuno-PET into clinical use", J. NUCL. MED., vol. 54, no. 8, August 2013 (2013-08-01), pages 1171 - 4 |
| Y. VUGMEYSTERC. A. ENTRICANA. P. JOYCER. F. LAWRENCE-HENDERSONB. A. LEARYC. S. MAHONEYH. K. PATELS. W. RASOS. H. OLLANDM. HEGEN ET, BIOCONJUG. CHEM., vol. 23, 2012, pages 1452 - 1462 |
| YANG JKARVER MRLI WSAHU SDEVARAJ NK: "Metal-catalyzed one-pot synthesis of tetrazines directly from aliphatic nitriles and hydrazine", ANGEW CHEM INT ED, vol. 51, no. 21, 2012, pages 5222 - 5225 |
| ZHU, J. ET AL.: "Differentiation of effector CD4 T cell populations", ANNU. REV. IMMUNOL., vol. 28, 2010, pages 445 - 489 |
| ZONG Y ET AL., J. BIOL CHEM., vol. 279, 2004, pages 31383 - 31389 |
Cited By (50)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10736976B2 (en) | 2016-12-01 | 2020-08-11 | Regeneron Pharmaceuticals, Inc. | Radiolabeled anti-PD-L1 antibodies for immuno-PET imaging |
| US12053534B2 (en) | 2016-12-01 | 2024-08-06 | Regeneron Pharmaceuticals, Inc. | Radiolabeled anti-PD-L1 antibodies for immuno-PET imaging |
| US12564651B2 (en) | 2016-12-01 | 2026-03-03 | Regeneron Pharmaceuticals, Inc. | Radiolabeled anti-PD-L1 antibodies for immuno-PET imaging |
| US11511001B2 (en) | 2017-02-10 | 2022-11-29 | Regeneron Pharmaceuticals, Inc. | Radiolabeled anti-LAG3 antibodies for immuno-PET imaging |
| US10905784B2 (en) | 2017-02-10 | 2021-02-02 | Regeneron Pharmaceuticals, Inc. | Radiolabeled anti-LAG3 antibodies for immuno-PET imaging |
| CN110691510B (en) * | 2017-05-30 | 2023-09-05 | 谷万达公司 | Immunomodulatory transgenic plants and related methods |
| CN110691510A (en) * | 2017-05-30 | 2020-01-14 | 谷万达公司 | Immunomodulatory transgenic plants and related methods |
| US11932864B2 (en) | 2017-05-30 | 2024-03-19 | Agrivida Inc. | Immunomodulating transgenic plants and related methods |
| US11390879B2 (en) | 2017-05-30 | 2022-07-19 | Agrivida, Inc. | Immunomodulating transgenic plants and related methods |
| US12565660B2 (en) | 2017-05-30 | 2026-03-03 | Agrivida, Inc. | Immunomodulating transgenic plants and related methods |
| EP3629709A4 (en) * | 2017-05-30 | 2021-06-30 | Agrivida, Inc. | IMMUNOMODULATOR TRANSGENIC PLANTS AND RELATED PROCESSES |
| US10730944B2 (en) | 2017-07-24 | 2020-08-04 | Regeneron Pharmaceuticals, Inc. | Anti-CD8 antibodies and uses thereof |
| US11525001B2 (en) | 2017-07-24 | 2022-12-13 | Regeneron Pharmaceuticals, Inc. | Anti-CD8 antibodies and uses thereof |
| US12077587B2 (en) | 2017-07-24 | 2024-09-03 | Regeneron Pharmaceuticals, Inc. | Anti-CD8 antibodies and uses thereof |
| US11712205B2 (en) | 2017-08-22 | 2023-08-01 | Albert Einstein College Of Medicine | High resolution intravital imaging and uses thereof |
| WO2019040244A1 (en) * | 2017-08-22 | 2019-02-28 | Albert Einstein College Of Medicine, Inc. | High resolution intravital imaging and uses thereof |
| US12089959B2 (en) | 2017-08-22 | 2024-09-17 | Albert Einstein College Of Medicine | High resolution intravital imaging and uses thereof |
| US11730836B2 (en) | 2018-01-12 | 2023-08-22 | Prolynx Llc | Synergistic cancer treatment |
| WO2019166622A1 (en) | 2018-03-01 | 2019-09-06 | Vrije Universiteit Brussel | Human pd-l1-binding immunoglobulins |
| US11858960B2 (en) | 2018-03-01 | 2024-01-02 | Vrije Universiteit Brussel | Human PD-L1-binding immunoglobulins |
| WO2019227490A1 (en) * | 2018-06-01 | 2019-12-05 | Tayu Huaxia Biotech Medical Group Co., Ltd. | Compositions and methods for imaging |
| US12144875B2 (en) | 2018-06-01 | 2024-11-19 | Tayu Huaxia Biotech Medical Group Co., Ltd. | Compositions and methods for imaging |
| WO2019228509A1 (en) * | 2018-06-01 | 2019-12-05 | Tayu Huaxia Biotech Medical Group Co., Ltd. | Compositions and methods for imaging |
| US11987629B2 (en) | 2018-06-01 | 2024-05-21 | Tayu Huaxia Biotech Medical Group Co., Ltd. | Compositions and uses thereof for treating disease or condition |
| CN112638415A (en) * | 2018-07-26 | 2021-04-09 | 大有华夏生物医药集团有限公司 | Compositions and methods for imaging |
| CN112638415B (en) * | 2018-07-26 | 2024-07-02 | 大有华夏生物医药集团有限公司 | Compositions and methods for imaging |
| US12263234B2 (en) | 2019-01-23 | 2025-04-01 | Tayu Huaxia Biotech Medical Group Co., Ltd. | Anti-PD-L1 diabodies and the use thereof |
| US12453785B2 (en) | 2019-05-10 | 2025-10-28 | Janssen Biotech, Inc. | Macrocyclic chelators and methods of use thereof |
| CN110118847B (en) * | 2019-05-17 | 2021-08-10 | 重庆派金生物科技有限公司 | Analysis method for determining modification sites of multi-site PEG modified protein |
| CN110118847A (en) * | 2019-05-17 | 2019-08-13 | 重庆派金生物科技有限公司 | Determine the analysis method in multidigit point PEG modification protein modification site |
| WO2021034924A1 (en) * | 2019-08-20 | 2021-02-25 | Biogen Ma Inc. | Trans-cyclooctene labeled antisense oligonucleotides, radio labeled tetrazine and methods |
| JP2022545449A (en) * | 2019-08-20 | 2022-10-27 | バイオジェン・エムエイ・インコーポレイテッド | Trans-Cyclooctene-Labeled Antisense Oligonucleotides, Radiolabeled Tetrazines, and Methods |
| JP2022547483A (en) * | 2019-09-04 | 2022-11-14 | ジェネンテック, インコーポレイテッド | CD8 binding agents and uses thereof |
| JP7743396B2 (en) | 2019-09-04 | 2025-09-24 | ジェネンテック, インコーポレイテッド | CD8 binding agents and uses thereof |
| US12605473B2 (en) | 2019-09-16 | 2026-04-21 | Regeneron Pharmaceuticals, Inc. | Methods for making radiolabeled anti-MET binding proteins |
| WO2021118885A1 (en) * | 2019-12-10 | 2021-06-17 | Eli Lilly And Company | Pre-targeting imaging agents |
| CN114828899A (en) * | 2019-12-10 | 2022-07-29 | 伊莱利利公司 | Pre-targeted imaging agents |
| WO2022132924A1 (en) | 2020-12-16 | 2022-06-23 | Eli Lilly And Company | Pretargeting imaging agents |
| CN116783177A (en) * | 2020-12-16 | 2023-09-19 | 伊莱利利公司 | Pretargeting imaging agent |
| US20240034722A1 (en) * | 2020-12-16 | 2024-02-01 | Eli Lilly And Company | Pretargeting imaging agents |
| CN116783177B (en) * | 2020-12-16 | 2025-09-23 | 伊莱利利公司 | Pretargeted imaging agents |
| WO2023170164A1 (en) | 2022-03-08 | 2023-09-14 | University Of Copenhagen | Method for providing a labeled single isomeric chemical entity targeting vector based on the use of a symmetrical diene |
| WO2023170174A1 (en) | 2022-03-08 | 2023-09-14 | University Of Copenhagen | Method for providing a labeled single isomeric chemical entity targeting vector based on the use of an isomer-free dienophile |
| WO2024156881A1 (en) | 2023-01-27 | 2024-08-02 | Vib Vzw | CD8b-BINDING POLYPEPTIDES |
| WO2024156888A1 (en) | 2023-01-27 | 2024-08-02 | Vib Vzw | Cd163-binding conjugates |
| WO2024231348A1 (en) | 2023-05-11 | 2024-11-14 | Vib Vzw | Slc4a4/nbce1 inhibitors |
| WO2025051721A1 (en) | 2023-09-05 | 2025-03-13 | University Of Copenhagen | Method for rapid oxidation of dihydropyridazines to pyridazines |
| EP4520751A1 (en) | 2023-09-05 | 2025-03-12 | University of Copenhagen | Method for rapid oxidation of dihydropyridazines to pyridazines |
| EP4653425A1 (en) | 2024-05-21 | 2025-11-26 | Tetrakit Technologies ApS | Method for rapidly providing pyridazines from tetrazines and cis-dienophiles |
| WO2025242715A1 (en) | 2024-05-21 | 2025-11-27 | Tetrakit Technologies Aps | Method for rapidly providing pyridazines from tetrazines and cis-dienophiles |
Also Published As
| Publication number | Publication date |
|---|---|
| ES2941968T3 (en) | 2023-05-29 |
| EP3359573A4 (en) | 2019-05-29 |
| EP3359573A1 (en) | 2018-08-15 |
| US20180280551A1 (en) | 2018-10-04 |
| US20240325575A1 (en) | 2024-10-03 |
| EP3359573B1 (en) | 2023-01-04 |
| EP4218833A1 (en) | 2023-08-02 |
| US12048753B2 (en) | 2024-07-30 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20240325575A1 (en) | Labeling of antibodies | |
| US11850216B2 (en) | 18F labeling of proteins using sortases | |
| Löfblom et al. | Affibody molecules: engineered proteins for therapeutic, diagnostic and biotechnological applications | |
| AU2016369524B2 (en) | C-terminal lysine conjugated immunoglobulins | |
| CN102333548B (en) | Methods and compositions for protein labelling | |
| US9974869B2 (en) | Chelated PSMA inhibitors | |
| BR112020012099A2 (en) | polypeptide radiolabeling | |
| Richardson-Sanchez et al. | Exploiting the biosynthetic machinery of Streptomyces pilosus to engineer a water-soluble zirconium (iv) chelator | |
| EP3795591B1 (en) | Cys80 conjugated immunoglobulins | |
| WO2019023651A2 (en) | Small molecule modulators of the androgen receptor | |
| Netirojjanakul et al. | Synthetically modified Fc domains as building blocks for immunotherapy applications | |
| CN114450293A (en) | Anthracycline derivatives | |
| US11998612B2 (en) | Method for conjugating antibody and physiologically active substance | |
| Earley et al. | Charting the chemical and mechanistic scope of light-triggered protein ligation | |
| Dierick et al. | Generic semi-automated radiofluorination strategy for single domain antibodies:[18F] FB-labelled single domain antibodies for PET imaging of fibroblast activation protein-α or folate receptor-α overexpression in cancer | |
| UA125749C2 (en) | Radio-pharmaceutical complexes | |
| TW202600606A (en) | Antibody linker conjugates | |
| Skovsgaard et al. | Affinity-guided conjugation to antibodies for use in positron emission tomography | |
| US20060083678A1 (en) | Radio-labeled compounds, compositions, and methods of making the same | |
| EP4543990A1 (en) | Indocyanine green (icg) modification for treatment of liver cancer | |
| KR101550399B1 (en) | Linker compound for preparing radioimmunoconjugates or radiolabeled peptides and a process for the preparation thereof | |
| WO2025166015A2 (en) | Bifunctional abl1-binding compounds and uses thereof | |
| CZ2008606A3 (en) | Recombinant protein adapted for direct radioiodination, preparation and use thereof | |
| Bridge | Modulating antibody-antigen binding by light | |
| Li | Applying aryltrifluoroborates as PET imaging agents |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 16852806 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 15764087 Country of ref document: US |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2016852806 Country of ref document: EP |

























































































