WO2017052679A1 - Monoclonal antibodies specific for heartland virus and methods of their use - Google Patents

Monoclonal antibodies specific for heartland virus and methods of their use Download PDF

Info

Publication number
WO2017052679A1
WO2017052679A1 PCT/US2016/013073 US2016013073W WO2017052679A1 WO 2017052679 A1 WO2017052679 A1 WO 2017052679A1 US 2016013073 W US2016013073 W US 2016013073W WO 2017052679 A1 WO2017052679 A1 WO 2017052679A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
hrtv
antibody
antigen
domain comprises
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2016/013073
Other languages
French (fr)
Inventor
Amanda E. CALVERT
Aaron C. BRAULT
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
US Department of Health and Human Services
Original Assignee
US Department of Health and Human Services
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by US Department of Health and Human Services filed Critical US Department of Health and Human Services
Priority to US15/761,789 priority Critical patent/US10584161B2/en
Publication of WO2017052679A1 publication Critical patent/WO2017052679A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/08Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from viruses
    • C07K16/10RNA viruses
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/569Immunoassay; Biospecific binding assay; Materials therefor for microorganisms, e.g. protozoa, bacteria, viruses
    • G01N33/56983Viruses
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/12Viral antigens
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/21Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/54F(ab')2
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/55Fab or Fab'
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/624Disulfide-stabilized antibody (dsFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2760/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
    • C12N2760/00011Details
    • C12N2760/12011Bunyaviridae
    • C12N2760/12211Phlebovirus, e.g. Rift Valley fever virus
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/005Assays involving biological materials from specific organisms or of a specific nature from viruses
    • G01N2333/08RNA viruses
    • G01N2333/175Bunyaviridae, e.g. California encephalitis virus, Rift valley fever virus, Hantaan virus
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2469/00Immunoassays for the detection of microorganisms
    • G01N2469/20Detection of antibodies in sample from host which are directed against antigens from microorganisms

Definitions

  • This disclosure concerns monoclonal antibodies that specifically recognize Heartland (HRTV), and diagnostic assays for detecting HRTV using the disclosed antibodies.
  • HRTV Heartland
  • Phlebovirus is one of five genera of the Bunyaviridae family. Phleboviruses are enveloped spherical viruses with icosahedral symmetry.
  • the genome of phleboviruses consists of three single-stranded RNA genome segments - small (S), medium (M) and large (L).
  • S small
  • M medium
  • L large
  • the M and L segments use a negative sense coding strategy, while the S segment encodes two proteins using an ambisense strategy.
  • the S segment encodes the non- structural protein NSs in the positive sense orientation and the nucleocapsid (N) protein in the negative sense orientation; each protein is translated from a subgenomic virus mRNA.
  • the M segment encodes the glycoprotein precursor that is cleaved by host proteases into two structural domains - Gn and Gc.
  • the L segment encodes the L protein, which functions as the RNA-dependent RNA polymerase in primary and secondary transcription to generate mRNA and replicative intermediates, respectively.
  • Heartland virus is a newly identified member of the Phlebovirus genus. It was first isolated from leukocytes of two Missouri farmers in separate incidences hospitalized in 2009 (McMullan et al , N Engl J Med 367: 834-841, 2012; PCT Publication No. WO 2013/142808). Each subject experienced similar, though not identical symptoms of fever, headache, anorexia, gastrointestinal distress and fatigue, and both reported recent tick bites. Initial investigations for erhlichiosis and rickettsial diseases returned negative results, and EDTA-treated blood taken two days after hospital admission was taken for further investigation (McMullan et al. , N Engl J Med 367: 834-841, 2012).
  • HRTV is closely related to severe fever with thrombocytopenia virus (SFTSV), a phlebo virus causing severe disease in China and neighboring countries (Yu et al. , N Engl J Med 364: 1523-1532, 2011.). SFTSV is also thought to be transmitted by ticks. The average case fatality rate of SFTSV infection is between 6-17% with the most severe manifestations occurring in elderly individuals (Xu et al, PLoS Pathog 7: el002369, 2011). SUMMARY
  • HRTV-specific monoclonal antibodies specific for HRTV are disclosed herein.
  • the HRTV-specific monoclonal antibodies can be used, for example, for the diagnosis and treatment of HRTV infection.
  • variable heavy (VH) and variable light (VL) domains of the monoclonal antibody (or antigen-binding fragment) comprise the complementarity determining region (CDR) sequences of a monoclonal antibody disclosed herein (referred to as 2AF11, 2AG8, 2AG9, 2BA2, 2BB5, 2BB6, 2BB7, 2BB8 and 2BB 10).
  • CDR complementarity determining region
  • fusion proteins comprising a disclosed monoclonal antibody (or antigen-binding fragment) and a heterologous protein; immunoconjugates comprising a disclosed monoclonal antibody (or antigen-binding fragment) and a detectable label; compositions comprising a disclosed monoclonal antibody (or antigen-binding fragment) and a pharmaceutically acceptable carrier; and compositions comprising a disclosed monoclonal antibody (or antigen- binding fragment) conjugated to a microsphere.
  • the method is a microsphere immunoassay (MIA) that uses a disclosed monoclonal antibody (or antigen-binding fragment) conjugated to a microsphere.
  • MIA microsphere immunoassay
  • the method is an indirect ELISA that uses a disclosed monoclonal antibody (or antigen-binding fragment) bound to a solid support, such as a microtiter plate.
  • the method is an antibody capture ELISA in which a labelled monoclonal antibody (or antigen-binding fragment) disclosed herein is used to detect immune complexes containing HRTV-specific antibodies from a biological sample. Also provided herein are methods of detecting HRTV in an isolated cell or tissue by contacting the cell or tissue with a monoclonal antibody or immunoconjugate disclosed herein and detecting binding of the monoclonal antibody or immunoconjugate to the cell or tissue.
  • a method of treating HRTV infection in a subject by administering to the subject a monoclonal antibody or antigen-binding fragment (or immunoconjugate thereof) disclosed herein is also provided by the present disclosure.
  • nucleic acid molecules and vectors encoding a disclosed monoclonal antibody or antigen binding fragment. Isolated host cells transformed with the nucleic acid molecules and vectors are also provided.
  • FIG. 1 is a blot showing reactivity of pooled mouse sera from day 34 post-infection.
  • M low-molecular mass marker (sizes are shown in KDa); Lane 1, mouse 1; Lane 2, mouse 2.
  • FIG. 2 is a graph showing a comparison of IgM and IgG MIA median fluorescent intensity (MFI) versus P/N values.
  • FIGS. 3A-3C provide a table showing Heartland virus diagnostic comparisons.
  • nucleic acid and amino acid sequences listed in the accompanying sequence listing are shown using standard letter abbreviations for nucleotide bases, and three letter code for amino acids, as defined in 37 C.F.R. 1.822. Only one strand of each nucleic acid sequence is shown, but the complementary strand is understood as included by any reference to the displayed strand.
  • sequence Listing is submitted as an ASCII text file, created on January 8, 2016, 28.3 KB, which is incorporated by reference herein. In the accompanying sequence listing:
  • SEQ ID Nos: 1 and 2 are the nucleotide and amino acid sequences of the 2AF11 VH domain.
  • SEQ ID Nos: 3 and 4 are the nucleotide and amino acid sequences of the 2AF11 VL domain.
  • SEQ ID Nos: 5 and 6 are the nucleotide and amino acid sequences of the 2AG8 VH domain.
  • SEQ ID Nos: 7 and 8 are the nucleotide and amino acid sequences of the 2AG8 VL domain.
  • SEQ ID Nos: 9 and 10 are the nucleotide and amino acid sequences of the 2AG9 VH domain.
  • SEQ ID Nos: 11 and 12 are the nucleotide and amino acid sequences of the 2AG9 VL domain.
  • SEQ ID Nos: 13 and 14 are the nucleotide and amino acid sequences of the 2BA2 VH domain.
  • SEQ ID Nos: 15 and 16 are the nucleotide and amino acid sequences of the 2BA2 VL domain.
  • SEQ ID Nos: 17 and 18 are the nucleotide and amino acid sequences of the 2BB5 VH domain.
  • SEQ ID Nos: 19 and 20 are the nucleotide and amino acid sequences of the 2BB5 VL domain.
  • SEQ ID Nos: 21 and 22 are the nucleotide and amino acid sequences of the 2BB6 VH domain.
  • SEQ ID Nos: 23 and 24 are the nucleotide and amino acid sequences of the 2BB6 VL domain.
  • SEQ ID Nos: 25 and 26 are the nucleotide and amino acid sequences of the 2BB7 VH domain.
  • SEQ ID Nos: 27 and 28 are the nucleotide and amino acid sequences of the 2BB7 VL domain.
  • SEQ ID Nos: 29 and 30 are the nucleotide and amino acid sequences of the 2BB8 VH domain.
  • SEQ ID Nos: 31 and 32 are the nucleotide and amino acid sequences of the 2BB8 VL domain.
  • SEQ ID Nos: 33 and 34 are the nucleotide and amino acid sequences of the 2BB10 VL domain.
  • RVFV Rift Valley fever virus
  • Antibody A polypeptide ligand comprising at least a light chain or heavy chain immunoglobulin variable region which specifically recognizes and binds an epitope of an antigen.
  • Antibodies are composed of a heavy and a light chain, each of which has a variable region, termed the variable heavy (VH) region and the variable light (VL) region. Together, the VH region and the VL region are responsible for binding the antigen recognized by the antibody.
  • Antibodies include intact immunoglobulins and the variants and portions of antibodies well known in the art, such as Fab fragments, Fab' fragments, F(ab)'2 fragments, single chain Fv proteins (“scFv”), and disulfide stabilized Fv proteins ("dsFv").
  • a scFv protein is a fusion protein in which a light chain variable region of an immunoglobulin and a heavy chain variable region of an immunoglobulin are bound by a linker, while in dsFvs, the chains have been mutated to introduce a disulfide bond to stabilize the association of the chains.
  • the term also includes genetically engineered forms such as chimeric antibodies (for example, humanized murine antibodies), heteroconjugate antibodies (such as, bispecific antibodies). See also, Pierce Catalog and
  • a naturally occurring immunoglobulin has heavy (H) chains and light (L) chains interconnected by disulfide bonds.
  • H heavy chain
  • L light chain
  • lambda
  • k kappa
  • IgM immunoglobulin heavy chain classes
  • Each heavy and light chain contains a constant region and a variable region (the regions are also known as “domains”).
  • the heavy and the light chain variable regions specifically bind the antigen.
  • Light and heavy chain variable regions contain a "framework" region interrupted by three hypervariable regions, also called “complementarity-determining regions” or "CDRs.”
  • CDRs complementarity-determining regions
  • the amino acid sequence boundaries of a given CDR can be readily determined using any of a number of well-known schemes, including those described by Kabat et al. (Sequences of Proteins of Immunological Interest, U.S. Department of Health and Human Services, 1991 ; the "Kabat” numbering scheme), Chothia et al. (see Chothia and Lesk, J Mol Biol 196:901-917, 1987; Chothia et al , Nature 342:877, 1989; and Al-Lazikani et al, JMB 273,927-948, 1997; the
  • the CDRs are primarily responsible for binding to an epitope of an antigen.
  • the CDRs of each chain are typically referred to as CDR1, CDR2, and CDR3, numbered sequentially starting from the N-terminus, and are often identified by the chain in which the particular CDR is located.
  • a VH CDR3 (or HCDR3) is located in the variable domain of the heavy chain of the antibody in which it is found
  • a VL CDRl or LCDR1 is the CDR1 from the variable domain of the light chain of the antibody in which it is found.
  • An antibody that binds HRTV N protein for example, will have a specific VH region and the VL region sequence, and thus specific CDR sequences.
  • Antibodies with different specificities i.e.
  • VH refers to the variable region of an immunoglobulin heavy chain, including that of an Fv, scFv, dsFv or Fab.
  • VL refers to the variable region of an immunoglobulin light chain, including that of an Fv, scFv, dsFv or Fab.
  • a “monoclonal antibody” is an antibody produced by a single clone of B -lymphocytes or by a cell into which the light and heavy chain genes of a single antibody have been transfected.
  • Monoclonal antibodies are produced by methods known to those of skill in the art, for instance by making hybrid antibody-forming cells from a fusion of myeloma cells with immune spleen cells. Monoclonal antibodies include humanized monoclonal antibodies.
  • a “chimeric antibody” has framework residues from one species, such as human, and CDRs
  • a “humanized” immunoglobulin is an immunoglobulin including a human framework region and one or more complementarity determining regions (CDRs) from a non-human (for example a mouse, rat, or synthetic) immunoglobulin.
  • the non-human immunoglobulin providing the CDRs is termed a "donor,” and the human immunoglobulin providing the framework is termed an "acceptor.”
  • CDRs complementarity determining regions
  • a “humanized antibody” is an antibody comprising a humanized light chain and a humanized heavy chain immunoglobulin.
  • a humanized antibody binds to the same antigen as the donor antibody that provides the CDRs.
  • Humanized immunoglobulins can be constructed by means of genetic engineering (see for example, U.S. Patent No. 5,585,089).
  • a “human” antibody (also called a “fully human” antibody) is an antibody that includes human framework regions and all of the CDRs from a human immunoglobulin.
  • the framework and the CDRs are from the same originating human heavy and/or light chain amino acid sequence.
  • frameworks from one human antibody can be engineered to include CDRs from a different human antibody. All parts of a human immunoglobulin are substantially identical to corresponding parts of natural human immunoglobulin sequences.
  • Antigen A compound, composition, or substance that can stimulate the production of antibodies or a T-cell response in an animal, including compositions that are injected or absorbed into an animal. An antigen reacts with the products of specific humoral or cellular immunity.
  • Antigen-specific antibody is an antibody that was elicited (produced and/or activated) in response to a particular antigen.
  • An “antigen-specific” antibody is capable of binding to the antigen, typically with high affinity.
  • Biological sample A sample obtained from a subject (such as a human or veterinary subject).
  • Biological samples include, for example, fluid, cell and/or tissue samples.
  • the biological sample is a fluid sample.
  • Fluid sample include, but are not limited to, serum, blood, plasma, urine, feces, saliva, cerebral spinal fluid (CSF) and
  • BAL bronchoalveolar lavage
  • Complementarity determining region Amino acid sequences which together define the binding affinity and specificity of the natural Fv region of a native Ig binding site.
  • the light and heavy chains of an Ig each have three CDRs, designated LCDR1, LCDR2, LCDR3 and HCDR1 , HCDR2 and HCDR3 , respectively.
  • Conjugated refers to two molecules that are bonded together, for example by covalent bonds.
  • Contacting Placement in direct physical association; includes both in solid and liquid form. “Contacting” is often used interchangeably with “exposed.” In some cases, “contacting” includes transfecting, such as transfecting a nucleic acid molecule into a cell. In other examples, “contacting” refers to incubating a molecule (such as an antibody) with a biological sample.
  • a reference standard for example a positive control or negative control.
  • a positive control is known to provide a positive test result.
  • a negative control is known to provide a negative test result.
  • the reference standard can be a theoretical or computed result, for example a result obtained in a population.
  • Detectable label A detectable compound or composition that is conjugated directly or indirectly to another molecule, such as an antibody, protein or microparticle, to facilitate detection of that molecule.
  • labels include fluorescent tags, enzymatic linkages, and radioactive isotopes.
  • a "labeled antibody” refers to incorporation of another molecule in the antibody.
  • the label is a detectable marker, such as the incorporation of a radiolabeled amino acid or attachment to a polypeptide of biotinyl moieties that can be detected by marked avidin (for example, streptavidin containing a fluorescent marker or enzymatic activity that can be detected by optical or colorimetric methods).
  • labels for polypeptides include, but are not limited to, the following: radioisotopes or radionucleotides (such as 35 S, n C, 13 N, 15 0, 18 F, 19 F, 99m Tc, 13 3 H, 14 C, 15 N, 90 Y, "Tc, i n In and 125 I), fluorescent labels (such as fluorescein isothiocyanate (FITC), rhodamine, lanthanide phosphors), enzymatic labels (such as horseradish peroxidase, beta-galactosidase, luciferase, alkaline phosphatase), chemiluminescent markers, biotinyl groups, predetermined polypeptide epitopes recognized by a secondary reporter (such as a leucine zipper pair sequences, binding sites for secondary antibodies, metal binding domains, epitope tags), or magnetic agents, such as ga
  • Diagnostic Identifying the presence or nature of a pathologic condition, such as a viral infection. Diagnostic methods differ in their sensitivity and specificity.
  • the "sensitivity” of a diagnostic assay is the percentage of diseased individuals who test positive (percent of true positives).
  • the "specificity" of a diagnostic assay is one minus the false positive rate, where the false positive rate is defined as the proportion of those without the disease who test positive. While a particular diagnostic method may not provide a definitive diagnosis of a condition, it suffices if the method provides a positive indication that aids in diagnosis.
  • Epitope An antigenic determinant. Epitopes are particular chemical groups or contiguous or non-contiguous peptide sequences on a molecule that are antigenic, that is, that elicit a specific immune response. An antibody binds a particular antigenic epitope based on the three dimensional structure of the antibody and the matching (or cognate) epitope.
  • Fluorophore A chemical compound, which when excited by exposure to a particular wavelength of light, emits light (i.e. , fluoresces), for example at a different wavelength.
  • fluorophores that may be used in the compositions and methods disclosed herein are provided in U.S. Patent No. 5,866,366 to Nazarenko et al. : 4-acetamido-4'- isothiocyanatostilbene-2,2'disulfonic acid, acridine and derivatives such as acridine and acridine isothiocyanate, 5-(2'-aminoethyl)aminonaphthalene-l -sulfonic acid (EDANS), 4-amino-N-[3- vinylsulfonyl)phenyl]naphthalimide-3,5 disulfonate (Lucifer Yellow VS), N-(4-anilino-l- naphthyl)maleimide, anthranilamide, Brilliant Yellow, coumarin and derivatives such as coumarin, 7-amino-4-methylcoumarin (AMC, Coumarin 120), 7-amino-4-trifluoromethylcouluar
  • rhodamine and derivatives such as 6-carboxy-X-rhodamine (ROX), 6-carboxyrhodamine (R6G), lissamine rhodamine B sulfonyl chloride, rhodamine (Rhod), rhodamine B, rhodamine 123, rhodamine X isothiocyanate, sulforhodamine B, sulforhodamine 101 and sulfonyl chloride derivative of sulforhodamine 101 (Texas Red); N,N,N',N'-tetramethyl-6-carboxyrhodamine (TAMRA); tetramethyl rhodamine; tetramethyl rhodamine isothiocyanate (TRITC); riboflavin; rosolic acid and terbium chelate derivatives.
  • ROX 6-carboxy-X-rhodamine
  • fluorophores include thiol-reactive europium chelates which emit at approximately 617 nm (Heyduk and Heyduk, Analyt. Biochem. 248:216-27, 1997; /. Biol. Chem. 274:3315-22, 1999).
  • fluorophores include GFP, LissamineTM, diethylaminocoumarin, fluorescein chlorotriazinyl, naphthofluorescein, 4,7-dichlororhodamine and xanthene (as described in U.S. Patent No. 5,800,996 to Lee et al.) and derivatives thereof.
  • fluorophores known to those skilled in the art may also be used.
  • Framework region Amino acid sequences of an antibody that are interposed between CDRs. Framework regions include variable light and variable heavy framework regions. The framework regions serve to hold the CDRs in an appropriate orientation for antigen binding.
  • Fusion protein A protein containing amino acid sequence from at least two different (heterologous) proteins or peptides. Fusion proteins can be generated, for example, by expression of a nucleic acid sequence engineered from nucleic acid sequences encoding at least a portion of two different (heterologous) proteins. To create a fusion protein, the nucleic acid sequences must be in the same reading frame and contain no internal stop codons. Fusion proteins, particularly short fusion proteins, can also be generated by chemical synthesis.
  • Heartland virus A member of the Phlebovirus genus in the family
  • HRTV has a single- stranded RNA genome consisting of three genome segments - small (S), medium (M) and large (L).
  • S small
  • M medium
  • L large
  • the nucleocapsid (N) protein of HRTV is encoded by the S segment.
  • the N protein has been shown to be immunodominant viral protein.
  • HRTV was first isolated from two Missouri farmers in 2009 (McMullan et al. , N Engl J Med 367: 834-841, 2012; PCT Publication No. 2013/142808). Infection with HRTV is
  • HRTV is transmitted by ticks.
  • heterologous protein or polypeptide refers to a protein or polypeptide derived from a different source or species.
  • Hybridoma A cell line or culture that secretes a homogenous population of monoclonal antibodies.
  • Hybridomas are hybrid cells resulting from the fusion of a myeloma (tumor cell), which confers immortality, and an antibody-producing cell, which confers antibody specificity onto the hybridoma.
  • Immune complex A protein complex that comprises an antibody bound to an antigen.
  • immune complex is used to indicate a protein complex that includes an antigen bound to two separate antigen-specific antibodies (each binding a different epitope of the antigen), whereas the term “antibody-antigen complex” is used to refer to an antigen bound to one antibody.
  • antibody-antibody complex is used to refer to an antibody bound to a different antibody (such as an antigen- specific antibody bound to a secondary antibody).
  • microsphere immune complex is used to indicate an immune complex conjugated to a microsphere.
  • Immunoconjugate A covalent linkage of an effector molecule to an antibody or
  • the effector molecule can be, for example, a detectable label or an immunotoxin.
  • conjugated or linked refers to making two polypeptides into one contiguous polypeptide molecule.
  • an antibody is joined to an effector
  • an antibody joined to an effector molecule is further joined to a lipid or other molecule to a protein or peptide to increase its half-life in the body.
  • the linkage can be either by chemical or recombinant means.
  • the linkage is chemical, wherein a reaction between the antibody moiety and the effector molecule has produced a covalent bond formed between the two molecules to form one molecule.
  • a peptide linker short peptide
  • immunoconjugates can optionally be included between the antibody and the effector molecule. Because immunoconjugates were originally prepared from two molecules with separate functionalities, such as an antibody and an effector molecule, they are also sometimes referred to as "chimeric
  • Isolated An "isolated" biological component (such as a nucleic acid, protein, antibody, antigen or virus) has been substantially separated or purified away from other biological components (such as cell debris, or other proteins or nucleic acids).
  • Biological components that have been “isolated” include those components purified by standard purification methods. The term also embraces recombinant nucleic acids, proteins or viruses, as well as chemically synthesized nucleic acids or peptides.
  • Microparticle/microsphere A particle that is generally about 0.01 to about 1000 microns in diameter.
  • Microparticles include microspheres (spherical microparticles), beads, or the like with a surface suitable for binding (e.g. , suitable for binding an antibody).
  • a microparticle can be a microsphere with a carboxylated surface.
  • the microparticles are polymeric microparticles (a microparticle made up of repeating subunits of a particular substance or substances).
  • the polymeric microparticles are polystyrene microparticles, such as a polystyrene microparticle with a carboxylated surface.
  • Microspheres or beads for use in flow cytometry and flow instrumentation are well known in the art and are commercially available from a variety of sources.
  • a first nucleic acid sequence is operably linked with a second nucleic acid sequence when the first nucleic acid sequence is placed in a functional relationship with the second nucleic acid sequence.
  • a promoter is operably linked to a coding sequence if the promoter affects the transcription or expression of the coding sequence.
  • operably linked DNA sequences are contiguous and, where necessary to join two protein-coding regions, in the same reading frame.
  • compositions and formulations suitable for pharmaceutically acceptable carriers are conventional. Remington's Pharmaceutical Sciences, by E.W. Martin, Mack Publishing Co., Easton, PA, 15th Edition, 1975, describes compositions and formulations suitable for
  • parenteral formulations usually comprise injectable fluids that include pharmaceutically and physiologically acceptable fluids such as water, physiological saline, balanced salt solutions, aqueous dextrose, glycerol or the like as a vehicle.
  • pharmaceutically and physiologically acceptable fluids such as water, physiological saline, balanced salt solutions, aqueous dextrose, glycerol or the like as a vehicle.
  • physiologically acceptable fluids such as water, physiological saline, balanced salt solutions, aqueous dextrose, glycerol or the like
  • solid compositions such as powder, pill, tablet, or capsule forms
  • conventional non-toxic solid carriers can include, for example, pharmaceutical grades of mannitol, lactose, starch, or magnesium stearate.
  • compositions to be administered can contain minor amounts of non-toxic auxiliary substances, such as wetting or emulsifying agents, preservatives, and pH buffering agents and the like, for example sodium acetate or sorbitan monolaurate.
  • non-toxic auxiliary substances such as wetting or emulsifying agents, preservatives, and pH buffering agents and the like, for example sodium acetate or sorbitan monolaurate.
  • Preventing, treating or ameliorating a disease "Preventing" a disease refers to
  • Treating refers to a therapeutic intervention that ameliorates a sign or symptom of a disease or pathological condition after it has begun to develop, such as a reduction in viral load.
  • Treating refers to the reduction in the number or severity of signs or symptoms of a disease, such as an infectious disease.
  • Phlebovirus One of five genera of the Bunyaviridae family. Phlebo viruses are enveloped spherical viruses with icosahedral symmetry. The genome of phleboviruses consists of three single-stranded RNA genome segments - small (S), medium (M) and large (L). The M and L segments are negative sense RNA strands, while the S segment is ambisense RNA. The S segment encodes the non-structural protein NSs in the positive sense orientation and the nucleocapsid (N) in the negative sense orientation. The M segment encodes the glycoprotein precursor that is cleaved by host proteases into two structural domains - Gn and Gc.
  • the L segment encodes the L protein, which functions as the RNA dependent RNA polymerase in primary and secondary transcription to generate mRNA and replicative intermediates, respectively.
  • Phleboviruses have a worldwide distribution and are transmitted by a wide variety of arthropods, including sandflies, mosquitoes and ticks. Several phleboviruses have been linked to human disease, in some cases causing febrile illness, fever, hepatitis, meningitis, encephalitis or hemorrhagic syndrome.
  • Secondary antibody An antibody that specifically recognizes the Fc region of a particular isotype of antibody (for example specifically recognizes human IgG or human IgM). Secondary antibodies for use with the methods disclosed herein include, but are not limited to, anti -human IgG and anti-human IgM. In some embodiments herein, the secondary antibody is conjugated to a detectable label, such as a fluorophore, enzyme or radioisotope, to facilitate detection of immune complexes to which the secondary antibody is bound.
  • a detectable label such as a fluorophore, enzyme or radioisotope
  • Sequence identity The similarity between amino acid or nucleic acid sequences is expressed in terms of the similarity between the sequences, otherwise referred to as sequence identity. Sequence identity is frequently measured in terms of percentage identity (or similarity or homology); the higher the percentage, the more similar the two sequences are. Homologs or variants of a polypeptide or nucleic acid molecule will possess a relatively high degree of sequence identity when aligned using standard methods.
  • NCBI National Center for Biotechnology Information
  • blastp blastn
  • blastx blastx
  • tblastn tblastx
  • Homologs and variants of a VL or a VH of an antibody that specifically binds the HRTV N protein or a fragment thereof are typically characterized by possession of at least about 75%, for example at least about 80%, 90%, 95%, 96%, 97%, 98% or 99% sequence identity counted over the full length alignment with the amino acid sequence of the antibody using the NCBI Blast 2.0, gapped blastp set to default parameters.
  • the Blast 2 sequences function is employed using the default BLOSUM62 matrix set to default parameters, (gap existence cost of 11, and a per residue gap cost of 1).
  • the alignment should be performed using the Blast 2 sequences function, employing the PAM30 matrix set to default parameters (open gap 9, extension gap 1 penalties). Proteins with even greater similarity to the reference sequences will show increasing percentage identities when assessed by this method, such as at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, or at least 99% sequence identity. When less than the entire sequence is being compared for sequence identity, homologs and variants will typically possess at least 80% sequence identity over short windows of 10-20 amino acids, and may possess sequence identities of at least 85% or at least 90% or 95% depending on their similarity to the reference sequence.
  • Serum The fluid portion of the blood that separates out from clotted blood. Serum contains many proteins, including antibodies, but does not contain clotting factors.
  • Subject Living multi-cellular vertebrate organisms, a category that includes both human and non-human mammals.
  • a vector may include nucleic acid sequences that permit it to replicate in a host cell, such as an origin of replication.
  • a vector may also include one or more selectable marker genes and other genetic elements known in the art. Unless otherwise explained, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this disclosure belongs. The singular terms “a,” “an,” and “the” include plural referents unless context clearly indicates otherwise. "Comprising A or B" means including A, or B, or A and B.
  • Heartland virus was first isolated from human leucocytes after two unrelated Missouri farmers were hospitalized in 2009. Next-generation sequencing and phylogenetic analysis confirmed the discovery of isolates of a novel bunyavirus of the genus Phlebovirus, which was subsequently named Heartland virus (HRTV). A subsequent field investigation resulted in the isolation of HRTV from Amblyomma americanum ticks. Therefore, a need surfaced for rapid and reliable serological assays to identify infection in patients.
  • HRTV Heartland virus
  • MAbs anti-HRTV murine monoclonal antibodies
  • microsphere assays were developed as a means of serological detection of both IgM and IgG antibodies in patient sera.
  • HRTV antigens were captured by monoclonal antibodies covalently bound to microspheres, thus allowing for non-purified antigen preparations to be used.
  • Antibodies in human sera from previously confirmed HRTV positive and negative cases were reacted with the microsphere complexes and detected by anti-human IgM or IgG antibodies coupled to phycoerythrin. Reactions were quantified using a BioPlex instrument.
  • Cutoffs were determined by receiver operator characteristic (ROC) analysis, and the sensitivities, specificities and accuracies of the IgM and IgG microsphere immunoassays (MIA) were all >97% as determined by a bootstrap method. Within-plate precision ranged from 12-15% and between-plate precisions ranged from 7-18%. No cross-reactivity with other arboviruses was observed.
  • ROC receiver operator characteristic
  • the HRTV N protein-specific monoclonal antibodies can be used in immunoassays to detect HRTV-specific antibodies in a biological sample or to detect HRTV in a cell or tissue sample.
  • the monoclonal antibodies can also be used, for example, to diagnose or treat an HRTV infection.
  • VH variable heavy
  • VL variable light domains of the disclosed antibodies
  • CDR sequences as determined by IMGT are underlined and the CDR sequences as determined by Kabat are shown in bold.
  • the nucleotide positions and amino acid residues of the VL and VH domain CDRs are provided below each sequence.
  • One of skill in the art could readily determine the CDR boundaries using alternative numbering schemes, such as the Chothia numbering scheme.
  • a 2AG9 VL amino acid sequence (SEQ ID NO: 12)
  • the monoclonal antibodies or antigen-binding fragments comprise a VH domain and/or a VL domain.
  • the VH domain of the antibody or antigen-binding fragment comprises at least a portion of the amino acid sequence set forth herein as any one of SEQ ID NOs: 2, 6, 10, 14, 18, 22, 26 and 30, such as one or more (such as all three) CDR sequences from any one of SEQ ID NOs: 2, 6, 10, 14, 18, 22, 26 and 30.
  • the VL domain of the antibody or antigen-binding fragment comprises at least a portion of the amino acid sequence set forth herein as any one of SEQ ID NOs: 4, 8, 12, 16, 20, 24, 28, 32 and 34, such as one or more (such as all three) CDR sequences from any one of SEQ ID NOs: 4, 8, 12, 16, 20, 24, 28, 32 and 34.
  • the CDR locations are determined IMGT, Kabat or Chothia.
  • the VH domain CDR sequences are at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to the CDR sequences of any one of SEQ ID NOs: 2, 6, 10, 14, 18, 22, 26 and 30 and/or the VL domain CDR sequences are at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to the CDR sequences of any one of SEQ ID NOs: 4, 8, 12, 16, 20, 24, 28, 32 and 34.
  • the VH domain comprises residues 26-35, 53-59 and 98-111 of SEQ ID NO: 2 and/or the VL domain comprises residues 27-32, 50-52 and 89-97 of SEQ ID NO: 4; the VH domain comprises residues 25-33, 50-57 and 96-106 of SEQ ID NO: 6 and/or the VL domain comprises residues 27-32, 50-52 and 89-97 of SEQ ID NO: 8; the VH domain comprises residues 17-24, 42-49 and 88-99 of SEQ ID NO: 10 and/or the VL domain comprises residues 27-31, 49-51 and 88-96 of SEQ ID NO: 12; the VH domain comprises residues 25-33, 51-57 and 96-107 of SEQ ID NO: 14 and/or the VL domain comprises residues 27-32, 50-53 and 89-97 of SEQ ID NO: 16; the VH domain comprises residues 26-33, 51-60
  • the VH domain comprises residues 31-37, 52-67 and 100-111 of SEQ ID NO: 2 and/or the VL domain comprises residues 24-34, 50-56 and 89-97 of SEQ ID NO: 4; the VH domain comprises residues 30-34, 49-65 and 98-106 of SEQ ID NO: 6 and/or the VL domain comprises residues 24-34, 50-56 and 89-97 of SEQ ID NO: 8; the VH domain comprises residues 22-26, 41-57 and 90-99 of SEQ ID NO: 10 and/or the VL domain comprises residues 24-34, 49-55 and 88-96 of SEQ ID NO: 12; the VH domain comprises residues 30-35, 50-65 and 98-107 of SEQ ID NO: 14 and/or the VL domain comprises residues 24-34, 50-56 and 89-97 of SEQ ID NO: 16; the VH domain comprises residues 31-35, 50-68 and 101-109 of SEQ ID NO: 4; the VH domain comprises residues 30-34, 49-
  • the VH domain comprises an amino acid sequence at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 2, SEQ ID NO: 6, SEQ ID NO: 10, SEQ ID NO: 14, SEQ ID NO: 18, SEQ ID NO: 22, SEQ ID NO: 26 or SEQ ID NO: 30.
  • the VH domain comprises or consists of the amino acid sequence of SEQ ID NO: 2, SEQ ID NO: 6, SEQ ID NO: 10, SEQ ID NO: 14, SEQ ID NO: 18, SEQ ID NO: 22, SEQ ID NO: 26 or SEQ ID NO: 30.
  • the VL domain comprises an amino acid sequence at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 4, SEQ ID NO: 8, SEQ ID NO: 12, SEQ ID NO: 16, SEQ ID NO: 20, SEQ ID NO: 24, SEQ ID NO: 28 or SEQ ID NO: 32.
  • the VL domain comprises or consists of the amino acid sequence of SEQ ID NO: 4, SEQ ID NO: 8, SEQ ID NO: 12, SEQ ID NO: 16, SEQ ID NO: 20, SEQ ID NO: 24, SEQ ID NO: 28 or SEQ ID NO: 32.
  • the monoclonal antibody is an immunoglobulin (Ig) molecule, such as an IgG antibody.
  • Ig immunoglobulin
  • the monoclonal antibody is an IgA, IgD, IgE or IgM antibody.
  • the antigen-binding fragment is an Fab fragment, an Fab' fragment, an F(ab)' 2 fragment, a single chain variable fragment (scFv) or a disulfide stabilized variable fragment (dsFv).
  • the monoclonal antibody or antigen-binding fragment is a mouse antibody. In other embodiments, the monoclonal antibody or antigen-binding fragment is a chimeric or synthetic antibody comprising human and mouse amino acid sequence. For example, the antibody can comprise one or more human framework regions. In other embodiments, the monoclonal antibody or antigen-binding fragment is humanized.
  • fusion proteins comprising a monoclonal antibody or antigen- binding fragment disclosed herein and a heterologous protein.
  • the heterologous protein is a protein tag, such as a myc tag, His tag, HA tag, or FLAG tag.
  • the heterologous protein is an affinity tag, such as chitin binding protein, maltose binding protein, or glutathione- S -transferase (GST).
  • immunoconjugates comprising a monoclonal antibody or antigen-binding fragment disclosed herein attached to a detectable label.
  • the detectable label is a fluorescent, radioactive or enzymatic label.
  • Compositions comprising a monoclonal antibody or antigen-binding fragment disclosed herein and a pharmaceutically acceptable carrier are further provided.
  • compositions that include a disclosed monoclonal antibody or antigen- binding fragment conjugated to a microsphere.
  • Microspheres for use in immunoassays are well known in the art and are commercially available from a variety of sources.
  • the microspheres are MICROPLEXTM microspheres (Luminex Corp, Austin, TX).
  • the antibody or antigen-binding fragment can be conjugated to the microsphere using any method known in the art.
  • the monoclonal antibody or antigen-binding fragment is chemically conjugated to the microsphere.
  • chemical conjugation is via carbodiimide coupling.
  • the microsphere comprises a fluorophore.
  • the microsphere comprises two different fluorophores.
  • the antibody-microsphere compositions further include HRTV N protein bound to the monoclonal antibody or antigen-binding fragment (referred to herein as "microsphere compositions").
  • the source of the N protein can include, for example, recombinantly prepared N protein, lysates of cells expressing N protein or lysates of HRTV-infected cells.
  • the method is a microsphere immunoassay (MIA) that uses a disclosed monoclonal antibody (or antigen-binding fragment) conjugated to a microsphere.
  • MIA microsphere immunoassay
  • the method is an indirect ELISA that uses a disclosed monoclonal antibody (or antigen-binding fragment) bound to a solid support, such as a microtiter plate.
  • the method is an antibody capture ELISA in which a labelled monoclonal antibody (or antigen-binding fragment) disclosed herein is used to detect immune complexes containing HRTV-specific antibodies from a biological sample.
  • a method of detecting HRTV-specific antibodies in a biological sample by contacting the biological sample with a microsphere composition under conditions sufficient to allow binding of any HRTV-specific antibodies present in the biological sample to the HRTV N protein, thereby forming a microsphere immune complex; contacting the microsphere immune complex with a labelled secondary antibody; and detecting binding of the secondary antibody to the microsphere immune complex, thereby detecting HRTV-specific antibodies present in the biological sample.
  • a "microsphere composition” refers to a HRTV N-protein specific monoclonal antibody or binding fragment conjugated to a microsphere, wherein the N-protein specific antibody or binding fragments is also bound to HRTV N protein.
  • the method is a method of detecting HRTV-specific IgM antibodies and the secondary antibody is anti-human IgM. In other examples, the method is a method of detecting HRTV-specific IgG antibodies and the secondary antibody is anti-human IgG. In some examples, the secondary antibody is labelled with a fluorophore. In some examples, a flow cytometer is used to detect binding of the secondary antibody to the microsphere immune complex.
  • a method of detecting HRTV-specific antibodies in a biological sample by providing a disclosed monoclonal antibody or antigen-binding fragment bound to a solid support; contacting the antibody-bound solid support with a preparation comprising HRTV N protein under conditions sufficient for the HRTV N protein to bind the monoclonal antibody or antigen-binding fragment to form an antibody-antigen complex; contacting the antibody-antigen complex with the biological sample to allow binding of any HRTV-specific antibodies present in the sample to the HRTV N protein, thereby forming an immune complex; contacting the immune complex with a labelled secondary antibody; and detecting binding of the secondary antibody to the immune complex, thereby detecting HRTV-specific antibodies present in the biological sample.
  • the secondary antibody is labelled with an enzyme and detecting binding of the secondary antibody to the immune complex comprises detecting enzyme activity.
  • the enzyme is horseradish peroxidase or alkaline phosphatase.
  • a method of detecting HRTV-specific antibodies in a biological sample includes providing a secondary antibody bound to a solid support; contacting the antibody-bound solid support with the biological sample under conditions sufficient to allow binding of the secondary antibody to any HRTV-specific antibodies present in the biological sample, thereby forming antibody- antibody complexes; contacting the antibody- antibody complexes with a preparation comprising HRTV N protein under conditions sufficient for the HRTV N protein to bind the HRTV-specific antibodies, thereby forming immune complexes; contacting the immune complexes with an immunoconjugate disclosed herein; and detecting binding of the immunoconjugate to the immune complexes, thereby detecting HRTV-specific antibodies in the biological sample.
  • the biological sample is a biological fluid sample.
  • the biological fluid sample comprises serum, blood or plasma.
  • the biological sample comprises serum.
  • An increase in binding of the antibody or immunoconjugate to the cell or tissue as compared to binding of the antibody or immunoconjugate to a control cell or tissue detects HRTV in the cell or tissue.
  • a labelled secondary antibody is used to detect the presence of HRTV.
  • a method of treating HRTV infection in a subject by administering to the subject a monoclonal antibody or antigen-binding fragment disclosed herein is also provided by the present disclosure.
  • nucleic acid molecules encoding a VH domain and/or a VL domain of a monoclonal antibody or antigen binding fragment disclosed herein.
  • the VH domain coding sequence is at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 1, SEQ ID NO: 5, SEQ ID NO: 9, SEQ ID NO: 13, SEQ ID NO; 17, SEQ ID NO: 21, SEQ ID NO: 25 or SEQ ID NO: 29.
  • the VH domain coding sequence comprises SEQ ID NO: 1, SEQ ID NO: 5, SEQ ID NO: 9, SEQ ID NO: 13, SEQ ID NO; 17, SEQ ID NO: 21, SEQ ID NO: 25 or SEQ ID NO: 29.
  • the VL domain coding sequence is at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 3, SEQ ID NO: 7, SEQ ID NO: 11, SEQ ID NO: 15, SEQ ID NO: 19, SEQ ID NO: 23, SEQ ID NO: 27 or SEQ ID NO: 31.
  • the VL domain coding sequence comprises SEQ ID NO: 3, SEQ ID NO: 7, SEQ ID NO: 11 , SEQ ID NO: 15, SEQ ID NO: 19, SEQ ID NO: 23, SEQ ID NO: 27 or SEQ ID NO: 31.
  • the nucleic acid molecule is operably linked to a promoter.
  • Vectors comprising the nucleic acid molecules are further provided. Also provided are isolated host cells transformed with the nucleic acid molecules and vectors disclosed herein.
  • the monoclonal antibodies disclosed herein can be of any isotype.
  • the monoclonal antibody can be, for example, an IgM or an IgG antibody, such as IgGior an IgG2.
  • the class of an antibody that specifically binds HRTV can be switched with another (for example, IgG can be switched to IgM), according to well-known procedures. Class switching can also be used to convert one IgG subclass to another, such as from IgGi to IgG2.
  • Antibody fragments are also encompassed by the present disclosure, such as single-domain antibodies (e.g. , VH domain antibodies), Fab, F(ab')2, and Fv. These antibody fragments retain the ability to selectively bind with the antigen.
  • antigen-binding fragments include: (1) Fab, the fragment which contains a monovalent antigen-binding fragment of an antibody molecule, can be produced by digestion of whole antibody with the enzyme papain to yield an intact light chain and a portion of one heavy chain;
  • Fab' the fragment of an antibody molecule can be obtained by treating whole antibody with pepsin, followed by reduction, to yield an intact light chain and a portion of the heavy chain; two Fab' fragments are obtained per antibody molecule;
  • Fv a genetically engineered fragment containing the variable region of the light chain and the variable region of the heavy chain expressed as two chains
  • Single chain antibody such as scFv
  • scFv Single chain antibody
  • a dimer of a single chain antibody (SCFV2), defined as a dimer of a scFv (also known as a "miniantibody”);
  • VH single-domain antibody an antibody fragment consisting of the heavy chain variable domain.
  • antibody fragments can be prepared by proteolytic hydrolysis of the antibody or by expression in a host cell (such as E. coli) of DNA encoding the fragment.
  • Antibody fragments can be obtained by pepsin or papain digestion of whole antibodies by conventional methods.
  • antibody fragments can be produced by enzymatic cleavage of antibodies with pepsin to provide a 5S fragment denoted F(ab')2. This fragment can be further cleaved using a thiol reducing agent, and optionally a blocking group for the sulfhydryl groups resulting from cleavage of disulfide linkages, to produce 3.5S Fab' monovalent fragments.
  • an enzymatic cleavage using pepsin produces two monovalent Fab' fragments and an Fc fragment directly (see U.S. Patent No. 4,036,945 and U.S. Patent No. 4,331,647).
  • cleaving antibodies such as separation of heavy chains to form monovalent light-heavy chain fragments, further cleavage of fragments, or other enzymatic, chemical, or genetic techniques may also be used, so long as the fragments bind to the antigen that is recognized by the intact antibody.
  • conservative variants of the antibodies can be produced. Such conservative variants employed in antibody fragments, such as dsFv fragments or in scFv fragments, will retain critical amino acid residues necessary for correct folding and stabilizing between the VH and the VL regions, and will retain the charge characteristics of the residues in order to preserve the low pi and low toxicity of the molecules.
  • Amino acid substitutions (such as at most one, at most two, at most three, at most four, or at most five amino acid substitutions) can be made in the VH and/or the VL regions to increase yield.
  • Conservative amino acid substitution tables providing functionally similar amino acids are well known to one of ordinary skill in the art. The following six groups are examples of amino acids that are considered to be conservative substitutions for one another:
  • Detection assays based on binding of an antigen to an antibody include, for example, ELISA, microsphere immunoassay (MIA), immunofluorescence assay (IFA), Western blot, fluorescence activated cell sorting (FACS), radioimmunoassay (RIA), immunohistochemistry (IHC) and plaque reduction neutralization test (PRNT).
  • MIA microsphere immunoassay
  • IFA immunofluorescence assay
  • FACS fluorescence activated cell sorting
  • RIA radioimmunoassay
  • IHC immunohistochemistry
  • PRNT plaque reduction neutralization test
  • the detection assay further includes the step of contacting an antigen-antibody complex with a detection reagent, such as a labeled secondary antibody (e.g. , an anti-isotype antibody, such as an anti-IgG antibody), or in the case of a sandwich ELISA, a second antibody that recognizes the same antigen as the first antibody and is labeled for detection.
  • a detection reagent such as a labeled secondary antibody (e.g. , an anti-isotype antibody, such as an anti-IgG antibody), or in the case of a sandwich ELISA, a second antibody that recognizes the same antigen as the first antibody and is labeled for detection.
  • Secondary antibodies can also be conjugated to magnetic beads to allow for magnetic sorting.
  • the primary antibody is directly labeled.
  • Directly labeled antibodies can be used for a variety of detection assays, such as FACS.
  • the HRTV-specific antibodies disclosed herein can be used any immune -based detection assay for the diagnosis of
  • Microsphere immunoassays are becoming increasingly popular for laboratory diagnosis of many diseases (Earley et al , Cytometry 50:239-242, 2002; Kellar et al, Cytometry 45:27-36, 2001).
  • the technology involves the detection and analysis of a reaction (such as an antibody or other ligand) attached to microspheres or beads.
  • the detecting instrument is a simplified flow cytometer, and lasers simultaneously identify the microsphere sets and measure the fluorescence associated with the reaction. The speed at which these tests can be performed and the ability to multiplex make this methodology particularly useful.
  • a MIA can be used to detect the presence of Heartland virus-specific antibodies in a sample.
  • microsphere beads are coated with a Heartland virus-specific antibody (such as an antibody produced by a hybridoma cell line disclosed herein) and contacted with HRTV antigen such that the HRTV antigen binds to the microsphere-bound virus-specific antibodies.
  • the microsphere immune complexes are mixed with a serum sample such that antibodies in the sample that are specifically reactive with the HRTV antigen bind the HRTV antigen bound (indirectly) to the microsphere.
  • the bead-bound immune complexes are allowed to react with fluorescent-dye labeled anti-species antibody (such as PE-labeled anti-human IgM or anti-human IgG), and are measured using a microsphere reader (such as a Luminex instrument).
  • fluorescent-dye labeled anti-species antibody such as PE-labeled anti-human IgM or anti-human IgG
  • microsphere reader such as a Luminex instrument
  • the host IgM response to infection occurs earlier than that the IgG response, and thus can be used to identify recent infections (Tardei et al. , J Clin Microbiol 38(6):2232-2239, 2000).
  • MAC-ELISA is typically performed to detect the IgM level in serum samples (Martin et al , J Clin Microbiol 38(5): 1823-1826, 2000).
  • anti-human IgM serves as a capture antibody and is coated onto an appropriate assay plate, such as a multi-well plate. After blocking of the plate, such as with nonfat dry milk, diluted human sera are reacted with the anti-human IgM.
  • Viral antigens such as infected tissue or cell extracts or recombinant viral proteins, are added to the plates.
  • a virus antigen-specific antibody conjugated to detectable label for example, an enzyme, such as horseradish peroxidase (HRP)
  • HRP horseradish peroxidase
  • an appropriate substrate such as 3,3'5,5' tetra methyl benzidine if HRP is used as the enzyme
  • reactions are measured using a microplate reader.
  • Serial dilutions of positive sera can be evaluated. The maximum dilution that exhibits positive signal is the titer for the serum.
  • the titer of the MAC-ELISA can be compared with the titers of other tests, such as hemagglutination inhibition tests (HIT) or PRNT.
  • Serum samples can also be tested on control antigen in addition to viral antigen, to reduce the number of false-positive results due to non-specific binding of the serum or other factors (U.S. Patent Application Publication No.
  • Indirect ELISAs to detect the presence of virus-specific antibodies are typically carried out by coating a microtiter plate with an antigen-specific antibody (such as a HRTV-specific monoclonal antibody), blocking the plates to prevent non-specific binding to the plate surface, and adding virus antigen to allow binding of the antigen to the virus-specific antibody. After several washes, diluted human sera is added to allow binding of any antibodies present in the sample to the immobilized viral antigens. IgM or IgG antibodies that were present in the sample are then detected using a labelled secondary antibody, such as anti-human IgG or anti-human IgM conjugated to an enzyme (such as alkaline phosphatase or HRP). An appropriate enzyme substrate is then added and the presence of virus-specific antibody is detected by measuring enzyme activity (for example, by measuring fluorescence, optical density or colorimetric absorbance).
  • an enzyme-specific antibody such as alkaline phosphatase or HRP
  • Lateral flow immunoassays are another method by which antigen-specific antibodies (or pathogen-specific antigens) can be detected in biological samples. These assays are generally very rapid and enable point of care testing.
  • LFA is performed over a strip, different parts of which are assembled on a plastic backing. These parts are sample application pad, conjugate pad, ni rocellulose membrane and adsorption pad. Nitrocellulose membrane is further divided into test and control lines. Pre - immobilized reagents at different parts of the strip become active upon flow of liquid sample. LFA combines the unique advantages of biorecognition probes and
  • LFAs include a porous support strip (such as a strip of cellulose) with a number of separate regions spaced horizontally along the support.
  • the solid support need not be identical in all regions of a strip.
  • the first region is a sample pad where a biological fluid is applied to flow laterally through the support to the remaining regions.
  • the second region generally contains a labeling moiety that can be bound to the analyte of interest (such as an antibody or protein) in the sample if present.
  • Downstream of the labeling region is a capture or "test" region where the labeled analyte (for example, antibody or peptide) is retained in the strip. It is in this test region where detection is generally performed.
  • the strip may contain a control region either in the same flow path as that of the test region, or in a parallel path on the strip. There may also be a reservoir downstream of the various regions to absorb the sample that has traversed the test strip.
  • LFAs can be direct assays, forming sandwiches in proportion to the level of analyte present, or may be competition assays where analyte in the sample diminishes the amount of label detected in the detection zone.
  • the sample may be labeled by colored particles that are coupled to affinity reagents such as secondary antibodies the bind HRTV- specific antibodies present in the sample, forming complexes which are then carried to the test region for capture by an additional reagent.
  • affinity reagents such as secondary antibodies the bind HRTV- specific antibodies present in the sample, forming complexes which are then carried to the test region for capture by an additional reagent.
  • the detectable label in the test region will be directly proportional to the level of peptide in the sample.
  • the labeling region may contain labeled reagents, for example, that are already coupled to the target analyte (e.g. antibody) or an analog thereof, and the analytes in the sample compete with this labeled material for capture by the capture reagent in the test region.
  • the detectable label in the test region will be inversely proportional to the quantity of analyte in the sample itself.
  • Simple visual detection is the most common means of reading an LFA, however, there are commercially available lateral flow readers that can quantitate the detectable label in the test region.
  • LFAs can be used, for example, to detect antigen-specific antibodies present in a biological sample (such as a serum sample) that specifically recognize HRTV. These assays can also be used to detecting pathogen-specific proteins/peptides present in a biological sample.
  • Example 1 Heartland Virus Produces a Humoral Response Lacking Virus-Neutralizing Antibody In Vivo
  • Heartland virus is a newly discovered member of the Phlebovirus genus in the family Bunyaviridae, presumably transmitted by ticks to humans causing severe disease characterized by fever, leukopenia and thrombocytopenia (McMullan et al , N Engl J Med 367: 834-841, 2012). It is closely related to severe fever with thrombocytopenia syndrome virus
  • Three-week old C57BL/6 mice were inoculated with 10 4 PFU, boosted with 10 4 PFU on 28 days post infection (DPI), and bled at 42 DPI to determine antibody titers.
  • Three-week old ⁇ , ⁇ and ⁇ interferon-receptor deficient AG129 mice were inoculated with 10 4 to 10° PFU and observed through day 30 to determine the LD50 dose.
  • AG129 mice surviving challenge with 10 2 PFU were boosted 30 DPI, and spleens were harvested 4 days later for hybridoma production.
  • Viremias were determined by plaque assay and PRNTso were performed on Vero E6 cells. Serum antibody and monoclonal antibody titers were determined by ELISA with purified virus coated directly to the plate.
  • Protein specificity was determined by running purified HRTV on 4-12% Bis/Tris gels with (ME+) or without (ME-) reducing agent ( ⁇ -mercaptoethanol). Cross-reactivity was determined by immunofluorescent assay (IFA) on SFTSV-infected Vero cells.
  • N nucleocapsid
  • the majority of anti-SFTSV human and murine MAbs developed have been nucleocapsid-specific and non-neutralizing (Yu et al, PLoS One 7: e38291, 2012; Guo et al, Clin Vaccine Immunol 20: 1426-1432, 2013).
  • the nucleocapsid protein has been shown to be the immunodominant viral protein in other phleboviral infections with Rift Valley fever virus and Toscana virus (Martin- Folgar et al, MAbs 2: 275-284, 2010; Magurano and Nicoletti, Clin Diagn Lab Immunol 6: 55-60, 1999).
  • Serologic diagnostic assays that do not rely on the detection of neutralizing antibody and BSL-3 containment are needed.
  • Example 2 Monoclonal Antibodies Directed Against the Nucleoprotein of Heartland Virus Diagnostic assays for the detection of HRTV is currently limited to the detection of viral
  • RNA by RT-PCR and the detection of neutralizing antibody by plaque reduction neutralization test PRNT.
  • PRNT plaque reduction neutralization test
  • Splenocytes were harvested 4 days after the last inoculation for fusions with the mouse myeloma cell line P3X63Ag8.653 using the CLONACELLTM-HY Hybridoma cloning kit (StemCell Technologies).
  • B-cell hybridoma clones are generally made by isolating activated B cells from the spleen of an immunized BALB/c mouse or mouse with a compatible major histocompatibility complex (MHC) haplotype (H2 d ) and fusing with a myeloma cell with the same haplotype.
  • MHC major histocompatibility complex
  • H2 d myeloma cell with the same haplotype.
  • AG129 mice were used as B cell donors which have a different MHC haplotype (H2 b ) from the P3X63Ag8.653 myeloma cells used for fusions. While the use of BALB/c mice may be appropriate for most infectious agents, some pathogens may be unable to mount a robust immune response. Utilizing AG129 mice for hybridoma development may be more appealing in these situations.
  • hybridomas were grown in high-glucose Dulbecco minimal essential medium supplemented with L-glutamine, 10% low IgG fetal bovine serum, 1 mM sodium pyruvate, 2 mM L-glutamine, 0.15% sodium bicarbonate, 100 U/ml penicillin G sodium, 100 ⁇ g/ml streptomycin sulfate, and 0.1 mM nonessential amino acids.
  • MAbs were purified from highly concentrated culture media using protein- A SEPHAROSETM (GE Healthcare) according to the manufacturer's instructions. Purified MAbs were dialyzed against PBS and the concentration was measured by Bradford protein assay.
  • mice 1 and mouse 2 had ELISA endpoint titers of ⁇ 2.70 logio and > 4.60 logio, respectively, indicating that mouse 1 did not develop an infection after the first inoculation.
  • those ELISA titers increased to 2.70 logio and 5.56 logio, respectively, while PRNTso titers on Vero cells were 1.90 logio and 2.51 logio, respectively (Table 3).
  • BCIP/NBT phosphatase substrate KPL was added until a color change appeared. Even though neutralizing antibody titers were detected for both mice, only mouse 2 produced IgG anti- glycoprotein (Gn and Gc) and anti-N antibody to HRTV detectable by Western blot by day 34 (FIG. 1).
  • hyridoma clones secreting anti-HRTV MAb were isolated from fusions. Nineteen of these were from fusions using splenocytes from mouse 2, while only one hybridoma clone was isolated from fusions using splenocytes from mouse 1. Twelve of the hybridoma clones were of varying IgG isotypes, while the other 8 were IgM (Table 4). Nine of the IgG MAbs were titrated by ELISA as previously described with starting concentrations of purified MAbs beginning at 10 ⁇ g/ml. An optical density (OD) of two times the background was considered a positive result and endpoints were expressed in ng/ml.
  • OD optical density
  • the MAbs with the highest reactivities by ELISA were 2BB5, 2AG8, 2BB8 and 2AG9 with endpoint concentrations of 0.156, 0.381, 0.610 and 1.526 ng/ml, respectively.
  • the MAbs with moderate reactivities by ELISA were 2BB7, 2BA2, and 2BB10 with endpoint concentrations of 24.41, 39.06 and 937.5 ng/ml.
  • Viral glycoprotein specificity for these MAbs was determined by immunoblot with or without the reducing agent, ⁇ -mercaptoethanol (ME). All anti-HRTV MAbs reacted specifically with the N protein which is approximately 20 KDa in mass. These MAbs were reactive under reducing and non-reducing conditions suggesting that all 9 MAbs recognize linear epitopes on the N protein (Table 4).
  • N nucleocapsid
  • the exception has been a human MAb (hMAb) recognizing a linear epitope in the ectodomain of Gn able to neutralize virus in vitro by blocking virus-cell mediated attachment (Guo et al, Clin Vaccine Immunol 20: 1426-1432, 2013).
  • the N protein has also been shown to be the immunodominant protein in other phleboviral infections including Rift Valley fever virus (RFTV) and Toscana (TOSV) viruses (Martin-Folgar et al , MAbs 2: 275-284, 2010; Magurano and Nicoletti, Clin Diagn Lab Immunol 6: 55-60, 1999).
  • RFTV Rift Valley fever virus
  • TOSV Toscana
  • MAbs directed against this antigen can be protective in vivo against RVFV and Hantaan viral infections (Boshra et al, Vaccine 29: 4469-4475, 2011; Jansen van Vuren et al, PLoS One 6: e25027, 2011; Nakamura et al, Arch Virol 86: 109-120, 1985; Yoshimatsu et al, Arch Virol 130: 365-376, 1993).
  • Bunyaviruses are a significant cause of human illness world-wide, with the most common in the United States being La Crosse encephalitis virus (LACV), of the genus Orthobunyavirus.
  • Phleboviruses possess large (L), medium (M) and small (S) genomic segments that encode genes for RNA-dependent RNA polymerase, envelope glycoproteins (Gn and Gc) and a nucleocapsid protein, respectively. Diagnostic methods for LACV were unsuitable for HRTV, and methods were developed using sequence information and virus isolates to generate reagents to aid in laboratory diagnosis.
  • Serum samples submitted for HRTV testing were from patients who had clinical and circumstantial presentations that were consistent with those described for HRTV, and who were accordingly enrolled in studies that were designed to investigate this virus. Serum specimens from patients previously diagnosed with non-HRTV infections or non-arboviral infections were also used. Data from 91 serum samples enrolled in a HRTV-related study were included, where results from an additional 49 blood or tissue samples that were previously tested by molecular or isolation methods only, were included in the analyses. A further cohort of 40 non-HRTV-related samples from the DVBD archives were included.
  • Tissue culture-derived HRTV antigen was produced in Vero cells and harvested at day 10 post-infection. After centrifugal clarification, virus was inactivated using 0.1% beta-propiolactone and checked for absence of infectivity (Goodman et al., J Virol Methods 208:66-78, 2014). Antigen preparations were stored frozen at -70°C until use. The same procedure was performed for non-infected Vero cells to produce normal antigen to serve as a control in the MI As.
  • PRNTs were performed using Vero cells ( Lindsey et al , J Clin Microbiol 4:503-510, 1976).
  • a double overlay system was used where the second overlay with neutral red was applied six days after the cells were infected, and plaques were read over the following two days.
  • IgG ELISA results were compared to those of the IgG MIA.
  • Inactivated virus -infected cell lysate antigen was used to coat 96-well plates at a 1: 1000 dilution in PBS with an overnight incubation at 4°C.
  • Serum dilutions were added at a 1: 1000 dilution in 5% milk block and incubated for 1 hour at 37°C.
  • Anti-HRTV IgG was detected with anti-human IgG horseradish peroxidase (HRP) (Jackson Immunoresearch) at 1 : 1000 for 1 hour at 37°C. Reactions were visualized using TMB substrate (Neogen, Lansing, MI), stopped with 1 N
  • MIAs were developed to detect IgM and IgG antibodies to HRTV.
  • Murine MAbs to HRTV were generated in AG129 mice (van den Broek et al., J Virol 69:4792-4796, 1995) and
  • MAb 2BB5 a non-neutralizing IgG3 isotype that recognizes nucleocapsid protein was covalently bound to individual MICROPLEXTM microsphere sets (Luminex Corp, Austin, TX) using standard carbodiimide coupling at a rate of 25 ⁇ g per 5.4 million microspheres as described previously (Johnson et al , Clin Diagn Lab Immunol 12:566-574, 2005).
  • Microspheres were adjusted to 5 x 10 6 /ml and the HRTV antigen reaction was titrated with the beads to determine optimal signal-to-noise ratio in the IgM and IgG tests.
  • Final volumes of 100 ⁇ antigen (IgM assay) and 12.5 ⁇ antigen (IgG assay) were added to 0.25 million antibody- coupled microspheres per 0.5 ml in Antibody Stabilizer (Boca Scientific, Boca Raton, FL) in amber vials and rotated for 1 hour at room temperature, then stored at 4°C until use.
  • microspheres prepared in this manner can be used from two days to five months (Basile et al , Clin Vaccine Immunol 17:56-61, 2010) after addition of antigen to the microspheres. The same was done using tissue culture-derived normal antigen to serve as a negative antigen control.
  • IFA for IgM
  • IgG ELISA for IgG
  • Microspheres were diluted 1: 10 in Low Cross Buffer (Boca Scientific, Boca Raton, FL) and 50 ⁇ per well (2500 microspheres) was added to a pre- wet 96-well filter plate (Millipore Corp, Billerica, MA). Wells were washed 2X with 100 ⁇ PBS using a vacuum filtration manifold.
  • Control sera for the IgM test was IgG-depleted as previously described (Johnson et al. , Clin Diagn Lab Immunol 12:566-574, 2005) and diluted 1:400 in 50% low cross buffer (LCB) (Boca Scientific, Boca Raton, FL) and 50 ⁇ was added to the washed microspheres. No depletion was necessary for the IgG controls, which were diluted at 1 :400 in 50% LCB.
  • Sera in the IgM test were co-incubated with 50 ⁇ /well anti-human IgM-red-phycoerythrin (R-PE) at 4 ⁇ g/ml of 50% LCB for 1.5 hours at room temperature.
  • R-PE anti-human IgM-red-phycoerythrin
  • the plate was covered with foil to protect the microspheres from being bleached and were kept in a state of suspension on a shaking platform.
  • Wells were washed 2X with 100 ⁇ PBS, resuspended in 100 ⁇ PBS and read on a BioPlex 100 (Biorad, Hercules, CA).
  • Biorad Hercules, CA
  • sera were added to the washed antigen/microspheres and incubated with shaking for 45 minutes, washed 2X, then 50 ⁇ anti-human IgG-RPE in 50 % LCB was added to the wells. After a further 15 minutes of incubation, wells were treated and read in the same manner as for IgM.
  • Readings were based on 50 ⁇ of sample with doublet-discriminator gates set at default, and median fluorescent intensity (MFI) was calculated based on a minimum of 50 microspheres per set per sample.
  • MFI median fluorescent intensity
  • ROC analysis performed using PRNT results for "truth" versus the IgG MIA MFI values yielded a cutoff of 3101.
  • the cutoff derived using PRNT versus P/N was 51.1.
  • a combination of these cutoffs was chosen to identify positives, equivocals and negatives, where samples with both MFIs >3101 and P/N>51.1 were positive; where either MFI >3101 OR P/N >51.1 were equivocal, and where MF 3101 and P/N ⁇ 51.1 were negative. Comparisons of P/N and MFI are charted in FIG. 2.
  • Samples from confirmed cases of non-HRTV arboviral disease were tested in the HRTV IgM and IgG MIAs to determine if cross-reactivity might exist. Eight samples were IgM and IgG positive to each of the following viruses: La Crosse virus (LACV), eastern equine encephalitis virus (EEEV), West Nile virus (WNV) and Powassan virus (POWV). These arboviruses are all endemic in Missouri and the Midwestern United States. A total of 32 previously-tested diagnostic specimens showed no reaction with the HRTV antigens in either test, indicating a lack of cross- reactivity. The anti-virus antibodies tested were to an alphavirus, two flaviviruses and a California serogroup bunyavirus.
  • LACV La Crosse virus
  • EEEV eastern equine encephalitis virus
  • WNV West Nile virus
  • POWV Powassan virus
  • Powassan virus is the only tick-borne virus that was investigated for cross- reactivity in the MIAs. Recently, Bourbon virus (Kosoy et al, Emerg Infect Dis 21(5):760-764, 2015) was newly discovered in a patient from Missouri. It is of the genus Thogotovirus (family Orthomyxoviridae) and is thought to be tick-borne. The patient was initially tested for HRTV and found to be negative; subsequent testing of sera using the MIA assays produced the same negative result, indicating a lack of cross-reactivity with this virus.
  • the HRTV IgG assay has advantages over the current IgG ELISA, which is based upon cell lysate antigen and has shown some inconsistencies. Both MIAs are considerably faster and easier to set up than the IFA and IgG ELISAs.
  • the use of MAbs to capture the antigen on the microspheres is a tool that is successfully employed here to alleviate the requirement for recombinant or purified viral protein, which normally is needed if the protein is to be directly linked to the microspheres. As knowledge of the geographic distribution of HRTV is gained, there may be a need to incorporate HRTV testing at some of the U.S. State Health laboratories.
  • HRTV will likely become part of the differential diagnosis for patients with a history of tick-bite in areas with known HRTV activity, or with obvious leukopenia and thrombocytopenia.
  • Luminex instruments are in use at many of these labs and therefore is a suitable platform for those who wish to add HRTV testing to their menus of screening methods.
  • the efficiency with which the HRTV MIAs can be performed will simplify any serosurveillance in the human population.
  • the HRTV IgG MIA can easily be modified to test for antibodies in wildlife populations, by using biotin to label the serum antibodies (Basile et al, Clin Vaccine Immunol 17:56-61, 2010).
  • the MIAs proved to be accurate and precise, and will be a useful screening tool for HRTV.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Virology (AREA)
  • Immunology (AREA)
  • Molecular Biology (AREA)
  • Organic Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Biochemistry (AREA)
  • Urology & Nephrology (AREA)
  • Hematology (AREA)
  • Biomedical Technology (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Food Science & Technology (AREA)
  • Analytical Chemistry (AREA)
  • Physics & Mathematics (AREA)
  • General Physics & Mathematics (AREA)
  • Pathology (AREA)
  • Microbiology (AREA)
  • Cell Biology (AREA)
  • Biotechnology (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Peptides Or Proteins (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)

Abstract

Monoclonal antibodies that specifically bind the nucleocapsid protein of Heartland virus (HRTV) are described. The monoclonal antibodies can be used, for example, in immunoassays to detect HRTV-specific antibodies in a biological sample or to detect HRTV in a cell or tissue sample. The monoclonal antibodies can also be used to diagnose or treat an HRTV infection.

Description

MONOCLONAL ANTIBODIES SPECIFIC FOR HEARTLAND VIRUS
AND METHODS OF THEIR USE
CROSS REFERENCE TO RELATED APPLICATIONS
This application claims the benefit of U.S. Provisional Application No. 62/221,431, filed September 21, 2015, which is herein incorporated by reference in its entirety.
FIELD
This disclosure concerns monoclonal antibodies that specifically recognize Heartland (HRTV), and diagnostic assays for detecting HRTV using the disclosed antibodies.
BACKGROUND
The genus Phlebovirus is one of five genera of the Bunyaviridae family. Phleboviruses are enveloped spherical viruses with icosahedral symmetry. The genome of phleboviruses consists of three single-stranded RNA genome segments - small (S), medium (M) and large (L). The M and L segments use a negative sense coding strategy, while the S segment encodes two proteins using an ambisense strategy. The S segment encodes the non- structural protein NSs in the positive sense orientation and the nucleocapsid (N) protein in the negative sense orientation; each protein is translated from a subgenomic virus mRNA. The M segment encodes the glycoprotein precursor that is cleaved by host proteases into two structural domains - Gn and Gc. The L segment encodes the L protein, which functions as the RNA-dependent RNA polymerase in primary and secondary transcription to generate mRNA and replicative intermediates, respectively.
Heartland virus (HRTV) is a newly identified member of the Phlebovirus genus. It was first isolated from leukocytes of two Missouri farmers in separate incidences hospitalized in 2009 (McMullan et al , N Engl J Med 367: 834-841, 2012; PCT Publication No. WO 2013/142808). Each subject experienced similar, though not identical symptoms of fever, headache, anorexia, gastrointestinal distress and fatigue, and both reported recent tick bites. Initial investigations for erhlichiosis and rickettsial diseases returned negative results, and EDTA-treated blood taken two days after hospital admission was taken for further investigation (McMullan et al. , N Engl J Med 367: 834-841, 2012). After cytopathic effect without bacterial microcolonies was observed in cell culture approximately nine days post-inoculation, a viral infection was suspected. Thin-section electron microscopy revealed enveloped particles consistent in size with those of the Bunyaviridae family. Next-generation sequencing and phylogenetic analysis confirmed the discovery of isolates of a novel bunyavirus of the genus Phlebovirus, which was subsequently named Heartland virus. HRTV is believed to be transmitted to humans by the bite of an infected Amblyomma americanum tick (Savage et al. , Am J Trop Med Hyg 89: 445-452, 2013). It causes severe disease characterized by fever, leukopenia and thrombocytopenia (McMullan et al. , N Engl J Med 367: 834-841, 2012). HRTV is closely related to severe fever with thrombocytopenia virus (SFTSV), a phlebo virus causing severe disease in China and neighboring countries (Yu et al. , N Engl J Med 364: 1523-1532, 2011.). SFTSV is also thought to be transmitted by ticks. The average case fatality rate of SFTSV infection is between 6-17% with the most severe manifestations occurring in elderly individuals (Xu et al, PLoS Pathog 7: el002369, 2011). SUMMARY
Monoclonal antibodies specific for HRTV are disclosed herein. The HRTV-specific monoclonal antibodies can be used, for example, for the diagnosis and treatment of HRTV infection.
Provided herein are isolated monoclonal antibodies specific for the nucleocapsid (Ν) protein of HRTV, or antigen-binding fragments thereof. In some embodiments, the variable heavy (VH) and variable light (VL) domains of the monoclonal antibody (or antigen-binding fragment) comprise the complementarity determining region (CDR) sequences of a monoclonal antibody disclosed herein (referred to as 2AF11, 2AG8, 2AG9, 2BA2, 2BB5, 2BB6, 2BB7, 2BB8 and 2BB 10). Also provided herein are fusion proteins comprising a disclosed monoclonal antibody (or antigen-binding fragment) and a heterologous protein; immunoconjugates comprising a disclosed monoclonal antibody (or antigen-binding fragment) and a detectable label; compositions comprising a disclosed monoclonal antibody (or antigen-binding fragment) and a pharmaceutically acceptable carrier; and compositions comprising a disclosed monoclonal antibody (or antigen- binding fragment) conjugated to a microsphere.
Further provided are methods of detecting HRTV-specific antibodies in a biological sample.
In some embodiments, the method is a microsphere immunoassay (MIA) that uses a disclosed monoclonal antibody (or antigen-binding fragment) conjugated to a microsphere. In other embodiments, the method is an indirect ELISA that uses a disclosed monoclonal antibody (or antigen-binding fragment) bound to a solid support, such as a microtiter plate. In yet other embodiments, the method is an antibody capture ELISA in which a labelled monoclonal antibody (or antigen-binding fragment) disclosed herein is used to detect immune complexes containing HRTV-specific antibodies from a biological sample. Also provided herein are methods of detecting HRTV in an isolated cell or tissue by contacting the cell or tissue with a monoclonal antibody or immunoconjugate disclosed herein and detecting binding of the monoclonal antibody or immunoconjugate to the cell or tissue.
A method of treating HRTV infection in a subject by administering to the subject a monoclonal antibody or antigen-binding fragment (or immunoconjugate thereof) disclosed herein is also provided by the present disclosure.
Further provided are nucleic acid molecules and vectors encoding a disclosed monoclonal antibody or antigen binding fragment. Isolated host cells transformed with the nucleic acid molecules and vectors are also provided.
The foregoing and other objects, features, and advantages of the invention will become more apparent from the following detailed description, which proceeds with reference to the accompanying figures. BRIEF DESCRIPTION OF THE DRAWINGS
FIG. 1 is a blot showing reactivity of pooled mouse sera from day 34 post-infection. M, low-molecular mass marker (sizes are shown in KDa); Lane 1, mouse 1; Lane 2, mouse 2.
FIG. 2 is a graph showing a comparison of IgM and IgG MIA median fluorescent intensity (MFI) versus P/N values.
FIGS. 3A-3C provide a table showing Heartland virus diagnostic comparisons.
SEQUENCE LISTING
The nucleic acid and amino acid sequences listed in the accompanying sequence listing are shown using standard letter abbreviations for nucleotide bases, and three letter code for amino acids, as defined in 37 C.F.R. 1.822. Only one strand of each nucleic acid sequence is shown, but the complementary strand is understood as included by any reference to the displayed strand. The Sequence Listing is submitted as an ASCII text file, created on January 8, 2016, 28.3 KB, which is incorporated by reference herein. In the accompanying sequence listing:
SEQ ID NOs: 1 and 2 are the nucleotide and amino acid sequences of the 2AF11 VH domain.
SEQ ID NOs: 3 and 4 are the nucleotide and amino acid sequences of the 2AF11 VL domain.
SEQ ID NOs: 5 and 6 are the nucleotide and amino acid sequences of the 2AG8 VH domain. SEQ ID NOs: 7 and 8 are the nucleotide and amino acid sequences of the 2AG8 VL domain.
SEQ ID NOs: 9 and 10 are the nucleotide and amino acid sequences of the 2AG9 VH domain.
SEQ ID NOs: 11 and 12 are the nucleotide and amino acid sequences of the 2AG9 VL domain.
SEQ ID NOs: 13 and 14 are the nucleotide and amino acid sequences of the 2BA2 VH domain.
SEQ ID NOs: 15 and 16 are the nucleotide and amino acid sequences of the 2BA2 VL domain.
SEQ ID NOs: 17 and 18 are the nucleotide and amino acid sequences of the 2BB5 VH domain.
SEQ ID NOs: 19 and 20 are the nucleotide and amino acid sequences of the 2BB5 VL domain.
SEQ ID NOs: 21 and 22 are the nucleotide and amino acid sequences of the 2BB6 VH domain.
SEQ ID NOs: 23 and 24 are the nucleotide and amino acid sequences of the 2BB6 VL domain.
SEQ ID NOs: 25 and 26 are the nucleotide and amino acid sequences of the 2BB7 VH domain.
SEQ ID NOs: 27 and 28 are the nucleotide and amino acid sequences of the 2BB7 VL domain.
SEQ ID NOs: 29 and 30 are the nucleotide and amino acid sequences of the 2BB8 VH domain.
SEQ ID NOs: 31 and 32 are the nucleotide and amino acid sequences of the 2BB8 VL domain.
SEQ ID NOs: 33 and 34 are the nucleotide and amino acid sequences of the 2BB10 VL domain.
DETAILED DESCRIPTION
I. Abbreviations
DPI days post infection
ELISA enzyme-linked immunosorbent assay
FITC fluorescein isothiocyanate hMAb human monoclonal antibody
HRTV Heartland virus
IFA immunofluorescence assay
IP intraperitoneal
LD50 lethal dose 50
LFA lateral flow assay
MAb monoclonal antibody
ME β-mercaptoethanol
MFI median fluorescent intensity
MHC major histocompatibility complex
MIA microsphere immunoassay
OD optical density
PE phycoerythrin
PFU plaque forming units
PRNT plaque reduction neutralization test
ROC receiver operator characteristic
RVFV Rift Valley fever virus
SFTSV severe fever with thrombocytopenia virus
TOSV Toscana virus
II. Terms and Methods
Unless otherwise noted, technical terms are used according to conventional usage.
Definitions of common terms in molecular biology may be found in Benjamin Lewin, Genes V, published by Oxford University Press, 1994 (ISBN 0-19-854287-9); Kendrew et al. (eds.), The Encyclopedia of Molecular Biology, published by Blackwell Science Ltd., 1994 (ISBN 0-632- 02182-9); and Robert A. Meyers (ed.), Molecular Biology and Biotechnology: a Comprehensive Desk Reference, published by VCH Publishers, Inc., 1995 (ISBN 1-56081-569-8).
In order to facilitate review of the various embodiments of the disclosure, the following explanations of specific terms are provided:
Antibody: A polypeptide ligand comprising at least a light chain or heavy chain immunoglobulin variable region which specifically recognizes and binds an epitope of an antigen. Antibodies are composed of a heavy and a light chain, each of which has a variable region, termed the variable heavy (VH) region and the variable light (VL) region. Together, the VH region and the VL region are responsible for binding the antigen recognized by the antibody. Antibodies include intact immunoglobulins and the variants and portions of antibodies well known in the art, such as Fab fragments, Fab' fragments, F(ab)'2 fragments, single chain Fv proteins ("scFv"), and disulfide stabilized Fv proteins ("dsFv"). A scFv protein is a fusion protein in which a light chain variable region of an immunoglobulin and a heavy chain variable region of an immunoglobulin are bound by a linker, while in dsFvs, the chains have been mutated to introduce a disulfide bond to stabilize the association of the chains. The term also includes genetically engineered forms such as chimeric antibodies (for example, humanized murine antibodies), heteroconjugate antibodies (such as, bispecific antibodies). See also, Pierce Catalog and
Handbook, 1994-1995 (Pierce Chemical Co., Rockford, IL); Kuby, J., Immunology, 3rd Ed., W. H. Freeman & Co., New York, 1997.
Typically, a naturally occurring immunoglobulin has heavy (H) chains and light (L) chains interconnected by disulfide bonds. There are two types of light chain, lambda (λ) and kappa (k). There are five main heavy chain classes (or isotypes) which determine the functional activity of an antibody molecule: IgM, IgD, IgG, IgA and IgE.
Each heavy and light chain contains a constant region and a variable region (the regions are also known as "domains"). In combination, the heavy and the light chain variable regions specifically bind the antigen. Light and heavy chain variable regions contain a "framework" region interrupted by three hypervariable regions, also called "complementarity-determining regions" or "CDRs." The amino acid sequence boundaries of a given CDR can be readily determined using any of a number of well-known schemes, including those described by Kabat et al. (Sequences of Proteins of Immunological Interest, U.S. Department of Health and Human Services, 1991 ; the "Kabat" numbering scheme), Chothia et al. (see Chothia and Lesk, J Mol Biol 196:901-917, 1987; Chothia et al , Nature 342:877, 1989; and Al-Lazikani et al, JMB 273,927-948, 1997; the
"Chothia" numbering scheme), and the ImMunoGeneTics (IMGT) database (see, Lefranc, Nucleic Acids Res 29:207-9, 2001 ; the "IMGT" numbering scheme). The Kabat and IMGT databases are maintained online. The sequences of the framework regions of different light or heavy chains are relatively conserved within a species, such as humans. The framework region of an antibody, that is the combined framework regions of the constituent light and heavy chains, serves to position and align the CDRs in three-dimensional space.
The CDRs are primarily responsible for binding to an epitope of an antigen. The CDRs of each chain are typically referred to as CDR1, CDR2, and CDR3, numbered sequentially starting from the N-terminus, and are often identified by the chain in which the particular CDR is located. Thus, a VH CDR3 (or HCDR3) is located in the variable domain of the heavy chain of the antibody in which it is found, whereas a VL CDRl (or LCDR1) is the CDR1 from the variable domain of the light chain of the antibody in which it is found. An antibody that binds HRTV N protein, for example, will have a specific VH region and the VL region sequence, and thus specific CDR sequences. Antibodies with different specificities (i.e. different combining sites for different antigens) have different CDRs. Although it is the CDRs that vary from antibody to antibody, only a limited number of amino acid positions within the CDRs are directly involved in antigen binding. These positions within the CDRs are called specificity determining residues (SDRs).
References to "VH" or "VH" refer to the variable region of an immunoglobulin heavy chain, including that of an Fv, scFv, dsFv or Fab. References to "VL" or "VL" refer to the variable region of an immunoglobulin light chain, including that of an Fv, scFv, dsFv or Fab.
A "monoclonal antibody" is an antibody produced by a single clone of B -lymphocytes or by a cell into which the light and heavy chain genes of a single antibody have been transfected.
Monoclonal antibodies are produced by methods known to those of skill in the art, for instance by making hybrid antibody-forming cells from a fusion of myeloma cells with immune spleen cells. Monoclonal antibodies include humanized monoclonal antibodies.
A "chimeric antibody" has framework residues from one species, such as human, and CDRs
(which generally confer antigen binding) from another species, such as a murine antibody.
A "humanized" immunoglobulin is an immunoglobulin including a human framework region and one or more complementarity determining regions (CDRs) from a non-human (for example a mouse, rat, or synthetic) immunoglobulin. The non-human immunoglobulin providing the CDRs is termed a "donor," and the human immunoglobulin providing the framework is termed an "acceptor." Generally, all parts of a humanized immunoglobulin, except possibly the CDRs, are substantially identical to corresponding parts of natural human immunoglobulin sequences. A "humanized antibody" is an antibody comprising a humanized light chain and a humanized heavy chain immunoglobulin. A humanized antibody binds to the same antigen as the donor antibody that provides the CDRs. Humanized immunoglobulins can be constructed by means of genetic engineering (see for example, U.S. Patent No. 5,585,089).
A "human" antibody (also called a "fully human" antibody) is an antibody that includes human framework regions and all of the CDRs from a human immunoglobulin. In one example, the framework and the CDRs are from the same originating human heavy and/or light chain amino acid sequence. However, frameworks from one human antibody can be engineered to include CDRs from a different human antibody. All parts of a human immunoglobulin are substantially identical to corresponding parts of natural human immunoglobulin sequences. Antigen: A compound, composition, or substance that can stimulate the production of antibodies or a T-cell response in an animal, including compositions that are injected or absorbed into an animal. An antigen reacts with the products of specific humoral or cellular immunity.
Antigen-specific: As used herein, an "antigen-specific" antibody is an antibody that was elicited (produced and/or activated) in response to a particular antigen. An "antigen-specific" antibody is capable of binding to the antigen, typically with high affinity.
Biological sample: A sample obtained from a subject (such as a human or veterinary subject). Biological samples, include, for example, fluid, cell and/or tissue samples. In some embodiments herein, the biological sample is a fluid sample. Fluid sample include, but are not limited to, serum, blood, plasma, urine, feces, saliva, cerebral spinal fluid (CSF) and
bronchoalveolar lavage (BAL) fluid.
Complementarity determining region (CDR): Amino acid sequences which together define the binding affinity and specificity of the natural Fv region of a native Ig binding site. The light and heavy chains of an Ig each have three CDRs, designated LCDR1, LCDR2, LCDR3 and HCDR1 , HCDR2 and HCDR3 , respectively.
Conjugated: Refers to two molecules that are bonded together, for example by covalent bonds.
Contacting: Placement in direct physical association; includes both in solid and liquid form. "Contacting" is often used interchangeably with "exposed." In some cases, "contacting" includes transfecting, such as transfecting a nucleic acid molecule into a cell. In other examples, "contacting" refers to incubating a molecule (such as an antibody) with a biological sample.
Control: A reference standard, for example a positive control or negative control. A positive control is known to provide a positive test result. A negative control is known to provide a negative test result. However, the reference standard can be a theoretical or computed result, for example a result obtained in a population.
Detectable label: A detectable compound or composition that is conjugated directly or indirectly to another molecule, such as an antibody, protein or microparticle, to facilitate detection of that molecule. Specific, non-limiting examples of labels include fluorescent tags, enzymatic linkages, and radioactive isotopes. In one example, a "labeled antibody" refers to incorporation of another molecule in the antibody. For example, the label is a detectable marker, such as the incorporation of a radiolabeled amino acid or attachment to a polypeptide of biotinyl moieties that can be detected by marked avidin (for example, streptavidin containing a fluorescent marker or enzymatic activity that can be detected by optical or colorimetric methods). Various methods of labeling polypeptides and glycoproteins are known in the art and may be used. Examples of labels for polypeptides include, but are not limited to, the following: radioisotopes or radionucleotides (such as 35S, nC, 13N, 150, 18F, 19F, 99mTc, 13 3H, 14C, 15N, 90Y, "Tc, i nIn and 125I), fluorescent labels (such as fluorescein isothiocyanate (FITC), rhodamine, lanthanide phosphors), enzymatic labels (such as horseradish peroxidase, beta-galactosidase, luciferase, alkaline phosphatase), chemiluminescent markers, biotinyl groups, predetermined polypeptide epitopes recognized by a secondary reporter (such as a leucine zipper pair sequences, binding sites for secondary antibodies, metal binding domains, epitope tags), or magnetic agents, such as gadolinium chelates. In some embodiments, labels are attached by spacer arms of various lengths to reduce potential steric hindrance.
Diagnostic: Identifying the presence or nature of a pathologic condition, such as a viral infection. Diagnostic methods differ in their sensitivity and specificity. The "sensitivity" of a diagnostic assay is the percentage of diseased individuals who test positive (percent of true positives). The "specificity" of a diagnostic assay is one minus the false positive rate, where the false positive rate is defined as the proportion of those without the disease who test positive. While a particular diagnostic method may not provide a definitive diagnosis of a condition, it suffices if the method provides a positive indication that aids in diagnosis.
Epitope: An antigenic determinant. Epitopes are particular chemical groups or contiguous or non-contiguous peptide sequences on a molecule that are antigenic, that is, that elicit a specific immune response. An antibody binds a particular antigenic epitope based on the three dimensional structure of the antibody and the matching (or cognate) epitope.
Fluorophore: A chemical compound, which when excited by exposure to a particular wavelength of light, emits light (i.e. , fluoresces), for example at a different wavelength.
Examples of fluorophores that may be used in the compositions and methods disclosed herein are provided in U.S. Patent No. 5,866,366 to Nazarenko et al. : 4-acetamido-4'- isothiocyanatostilbene-2,2'disulfonic acid, acridine and derivatives such as acridine and acridine isothiocyanate, 5-(2'-aminoethyl)aminonaphthalene-l -sulfonic acid (EDANS), 4-amino-N-[3- vinylsulfonyl)phenyl]naphthalimide-3,5 disulfonate (Lucifer Yellow VS), N-(4-anilino-l- naphthyl)maleimide, anthranilamide, Brilliant Yellow, coumarin and derivatives such as coumarin, 7-amino-4-methylcoumarin (AMC, Coumarin 120), 7-amino-4-trifluoromethylcouluarin (Coumarin 151); cyanosine; 4',6-diaminidino-2-phenylindole (DAPI); 5', 5"-dibromopyrogallol- sulfonephthalein (Bromopyrogallol Red); 7-diethylamino-3-(4'-isothiocyanatophenyl)-4- methylcoumarin; diethylenetriamine pentaacetate; 4,4'-diisothiocyanatodihydro-stilbene-2,2'- disulfonic acid; 4,4'-diisothiocyanatostilbene-2,2'-disulfonic acid; 5-[dimethylamino]naphthalene- 1-sulfonyl chloride (DNS, dansyl chloride); 4-(4'-dimethylaminophenylazo)benzoic acid (DABCYL); 4-dimethylaminophenylazophenyl-4'-isothiocyanate (DABITC); eosin and derivatives such as eosin and eosin isothiocyanate; erythrosin and derivatives such as erythrosin B and erythrosin isothiocyanate; ethidium; fluorescein and derivatives such as 5-carboxyfluorescein (FAM), 5-(4,6-dichlorotriazin-2-yl)aminofluorescein (DTAF), 2'7'-dimethoxy-4'5'-dichloro-6- carboxyfluorescein (JOE), fluorescein, fluorescein isothiocyanate (FITC), and QFITC (XRITC); fluorescamine; IR144; IR1446; Malachite Green isothiocyanate; 4-methylumbelliferone; ortho cresolphthalein; nitrotyrosine; pararosaniline; Phenol Red; B-phycoerythrin; R-phycoerythrin; o- phthaldialdehyde; pyrene and derivatives such as pyrene, pyrene butyrate and succinimidyl 1- pyrene butyrate; Reactive Red 4 (Cibacron .RTM. Brilliant Red 3B-A); rhodamine and derivatives such as 6-carboxy-X-rhodamine (ROX), 6-carboxyrhodamine (R6G), lissamine rhodamine B sulfonyl chloride, rhodamine (Rhod), rhodamine B, rhodamine 123, rhodamine X isothiocyanate, sulforhodamine B, sulforhodamine 101 and sulfonyl chloride derivative of sulforhodamine 101 (Texas Red); N,N,N',N'-tetramethyl-6-carboxyrhodamine (TAMRA); tetramethyl rhodamine; tetramethyl rhodamine isothiocyanate (TRITC); riboflavin; rosolic acid and terbium chelate derivatives.
Other suitable fluorophores include thiol-reactive europium chelates which emit at approximately 617 nm (Heyduk and Heyduk, Analyt. Biochem. 248:216-27, 1997; /. Biol. Chem. 274:3315-22, 1999).
Other suitable fluorophores include GFP, Lissamine™, diethylaminocoumarin, fluorescein chlorotriazinyl, naphthofluorescein, 4,7-dichlororhodamine and xanthene (as described in U.S. Patent No. 5,800,996 to Lee et al.) and derivatives thereof. Other fluorophores known to those skilled in the art may also be used.
Framework region: Amino acid sequences of an antibody that are interposed between CDRs. Framework regions include variable light and variable heavy framework regions. The framework regions serve to hold the CDRs in an appropriate orientation for antigen binding.
Fusion protein: A protein containing amino acid sequence from at least two different (heterologous) proteins or peptides. Fusion proteins can be generated, for example, by expression of a nucleic acid sequence engineered from nucleic acid sequences encoding at least a portion of two different (heterologous) proteins. To create a fusion protein, the nucleic acid sequences must be in the same reading frame and contain no internal stop codons. Fusion proteins, particularly short fusion proteins, can also be generated by chemical synthesis.
Heartland virus (HRTV): A member of the Phlebovirus genus in the family
Bunyaviridae . HRTV has a single- stranded RNA genome consisting of three genome segments - small (S), medium (M) and large (L). The nucleocapsid (N) protein of HRTV is encoded by the S segment. For other phlebo viruses, the N protein has been shown to be immunodominant viral protein. HRTV was first isolated from two Missouri farmers in 2009 (McMullan et al. , N Engl J Med 367: 834-841, 2012; PCT Publication No. 2013/142808). Infection with HRTV is
characterized by symptoms of fever, headache, anorexia, gastrointestinal distress and fatigue.
HRTV is transmitted by ticks.
Heterologous: A heterologous protein or polypeptide refers to a protein or polypeptide derived from a different source or species.
Hybridoma: A cell line or culture that secretes a homogenous population of monoclonal antibodies. Hybridomas are hybrid cells resulting from the fusion of a myeloma (tumor cell), which confers immortality, and an antibody-producing cell, which confers antibody specificity onto the hybridoma.
Immune complex: A protein complex that comprises an antibody bound to an antigen. In the context of the present disclosure, the term "immune complex" is used to indicate a protein complex that includes an antigen bound to two separate antigen-specific antibodies (each binding a different epitope of the antigen), whereas the term "antibody-antigen complex" is used to refer to an antigen bound to one antibody. Furthermore, the term "antibody-antibody complex" is used to refer to an antibody bound to a different antibody (such as an antigen- specific antibody bound to a secondary antibody). The term "microsphere immune complex" is used to indicate an immune complex conjugated to a microsphere.
Immunoconjugate: A covalent linkage of an effector molecule to an antibody or
functional fragment thereof. The effector molecule can be, for example, a detectable label or an immunotoxin. The term "conjugated" or "linked" refers to making two polypeptides into one contiguous polypeptide molecule. In one embodiment, an antibody is joined to an effector
molecule. In another embodiment, an antibody joined to an effector molecule is further joined to a lipid or other molecule to a protein or peptide to increase its half-life in the body. The linkage can be either by chemical or recombinant means. In one embodiment, the linkage is chemical, wherein a reaction between the antibody moiety and the effector molecule has produced a covalent bond formed between the two molecules to form one molecule. A peptide linker (short peptide
sequence) can optionally be included between the antibody and the effector molecule. Because immunoconjugates were originally prepared from two molecules with separate functionalities, such as an antibody and an effector molecule, they are also sometimes referred to as "chimeric
molecules."
Isolated: An "isolated" biological component (such as a nucleic acid, protein, antibody, antigen or virus) has been substantially separated or purified away from other biological components (such as cell debris, or other proteins or nucleic acids). Biological components that have been "isolated" include those components purified by standard purification methods. The term also embraces recombinant nucleic acids, proteins or viruses, as well as chemically synthesized nucleic acids or peptides.
Microparticle/microsphere: A particle that is generally about 0.01 to about 1000 microns in diameter. Microparticles include microspheres (spherical microparticles), beads, or the like with a surface suitable for binding (e.g. , suitable for binding an antibody). For example, a microparticle can be a microsphere with a carboxylated surface. In some embodiments, the microparticles are polymeric microparticles (a microparticle made up of repeating subunits of a particular substance or substances). In some examples, the polymeric microparticles are polystyrene microparticles, such as a polystyrene microparticle with a carboxylated surface. Microspheres or beads for use in flow cytometry and flow instrumentation are well known in the art and are commercially available from a variety of sources.
Operably linked: A first nucleic acid sequence is operably linked with a second nucleic acid sequence when the first nucleic acid sequence is placed in a functional relationship with the second nucleic acid sequence. For instance, a promoter is operably linked to a coding sequence if the promoter affects the transcription or expression of the coding sequence. Generally, operably linked DNA sequences are contiguous and, where necessary to join two protein-coding regions, in the same reading frame.
Pharmaceutically acceptable carriers: The pharmaceutically acceptable carriers of use are conventional. Remington's Pharmaceutical Sciences, by E.W. Martin, Mack Publishing Co., Easton, PA, 15th Edition, 1975, describes compositions and formulations suitable for
pharmaceutical delivery of the antibodies and conjugates disclosed herein.
In general, the nature of the carrier will depend on the particular mode of administration being employed. For instance, parenteral formulations usually comprise injectable fluids that include pharmaceutically and physiologically acceptable fluids such as water, physiological saline, balanced salt solutions, aqueous dextrose, glycerol or the like as a vehicle. For solid compositions (such as powder, pill, tablet, or capsule forms), conventional non-toxic solid carriers can include, for example, pharmaceutical grades of mannitol, lactose, starch, or magnesium stearate. In addition to biologically neutral carriers, pharmaceutical compositions to be administered can contain minor amounts of non-toxic auxiliary substances, such as wetting or emulsifying agents, preservatives, and pH buffering agents and the like, for example sodium acetate or sorbitan monolaurate.
Preventing, treating or ameliorating a disease: "Preventing" a disease refers to
inhibiting the full development of a disease. "Treating" refers to a therapeutic intervention that ameliorates a sign or symptom of a disease or pathological condition after it has begun to develop, such as a reduction in viral load. "Ameliorating" refers to the reduction in the number or severity of signs or symptoms of a disease, such as an infectious disease.
Phlebovirus: One of five genera of the Bunyaviridae family. Phlebo viruses are enveloped spherical viruses with icosahedral symmetry. The genome of phleboviruses consists of three single-stranded RNA genome segments - small (S), medium (M) and large (L). The M and L segments are negative sense RNA strands, while the S segment is ambisense RNA. The S segment encodes the non-structural protein NSs in the positive sense orientation and the nucleocapsid (N) in the negative sense orientation. The M segment encodes the glycoprotein precursor that is cleaved by host proteases into two structural domains - Gn and Gc. The L segment encodes the L protein, which functions as the RNA dependent RNA polymerase in primary and secondary transcription to generate mRNA and replicative intermediates, respectively. Phleboviruses have a worldwide distribution and are transmitted by a wide variety of arthropods, including sandflies, mosquitoes and ticks. Several phleboviruses have been linked to human disease, in some cases causing febrile illness, fever, hepatitis, meningitis, encephalitis or hemorrhagic syndrome.
Secondary antibody: An antibody that specifically recognizes the Fc region of a particular isotype of antibody (for example specifically recognizes human IgG or human IgM). Secondary antibodies for use with the methods disclosed herein include, but are not limited to, anti -human IgG and anti-human IgM. In some embodiments herein, the secondary antibody is conjugated to a detectable label, such as a fluorophore, enzyme or radioisotope, to facilitate detection of immune complexes to which the secondary antibody is bound.
Sequence identity: The similarity between amino acid or nucleic acid sequences is expressed in terms of the similarity between the sequences, otherwise referred to as sequence identity. Sequence identity is frequently measured in terms of percentage identity (or similarity or homology); the higher the percentage, the more similar the two sequences are. Homologs or variants of a polypeptide or nucleic acid molecule will possess a relatively high degree of sequence identity when aligned using standard methods.
Methods of alignment of sequences for comparison are well known in the art. Various programs and alignment algorithms are described in: Smith and Waterman, Adv. Appl. Math. 2:482, 1981; Needleman and Wunsch, /. Mol. Biol. 48:443, 1970; Pearson and Lipman, Proc. Natl. Acad. Sci. U.S.A. 85:2444, 1988; Higgins and Sharp, Gene 73:237, 1988; Higgins and Sharp, CABIOS 5: 151, 1989; Corpet et al. , Nucleic Acids Research 16: 10881, 1988; and Pearson and Lipman, Proc. Natl. Acad. Sci. U.S.A. 85:2444, 1988. Altschul et al. , Nature Genet. 6: 119, 1994, presents a detailed consideration of sequence alignment methods and homology calculations. The NCBI Basic Local Alignment Search Tool (BLAST) (Altschul et al, J. Mol. Biol.
215:403, 1990) is available from several sources, including the National Center for Biotechnology Information (NCBI, Bethesda, MD) and on the internet, for use in connection with the sequence analysis programs blastp, blastn, blastx, tblastn and tblastx. A description of how to determine sequence identity using this program is available on the NCBI website on the internet.
Homologs and variants of a VL or a VH of an antibody that specifically binds the HRTV N protein or a fragment thereof are typically characterized by possession of at least about 75%, for example at least about 80%, 90%, 95%, 96%, 97%, 98% or 99% sequence identity counted over the full length alignment with the amino acid sequence of the antibody using the NCBI Blast 2.0, gapped blastp set to default parameters. For comparisons of amino acid sequences of greater than about 30 amino acids, the Blast 2 sequences function is employed using the default BLOSUM62 matrix set to default parameters, (gap existence cost of 11, and a per residue gap cost of 1). When aligning short peptides (fewer than around 30 amino acids), the alignment should be performed using the Blast 2 sequences function, employing the PAM30 matrix set to default parameters (open gap 9, extension gap 1 penalties). Proteins with even greater similarity to the reference sequences will show increasing percentage identities when assessed by this method, such as at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, or at least 99% sequence identity. When less than the entire sequence is being compared for sequence identity, homologs and variants will typically possess at least 80% sequence identity over short windows of 10-20 amino acids, and may possess sequence identities of at least 85% or at least 90% or 95% depending on their similarity to the reference sequence. Methods for determining sequence identity over such short windows are available at the NCBI website on the internet. One of skill in the art will appreciate that these sequence identity ranges are provided for guidance only; it is entirely possible that strongly significant homologs could be obtained that fall outside of the ranges provided.
Serum: The fluid portion of the blood that separates out from clotted blood. Serum contains many proteins, including antibodies, but does not contain clotting factors.
Subject: Living multi-cellular vertebrate organisms, a category that includes both human and non-human mammals.
Vector: A nucleic acid molecule as introduced into a host cell, thereby producing a transformed host cell. A vector may include nucleic acid sequences that permit it to replicate in a host cell, such as an origin of replication. A vector may also include one or more selectable marker genes and other genetic elements known in the art. Unless otherwise explained, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this disclosure belongs. The singular terms "a," "an," and "the" include plural referents unless context clearly indicates otherwise. "Comprising A or B" means including A, or B, or A and B. It is further to be understood that all base sizes or amino acid sizes, and all molecular weight or molecular mass values, given for nucleic acids or polypeptides are approximate, and are provided for description. Although methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present disclosure, suitable methods and materials are described below. All publications, patent applications, patents, and other references mentioned herein are incorporated by reference in their entirety. In case of conflict, the present specification, including explanations of terms, will control. In addition, the materials, methods, and examples are illustrative only and not intended to be limiting.
III. Introduction
Heartland virus was first isolated from human leucocytes after two unrelated Missouri farmers were hospitalized in 2009. Next-generation sequencing and phylogenetic analysis confirmed the discovery of isolates of a novel bunyavirus of the genus Phlebovirus, which was subsequently named Heartland virus (HRTV). A subsequent field investigation resulted in the isolation of HRTV from Amblyomma americanum ticks. Therefore, a need surfaced for rapid and reliable serological assays to identify infection in patients.
In order to expand the diagnostic capabilities for detection of HRTV infection, twenty hybridoma clones secreting anti-HRTV murine monoclonal antibodies (MAbs) were developed using splenocytes from HRTV infected-AG129 receptor-interferon deficient mice. Nine of these MAbs were characterized for inclusion in HRTV diagnostic assays. All of the MAbs developed were found to be non-neutralizing and reactive to linear epitopes on HRTV nucleocapsid (N) protein. MAb 2AF11 was found to be cross-reactive with SFTSV.
In addition, microsphere assays were developed as a means of serological detection of both IgM and IgG antibodies in patient sera. HRTV antigens were captured by monoclonal antibodies covalently bound to microspheres, thus allowing for non-purified antigen preparations to be used. Antibodies in human sera from previously confirmed HRTV positive and negative cases were reacted with the microsphere complexes and detected by anti-human IgM or IgG antibodies coupled to phycoerythrin. Reactions were quantified using a BioPlex instrument. Cutoffs were determined by receiver operator characteristic (ROC) analysis, and the sensitivities, specificities and accuracies of the IgM and IgG microsphere immunoassays (MIA) were all >97% as determined by a bootstrap method. Within-plate precision ranged from 12-15% and between-plate precisions ranged from 7-18%. No cross-reactivity with other arboviruses was observed.
IV. Overview of Several Embodiments
Disclosed herein are monoclonal antibodies that specifically bind the N protein of HRTV.
The HRTV N protein- specific monoclonal antibodies can be used in immunoassays to detect HRTV-specific antibodies in a biological sample or to detect HRTV in a cell or tissue sample. The monoclonal antibodies can also be used, for example, to diagnose or treat an HRTV infection.
The nucleotide and amino acid sequences of the variable heavy (VH) and variable light (VL) domains of the disclosed antibodies are provided below. In the amino acid sequences, the CDR sequences as determined by IMGT are underlined and the CDR sequences as determined by Kabat are shown in bold. The nucleotide positions and amino acid residues of the VL and VH domain CDRs are provided below each sequence. One of skill in the art could readily determine the CDR boundaries using alternative numbering schemes, such as the Chothia numbering scheme.
2AF11 VH DNA sequence (SEQ ID NO: 1)
CAGGTTACTCTGAAAGAGTCTGGCCCTGGGATATTGCAGCCCTCCCAGACCCTCAGTCTGACTT GTTCTTTCTCTGGGTTTTCACTGAGCACTTCTGGTATGAGTGTAGGCTGGATTCGTCAGCCTTCA GGGAAGGGTCTGGAGTGGCTGGCACACATTTGGTGGAATGATGATATGTACTATAACCCAGCC CTGGAAAGCCGGCTCACAATCTCCAAGGATACCTCCAACAACCAGGTTTTCCTCAAGATCGCC AGTGTGGTCACTGCAGATACTGCCACATACTACTGTGCTCGAATAGCCCTAACTGGGCCCTACT GGTACTTCGATGTCTGGGGCGCAGGGACCACGGTCACCGTCTCCTCAGCCAAAACAACAGCCC CATCGGTCTATCCACTGGCCCCTGTGTGTGGAGATACAACTGGCTCCTCGGTGACTCTAGGATG CCTGGTCAAGGCTAGCATCCGAAT
2AF11 VH amino acid sequence (SEQ ID NO: 2)
OVTLKESGPGILOPSOTLSLTCSFSGFSLSTSGMSVGWIROPSGKGLEWLAHIWWNDDMYYNPAL
ESRLTISKDTSNNOVFLKIASVVTADTATYYCARIALTGPYWYFDVWGAGTTVTVSSAKTTAPSV
YPLAPVCGDTTGSSVTLGCLVK
Locations of CDRs in 2AF11 VH sequence (according to Kabat)
Figure imgf000017_0001
Locations of CDRs in 2AF11 VH sequence (according to IMGT)
Figure imgf000018_0001
2AF11 VL DNA sequence (SEQ ID NO: 3)
GACATTGTGATGACCCAGACTCCAGCCTCCCTATCTGCATCTGTGGGAGAAACTGTCACCATCA CATGTCGAGCAAGTGAGAATATTTACAGTTATTTAGCATGGTATCAGCAGAAACAGGGAAAAT CTCCTCAGCTCCTGGTCAATAATGCAAAAACCTTAGCAGAAGGTGTGCCATCAAGGTTCAGTG GCAGTGGTTCAGGCACACAGTTTTCTCTGAAGATCAACAGCCTGCAGCCTGAAGATTGTGGGA ATTATTACTGTCAACATCATTATGGCACTCCGCTCACGTTCGGTGCTGGGACCAAGCTGGAGCT GAAA
2AF11 VL amino acid sequence (SEQ ID NO: 4)
DIVMTOTPASLSASVGETVTITCRASENIYSYLAWYOOKOGKSPOLLVNNAKTLAEGVPSRFSGSG SGTOFSLKINSLOPEDCGNYYCOHHYGTPLTFGAGTKLELK Locations of CDRs in 2AF11 VL sequence (according to Kabat)
Figure imgf000018_0002
Locations of CDRs in 2AF11 VL sequence (according to IMGT)
Figure imgf000018_0003
2AG8 VH DNA sequence (SEQ ID NO: 5)
GAAGTGCAGCTGGAGGAGTCTGGGGCTGAACTGGTGAGGTCTGGGGCCTCACTGAAGATGTCC TGCAAGGCTTCTGGCTACACATTTACCAGTTACAATCTGCACTGGGTTAAGCAGACACCAGGAC AGGGCCTGGAATGGATTGGATATATTTTTCCTGGAAATGGTGGTACTGCCTACAATGAGAAGTT CAAGGGCAAGGCCACATTGACTGCAGACACATCCTCCTCCACAGCCTACATGCAGATCAGCAG CCTGACATCTGAGGACTCTGCGGTCTATTTCTGTGCAAGAGGGGGCCCTTACTATGCTTTGGAC TACTGGGGTCAAGGAACCTCAGTCACCGTCTCCTCA 2AG8 VH amino acid sequence (SEQ ID NO: 6)
VKLEESGAELVRSGASLKMSCKASGYTFTSYNLHWVKOTPGOGLEWIGYIFPGNGGTAYNEKFK GKATLT ADTS S STAYMOIS S LTSEDS AV YFC ARGGP Y YALD YWGOGTS VTVS S
Locations of CDRs in 2AG8 VH sequence (according to Kabat)
Figure imgf000019_0001
Locations of CDRs in 2AG8 VH sequence (according to IMGT)
Figure imgf000019_0002
2AG8 VL DNA sequence (SEQ ID NO: 7)
GACATTGTGATGACCCAGTCTCCAGCCTCCCTATCTGCATCTGTGGGAGAAACTGTCACCATCA CATGTCGAACAAGTGGGAATATTCACACTTATTTAGCATGGTATCAGCACAAACAGGGAAAAT CTCCTCAGCTCCTGGTCTATTATGCAAAAACCTTAGCAGATGGTGTGCCATCAAGGTTCAGTGG CAGTGGATCAGGAACACAATATTCTCTCAAGATCAACAGCCTGCAGCCTGAAGATTTTGGGAG TTATTACTGTCAACATTTTTGGAGTAATCCTCGGACGTTCGGTGGAGGCACCAAGCTGGAAATC AAA
2AG8 VL amino acid sequence (SEQ ID NO: 8)
DIVMTOSPASLSASVGETVTITCRTSGNIHTYLAWYOHKOGKSPOLLVYYAKTLADGVPSRFSGS GSGTOYSLKINSLQPEDFGSYYCQHFWSNPRTFGGGTKLEIKRADAAPTVS
Locations of CDRs in 2AG8 VL sequence (according to Kabat)
Figure imgf000019_0003
Locations of CDRs in 2AG8 VL sequence (according to IMGT)
Figure imgf000020_0001
2AG9 VH DNA sequence (SEQ ID NO: 9)
GAACTGGCAAGACCTGGGGCTTCAGTGAAGTTGTCCTGCAAGGCTTCTGGCTACACCTTTACTA ATTACTATATGCAGTGGATAAAACAGCGGCCTGGACAGGGTCTGGAGTGGATTGGGGCTGTTT ATCCTGGAGATGGTGATACTAGGTACACTCAGAAGTTCAAGGGCAAGGCCTCATTGACTGCAG ATAAATCCTCCACCACAGCCTATATGCAACTCAGCAGCTTGGCATCTGAGGACTCTGCGGTCTA TTACTGTACAAGGGGAGATTACGAGGGAACCTGGTTTACTTACTGGGGCCAAGGGACTCTGGT CACTGTCTCTGCA
2AG9 VH amino acid sequence (SEQ ID NO: 10)
ELARPGASVKLSCKASGYTFTNYYMOWIKORPGOGLEWIGAVYPGDGDTRYTOKFKGKASLTA DKSSTTAYMOLSSLASEDSAVYYCTRGDYEGTWFTYWGOGTLVTVSA
Locations of CDRs in 2AG9 VH sequence (according to Kabat)
Figure imgf000020_0002
Locations of CDRs in 2AG9 VH sequence (according to IMGT)
Figure imgf000020_0003
2AG9 VL DNA sequence (SEQ ID NO: 11)
GATATTGTGATGACCCAGACTCCAGCAATCATGTCTGCATCTCCAGGGGAGAAGGTCACCATG
ACCTGCAGTGCCAGCTCAAGTGTAAGTTACATGCACTGGTACCAGCAGAAGTCAGGCACCTCC
CCCAAAAGATGGATGTATGACACATCCAAACTGGCTTCTGGAGTCCCTGGTCGCTTCAGTGGCA
GTGGGTCTGGGACCACTTACTCTCTCACAATCAGCACCATGGAGGCTGAAGATGCTGCCACCTA
TTACTGCCAGCAGTGGAGTAGTAACCCACCCACGTTCGGGGGGGGGACCAAGCTGGAAATAAA
A 2AG9 VL amino acid sequence (SEQ ID NO: 12)
DIVMTOTTAIMSASPGEKVTMTCSASSSVSYMHWYOOKSGTSPKRWMYDTSKLASGVPGRFSGS GSGTTYSLTISTMEAEDAATYYCOOWSSNPPTFGGGTKLEIK
Locations of CDRs in 2AG9 VL sequence (according to Kabat)
Figure imgf000021_0001
Locations of CDRs in 2AG9 VL sequence (according to IMGT)
Figure imgf000021_0002
2BA2 VH DNA sequence (SEQ ID NO: 13)
GTGCAGCTGCAGGAGTCGGGACCTGGCCTCGTGAAACCTTCGCAGCCTCTGTCTCTCACCTGCT CTGTCACTGGCTACTCCATTACCAGTGCTTATTACTGGAACTGGATCCGGCAGTTTCCAGGAAA CAAACTGGAATGGATGGGATACATAACCTACGACGGTACCAATAACTACAACCCATCTCTCAA AAATCGAATCTCCATCACTCGTGACACATCTAAGAACCAGTTTTTCCTGAAGTTGAATTCTGTG ACTACTGAGGACACAGCTTCATATTACTGTGCAAGAGATGTTGCTACGGTCGGTGCTATGGACT ACTGGGGTCAAGGAACCTCAGTCACCGTCTCCTCA
2BA2 VH amino acid sequence (SEQ ID NO: 14)
VOLOESGPGLVKPSOPLSLTCSVTGYSITSAYYWNWIROFPGNKLEWMGYITYDGTNNYNPSLKN RISITRDTSKNOFFLKLNSVTTEDTASYYCARDVATVGAMDYWGOGTSVTVSS
Locations of CDRs in 2BA2 VH sequence (according to Kabat)
Figure imgf000021_0003
Locations of CDRs in 2BA2 VH sequence (according to IMGT)
Figure imgf000022_0001
2BA2 VL DNA sequence (SEQ ID NO: 15)
AGTATTGTGATGACCCAGACTCCCAAATTCCTGCTTGTATCAGCAGGAGACAGGGTTACCATAA CCTGCAAGGCCAGTCAGAGTGTGAGTAATGATGTAGCTTGGTACCAACAGAAGCCAGGGCAGT CTCCTAAACTGCTGATATACTTTGCATCCAATCGCTACACTGGAGTCCCTGATCGCTTCACTGG CAGTGGATATGGGACGGATTTCACTTTCACCATCAGCACTGTGCTGGCTGAAGACCTGGCACTT TATTTCTGTCAGCAGGATTATAGCTCTCCTCGGACGTTCGGTGGAGGCACCAAACTGGAAGTCA AA
2BA2 VL amino acid sequence (SEQ ID NO: 16)
SIVMTOTPKFLLVSAGDRVTITCKASOSVSNDVAWYOOKPGOSPKLLIYFASNRYTGVPDRFTGSG YGTDFTFTISTVLAEDLALYFCOODYSSPRTFGGGTKLEVK
Locations of CDRs in 2BA2 VL sequence (according to Kabat)
Figure imgf000022_0002
2BB5 VH DNA sequence (SEQ ID NO: 17)
GAGGTGCAGCTGGAGGAGTCAGGAGGAGGCTTGGTGCAACCTGGAGGATCCATGAAACTCTCC TGTGTTGCCTCTGGATTCACTTTCAGTAACTACTGGATGAACTGGGTCCGCCAGTCTCCAGAGA AGGGGCTTGAGTGGGTTGCTGAAGTTAGATTGAATTCTAATAATTATGCAACACATTATGCGGA GTCTGTGAAAGGGAGGTTCACCATCTCAAGAGATGATTCCAAAAGTAGTGTCTACCTGCAAAT GAGCAACTTAAGATCTGAAGACACTGGCATTTATTATTGTTCCACCGATTATTACGGCTATGCT ATGGACTACTGGGGTCAAGGAACCTCAGTCACCGTCTCCTCA 2BB5 VH amino acid sequence (SEQ ID NO: 18)
EVOLEESGGGLVOPGGSMKLSCVASGFTFSNYWMNWVROSPEKGLEWVAEVRLNSNNYATHYA ESVKGRFTISRDDSKSSVYLOMSNLRSEDTGIYYCSTDYYGYAMDYWGOGTSVTVSS
Locations of CDRs in 2BB5 VH sequence (according to Kabat)
Figure imgf000023_0001
2BB5 VL DNA sequence (SEQ ID NO: 19)
GATATTGTGATGACCCAGACTCCATCAATCATGTCTGCATCTCCAGGGGAGAAGGTCACCATA ACCTGCAGTGCCAGCTCTAATGTAAATTACATGCACTGGTTCCAGCAGAAGCCAGGCACTTCTC CCAAACTCTGGATTTATAGCACATCCAACCTGGCTTCTGGAGTCCCTGCTCGCTTCAGTGGCAG TGGATCTGGGACCTCTTACTCTCTCACAATCAGCCGAATGGAGGCTGAAGATGCTGCCACTTAT TACTGCCAGCAAAGGAGTAATTACCCACCCACGTTCGGTGCTGGGACCAAGCTGGAGCTGAAA
2BB5 VL amino acid sequence (SEQ ID NO: 20)
DIVMTQTPSIMSASPGEKVTITCSASSNVNYMHWFQQKPGTSPKLWIYSTSNLASGVPARFSGSGSG TSYSLTISRMEAEDAATYYCOORSNYPPTFGAGTKLELK
Locations of CDRs in 2BB5 VL sequence (according to Kabat)
CDR DNA Sequence Protein Sequence
CDR1 Nucleotides 70-99 Amino acids 24-33
CDR2 Nucleotides 145-165 Amino acids 49-55
CDR3 Nucleotides 262-288 Amino acids 88-96
Locations of CDRs in 2BB5 VL sequence (according to IMGT)
CDR DNA Sequence Protein Sequence
CDR1 Nucleotides 79-93 Amino acids 27-31 CDR DNA Sequence Protein Sequence
CDR2 Nucleotides 145-153 Amino acids 49-51
CDR3 Nucleotides 262-288 Amino acids 88-96
2BB6 VH DNA sequence (SEQ ID NO: 21)
GAGGTTCAGCTGGAGGAGTCAGGACCTGACCTGGTGAAACCTTCTCAGTCACTTTCACTCACCT GCACTGTCACTGGCTTCTCCATCACCAGTGGTTATAGTTGGCACTGGATCCGGCAATTTCCAGG AAACAAACTGGAATGGATGGGCTACATACACTTCAGTGGTAGCACGAACTACAACCCATCTCT CAAAAGTCGAATCTCTATCACTCGAGACACATCCAAGAACCAGTTCTTCCTGCAGTTGAGTTCT GTGACTACTGACGACACAGGCACATATTACTGTGCAAGAGATCTGACTGGGATTGACTCCTGG GGCCAAGGCACCACTCTCACAGTCTCCTCA 2BB6 VH amino acid sequence (SEQ ID NO: 22)
EVOLEESGPDLVKPSOSLSLTCTVTGFSITSGYSWHWIROFPGNKLEWMGYIHFSGSTNYNPSLKS RISITRDTSKNQFFLQLSSVTTDDTGTYYCARDLTGIDSWGQGTTLTVSS
Locations of CDRs in 2BB6 VH sequence (according to Kabat)
Figure imgf000024_0001
2BB6 VL DNA sequence (SEQ ID NO: 23)
GATATTGTGATGACACAGACTCCAGCAATCATGTCTGCATCTCCAGGGGAGAAGGTCACCATA TCCTGCAGTGCCAGCTCAAGTGTAAGTTACATGTACTGGTTCCAGCAGAAGCCAGGATCCTCCC CCAAACCCTGGATTTATCGCACATCCAACCTGGCTTCTGGAGTCCCTGCTCGCTTCAGTGGCAG TGGGTCTGGGACCTCTTACTCTGTCACAATCAGCAGCATGGAGGCTGAAGATGCTGCCACTTAT TACTGCCAGCAGTATCATAGTTACCCACTCACGTTCGGTGCTGGGACCAAGCTGGAGCTGAAA
2BB6 VL amino acid sequence (SEQ ID NO: 24)
DIVMTOTPAIMSASPGEKVTISCSASSSVSYMYWFOOKPGSSPKPWIYRTSNLASGVPARFSGSGSG TSYSVTISSMEAEDAATYYCOOYHSYPLTFGAGTKLELK Locations of CDRs in 2BB6 VL sequence (according to Kabat)
Figure imgf000025_0001
2BB7 VH DNA sequence (SEQ ID NO: 25)
GAGGTCCAGCTGCAACAGTCTGGACCTGACCTGGTGAAGCCTGGAGCTTCAATGAAGATATCC TGCAAGGCTTCTGGTTACTCATTCACTGCCTACACCATGAACTGGGTGAAGCAGAGCCATGGA AAGAACCTTGAGTGGATTGGACTTATTAGTCCTTACAATGGTGGTACTAGTTACAACCAGAAGT TCAAGGGCAAGGCCACATTAACTGTAGACAAGTCATCCAGCACAGCCTACATGGAGCTCCTCA GTCTGACATCTGAGGACTCTGCAGTCTATTACTGTGCAAGACAGATCGGGCCTTACTTTGACCA TTGGGGCCAAGGCACCACTCTCACAGTCTCCTCA
2BB7 VH amino acid sequence (SEQ ID NO: 26)
EVOLOOSGPDLVKPGASMKISCKASGYSFTAYTMNWVKOSHGKNLEWIGLISPYNGGTSYNOKF KGKATLTVDKSSSTAYMELLSLTSEDSAVYYCAROIGPYFDHWGOGTTLTVSS
Locations of CDRs in 2BB7 VH sequence (according to Kabat)
Figure imgf000025_0002
2BB7 VL DNA sequence (SEQ ID NO: 27)
GACATTGTGATGACCCAGACTCCATCTTCCATGTATGCATCTCTAGGAGAGAGAGTCACTATCA CTTGCAAGGCGAGTCAGGACATTAAAAGCTCTTTTAGTTGGTTCCAGCAGAAACCAGGGAAAT CTCCTAAGACCCTGATCTATCGTGCAAGCAGATTGGTAGATGGGGTCCCATCAAGGTTCAGTGG CAGTGGATCTGGGCAAGATTCTTCTCTCACCATCAGCAGCCTGGAGTATGAAGATATGGGAATT TATTATTGTCTACAGTGTGATGAGTTTCCGTACACGTTCGGAGGGGGGACCAAGCTGGAAATA AAA
2BB7 VL amino acid sequence (SEQ ID NO: 28)
DIVMTOTTPSSMYASLGERVTITCKASODIKSSFSWFOOKPGKSPKTLIYRASRLVDGVPSRFSGSG SGQDS S LTIS SLE YEDMGIY YCLQCDEFP YTFGGGTKLEIK
Locations of CDRs in 2BB7 VL sequence (according to Kabat)
Figure imgf000026_0001
2BB8 VH DNA sequence (SEQ ID NO: 29)
CAGGCTTATCTACAGCAGTCTGGGGCTGAACTGGTGAGGTCTGGGGCCTCACTGAAGATGTCCT GCAAGGCTTCTGGCTACACATTTACCAGTTACAATCTGCACTGGGTTAAGCAGACACCAGGAC AGGGCCTGGAATGGATTGGATATATTTTTCCTGGAAATGGTGGTACTGCCTACAATGAGAAGTT CAAGGGCAAGGCCACATTGACTGCAGACACATCCTCCTCCACAGCCTACATGCAGATCAGCAG CCTGACATCTGAGGACTCTGCGGTCTATTTCTGTGCAAGAGGGGGCCCTTACTATGCTTTGGAC TACTGGGGTCAAGGAACCTCAGTCACCGTCTCCTCAG 2BB8 VH amino acid sequence (SEQ ID NO: 30)
OAYLOOSGAELVRSGASLKMSCKASGYTFTSYNLHWVKOTPGOGLEWIGYIFPGNGGTAYNEKF KGKATLTADTSSSTAYMOISSLTSEDSAVYFCARGGPYYALDYWGOGTSVTVSS Locations of CDRs in 2BB8 VH sequence (according to Kabat)
Figure imgf000027_0001
2BB8 VL DNA sequence (SEQ ID NO: 31)
GACATCCAGATGACTCAGTCTCCAGCCTCCCTATCTGCATCTGTGGGAGAAACTGTCACCATCA CATGTCGAACAAGTGGGAATATTCACACTTATTTAGCATGGTATCAGCACAAACAGGGAAAAT CTCCTCAGCTCCTGGTCTATTATGCAAAAACCTTAGCAGATGGTGTGCCATCAAGGTTCAGTGG CAGTGGATCAGGAACACAATATTCTCTCAAGATCAACAGCCTGCAGCCTGAAGATTTTGGGAG TTATTACTGTCAACATTTTTGGAGTAATCCTCGGACGTTCGGTGGAGGCACCAAGCTGGAAATC AAA
2BB8 VL amino acid sequence (SEQ ID NO: 32)
DIOMTOSPASLSASVGETVTITCRTSGNIHTYLAWYOHKOGKSPOLLVYYAKTLADGVPSRFSGS GSGTOYSLKINSLOPEDFGSYYCOHFWSNPRTFGGGTKLEIK
Locations of CDRs in 2BB8 VL sequence (according to Kabat)
Figure imgf000027_0002
2BB10 VL DNA sequence (SEQ ID NO: 33)
GATATTGTGATGACACAGACTCCACTCTCCCTGCCTGTCAGTCTTGGAGATCAAGCCTCCATCT CTTGCAGATCTAGTCAGAGCATTGTACATAGTAATGGAAACACCTATTTAGAATGGTACCTGCA GAAACCAGGCCAGTCTCCAAAGCTCCTGATCTACAAAGTTTCCAACCGATTTTCTGGGGTCCCA GACAGGTTCAGTGGCAGTGGATCAGGGACAGATTTCACACTCAAGATCAGCAGAGTGGAGGCT GAGGATCTGGGAGTTTATTACTGCTTTCAAGGTTCACATGTTCCGTGGACGTTCGGTGGAGGCA CCAAGCTGGAAATCAAA
2BB10 VL amino acid sequence (SEQ ID NO: 34)
DIVMTOTPLSLPVSLGDOASISCRSSOSIVHSNGNTYLEWYLOKPGOSPKLLIYKVSNRFSGVPDRF SGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPWTFGGGTKLEIK
Locations of CDRs in 2BB10 VL sequence (according to Kabat)
Figure imgf000028_0001
Provided herein are isolated monoclonal antibodies specific for the N protein of HRTV, and antigen-binding fragments thereof. The monoclonal antibodies or antigen-binding fragments comprise a VH domain and/or a VL domain. In some embodiments, the VH domain of the antibody or antigen-binding fragment comprises at least a portion of the amino acid sequence set forth herein as any one of SEQ ID NOs: 2, 6, 10, 14, 18, 22, 26 and 30, such as one or more (such as all three) CDR sequences from any one of SEQ ID NOs: 2, 6, 10, 14, 18, 22, 26 and 30. In some embodiments, the VL domain of the antibody or antigen-binding fragment comprises at least a portion of the amino acid sequence set forth herein as any one of SEQ ID NOs: 4, 8, 12, 16, 20, 24, 28, 32 and 34, such as one or more (such as all three) CDR sequences from any one of SEQ ID NOs: 4, 8, 12, 16, 20, 24, 28, 32 and 34. In some examples, the CDR locations are determined IMGT, Kabat or Chothia. In some embodiments, the VH domain CDR sequences are at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to the CDR sequences of any one of SEQ ID NOs: 2, 6, 10, 14, 18, 22, 26 and 30 and/or the VL domain CDR sequences are at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to the CDR sequences of any one of SEQ ID NOs: 4, 8, 12, 16, 20, 24, 28, 32 and 34.
In some embodiments of the monoclonal antibody or antigen-binding fragment, the VH domain comprises residues 26-35, 53-59 and 98-111 of SEQ ID NO: 2 and/or the VL domain comprises residues 27-32, 50-52 and 89-97 of SEQ ID NO: 4; the VH domain comprises residues 25-33, 50-57 and 96-106 of SEQ ID NO: 6 and/or the VL domain comprises residues 27-32, 50-52 and 89-97 of SEQ ID NO: 8; the VH domain comprises residues 17-24, 42-49 and 88-99 of SEQ ID NO: 10 and/or the VL domain comprises residues 27-31, 49-51 and 88-96 of SEQ ID NO: 12; the VH domain comprises residues 25-33, 51-57 and 96-107 of SEQ ID NO: 14 and/or the VL domain comprises residues 27-32, 50-53 and 89-97 of SEQ ID NO: 16; the VH domain comprises residues 26-33, 51-60 and 99-109 of SEQ ID NO: 18 and/or the VL domain comprises residues 27- 31, 49-51 and 88-96 of SEQ ID NO: 20; the VH domain comprises residues 26-34, 52-58 and 97- 105 of SEQ ID NO: 22 and/or the VL domain comprises residues 27-31, 49-51 and 88-96 of SEQ ID NO: 24; the VH domain comprises residues 26-33, 51-58 and 97-106 of SEQ ID NO: 26 and/or the VL domain comprises residues 27-32, 50-52 and 89-97 of SEQ ID NO: 28; or the VH domain comprises residues 26-33, 51-58 and 97-107 of SEQ ID NO: 30 and/or the VL domain comprises residues 27-32, 50-52 and 89-97 of SEQ ID NO: 32.
In some embodiments of the monoclonal antibody or antigen-binding fragment, the VH domain comprises residues 31-37, 52-67 and 100-111 of SEQ ID NO: 2 and/or the VL domain comprises residues 24-34, 50-56 and 89-97 of SEQ ID NO: 4; the VH domain comprises residues 30-34, 49-65 and 98-106 of SEQ ID NO: 6 and/or the VL domain comprises residues 24-34, 50-56 and 89-97 of SEQ ID NO: 8; the VH domain comprises residues 22-26, 41-57 and 90-99 of SEQ ID NO: 10 and/or the VL domain comprises residues 24-34, 49-55 and 88-96 of SEQ ID NO: 12; the VH domain comprises residues 30-35, 50-65 and 98-107 of SEQ ID NO: 14 and/or the VL domain comprises residues 24-34, 50-56 and 89-97 of SEQ ID NO: 16; the VH domain comprises residues 31-35, 50-68 and 101-109 of SEQ ID NO: 18 and/or the VL domain comprises residues 24-33, 49-55 and 88-96 of SEQ ID NO: 20; the VH domain comprises residues 31-36, 51-66 and 99-105 of SEQ ID NO: 22 and/or the VL domain comprises residues 24-33, 49-55 and 88-96 of SEQ ID NO: 24; the VH domain comprises residues 31-35, 50-66 and 99-106 of SEQ ID NO: 26 and/or the VL domain comprises residues 24-34, 50-56 and 89-97 of SEQ ID NO: 28; or the VH domain comprises residues 31-35, 50-66 and 99-107 of SEQ ID NO: 30 and/or the VL domain comprises residues 24-34, 50-56 and 89-97 of SEQ ID NO: 32.
In some embodiments, the VH domain comprises an amino acid sequence at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 2, SEQ ID NO: 6, SEQ ID NO: 10, SEQ ID NO: 14, SEQ ID NO: 18, SEQ ID NO: 22, SEQ ID NO: 26 or SEQ ID NO: 30. In some examples, the VH domain comprises or consists of the amino acid sequence of SEQ ID NO: 2, SEQ ID NO: 6, SEQ ID NO: 10, SEQ ID NO: 14, SEQ ID NO: 18, SEQ ID NO: 22, SEQ ID NO: 26 or SEQ ID NO: 30.
In some embodiments, the VL domain comprises an amino acid sequence at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 4, SEQ ID NO: 8, SEQ ID NO: 12, SEQ ID NO: 16, SEQ ID NO: 20, SEQ ID NO: 24, SEQ ID NO: 28 or SEQ ID NO: 32. In some examples, the VL domain comprises or consists of the amino acid sequence of SEQ ID NO: 4, SEQ ID NO: 8, SEQ ID NO: 12, SEQ ID NO: 16, SEQ ID NO: 20, SEQ ID NO: 24, SEQ ID NO: 28 or SEQ ID NO: 32.
In some embodiments, the monoclonal antibody is an immunoglobulin (Ig) molecule, such as an IgG antibody. In other embodiments, the monoclonal antibody is an IgA, IgD, IgE or IgM antibody.
In some embodiments, the antigen-binding fragment is an Fab fragment, an Fab' fragment, an F(ab)' 2 fragment, a single chain variable fragment (scFv) or a disulfide stabilized variable fragment (dsFv).
In some embodiments, the monoclonal antibody or antigen-binding fragment is a mouse antibody. In other embodiments, the monoclonal antibody or antigen-binding fragment is a chimeric or synthetic antibody comprising human and mouse amino acid sequence. For example, the antibody can comprise one or more human framework regions. In other embodiments, the monoclonal antibody or antigen-binding fragment is humanized.
Also provided herein are fusion proteins comprising a monoclonal antibody or antigen- binding fragment disclosed herein and a heterologous protein. In some examples, the heterologous protein is a protein tag, such as a myc tag, His tag, HA tag, or FLAG tag. In other examples, the heterologous protein is an affinity tag, such as chitin binding protein, maltose binding protein, or glutathione- S -transferase (GST).
Further provided herein are immunoconjugates comprising a monoclonal antibody or antigen-binding fragment disclosed herein attached to a detectable label. In some embodiments, the detectable label is a fluorescent, radioactive or enzymatic label. Compositions comprising a monoclonal antibody or antigen-binding fragment disclosed herein and a pharmaceutically acceptable carrier are further provided.
Also provided are compositions that include a disclosed monoclonal antibody or antigen- binding fragment conjugated to a microsphere. Microspheres for use in immunoassays are well known in the art and are commercially available from a variety of sources. In some examples, the microspheres are MICROPLEX™ microspheres (Luminex Corp, Austin, TX). The antibody or antigen-binding fragment can be conjugated to the microsphere using any method known in the art. In some embodiments, the monoclonal antibody or antigen-binding fragment is chemically conjugated to the microsphere. In some examples, chemical conjugation is via carbodiimide coupling. In some embodiments, the microsphere comprises a fluorophore. In some examples, the microsphere comprises two different fluorophores.
In some embodiments, the antibody-microsphere compositions further include HRTV N protein bound to the monoclonal antibody or antigen-binding fragment (referred to herein as "microsphere compositions"). The source of the N protein can include, for example, recombinantly prepared N protein, lysates of cells expressing N protein or lysates of HRTV-infected cells.
Further provided herein are methods of detecting HRTV-specific antibodies in a biological sample. In some embodiments, the method is a microsphere immunoassay (MIA) that uses a disclosed monoclonal antibody (or antigen-binding fragment) conjugated to a microsphere. In other embodiments, the method is an indirect ELISA that uses a disclosed monoclonal antibody (or antigen-binding fragment) bound to a solid support, such as a microtiter plate. In yet other embodiments, the method is an antibody capture ELISA in which a labelled monoclonal antibody (or antigen-binding fragment) disclosed herein is used to detect immune complexes containing HRTV-specific antibodies from a biological sample.
In some embodiments, provided is a method of detecting HRTV-specific antibodies in a biological sample by contacting the biological sample with a microsphere composition under conditions sufficient to allow binding of any HRTV-specific antibodies present in the biological sample to the HRTV N protein, thereby forming a microsphere immune complex; contacting the microsphere immune complex with a labelled secondary antibody; and detecting binding of the secondary antibody to the microsphere immune complex, thereby detecting HRTV-specific antibodies present in the biological sample. In this embodiment, a "microsphere composition" refers to a HRTV N-protein specific monoclonal antibody or binding fragment conjugated to a microsphere, wherein the N-protein specific antibody or binding fragments is also bound to HRTV N protein. In some examples, the method is a method of detecting HRTV-specific IgM antibodies and the secondary antibody is anti-human IgM. In other examples, the method is a method of detecting HRTV-specific IgG antibodies and the secondary antibody is anti-human IgG. In some examples, the secondary antibody is labelled with a fluorophore. In some examples, a flow cytometer is used to detect binding of the secondary antibody to the microsphere immune complex.
In some embodiments, provided is a method of detecting HRTV-specific antibodies in a biological sample by providing a disclosed monoclonal antibody or antigen-binding fragment bound to a solid support; contacting the antibody-bound solid support with a preparation comprising HRTV N protein under conditions sufficient for the HRTV N protein to bind the monoclonal antibody or antigen-binding fragment to form an antibody-antigen complex; contacting the antibody-antigen complex with the biological sample to allow binding of any HRTV-specific antibodies present in the sample to the HRTV N protein, thereby forming an immune complex; contacting the immune complex with a labelled secondary antibody; and detecting binding of the secondary antibody to the immune complex, thereby detecting HRTV-specific antibodies present in the biological sample.
In some examples, the secondary antibody is labelled with an enzyme and detecting binding of the secondary antibody to the immune complex comprises detecting enzyme activity. In particular examples, the enzyme is horseradish peroxidase or alkaline phosphatase.
In other embodiments, provided is a method of detecting HRTV-specific antibodies in a biological sample that includes providing a secondary antibody bound to a solid support; contacting the antibody-bound solid support with the biological sample under conditions sufficient to allow binding of the secondary antibody to any HRTV-specific antibodies present in the biological sample, thereby forming antibody- antibody complexes; contacting the antibody- antibody complexes with a preparation comprising HRTV N protein under conditions sufficient for the HRTV N protein to bind the HRTV-specific antibodies, thereby forming immune complexes; contacting the immune complexes with an immunoconjugate disclosed herein; and detecting binding of the immunoconjugate to the immune complexes, thereby detecting HRTV-specific antibodies in the biological sample.
In some embodiments of the detection methods disclosed herein, the biological sample is a biological fluid sample. In some examples, the biological fluid sample comprises serum, blood or plasma. In one non- limiting example, the biological sample comprises serum.
Also provided herein are methods of detecting HRTV in an isolated cell or tissue by contacting the cell or tissue with a monoclonal antibody or immunoconjugate disclosed herein and detecting binding of the monoclonal antibody or immunoconjugate to the cell or tissue. An increase in binding of the antibody or immunoconjugate to the cell or tissue as compared to binding of the antibody or immunoconjugate to a control cell or tissue detects HRTV in the cell or tissue. In some embodiments in which a monoclonal antibody (without a label) is used for detection, a labelled secondary antibody is used to detect the presence of HRTV.
A method of treating HRTV infection in a subject by administering to the subject a monoclonal antibody or antigen-binding fragment disclosed herein is also provided by the present disclosure.
Further provided are nucleic acid molecules encoding a VH domain and/or a VL domain of a monoclonal antibody or antigen binding fragment disclosed herein.
In some embodiments, the VH domain coding sequence is at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 1, SEQ ID NO: 5, SEQ ID NO: 9, SEQ ID NO: 13, SEQ ID NO; 17, SEQ ID NO: 21, SEQ ID NO: 25 or SEQ ID NO: 29. In some examples, the VH domain coding sequence comprises SEQ ID NO: 1, SEQ ID NO: 5, SEQ ID NO: 9, SEQ ID NO: 13, SEQ ID NO; 17, SEQ ID NO: 21, SEQ ID NO: 25 or SEQ ID NO: 29.
In some embodiments, the VL domain coding sequence is at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 3, SEQ ID NO: 7, SEQ ID NO: 11, SEQ ID NO: 15, SEQ ID NO: 19, SEQ ID NO: 23, SEQ ID NO: 27 or SEQ ID NO: 31. In some examples, the VL domain coding sequence comprises SEQ ID NO: 3, SEQ ID NO: 7, SEQ ID NO: 11 , SEQ ID NO: 15, SEQ ID NO: 19, SEQ ID NO: 23, SEQ ID NO: 27 or SEQ ID NO: 31.
In some embodiments, the nucleic acid molecule is operably linked to a promoter. Vectors comprising the nucleic acid molecules are further provided. Also provided are isolated host cells transformed with the nucleic acid molecules and vectors disclosed herein.
IV. Monoclonal Antibodies and Antigen-Binding Fragments Thereof
The monoclonal antibodies disclosed herein can be of any isotype. The monoclonal antibody can be, for example, an IgM or an IgG antibody, such as IgGior an IgG2. The class of an antibody that specifically binds HRTV can be switched with another (for example, IgG can be switched to IgM), according to well-known procedures. Class switching can also be used to convert one IgG subclass to another, such as from IgGi to IgG2.
Antibody fragments are also encompassed by the present disclosure, such as single-domain antibodies (e.g. , VH domain antibodies), Fab, F(ab')2, and Fv. These antibody fragments retain the ability to selectively bind with the antigen. These antigen-binding fragments include: (1) Fab, the fragment which contains a monovalent antigen-binding fragment of an antibody molecule, can be produced by digestion of whole antibody with the enzyme papain to yield an intact light chain and a portion of one heavy chain;
(2) Fab', the fragment of an antibody molecule can be obtained by treating whole antibody with pepsin, followed by reduction, to yield an intact light chain and a portion of the heavy chain; two Fab' fragments are obtained per antibody molecule;
(3) (Fab')2, the fragment of the antibody that can be obtained by treating whole antibody with the enzyme pepsin without subsequent reduction; F(ab')2 is a dimer of two Fab' fragments held together by two disulfide bonds;
(4) Fv, a genetically engineered fragment containing the variable region of the light chain and the variable region of the heavy chain expressed as two chains;
(5) Single chain antibody (such as scFv), a genetically engineered molecule containing the variable region of the light chain, the variable region of the heavy chain, linked by a suitable polypeptide linker as a genetically fused single chain molecule;
(6) A dimer of a single chain antibody (SCFV2), defined as a dimer of a scFv (also known as a "miniantibody"); and
(7) VH single-domain antibody, an antibody fragment consisting of the heavy chain variable domain.
Methods of making these fragments are known in the art (see for example, Harlow and Lane, Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory, New York, 1988).
In some cases, antibody fragments can be prepared by proteolytic hydrolysis of the antibody or by expression in a host cell (such as E. coli) of DNA encoding the fragment. Antibody fragments can be obtained by pepsin or papain digestion of whole antibodies by conventional methods. For example, antibody fragments can be produced by enzymatic cleavage of antibodies with pepsin to provide a 5S fragment denoted F(ab')2. This fragment can be further cleaved using a thiol reducing agent, and optionally a blocking group for the sulfhydryl groups resulting from cleavage of disulfide linkages, to produce 3.5S Fab' monovalent fragments. Alternatively, an enzymatic cleavage using pepsin produces two monovalent Fab' fragments and an Fc fragment directly (see U.S. Patent No. 4,036,945 and U.S. Patent No. 4,331,647).
Other methods of cleaving antibodies, such as separation of heavy chains to form monovalent light-heavy chain fragments, further cleavage of fragments, or other enzymatic, chemical, or genetic techniques may also be used, so long as the fragments bind to the antigen that is recognized by the intact antibody. One of skill will realize that conservative variants of the antibodies can be produced. Such conservative variants employed in antibody fragments, such as dsFv fragments or in scFv fragments, will retain critical amino acid residues necessary for correct folding and stabilizing between the VH and the VL regions, and will retain the charge characteristics of the residues in order to preserve the low pi and low toxicity of the molecules. Amino acid substitutions (such as at most one, at most two, at most three, at most four, or at most five amino acid substitutions) can be made in the VH and/or the VL regions to increase yield. Conservative amino acid substitution tables providing functionally similar amino acids are well known to one of ordinary skill in the art. The following six groups are examples of amino acids that are considered to be conservative substitutions for one another:
1) Alanine (A), Serine (S), Threonine (T);
2) Aspartic acid (D), Glutamic acid (E);
3) Asparagine (N), Glutamine (Q);
4) Arginine (R), Lysine (K);
5) Isoleucine (I), Leucine (L), Methionine (M), Valine (V); and
6) Phenylalanine (F), Tyrosine (Y), Tryptophan (W).
VI. Detection of Heartland Virus-Specific Antibodies
Methods of detecting HRTV-specific antibodies in a biological sample, such as a serum sample, using a HRTV-specific monoclonal antibody, are disclosed herein. Detection assays based on binding of an antigen to an antibody are well known in the art and include, for example, ELISA, microsphere immunoassay (MIA), immunofluorescence assay (IFA), Western blot, fluorescence activated cell sorting (FACS), radioimmunoassay (RIA), immunohistochemistry (IHC) and plaque reduction neutralization test (PRNT). As is well known to one of skill in the art, in some cases the detection assay further includes the step of contacting an antigen-antibody complex with a detection reagent, such as a labeled secondary antibody (e.g. , an anti-isotype antibody, such as an anti-IgG antibody), or in the case of a sandwich ELISA, a second antibody that recognizes the same antigen as the first antibody and is labeled for detection. Secondary antibodies can also be conjugated to magnetic beads to allow for magnetic sorting. In other cases, the primary antibody is directly labeled. Directly labeled antibodies can be used for a variety of detection assays, such as FACS. The HRTV-specific antibodies disclosed herein can be used any immune -based detection assay for the diagnosis of HRTV infection. Several exemplary immune-based detection assays are described below. A. Microsphere Immunoassay (MIA)
Microsphere immunoassays are becoming increasingly popular for laboratory diagnosis of many diseases (Earley et al , Cytometry 50:239-242, 2002; Kellar et al, Cytometry 45:27-36, 2001). The technology involves the detection and analysis of a reaction (such as an antibody or other ligand) attached to microspheres or beads. The detecting instrument is a simplified flow cytometer, and lasers simultaneously identify the microsphere sets and measure the fluorescence associated with the reaction. The speed at which these tests can be performed and the ability to multiplex make this methodology particularly useful.
A MIA can be used to detect the presence of Heartland virus-specific antibodies in a sample. In some embodiments, microsphere beads are coated with a Heartland virus-specific antibody (such as an antibody produced by a hybridoma cell line disclosed herein) and contacted with HRTV antigen such that the HRTV antigen binds to the microsphere-bound virus-specific antibodies. The microsphere immune complexes are mixed with a serum sample such that antibodies in the sample that are specifically reactive with the HRTV antigen bind the HRTV antigen bound (indirectly) to the microsphere. The bead-bound immune complexes are allowed to react with fluorescent-dye labeled anti-species antibody (such as PE-labeled anti-human IgM or anti-human IgG), and are measured using a microsphere reader (such as a Luminex instrument).
B. IgM Antibody Capture (MAC)-ELISA
For some types of viruses, the host IgM response to infection occurs earlier than that the IgG response, and thus can be used to identify recent infections (Tardei et al. , J Clin Microbiol 38(6):2232-2239, 2000). MAC-ELISA is typically performed to detect the IgM level in serum samples (Martin et al , J Clin Microbiol 38(5): 1823-1826, 2000). In these assays, anti-human IgM serves as a capture antibody and is coated onto an appropriate assay plate, such as a multi-well plate. After blocking of the plate, such as with nonfat dry milk, diluted human sera are reacted with the anti-human IgM. Viral antigens, such as infected tissue or cell extracts or recombinant viral proteins, are added to the plates. A virus antigen-specific antibody conjugated to detectable label (for example, an enzyme, such as horseradish peroxidase (HRP)) is then reacted with the immobilized viral antigen. After addition of an appropriate substrate (such as 3,3'5,5' tetra methyl benzidine if HRP is used as the enzyme), reactions are measured using a microplate reader. Serial dilutions of positive sera can be evaluated. The maximum dilution that exhibits positive signal is the titer for the serum. The titer of the MAC-ELISA can be compared with the titers of other tests, such as hemagglutination inhibition tests (HIT) or PRNT. Serum samples can also be tested on control antigen in addition to viral antigen, to reduce the number of false-positive results due to non-specific binding of the serum or other factors (U.S. Patent Application Publication No.
2006/0115896).
C. Indirect ELISA
Indirect ELISAs to detect the presence of virus-specific antibodies are typically carried out by coating a microtiter plate with an antigen- specific antibody (such as a HRTV-specific monoclonal antibody), blocking the plates to prevent non-specific binding to the plate surface, and adding virus antigen to allow binding of the antigen to the virus-specific antibody. After several washes, diluted human sera is added to allow binding of any antibodies present in the sample to the immobilized viral antigens. IgM or IgG antibodies that were present in the sample are then detected using a labelled secondary antibody, such as anti-human IgG or anti-human IgM conjugated to an enzyme (such as alkaline phosphatase or HRP). An appropriate enzyme substrate is then added and the presence of virus-specific antibody is detected by measuring enzyme activity (for example, by measuring fluorescence, optical density or colorimetric absorbance).
D. Lateral Flow Assay (LFA)
Lateral flow immunoassays are another method by which antigen-specific antibodies (or pathogen-specific antigens) can be detected in biological samples. These assays are generally very rapid and enable point of care testing. LFA is performed over a strip, different parts of which are assembled on a plastic backing. These parts are sample application pad, conjugate pad, ni rocellulose membrane and adsorption pad. Nitrocellulose membrane is further divided into test and control lines. Pre - immobilized reagents at different parts of the strip become active upon flow of liquid sample. LFA combines the unique advantages of biorecognition probes and
chromatograph .
Several designs have been developed for lateral flow assays. Generally LFAs include a porous support strip (such as a strip of cellulose) with a number of separate regions spaced horizontally along the support. The solid support need not be identical in all regions of a strip. Typically, the first region is a sample pad where a biological fluid is applied to flow laterally through the support to the remaining regions. The second region generally contains a labeling moiety that can be bound to the analyte of interest (such as an antibody or protein) in the sample if present. Downstream of the labeling region is a capture or "test" region where the labeled analyte (for example, antibody or peptide) is retained in the strip. It is in this test region where detection is generally performed. In addition to the test region, the strip may contain a control region either in the same flow path as that of the test region, or in a parallel path on the strip. There may also be a reservoir downstream of the various regions to absorb the sample that has traversed the test strip. LFAs can be direct assays, forming sandwiches in proportion to the level of analyte present, or may be competition assays where analyte in the sample diminishes the amount of label detected in the detection zone. In direct sandwich assays, for example, the sample may be labeled by colored particles that are coupled to affinity reagents such as secondary antibodies the bind HRTV- specific antibodies present in the sample, forming complexes which are then carried to the test region for capture by an additional reagent. The detectable label in the test region will be directly proportional to the level of peptide in the sample.
In competitive assays, the labeling region may contain labeled reagents, for example, that are already coupled to the target analyte (e.g. antibody) or an analog thereof, and the analytes in the sample compete with this labeled material for capture by the capture reagent in the test region. In this case, the detectable label in the test region will be inversely proportional to the quantity of analyte in the sample itself.
Simple visual detection is the most common means of reading an LFA, however, there are commercially available lateral flow readers that can quantitate the detectable label in the test region.
LFAs can be used, for example, to detect antigen- specific antibodies present in a biological sample (such as a serum sample) that specifically recognize HRTV. These assays can also be used to detecting pathogen-specific proteins/peptides present in a biological sample The following examples are provided to illustrate certain particular features and/or embodiments. These examples should not be construed to limit the disclosure to the particular features or embodiments described.
EXAMPLES
Example 1: Heartland Virus Produces a Humoral Response Lacking Virus-Neutralizing Antibody In Vivo
Heartland virus (HRTV) is a newly discovered member of the Phlebovirus genus in the family Bunyaviridae, presumably transmitted by ticks to humans causing severe disease characterized by fever, leukopenia and thrombocytopenia (McMullan et al , N Engl J Med 367: 834-841, 2012). It is closely related to severe fever with thrombocytopenia syndrome virus
(SFTSV) from China with case fatality rates as high as 30% in outbreaks. Since 2009, only 8 cases of HRTV have been documented. Little is known about HRTV and currently the only diagnostic tests are RT-PCR and plaque reduction neutralization test (PRNT). In the study described below, mice were experimentally inoculated in order to better understand the virulence, pathology and subsequent immune response to HRTV. Monoclonal antibodies were also produced in order to develop serological diagnostic tests.
Methods
Three-week old C57BL/6 mice were inoculated with 104 PFU, boosted with 104 PFU on 28 days post infection (DPI), and bled at 42 DPI to determine antibody titers. Three-week old α, β and γ interferon-receptor deficient AG129 mice were inoculated with 104 to 10° PFU and observed through day 30 to determine the LD50 dose. AG129 mice surviving challenge with 102 PFU were boosted 30 DPI, and spleens were harvested 4 days later for hybridoma production. Viremias were determined by plaque assay and PRNTso were performed on Vero E6 cells. Serum antibody and monoclonal antibody titers were determined by ELISA with purified virus coated directly to the plate. Protein specificity was determined by running purified HRTV on 4-12% Bis/Tris gels with (ME+) or without (ME-) reducing agent (β-mercaptoethanol). Cross-reactivity was determined by immunofluorescent assay (IFA) on SFTSV-infected Vero cells.
Results
All C57BL/6 mice survived challenge with 104 PFU HRTV, and no viremia was detected. All AG129 mice succumbed to infection with 104 PFU HRTV. An LD50 was calculated to be 9 PFU. Hepatic hemorrhagic lesions and enlarged pale spleens were observed in AG129 mice that succumbed to infection. Immunohistochemistry showed antigen in hematopoietic cells in the spleen, interstitial mononuclear cells in the kidney and Kupffer/sinusoidal cells in the liver.
Low to no detectable neutralizing antibody was detected in C57BL/6 mice; however, high ELISA antibody titers were observed (Table 1) and antibodies specific for Gn/Gc and N were detected. In infected AG129 mice, no detectable neutralizing antibody was found with any dose; however, high ELISA antibody titers were detected (Table 1), as well as antibodies specific for Gn/Gc and N.
Table 1. HRTV-Specific Antibody Responses in Surviving Mice
Mice3 HRTV Geometric mean Geometric Mice with Survivors/total
Dose (PFU) reciprocal PRNTso mean ELISA
(logio) reciprocal Ab titers
ELISA titer >2.70
(logio)
C57BL/6 104 1.13 (0.91)b 4.47 (0.42) 15/15 16/16 AG129 103 >1.00 (0) 4.13 (2.02) 1/2 3/15
AG129 102 >1.00 (0) 3.89 (1.68) 1/2 2/14
AG129 101 >1.00 (0) 3.49 (1.37) 1/3 3/15
AG129 100 >1.00 (0) 2.74 (0.117) 1/10 11/13 a 3-week old C57BL/6 and AG129 mice were inoculated intraperitoneally with 0.1 ml of HRTV. C57BL/6 mice were bled on day 42, and surviving AG129 mice were bled on day 30 to determine PRNT and ELISA antibody titers.
b Standard deviation in parentheses.
Twenty hybridomas were produced using splenocytes from HRTV-infected AG 129 mice. Seven MAbs with the highest reactivity in ELISA were purified and characterized (Table 2). All 7 MAbs had high endpoint ELISA titers. The MAbs were non-neutralizing and specific to linear epitopes on the nucleocapsid protein. No cross-reactivity to SFTSV antigen was detected.
Table 2. Serological and Biological Characteristics of Anti-HRTV MAbs
Figure imgf000040_0001
a ELISA endpoint titers expressed as ng/ml.
b PRNT endpoint titers expressed as mg/ml.
e Protein specificities (by immunoblot): N, nucleocapsid.
d Cross-reactivity with SFTSV antigen determined by IFA on SFTSV-infected Vero cells.
Conclusion
Adult C57BL/6 mice did not succumb to HRTV infection; however, they did develop an anti- viral humoral response characterized by high antibody titers with low or no neutralizing antibody. Similar results have been found with SFTSV-infected C57BL/6 mice (Jin et al. , Proc Natl Acad Sci USA 109: 10053-10058, 2012). In contrast, interferon receptor-deficient AG129 mice developed illness similar to human clinical disease. No neutralizing antibody was detected in AG129 mice that survived HRTV infection; however, virus-specific antibody titers were reasonably high. Similarly, adult α/β interferon receptor-deficient A129 mice were found to be highly susceptible to SFSTV infection with the most heavily infected tissues being in the mesenteric lymph nodes and spleen of infected mice (Liu et al, J Virol 88:1781-1786, 2014). Of the 20 hybridomas developed using splenocytes from HRTV-infected AG 129 mice, seven were highly reactive by ELISA. These MAbs were nucleocapsid-specific and non-neutralizing. The majority of anti-SFTSV human and murine MAbs developed have been nucleocapsid-specific and non-neutralizing (Yu et al, PLoS One 7: e38291, 2012; Guo et al, Clin Vaccine Immunol 20: 1426-1432, 2013). The nucleocapsid protein has been shown to be the immunodominant viral protein in other phleboviral infections with Rift Valley fever virus and Toscana virus (Martin- Folgar et al, MAbs 2: 275-284, 2010; Magurano and Nicoletti, Clin Diagn Lab Immunol 6: 55-60, 1999). Serologic diagnostic assays that do not rely on the detection of neutralizing antibody and BSL-3 containment are needed. An IgM antibody capture ELISA (MAC-ELISA) and
LUMINEX™ assay for the detection of HRTV- specific IgM and IgG using the disclosed HRTV- specific MAbs are described herein (see Example 3).
Example 2: Monoclonal Antibodies Directed Against the Nucleoprotein of Heartland Virus Diagnostic assays for the detection of HRTV is currently limited to the detection of viral
RNA by RT-PCR and the detection of neutralizing antibody by plaque reduction neutralization test (PRNT). In order to develop diagnostic assays able to detect both recent and past infections and to assess the disease burden of HRTV infection in the United States, anti-HRTV murine MAbs were developed and characterized. Interferon-receptor deficient AG129 mice approximately 3 weeks old were inoculated intraperitoneally (IP) with 100 plaque forming units (PFU) of HRTV strain MO-4. Thirty days later, mice were bled and boosted with another 100 PFU of HRTV MO-4 IP.
Splenocytes were harvested 4 days after the last inoculation for fusions with the mouse myeloma cell line P3X63Ag8.653 using the CLONACELL™-HY Hybridoma cloning kit (StemCell Technologies).
This is the first report of the use of activated B cells from AG129 mice for the development of hybridomas. B-cell hybridoma clones are generally made by isolating activated B cells from the spleen of an immunized BALB/c mouse or mouse with a compatible major histocompatibility complex (MHC) haplotype (H2d) and fusing with a myeloma cell with the same haplotype. In this case, AG129 mice were used as B cell donors which have a different MHC haplotype (H2b) from the P3X63Ag8.653 myeloma cells used for fusions. While the use of BALB/c mice may be appropriate for most infectious agents, some pathogens may be unable to mount a robust immune response. Utilizing AG129 mice for hybridoma development may be more appealing in these situations.
After fusions, hybridomas were grown in high-glucose Dulbecco minimal essential medium supplemented with L-glutamine, 10% low IgG fetal bovine serum, 1 mM sodium pyruvate, 2 mM L-glutamine, 0.15% sodium bicarbonate, 100 U/ml penicillin G sodium, 100 μg/ml streptomycin sulfate, and 0.1 mM nonessential amino acids. MAbs were purified from highly concentrated culture media using protein- A SEPHAROSE™ (GE Healthcare) according to the manufacturer's instructions. Purified MAbs were dialyzed against PBS and the concentration was measured by Bradford protein assay.
Sera from infected mice taken on days 30 and 34 post-infection were tested by enzyme- linked immunosorbent assay (ELISA) using purified HRTV at a dilution of 0.06 μg/well coated overnight at 4°C to 96-well plates in 50 mM sodium carbonate/ 50 mM sodium bicarbonate buffer, pH 9.6. Plates were washed five times in PBS/0.05% Tween before non-specific binding sites were blocked with Starting Block (Pierce) and sera diluted in PBS were incubated on the plates for one hour at 37°C. Plates were washed again before goat anti-mouse conjugated to horseradish peroxidase diluted 1:5000 in PBS was incubated on the plates. After plates were washed a final time, reactions were developed using TMB K-blue substrate (KPL) and stopped with the addition of IN H2SO4 before being read at 450 nm. On day 30, mouse 1 and mouse 2 had ELISA endpoint titers of < 2.70 logio and > 4.60 logio, respectively, indicating that mouse 1 did not develop an infection after the first inoculation. On day 34, those ELISA titers increased to 2.70 logio and 5.56 logio, respectively, while PRNTso titers on Vero cells were 1.90 logio and 2.51 logio, respectively (Table 3).
Table 3
HRTV-specific antibody responses in AG129 mice following primary and secondary immunizations with HRTV
Figure imgf000042_0001
*Days post-infection. To determine the viral protein specificity of the antibody response, purified HRTV (5 was run on a 4-12% Bis-Tris polyacrylamide gel (Life Technologies) under reducing conditions. Proteins were blotted electrophoretically from the gels onto nitrocellulose membranes and washed for 15 minutes in PBS/0.1% Tween wash buffer. Non-specific binding sites were blocked with 10% goat serum in PBS for 1 hour while rocking. Sera diluted 1:200 were incubated with the membrane for 1 hour with gentle rocking. Membranes were washed again before goat anti-mouse conjugated to alkaline phosphatase (Jackson ImmunoResearch) was diluted 1:200 and incubated on the membrane for 1 hour with gentle rocking. Membranes were washed and
BCIP/NBT phosphatase substrate (KPL) was added until a color change appeared. Even though neutralizing antibody titers were detected for both mice, only mouse 2 produced IgG anti- glycoprotein (Gn and Gc) and anti-N antibody to HRTV detectable by Western blot by day 34 (FIG. 1).
Twenty hyridoma clones secreting anti-HRTV MAb were isolated from fusions. Nineteen of these were from fusions using splenocytes from mouse 2, while only one hybridoma clone was isolated from fusions using splenocytes from mouse 1. Twelve of the hybridoma clones were of varying IgG isotypes, while the other 8 were IgM (Table 4). Nine of the IgG MAbs were titrated by ELISA as previously described with starting concentrations of purified MAbs beginning at 10 μg/ml. An optical density (OD) of two times the background was considered a positive result and endpoints were expressed in ng/ml. The MAbs with the highest reactivities by ELISA were 2BB5, 2AG8, 2BB8 and 2AG9 with endpoint concentrations of 0.156, 0.381, 0.610 and 1.526 ng/ml, respectively. The MAbs with moderate reactivities by ELISA were 2BB7, 2BA2, and 2BB10 with endpoint concentrations of 24.41, 39.06 and 937.5 ng/ml. Two MAbs (2AF11 and 2BB6) had the lowest ELISA reactivities (10 g/ml endpoints) (Table 4).
To assess whether these MAbs could neutralize virus in vitro, purified MAbs were tested in a PRNT with HRTV. One PFU of HRTV MO-4 were incubated with equal amounts of serial twofold dilutions of purified antibody starting at 10 g/ml for 1 hour at 37°C. Six-well plates of Vero cells were then inoculated with the virus-antibody mixtures and incubated at 37 °C with 5% CO2 for 1 hour after which cells were overlaid with 3 ml of medium containing 1% SeaKem LE agarose (FMC BioProducts) in nutrient medium (0.165% lactalbumin hydrolysate, 0.033% yeast extract, Earle's balanced salt solution and 2% FBS). Following incubation at 37°C for 7 days, a second overlay containing an additional 80 μg of neutral red vital stain (GIBCO-BRL) per ml was added. Plaques were counted on days 9 and 10. None of the MAbs were found to neutralize virus in vitro when tested by plaque reduction neutralization test using an 80% reduction in plaque formation as significant (PRNTso) (Table 4).
Viral glycoprotein specificity for these MAbs was determined by immunoblot with or without the reducing agent, β-mercaptoethanol (ME). All anti-HRTV MAbs reacted specifically with the N protein which is approximately 20 KDa in mass. These MAbs were reactive under reducing and non-reducing conditions suggesting that all 9 MAbs recognize linear epitopes on the N protein (Table 4).
In order to determine the cross-reactivity of anti-HRTV MAbs with SFTSV, Vero cells were infected with SFTSV, harvested 5 days after infection and fixed to 12-well glass slides in 70% acetone in PBS. MAbs were added in doubling dilutions (20 μΐ/well) to the wells of the slide and incubated at 37°C for 30 minutes. Slides were washed three times in PBS before goat anti-mouse conjugated to fluorescein isothiocyanate (FITC) (Invitrogen) diluted 1:200 in PBS was added (20 μΐ/well) and incubated at 37°C for 30 minutes. Only MAb 2AF11 was found to be cross-reactive with SFTSV with an endpoint titer of 1 g/ml (Table 4).
Table 4. Serological and Biological Characteristics of anti-HRTV MAbs
Figure imgf000044_0003
a ELISA endpoint titers expressed as ng/ml.
h PRNT endpoint titers expressed as
Figure imgf000044_0001
e Protein specificities (by immunoblot): N, nucleocapsid.
d Cross-reactivity with SFTSV antigen determined by IFA on SFTSV-infected Vero cells. IFA endpoint titers expressed as
Figure imgf000044_0002
e Negative reactivity with SFTSV-infected cells. This study reports the first generation of a panel of murine monoclonal antibodies directed to HRTV as well as the importance of the N protein in immunogenicity to HRTV infection. The majority of anti-SFTSV human and murine MAbs developed have been nucleocapsid-specific and non-neutralizing (Yu et al, PLoS One 7: e38291, 2012; Guo et al, Clin Vaccine Immunol 20:
1426-1432, 2013). The exception has been a human MAb (hMAb) recognizing a linear epitope in the ectodomain of Gn able to neutralize virus in vitro by blocking virus-cell mediated attachment (Guo et al, Clin Vaccine Immunol 20: 1426-1432, 2013). The N protein has also been shown to be the immunodominant protein in other phleboviral infections including Rift Valley fever virus (RFTV) and Toscana (TOSV) viruses (Martin-Folgar et al , MAbs 2: 275-284, 2010; Magurano and Nicoletti, Clin Diagn Lab Immunol 6: 55-60, 1999). It is highly conserved in the Bunyaviridae family and is the most abundantly expressed viral protein in virus -infected cells (Magurano and Nicoletti, Clin Diagn Lab Immunol 6: 55-60, 1999; Schwarz et al, J Med Virol 49: 83-86, 1996; Swanepoel et al, J Hyg (Lond) 97: 317-329, 1986). Even though the N protein does not produce neutralizing antibody, MAbs directed against this antigen can be protective in vivo against RVFV and Hantaan viral infections (Boshra et al, Vaccine 29: 4469-4475, 2011; Jansen van Vuren et al, PLoS One 6: e25027, 2011; Nakamura et al, Arch Virol 86: 109-120, 1985; Yoshimatsu et al, Arch Virol 130: 365-376, 1993). While neutralizing antibodies in bunyaviral infections are directed to the Gn or Gc glycoproteins, these antibodies may be harder to isolate since they usually recognize conformationally-dependent epitopes requiring higher binding avidities (Magurano and Nicoletti, Clin Diagn Lab Immunol 6: 55-60, 1999; Besselaar and Blackburn, Arch Virol 121: 111- 124, 1991; Lundkvist et al, Arch Virol 130: 121-130, 1993).
Serologic diagnostic assays that do not rely on the detection of neutralizing antibody and BSL-3 containment are needed for the detection of HRTV-specific IgM and IgG. Recombinant N protein has been used in diagnostic applications for phleboviruses including RVFV and SFTSV
(Paweska et al , Vet Microbiol 127: 21-28, 2008; Paweska et al , J Virol Methods 127: 10-18, 2005; Jiao et al, J Clin Microbiol 50: 372-377, 2012). An assay for the detection of total anti-HRTV antibody reactivity in serum samples may be more beneficial than neutralization assays that require special containment. The MAbs described herein were evaluated for their inclusion in microsphere immunoassays and ELISAs for the detection of HRTV-specific IgM and IgG in human infections (see Example 3). Example 3: Development of IgM and IgG Microsphere Immunoassays for Heartland Virus
Bunyaviruses are a significant cause of human illness world-wide, with the most common in the United States being La Crosse encephalitis virus (LACV), of the genus Orthobunyavirus. Phleboviruses possess large (L), medium (M) and small (S) genomic segments that encode genes for RNA-dependent RNA polymerase, envelope glycoproteins (Gn and Gc) and a nucleocapsid protein, respectively. Diagnostic methods for LACV were unsuitable for HRTV, and methods were developed using sequence information and virus isolates to generate reagents to aid in laboratory diagnosis. An RT-PCR method was devised using primers and probes that targeted the S segment (Lambert and Lanciotti, / Clin Microbiol 47:2398-2404, 2009). An IgG assay using inactivated virus-infected cell lysate was also developed (McMullan et al. , N Engl J Med 367: 834-841, 2012). These tests were followed by the traditional serological method of PRNT (Lindsey et al. , J Clin Microbiol 4:503-510, 1976).
To date, there are 9 confirmed cases of HRTV have been identified in the States of Missouri, Oklahoma and Tennessee (Pastula et al , MMWR Morb Mortal Wkly Rep 63:270-271, 2014). As local health departments were made aware of this newly discovered virus, and studies designed to identify potentially-infected patients were developed, the need for rapid and reliable serological assays increased. The lack of an IgM assay precluded the distinction of recent infections from those of past infections, when RNA was not present in acute patient samples. Immunofluorescence assays (IFAs) are inconsistent with the less subjective current methodologies such as ELISA and MIAs. Development of HRTV MIAs for detection of IgM and IgG are described herein; these assays overcome many of the shortfalls of the existing methods.
Anonymized serum samples previously received for laboratory diagnosis were used in the development and validation of these assays. Serum samples submitted for HRTV testing were from patients who had clinical and circumstantial presentations that were consistent with those described for HRTV, and who were accordingly enrolled in studies that were designed to investigate this virus. Serum specimens from patients previously diagnosed with non-HRTV infections or non-arboviral infections were also used. Data from 91 serum samples enrolled in a HRTV-related study were included, where results from an additional 49 blood or tissue samples that were previously tested by molecular or isolation methods only, were included in the analyses. A further cohort of 40 non-HRTV-related samples from the DVBD archives were included.
Tissue culture-derived HRTV antigen was produced in Vero cells and harvested at day 10 post-infection. After centrifugal clarification, virus was inactivated using 0.1% beta-propiolactone and checked for absence of infectivity (Goodman et al., J Virol Methods 208:66-78, 2014). Antigen preparations were stored frozen at -70°C until use. The same procedure was performed for non-infected Vero cells to produce normal antigen to serve as a control in the MI As.
Diagnostic results from the DVBD database for the samples were used to confirm those of the MIAs. Where multiple samples taken from a single patient were received, the most acute sample, preferably whole blood, was tested by RT-PCR or virus isolation, or both. Viral RNA was extracted using a Qiagen QIAmp Viral RNA extraction kit (Qiagen, Inc, Valencia, CA) according to the manufacturer's instructions and RT-PCR was performed according to Savage et al. (Am J Trop Med Hyg 89:445-452, 2013. Virus isolation was attempted for a few samples in Vero E6 cells and cytopathic effect was checked daily for up to 12 days. To confirm HRTV antibody presence, PRNTs were performed using Vero cells ( Lindsey et al , J Clin Microbiol 4:503-510, 1976). A double overlay system was used where the second overlay with neutral red was applied six days after the cells were infected, and plaques were read over the following two days. Ninety percent plaque reduction compared to the negative control indicated a positive reaction.
To obtain a comparative measure of IgM content, samples were tested using IFA (Storch, "Diagnostic virology," Lippincott, Williams and Wilkins, Philadelphia, PA, 2007) with HRTV
(strain M12-66) in Vero E6 cells that were harvested six days post-inoculation. A minimum 4-fold difference between the highest serum dilution to fluoresce on virus-containing cells and non- infected cells indicated a positive result. IgG ELISA results were compared to those of the IgG MIA. Inactivated virus -infected cell lysate antigen was used to coat 96-well plates at a 1: 1000 dilution in PBS with an overnight incubation at 4°C. Serum dilutions were added at a 1: 1000 dilution in 5% milk block and incubated for 1 hour at 37°C. Anti-HRTV IgG was detected with anti-human IgG horseradish peroxidase (HRP) (Jackson Immunoresearch) at 1 : 1000 for 1 hour at 37°C. Reactions were visualized using TMB substrate (Neogen, Lansing, MI), stopped with 1 N
Figure imgf000047_0001
MIAs were developed to detect IgM and IgG antibodies to HRTV. Murine MAbs to HRTV were generated in AG129 mice (van den Broek et al., J Virol 69:4792-4796, 1995) and
characterized (see Examples 1 and 2). After purification using protein A SEPHAROSE™ (GE Healthcare Bio-Sciences, Piscataway, NJ), MAb 2BB5 (a non-neutralizing IgG3 isotype that recognizes nucleocapsid protein) was covalently bound to individual MICROPLEX™ microsphere sets (Luminex Corp, Austin, TX) using standard carbodiimide coupling at a rate of 25 μg per 5.4 million microspheres as described previously (Johnson et al , Clin Diagn Lab Immunol 12:566-574, 2005). Microspheres were adjusted to 5 x 106/ml and the HRTV antigen reaction was titrated with the beads to determine optimal signal-to-noise ratio in the IgM and IgG tests. Final volumes of 100 μΐ antigen (IgM assay) and 12.5 μΐ antigen (IgG assay) were added to 0.25 million antibody- coupled microspheres per 0.5 ml in Antibody Stabilizer (Boca Scientific, Boca Raton, FL) in amber vials and rotated for 1 hour at room temperature, then stored at 4°C until use. Previous experience has shown that microspheres prepared in this manner can be used from two days to five months (Basile et al , Clin Vaccine Immunol 17:56-61, 2010) after addition of antigen to the microspheres. The same was done using tissue culture-derived normal antigen to serve as a negative antigen control.
Positive and negative control sera were identified using IFA (for IgM) and IgG ELISA (for IgG). Microspheres were diluted 1: 10 in Low Cross Buffer (Boca Scientific, Boca Raton, FL) and 50 μΐ per well (2500 microspheres) was added to a pre- wet 96-well filter plate (Millipore Corp, Billerica, MA). Wells were washed 2X with 100 μΐ PBS using a vacuum filtration manifold.
Control sera for the IgM test was IgG-depleted as previously described (Johnson et al. , Clin Diagn Lab Immunol 12:566-574, 2005) and diluted 1:400 in 50% low cross buffer (LCB) (Boca Scientific, Boca Raton, FL) and 50 μΐ was added to the washed microspheres. No depletion was necessary for the IgG controls, which were diluted at 1 :400 in 50% LCB. Sera in the IgM test were co-incubated with 50 μΐ/well anti-human IgM-red-phycoerythrin (R-PE) at 4 μg/ml of 50% LCB for 1.5 hours at room temperature. The plate was covered with foil to protect the microspheres from being bleached and were kept in a state of suspension on a shaking platform. Wells were washed 2X with 100 μΐ PBS, resuspended in 100 μΐ PBS and read on a BioPlex 100 (Biorad, Hercules, CA). For the IgG test, sera were added to the washed antigen/microspheres and incubated with shaking for 45 minutes, washed 2X, then 50 μΐ anti-human IgG-RPE in 50 % LCB was added to the wells. After a further 15 minutes of incubation, wells were treated and read in the same manner as for IgM.
Readings were based on 50 μΐ of sample with doublet-discriminator gates set at default, and median fluorescent intensity (MFI) was calculated based on a minimum of 50 microspheres per set per sample.
Samples were anonymized and tested in the MIAs, where MFIs and P/Ns (MFI of test serum reacted on viral antigen/mean MFI of 3 negative control sera) were compared to the reference results.
To derive the MIA cutoffs from the results of the US and MO HRTV study samples, ROC analysis was performed using IFA results for "truth" versus the IgM MIA MFI values. This yielded a cutoff of 538. The cutoff derived using IFA versus P/N was 14.8. A combination of these cutoffs was chosen to identify positives, equivocals and negatives, where samples with both MFIs >538 and P/N>14.8 were positive; where either MFI >538 OR P/N >14.8 were equivocal, and where MFI<538 and P/N<14.8 were negative. Similarly, ROC analysis performed using PRNT results for "truth" versus the IgG MIA MFI values yielded a cutoff of 3101. The cutoff derived using PRNT versus P/N was 51.1. A combination of these cutoffs was chosen to identify positives, equivocals and negatives, where samples with both MFIs >3101 and P/N>51.1 were positive; where either MFI >3101 OR P/N >51.1 were equivocal, and where MF 3101 and P/N<51.1 were negative. Comparisons of P/N and MFI are charted in FIG. 2.
Because all the available samples were used to derive the cut-offs, it was not possible to validate the cut-offs on an independent sample set. As a substitute, bootstrap analyses (Davison, "Bootstrap methods and their applications," Cambridge Press, Cambridge, 1997) were performed to produce a numerical validation on the original set to produce sensitivity, specificity and 95% confidence intervals, using an S-plus based software (Canty, "Boot: Bootstrap R (S-Plus)
Functions," R Package version 1.3-13, 2014). Results are listed in Table 5.
Table 5
Cutoffs and percent specificity and sensitivity data for HRTV IgM and IgG MIAs
Figure imgf000049_0001
Accuracy was 100% for both IgM and IgG assays based upon the MFI cutoffs, and was
100% using P/N for the IgM assay; 97.4% for the IgG assay. As the tests are incorporated into the diagnostic algorithm, lower cutoffs than these (MFI 500; P/N 10 for IgM and MFI 2000; P/N 20 for IgG) will be used to ensure that low positives are not missed. PRNT will remain as the
confirmatory test for all positive samples, thus weeding out false positives among the low positive, equivocal, and background responders in the MIA.
Repeatability within the plate (%CV) and reproducibility across different plates with samples prepared on different days were determined for both tests. Precision analysis using eight samples ranging from high positive to low negative was performed using 12 replicates of the samples within a single plate. The %CV of the viral antigen MFI averaged 15% for the IgM HRTV MIA and 12% for the IgG HRTV MIA. For between-plate precision analysis, the same eight samples were prepared for testing and applied to the IgM and IgG MIAs on six different days. The %CV of the viral antigen MFI averaged 18% for the IgM HRTV MIA and 7% for the IgG HRTV MIA.
Samples from confirmed cases of non-HRTV arboviral disease were tested in the HRTV IgM and IgG MIAs to determine if cross-reactivity might exist. Eight samples were IgM and IgG positive to each of the following viruses: La Crosse virus (LACV), eastern equine encephalitis virus (EEEV), West Nile virus (WNV) and Powassan virus (POWV). These arboviruses are all endemic in Missouri and the Midwestern United States. A total of 32 previously-tested diagnostic specimens showed no reaction with the HRTV antigens in either test, indicating a lack of cross- reactivity. The anti-virus antibodies tested were to an alphavirus, two flaviviruses and a California serogroup bunyavirus. Powassan virus is the only tick-borne virus that was investigated for cross- reactivity in the MIAs. Recently, Bourbon virus (Kosoy et al, Emerg Infect Dis 21(5):760-764, 2015) was newly discovered in a patient from Missouri. It is of the genus Thogotovirus (family Orthomyxoviridae) and is thought to be tick-borne. The patient was initially tested for HRTV and found to be negative; subsequent testing of sera using the MIA assays produced the same negative result, indicating a lack of cross-reactivity with this virus.
All samples tested belonged to a series of 2-4 for the individual patient, and complete results for molecular and serological assays for the 24 patients who were diagnosed with either current or past HRTV infections are shown in FIGS. 3A-3C. In current infections, IgM and IgG were both detectable using the MIAs as early as four days post-onset and as late as day 95, which was true also of the PRNT. Samples outside of this range to investigate the longevity of the antibodies were unavailable. By comparison, RT-PCR was capable of detecting RNA to HRTV in samples collected between four and 15 days after onset of symptoms. Determination of IgM presence using IFA is subjective and is not a method of choice. The addition of a viable non- subjective HRTV IgM assay such as the HRTV IgM MIA to the current repertoire of tests will allow for current infections for which RNA-containing samples are unavailable to be distinguished from past infections by showing an absence of IgM.
Similarly, the HRTV IgG assay has advantages over the current IgG ELISA, which is based upon cell lysate antigen and has shown some inconsistencies. Both MIAs are considerably faster and easier to set up than the IFA and IgG ELISAs. The use of MAbs to capture the antigen on the microspheres is a tool that is successfully employed here to alleviate the requirement for recombinant or purified viral protein, which normally is needed if the protein is to be directly linked to the microspheres. As knowledge of the geographic distribution of HRTV is gained, there may be a need to incorporate HRTV testing at some of the U.S. State Health laboratories. HRTV will likely become part of the differential diagnosis for patients with a history of tick-bite in areas with known HRTV activity, or with obvious leukopenia and thrombocytopenia. Luminex instruments are in use at many of these labs and therefore is a suitable platform for those who wish to add HRTV testing to their menus of screening methods. The efficiency with which the HRTV MIAs can be performed will simplify any serosurveillance in the human population. In addition, the HRTV IgG MIA can easily be modified to test for antibodies in wildlife populations, by using biotin to label the serum antibodies (Basile et al, Clin Vaccine Immunol 17:56-61, 2010). The MIAs proved to be accurate and precise, and will be a useful screening tool for HRTV.
In view of the many possible embodiments to which the principles of the disclosed invention may be applied, it should be recognized that the illustrated embodiments are only preferred examples of the invention and should not be taken as limiting the scope of the invention. Rather, the scope of the invention is defined by the following claims. We therefore claim as our invention all that comes within the scope and spirit of these claims.

Claims

1. An isolated monoclonal antibody specific for the nucleocapsid (N) protein of Heartland virus (HRTV), or an antigen-binding fragment thereof, wherein the monoclonal antibody or antigen-binding fragment comprises a variable heavy (VH) domain and a variable light (VL) domain, wherein the VH and VL domains respectively comprise the complementarity determining region (CDR) sequences of:
SEQ ID NO: 2 and SEQ ID NO: 4;
SEQ ID NO: 6 and SEQ ID NO: 8;
SEQ ID NO: 10 and SEQ ID NO: 12;
SEQ ID NO: 14 and SEQ ID NO: 16;
SEQ ID NO: 18 and SEQ ID NO: 20;
SEQ ID NO: 22 and SEQ ID NO: 24;
SEQ ID NO: 26 and SEQ ID NO: 28; or
SEQ ID NO: 30 and SEQ ID NO: 32.
2. The monoclonal antibody or antigen-binding fragment of claim 1, wherein the CDR sequences are CDR sequences determined by IMGT.
3. The monoclonal antibody or antigen-binding fragment of claim 2, wherein:
the VH domain comprises residues 26-35, 53-59 and 98-111 of SEQ ID NO: 2 and the VL domain comprises residues 27-32, 50-52 and 89-97 of SEQ ID NO: 4;
the VH domain comprises residues 25-33, 50-57 and 96-106 of SEQ ID NO: 6 and the VL domain comprises residues 27-32, 50-52 and 89-97 of SEQ ID NO: 8;
the VH domain comprises residues 17-24, 42-49 and 88-99 of SEQ ID NO: 10 and the VL domain comprises residues 27-31, 49-51 and 88-96 of SEQ ID NO: 12;
the VH domain comprises residues 25-33, 51-57 and 96-107 of SEQ ID NO: 14 and the VL domain comprises residues 27-32, 50-53 and 89-97 of SEQ ID NO: 16;
the VH domain comprises residues 26-33, 51-60 and 99-109 of SEQ ID NO: 18 and the VL domain comprises residues 27-31, 49-51 and 88-96 of SEQ ID NO: 20;
the VH domain comprises residues 26-34, 52-58 and 97-105 of SEQ ID NO: 22 and the VL domain comprises residues 27-31, 49-51 and 88-96 of SEQ ID NO: 24;
the VH domain comprises residues 26-33, 51-58 and 97-106 of SEQ ID NO: 26 and the VL domain comprises residues 27-32, 50-52 and 89-97 of SEQ ID NO: 28; or the VH domain comprises residues 26-33, 51-58 and 97-107 of SEQ ID NO: 30 and the VL domain comprises residues 27-32, 50-52 and 89-97 of SEQ ID NO: 32.
4. The monoclonal antibody or antigen-binding fragment of claim 1 , wherein the CDR sequences are CDR sequences determined by Kabat.
5. The monoclonal antibody or antigen-binding fragment of claim 4, wherein:
the VH domain comprises residues 31-37, 52-67 and 100-111 of SEQ ID NO: 2 and the VL domain comprises residues 24-34, 50-56 and 89-97 of SEQ ID NO: 4;
the VH domain comprises residues 30-34, 49-65 and 98-106 of SEQ ID NO: 6 and the VL domain comprises residues 24-34, 50-56 and 89-97 of SEQ ID NO: 8;
the VH domain comprises residues 22-26, 41-57 and 90-99 of SEQ ID NO: 10 and the VL domain comprises residues 24-34, 49-55 and 88-96 of SEQ ID NO: 12;
the VH domain comprises residues 30-35, 50-65 and 98-107 of SEQ ID NO: 14 and the VL domain comprises residues 24-34, 50-56 and 89-97 of SEQ ID NO: 16;
the VH domain comprises residues 31-35, 50-68 and 101-109 of SEQ ID NO: 18 and the VL domain comprises residues 24-33, 49-55 and 88-96 of SEQ ID NO: 20;
the VH domain comprises residues 31-36, 51-66 and 99-105 of SEQ ID NO: 22 and the VL domain comprises residues 24-33, 49-55 and 88-96 of SEQ ID NO: 24;
the VH domain comprises residues 31-35, 50-66 and 99-106 of SEQ ID NO: 26 and the VL domain comprises residues 24-34, 50-56 and 89-97 of SEQ ID NO: 28; or
the VH domain comprises residues 31-35, 50-66 and 99-107 of SEQ ID NO: 30 and the VL domain comprises residues 24-34, 50-56 and 89-97 of SEQ ID NO: 32.
6. The monoclonal antibody or antigen-binding fragment of any one of claims 1-5, wherein the VH domain comprises an amino acid sequence at least 90% identical to SEQ ID NO: 2, SEQ ID NO: 6, SEQ ID NO: 10, SEQ ID NO: 14, SEQ ID NO: 18, SEQ ID NO: 22, SEQ ID NO: 26 or SEQ ID NO: 30.
7. The monoclonal antibody or antigen-binding fragment of any one of claims 1-5, wherein the VH domain comprises the amino acid sequence of SEQ ID NO: 2, SEQ ID NO: 6, SEQ ID NO: 10, SEQ ID NO: 14, SEQ ID NO: 18, SEQ ID NO: 22, SEQ ID NO: 26 or SEQ ID NO: 30.
8. The monoclonal antibody or antigen-binding fragment of any one of claims 1-7, wherein the VL domain comprises an amino acid sequence at least 90% identical to SEQ ID NO: 4, SEQ ID NO: 8, SEQ ID NO: 12, SEQ ID NO: 16, SEQ ID NO: 20, SEQ ID NO: 24, SEQ ID NO: 28 or SEQ ID NO: 32.
9. The monoclonal antibody or antigen-binding fragment of any one of claims 1-7, wherein the VL domain comprises the amino acid sequence of SEQ ID NO: 4, SEQ ID NO: 8, SEQ ID NO: 12, SEQ ID NO: 16, SEQ ID NO: 20, SEQ ID NO: 24, SEQ ID NO: 28 or SEQ ID NO: 32.
10. The monoclonal antibody of any one of claims 1-9, wherein the monoclonal antibody is an IgG.
11. The antigen-binding fragment of any one of claims 1-9, wherein fragment comprises an Fab fragment, an Fab' fragment, an F(ab) ' 2 fragment, a single chain variable fragment (scFv) or a disulfide stabilized variable fragment (dsFv).
12. The monoclonal antibody or antigen-binding fragment of any one of claims 1-11, wherein the monoclonal antibody or antigen-binding fragment is a chimeric antibody comprising human and mouse amino acid sequence.
13. The monoclonal antibody or antigen-binding fragment of any one of claims 1-11, wherein the monoclonal antibody or antigen-binding fragment is humanized.
14. A fusion protein comprising the monoclonal antibody or antigen-binding fragment of any one of claims 1-13 and a heterologous protein.
15. An immunoconjugate comprising the monoclonal antibody or antigen-binding fragment of any one of claims 1-13 and a detectable label.
16. The immunoconjugate of claim 15, wherein the detectable label is a fluorescent, radioactive or enzymatic label.
17. A composition comprising the monoclonal antibody or antigen-binding fragment of any one of claims 1-13 and a pharmaceutically acceptable carrier.
18. A composition comprising the monoclonal antibody or antigen-binding fragment of any one of claims 1-13 conjugated to a microsphere.
19. The composition of claim 18, wherein the monoclonal antibody or antigen-binding fragment is chemically conjugated to the microsphere.
20. The composition of claim 18 or claim 19, wherein the microsphere comprises a fluorophore.
21. The composition of any one of claims 18-20, further comprising HRTV N protein bound to the monoclonal antibody or antigen-binding fragment.
22. A method of detecting HRTV-specific antibodies in a biological sample, comprising:
contacting the biological sample with the composition of claim 21 under conditions sufficient to allow binding of any HRTV-specific antibodies present in the biological sample to the HRTV N protein, thereby forming a microsphere immune complex;
contacting the microsphere immune complex with a labelled secondary antibody; and detecting binding of the secondary antibody to the microsphere immune complex, thereby detecting HRTV-specific antibodies present in the biological sample.
23. The method of claim 22, wherein the method is a method of detecting HRTV- specific IgM antibodies and the secondary antibody is anti-human IgM.
24. The method of claim 22, wherein the method is a method of detecting HRTV- specific IgG antibodies and the secondary antibody is anti-human IgG.
25. The method of any one of claims 22-24, wherein the secondary antibody is labelled with a fluorophore.
26. The method of any one of claims 22-25, wherein a flow cytometer is used to detect binding of the secondary antibody to the microsphere immune complex.
27. A method of detecting HRTV-specific antibodies in a biological sample, comprising:
providing the monoclonal antibody or antigen-binding fragment of any one of claims 1-13 bound to a solid support;
contacting the antibody-bound solid support with a preparation comprising HRTV N protein under conditions sufficient for the HRTV N protein to bind the monoclonal antibody or antigen- binding fragment to form an antibody- antigen complex;
contacting the antibody-antigen complex with the biological sample to allow binding of any HRTV-specific antibodies present in the sample to the HRTV N protein, thereby forming an immune complex;
contacting the immune complex with a labelled secondary antibody; and
detecting binding of the secondary antibody to the immune complex, thereby detecting HRTV-specific antibodies present in the biological sample.
28. The method of claim 27, wherein the secondary antibody is labelled with an enzyme and detecting binding of the secondary antibody to the immune complex comprises detecting enzyme activity.
29. The method of claim 28, wherein the enzyme is horseradish peroxidase or alkaline phosphatase.
30. A method of detecting HRTV-specific antibodies in a biological sample, comprising:
providing a secondary antibody bound to a solid support;
contacting the secondary antibody-bound solid support with the biological sample under conditions sufficient to allow binding of the secondary antibody to any HRTV-specific antibodies present in the biological sample, thereby forming antibody- antibody complexes;
contacting the antibody-antibody complexes with a preparation comprising HRTV N protein under conditions sufficient for the HRTV N protein to bind the HRTV-specific antibodies, thereby forming immune complexes;
contacting the immune complexes with the immunoconjugate of claim 15 or claim 16; and detecting binding of the immunoconjugate to the immune complexes, thereby detecting HRTV-specific antibodies in the biological sample.
31. The method of any one of claims 22-30, wherein the biological sample comprises serum.
32. A method of detecting HRTV in an isolated cell or tissue, comprising:
contacting the cell or tissue with the monoclonal antibody or antigen binding fragment of any one of claims 1-13, or the immunoconjugate of claim 15 or claim 16; and
detecting binding of the antibody or immunoconjugate to the cell or tissue,
wherein an increase in binding of the antibody or immunoconjugate to the cell or tissue as compared to binding of the antibody or immunoconjugate to a control cell or tissue detects HRTV in the cell or tissue.
33. A method of treating a HRTV infection in a subject, comprising administering to the subject the monoclonal antibody or antigen-binding fragment of any one of claims 1-13.
34. A nucleic acid molecule encoding a VH domain or a VL domain of the monoclonal antibody or antigen-binding fragment of any one of claims 1-13.
35. The nucleic acid molecule of claim 34, wherein the VH domain coding sequence comprises SEQ ID NO: 1, SEQ ID NO: 5, SEQ ID NO: 9, SEQ ID NO: 13, SEQ ID NO; 17, SEQ ID NO: 21, SEQ ID NO: 25 or SEQ ID NO: 29.
36. The nucleic acid molecule of claim 34, wherein the VL domain coding sequence comprises SEQ ID NO: 3, SEQ ID NO: 7, SEQ ID NO: 11, SEQ ID NO: 15, SEQ ID NO: 19, SEQ ID NO: 23, SEQ ID NO: 27 or SEQ ID NO: 31.
37. The nucleic acid molecule of any one of claims 34-36 operably linked to a promoter.
38. A vector comprising the nucleic acid molecule of any one of claims 34-37.
39. An isolated host cell transformed with the nucleic acid molecule or vector of any one of claims 34-38.
PCT/US2016/013073 2015-09-21 2016-01-12 Monoclonal antibodies specific for heartland virus and methods of their use Ceased WO2017052679A1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US15/761,789 US10584161B2 (en) 2015-09-21 2016-01-12 Monoclonal antibodies specific for heartland virus and methods of their use

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201562221431P 2015-09-21 2015-09-21
US62/221,431 2015-09-21

Publications (1)

Publication Number Publication Date
WO2017052679A1 true WO2017052679A1 (en) 2017-03-30

Family

ID=55221568

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2016/013073 Ceased WO2017052679A1 (en) 2015-09-21 2016-01-12 Monoclonal antibodies specific for heartland virus and methods of their use

Country Status (2)

Country Link
US (1) US10584161B2 (en)
WO (1) WO2017052679A1 (en)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN111194222A (en) * 2017-05-01 2020-05-22 阿吉尔瓦克斯公司 Compositions and methods related to xCT antibodies
CN119708243A (en) * 2025-02-25 2025-03-28 北京索莱宝科技有限公司 Anti-human IgM antibody or antigen binding fragment thereof and application thereof

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN116908433B (en) * 2023-06-26 2024-05-07 广州市妇女儿童医疗中心 A NEXN chemiluminescence detection kit and its application
WO2025090760A1 (en) * 2023-10-25 2025-05-01 Board Of Regents, The University Of Texas System Antibodies specific to scube3 and methods of use

Citations (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4036945A (en) 1976-05-03 1977-07-19 The Massachusetts General Hospital Composition and method for determining the size and location of myocardial infarcts
US4331647A (en) 1980-03-03 1982-05-25 Goldenberg Milton David Tumor localization and therapy with labeled antibody fragments specific to tumor-associated markers
US5585089A (en) 1988-12-28 1996-12-17 Protein Design Labs, Inc. Humanized immunoglobulins
US5800996A (en) 1996-05-03 1998-09-01 The Perkin Elmer Corporation Energy transfer dyes with enchanced fluorescence
US5866366A (en) 1997-07-01 1999-02-02 Smithkline Beecham Corporation gidB
US20060115896A1 (en) 2002-03-11 2006-06-01 Wong Susan J Diagnostic test for west nile virus
WO2013142808A1 (en) 2012-03-23 2013-09-26 The Government Of The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services Pathogenic phlebovirus isolates and compositions and methods of use

Patent Citations (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4036945A (en) 1976-05-03 1977-07-19 The Massachusetts General Hospital Composition and method for determining the size and location of myocardial infarcts
US4331647A (en) 1980-03-03 1982-05-25 Goldenberg Milton David Tumor localization and therapy with labeled antibody fragments specific to tumor-associated markers
US5585089A (en) 1988-12-28 1996-12-17 Protein Design Labs, Inc. Humanized immunoglobulins
US5800996A (en) 1996-05-03 1998-09-01 The Perkin Elmer Corporation Energy transfer dyes with enchanced fluorescence
US5866366A (en) 1997-07-01 1999-02-02 Smithkline Beecham Corporation gidB
US20060115896A1 (en) 2002-03-11 2006-06-01 Wong Susan J Diagnostic test for west nile virus
WO2013142808A1 (en) 2012-03-23 2013-09-26 The Government Of The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services Pathogenic phlebovirus isolates and compositions and methods of use

Non-Patent Citations (67)

* Cited by examiner, † Cited by third party
Title
"Antibody Stabilizer", BOCA SCIENTIFIC
"Molecular Biology and Biotechnology: a Comprehensive Desk Reference", 1995, VCH PUBLISHERS, INC.
"Pierce Catalog and Handbook, 1994-1995", PIERCE CHEMICAL CO.
"The Encyclopedia of Molecular Biology", 1994, BLACKWELL SCIENCE LTD.
A. MUEHLENBACHS ET AL: "Heartland Virus-Associated Death in Tennessee", CLINICAL INFECTIOUS DISEASES, vol. 59, no. 6, 15 September 2014 (2014-09-15), US, pages 845 - 850, XP055267701, ISSN: 1058-4838, DOI: 10.1093/cid/ciu434 *
AL-LAZIKANI ET AL., JMB, vol. 273, 1997, pages 927 - 948
ALTSCHUL ET AL., J. MOL. BIOL., vol. 215, 1990, pages 403
ALTSCHUL ET AL., NATURE GENET., vol. 6, 1994, pages 119
BASILE ET AL., CLIN VACCINE IMMUNOL, vol. 17, 2010, pages 56 - 61
BENJAMIN LEWIN: "Genes V,", 1994, OXFORD UNIVERSITY PRESS
BESSELAAR; BLACKBURN, ARCH VIROL, vol. 121, 1991, pages 111 - 124
BOSHRA ET AL., VACCINE, vol. 29, 2011, pages 4469 - 4475
CALVERT AMANDA E ET AL: "Development and Characterization of Monoclonal Antibodies Directed Against the Nucleoprotein of Heartland Virus", THE AMERICAN JOURNAL OF TROPICAL MEDICINE AND HYGIENE, AMERICAN SOCIETY OF TROPICAL MEDICINE AND HYGIENE, USA, vol. 93, no. 6, 1 December 2015 (2015-12-01), pages 1338 - 1340, XP009189735, ISSN: 1476-1645 *
CANTY: "Boot: Bootstrap R (S-Plus) Functions", R PACKAGE VERSION 1.3-13, 2014
CHOTHIA ET AL., NATURE, vol. 342, 1989, pages 877
CHOTHIA; LESK, J MOL BIOL, vol. 196, 1987, pages 901 - 917
CORPET ET AL., NUCLEIC ACIDS RESEARCH, vol. 16, 1988, pages 10881
DAVISON: "Bootstrap methods and their applications", 1997, CAMBRIDGE PRESS
E.W. MARTIN: "Remington's Pharmaceutical Sciences", 1975, MACK PUBLISHING CO.
EARLEY ET AL., CYTOMETRY, vol. 50, 2002, pages 239 - 242
FUXUN YU ET AL: "Application of recombinant severe fever with thrombocytopenia syndrome virus nucleocapsid protein for the detection of SFTSV-specific human IgG and IgM antibodies by indirect ELISA", VIROLOGY JOURNAL, vol. 20, no. 1, 4 August 2015 (2015-08-04), pages 784, XP055267621, DOI: 10.1186/s12985-015-0350-0 *
GOODMAN ET AL., J VIROL METHODS, vol. 208, 2014, pages 66 - 78
GUO ET AL., CLIN VACCINE IMMUNOL, vol. 20, 2013, pages 1426 - 1432
HARLOW; LANE: "Antibodies: A Laboratory Manual", 1988, COLD SPRING HARBOR LABORATORY
HEYDUK; HEYDUK, ANALYT. BIOCHEM., vol. 248, 1997, pages 216 - 227
HIGGINS; SHARP, CABIOS, vol. 5, 1989, pages 151
HIGGINS; SHARP, GENE, vol. 73, 1988, pages 237
J. BIOL. CHEM., vol. 274, 1999, pages 3315 - 3322
J. M. FAFETINE ET AL: "Generation and Characterization of Monoclonal Antibodies Against Rift Valley Fever Virus Nucleoprotein", TRANSBOUNDARY AND EMERGING DISEASES, vol. 60, 8 November 2013 (2013-11-08), pages 24 - 30, XP055268678, ISSN: 1865-1674, DOI: 10.1111/tbed.12140 *
JANSEN VAN VUREN ET AL., PLOS ONE, vol. 6, 2011, pages E25027
JIAO ET AL., J CLIN MICROBIOL, vol. 50, 2012, pages 372 - 377
JIN ET AL., PROC NATL ACAD SCI USA, vol. 109, 2012, pages 10053 - 10058
JOHNSON ET AL., CLIN DIAGN LAB IMMUNOL, vol. 12, 2005, pages 566 - 574
KABAT ET AL.: "Sequences of Proteins of Immunological Interest", 1991, U.S. DEPARTMENT OF HEALTH AND HUMAN SERVICES
KELLAR ET AL., CYTOMETRY, vol. 45, 2001, pages 27 - 36
KOSOY ET AL., EMERG INFECT DIS, vol. 21, no. 5, 2015, pages 760 - 764
KUBY, J.: "Immunology", 1997, W. H. FREEMAN & CO.
LAMBERT; LANCIOTTI, J CLIN MICROBIOL, vol. 47, 2009, pages 2398 - 2404
LAURA K. MCMULLAN ET AL: "A New Phlebovirus Associated with Severe Febrile Illness in Missouri", NEW ENGLAND JOURNAL OF MEDICINE, vol. 367, no. 9, 30 August 2012 (2012-08-30), pages 834 - 841, XP055065434, ISSN: 0028-4793, DOI: 10.1056/NEJMoa1203378 *
LAURA K. MCMULLAN ET AL: "A New Phlebovirus Associated with Severe Febrile Illness in Missouri", NEW ENGLAND JOURNAL OF MEDICINE, vol. 367, no. 9, 30 August 2012 (2012-08-30), US, pages 834 - 841, XP055268680, ISSN: 0028-4793, DOI: 10.1056/NEJMoa1203378 *
LEFRANC, NUCLEIC ACIDS RES, vol. 29, 2001, pages 207 - 209
LINDSEY ET AL., J CLIN MICROBIOL, vol. 4, 1976, pages 503 - 510
LIU ET AL., J VIROL, vol. 88, 2014, pages 1781 - 1786
LUNDKVIST ET AL., ARCH VIROL, vol. 130, 1993, pages 121 - 130
MAGURANO; NICOLETTI, CLIN DIAGN LAB IMMUNOL, vol. 6, 1999, pages 55 - 60
MARTIN ET AL., J CLIN MICROBIOL, vol. 38, no. 5, 2000, pages 1823 - 1826
MARTIN-FOLGAR ET AL., MABS, vol. 2, 2010, pages 275 - 284
MARTIN-FOLGAR RAQUEL ET AL: "Development and characterization of monoclonal antibodies against Rift Valley fever virus nucleocapsid protein generated by DNA immunization", MABS, LANDES BIOSCIENCE, US, vol. 2, no. 3, 1 May 2010 (2010-05-01), pages 275 - 284, XP009189743, ISSN: 1942-0862 *
MCMULLAN ET AL., N ENGL J MED, vol. 367, 2012, pages 834 - 841
MCMULLAN, N ENGL J MED, vol. 367, 2012, pages 834 - 841
NAKAMURA ET AL., ARCH VIROL, vol. 86, 1985, pages 109 - 120
NEEDLEMAN; WUNSCH, J. MOL. BIOL., vol. 48, 1970, pages 443
PASTULA ET AL., MMWR MORB MORTAL WKLY REP, vol. 63, 2014, pages 270 - 271
PAWESKA ET AL., J VIROL METHODS, vol. 127, 2005, pages 10 - 18
PAWESKA, VET MICROBIOL, vol. 127, 2008, pages 21 - 28
PEARSON; LIPMAN, PROC. NATL. ACAD. SCI. U.S.A., vol. 85, 1988, pages 2444
SAVAGE ET AL., AM J TROP MED HYG, vol. 89, 2013, pages 445 - 452
SCHWARZ ET AL., J MED VIROL, vol. 49, 1996, pages 83 - 86
SMITH; WATERMAN, ADV. APPL. MATH., vol. 2, 1981, pages 482
STORCH: "Diagnostic virology", 2007, LIPPINCOTT, WILLIAMS AND WILKINS
SWANEPOEL ET AL., J HYG (LOND, vol. 97, 1986, pages 317 - 329
TARDEI ET AL., J CLIN MICROBIOL, vol. 38, no. 6, 2000, pages 2232 - 2239
VAN DEN BROEK ET AL., J VIROL, vol. 69, 1995, pages 4792 - 4796
XU ET AL., PLOS PATHOG, vol. 7, 2011, pages EL002369
YOSHIMATSU ET AL., ARCH VIROL, vol. 130, 1993, pages 365 - 376
YU ET AL., PLOS ONE, vol. 7, 2012, pages E38291
YU, N ENGL J MED, vol. 364, 2011, pages 1523 - 1532

Cited By (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN111194222A (en) * 2017-05-01 2020-05-22 阿吉尔瓦克斯公司 Compositions and methods related to xCT antibodies
EP3618869A4 (en) * 2017-05-01 2021-01-20 Agilvax, Inc. COMPOSITIONS AND METHODS RELATED TO xCT ANTIBODIES
CN119708243A (en) * 2025-02-25 2025-03-28 北京索莱宝科技有限公司 Anti-human IgM antibody or antigen binding fragment thereof and application thereof
CN119708243B (en) * 2025-02-25 2025-06-10 北京索莱宝科技有限公司 Anti-human IgM antibody or antigen-binding fragment thereof and application thereof

Also Published As

Publication number Publication date
US20180244757A1 (en) 2018-08-30
US10584161B2 (en) 2020-03-10

Similar Documents

Publication Publication Date Title
JP7235256B2 (en) Antibody that binds to outer membrane glycoprotein of severe fever with thrombocytopenic syndrome virus and use thereof
KR102595764B1 (en) Novel antibody specifically binding to Zika virus epitope and use thereof
AU2007353481B2 (en) H5 subtype-specific binding proteins useful for H5 avian influenza diagnosis and surveillance
US9523686B2 (en) Methods and materials for the detection of dengue virus infection
CN115768790A (en) Human monoclonal antibodies against severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
JP5998222B2 (en) Binding molecule with neutralizing activity of influenza A virus produced in human B cells
US11054423B2 (en) Antibody-mediated neutralization of ebolaviruses
WO2023130770A1 (en) Fully human broadly neutralizing antibody zw2g10 against novel coronavirus and application thereof
JP2010538291A (en) Anti-chikungunya monoclonal antibody and use thereof
JP7463366B2 (en) Novel anti-Zika virus antibodies and uses thereof
AU2022221297A1 (en) Antibodies targeting the spike protein of coronaviruses
CA2982491A1 (en) Antibody-mediated neutralization of chikungunya virus
WO2015196192A2 (en) Methods and compositions relating to dengue virus
US10584161B2 (en) Monoclonal antibodies specific for heartland virus and methods of their use
JP2005531286A (en) Human monoclonal antibody Fab fragment directed against HCVE2 glycoprotein and having in vitro neutralizing activity
WO2013043125A1 (en) Enterovirus 71 specific antibodies and uses thereof
US11267872B2 (en) Polyclonal antibodies produced using HIV-1 trimeric envelope glycoprotein subunits
TW202000696A (en) Anti-dengue virus antibodies and applications thereof
US20240182551A1 (en) Cross-reactive monoclonal antibodies against coronaviruses
KR20230124282A (en) Antibody for Detection Specific for Non-structural protein 1 of ZIKA virus and Use thereof
CN121758601A (en) An anti-P24 antibody and its application
CA2332651A1 (en) Construction and characterization of monoclonal antibodies against western equine encephalitis virus
HK1161725B (en) H5 subtype-specific binding proteins useful for h5 avian influenza diagnosis and surveillance

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 16701388

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 15761789

Country of ref document: US

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 16701388

Country of ref document: EP

Kind code of ref document: A1