WO2017047846A1 - 아르기닌화된 er 단백질에 특이적으로 결합하는 항체 및 이의 용도 - Google Patents

아르기닌화된 er 단백질에 특이적으로 결합하는 항체 및 이의 용도 Download PDF

Info

Publication number
WO2017047846A1
WO2017047846A1 PCT/KR2015/009820 KR2015009820W WO2017047846A1 WO 2017047846 A1 WO2017047846 A1 WO 2017047846A1 KR 2015009820 W KR2015009820 W KR 2015009820W WO 2017047846 A1 WO2017047846 A1 WO 2017047846A1
Authority
WO
WIPO (PCT)
Prior art keywords
protein
bip
antibody
arginated
terminal
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/KR2015/009820
Other languages
English (en)
French (fr)
Inventor
권용태
김보연
차현주
유영동
황준성
김경아
문수란
지창훈
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Korea Research Institute of Bioscience and Biotechnology KRIBB
SNU R&DB Foundation
Original Assignee
Korea Research Institute of Bioscience and Biotechnology KRIBB
Seoul National University R&DB Foundation
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Korea Research Institute of Bioscience and Biotechnology KRIBB, Seoul National University R&DB Foundation filed Critical Korea Research Institute of Bioscience and Biotechnology KRIBB
Priority to PCT/KR2015/009820 priority Critical patent/WO2017047846A1/ko
Publication of WO2017047846A1 publication Critical patent/WO2017047846A1/ko
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/569Immunoassay; Biospecific binding assay; Materials therefor for microorganisms, e.g. protozoa, bacteria, viruses

Definitions

  • Antibodies that specifically bind to arginated ER proteins and uses thereof
  • the present invention relates to an antibody that specifically binds to an arginylated protein, an immunomodulator using the antibody, and a virus or bacterial infection diagnosis and a method for screening a therapeutic agent.
  • the body's immune response to foreign antigens can be broadly divided into innate immune response and adaptive immune response. Can be.
  • the pathogen When the human body is infected with a pathogen, the pathogen must first contact the host in order to cause the disease, and then create an infectious agent, since these pathogens have different surface structures and pathological mechanisms, and thus the defense mechanisms that arise from the host's immune response system.
  • the epithelial surface of the body protects the body from pathogens, prevents colonization and adhesion, and blocks viruses and bacteria entering the cell through specialized cell surface devices that secrete antimicrobial enzymes and peptides.
  • bacteria, viruses, or parasites that penetrate these barriers encounter macrophages that have surface receptors that can readily bind to various types of pathogens for phagocytosis, which causes an inflammatory reaction. This results in the accumulation of phagocytic neutrophils in the plasma protein and in the place of infection containing complement components that provide humoral intrinsic immunity.
  • Intrinsic immunity is directly involved in infection with the same or other pathogens, leading to first-class host defense through an immediate effect mechanism, which in turn prevents frequent infections of the body.
  • Autophagy is a new type of cell regulatory mechanism, While known natural deaths and necrosis only deal with cell death, they are associated with the death and regeneration of intracellular organelles such as mitochondrial plasma.
  • Intracellular organelles have been thought to remain static at normal times, but recent studies have shown that they continue to die and regenerate under normal circumstances. This process destroys the old, degenerative intracellular organelles, providing a nutrient source for regenerating new intracellular organelles. Autophagy protects the entire cell from death through the death and regeneration of these intracellular organelles, and induces the death of the whole cell.
  • the physiological function and clinical significance of endless death and regeneration of intracellular organelles by autophagy have been unclear, but recent researches have suggested the relationship between autophagy and various diseases or aging. In addition, it has been found that autophagy plays an important role in cancer, neurodegenerative diseases, etc., but it is unknown what role autophagy plays in the immune response.
  • N-end rule pathway is a proteolytic system of N-terminal residues that acts as the degron's essential determinant, called N-degron. (proteolytic system).
  • N-degron proteolytic system
  • These degrones have specific recognition, such as the family of UBR box-containing proteins known to promote polyubiquitination of proteins and selective proteolysis by proteasomes. It is recognized by the element [N-recognin].
  • Substrates of N-recognin are arginine (Arg), lysine, Lys, and histidine (N-terminal) positively charged exposed by endoproteolytic cleavage. His) Same type 1, and bulky hydrophobic phenylalanine (phenylalanine, Phe), tyrosine (tyrosine, Tyr), tryptophane (Trp), leucine (Leu) and isoleucine (isoleucine, lie) And type 2 residues.
  • Arg Tegron is produced by being exposed by being cut by a peptide internal hydrolase (endopeptidase) such as caspase or separase.
  • ER is rich in pro-N-de because the new N ⁇ -terminal groups are exposed when the signal sequence of the secreted proteins, which make up about one third of the human protein, is translocation into the ER by a signal peptide hydrolase. Is the source of the gron. In principle, the cleavage can produce potentially labile N-terminus under N-terminal law procedure if exposed to the cytoplasm. Accordingly, the present inventors have made efforts to develop a method for screening immunomodulators, and have produced an antibody that specifically binds to an arginated ER protein, and the ER-existing protein of ATE1 R-transferase using the antibody.
  • N-terminal argination effect of the phosphorus Bip protein, dsDNA as part of the intrinsic immune system of the arginated protein and cytoplasmic positioning by direct confirmation of the effect of inducing autophagic vacuoles to the target The present invention has been completed by revealing that an antibody that specifically binds to ER protein can be usefully used for immunomodulatory and virus or bacterial infection diagnosis and therapeutic screening methods.
  • an antibody that specifically binds to an arginylated (arginyl at ion) protein.
  • the present invention also provides a kit for diagnosing a viral or bacterial infection comprising an antibody that specifically binds to an arginated protein.
  • the present invention provides an immunomodulator screening kit comprising an antibody that specifically binds to an arginated protein.
  • a virus therapeutic screening method comprising the step of measuring the level and the arginated protein in the experimental group treated with the test compound and virus, and the control treated with the virus.
  • Argination occurs at the N-terminus of the ER protein by ATE1 R-transferase, and the arginated ER protein is autophagi c vacuoles for cytosolic local i zat ion and target.
  • the cytosolic dsDNA Induced by the cytosolic dsDNA as part of the innate immune system (innate i une system), the cytosolic dsDNA induces argination of the ER protein in an ATE1-dependent manner.
  • the arginated ER protein is a target of autophagosomes that induces autophagi c degradat ion.
  • the antibody which specifically binds to the arginated ER protein of the present invention can detect the arginated ER protein significantly, and thus, kits for immunomodulator screening, diagnosis of viral or bacterial infections, immunomodulators And virus therapeutic screening methods.
  • FIG. La is a diagram showing sequence alignment of Bip proteins from various species.
  • Lb and lc show the results of cycloheximide digestion analysis in 100 nM tappsigargin in the absence (b) or presence (c) for 16 hours.
  • FIG. Le is a diagram showing the results of immunoblotting of HeLa cell lines expressing ATE1 isoform.
  • is a total extract of HeLa cell line expressing ATE1 1A7A (total extract,
  • cytosolic fraction (Cyt), and the microsomal fraction (Mic) are classified into cells, followed by cell fraction analysis.
  • Figure lg is a diagram showing the results of cyclonucleide digestion analysis of ATE1 1A7A -expressing HeLa cell line.
  • Figure lh shows the results of immunoblotting of HeLa cell lines expressing Bip-flag-KDEL or Bip-E19V-Hag-KDEL.
  • Figures li and lj show the results of immunoblotting of HeLa cell lines expressing Ub ⁇ X-Bip-myc / his when coexpressed with or without si NA (j) for ATEl 1A7A (i) or ATE1 .
  • 2A and 2B show immunoblotting results after transfection of a HeLa cell line with plasmid (a) or poly (dA: dT) dsDNA (b).
  • 2C shows immunoblotting of phosphorylated IRF3 and R-Bip after co-transfection with 0.5 ⁇ g / mi poly (dA: dT) or 10 nM siRNA against ATE1 in HeLa cell lines The results are shown.
  • 2d is a diagram showing the results of immunoblotting after transfection with pcDNA3.1 in the presence or absence of lipofectamine LTX in HeLa cell line.
  • FIG. 2F shows the luciferase reporter assay after treatment with poly (dA: dT) in combination with ATE1-knockdown or ATE1 1A7A overexpression in an IgK-IFN ⁇ -Luc-expressing HeLa cell line. to be.
  • 3A and 3B show RFP signals (red) showing LC3—positive autophagic vacuoles after treatment with poly (dA: dT) in HeLa cell lines stably expressing RFP-GFP-LC3. Compared with the results of immunostaining of R-Bip (A) or p62 (B).
  • FIG. 3C shows RFP signals (red) showing LC3-positive autophagic vacuoles following treatment of poly (dA: dT) with ATE1 and Bip siRNAs in HeLa cell lines stably expressing RFP-GFP-LC3 It shows the result of immunostaining of R-Bip compared to the color).
  • Figure 4a is a HeLa cell line stably expressing RFP-GFP-LC3
  • X-Bip-RFP fluorescence was compared to GFP-LC3 fluorescence (green) for immunohistochemistry. This figure was confirmed by a chemical test.
  • 4C shows LC3 fluorescence (green) in comparison to R _ B i pi9-io6_ YFp fluorescence (red) in HeLa cell line transiently expressing Ub-R-Bip 19 — 106 -YFP This is confirmed by immunohistochemistry.
  • 5A and 5B show the results of immunoblotting with FK antibody after treatment with geldanamycin (a) or various stress sources (b) in HeLa cell lines:
  • A23187 calcium carrier (calcium i onophor e);
  • CCCP carbonyl cyanide m-chlorophenylhydrazone (m— ch 1 oropheny 1 hydr azone) [prot onophore (H + ionophore) and mitocon H laa Anticoupler of oxidative phosphorylated ion;
  • BafAl bafilomycin A1.
  • Figure 5c is a diagram showing the correlation between arginization and ubiquitination in DNA induced endogenous immune response.
  • 5d is a diagram showing the results of immunoblotting of HeLa cell lines expressing a mutant in which Ub-HA or Lys is converted to Arg and ubiquitination is terminated.
  • Figure 5e is a HeLa cell line converting 1 i / u poly (dA: dT) dsDNA well, and then, immunostaining of FK2, R-Bip or p62 antibody.
  • FIG. 7A shows a step-diluted anti—R-Bip antibody and an immobilized 11-mer R-Bip peptide (R-Bip-peptide) floating on the N-terminal end of R-Bip in 96-well plate. And then incubated with an anti-goat secondary antibody bound to horseradish peroxide, and then the amount of R-Bip antibody binding to the immobilized R-Bip peptide was determined by the OD value at 450 nm of the secondary antibody. Based on the determination, the peptide competition assay was performed. Bip-peptide as a control, 10-mer peptides were used which stood at the N-terminal portion of the non-arginated Bip.
  • 7B is a diagram illustrating peptide competition assays after anti-R-Bip antibodies were cultured alone or in combination with R-Bip-peptides or Bip-peptides.
  • FIG. 7C shows peptide competition assays using R-CRT-peptide and CRT-peptides, respectively, which accentuate the N-terminal portion of arginated or non-arginated CRTs.
  • FIG. 7D is a diagram showing peptide competition analysis using R-PDI-peptide and PDI-peptide, each of which is bound to the N-terminal portion of PDI, which is either arginated or unarginated.
  • FIG. 7E is a dot blot analysis of anti-R-Bip antibodies against peptides floating on the N-terminal region of unarginated (E-peptide) or arginated (R-peptide) Bip The results are shown.
  • 8A shows a schematic of the ATE1 gene and its spliced isoform.
  • 8B is a diagram showing the results of immunoblotting over time of R-Bip, Bip and LC3 in HeLa cell lines transiently expressing ATE1 1A7A or treated with cyclonucleosides .
  • 8C is a diagram illustrating argination of Bip after ATE1-knockdown in HeLa cell lines expressing ⁇ .
  • Figure 8d is a diagram showing the results of immunoblotting after transfection of plasmid expressing ATE1 1A7A in HeLa cell line.
  • FIG. 8E shows the full length compared to Ub-X—Bip—myc / his, which is cleavage ((: 01; ⁇ 11310 101131 cleavage) by Ub hydrolases at the Ub-Bi junction. It is a figure which shows schematic diagram of Bip.
  • Figures 9a and 9b is a diagram showing the results of immunoblotting after infecting the HeLa cell line lipofectamine LTX alone or various DNA forms.
  • 9C expresses siRNA # 204 and NHK-GFP for ATE1 in HeLa cell lines. After co-transfection with the plasmid, the cells were classified into cell substrates and immunoblot is shown.
  • 9d is a diagram showing the results of immunostaining of R-Bip after co-transfection with a mixture of NHK-GFP plasmid and ATE1 siRNA # 204 in HeLa cell line, compared to NHK-GFP fluorescence.
  • Figure 11a is a diagram showing the result of performing immunoblot after transfection with HeLa cell line with poly (dA: dT) dsDNA or 5 'ppp-dsRNA.
  • FIG. Lib shows NF- ⁇ ⁇ p50 and immunostaining results in HeLa cell lines (3 ⁇ 10 6 / well) treated with 0.5 / well poly (dA: dT) dsDNA for 16 hours.
  • 11C is a diagram showing the results of immunoblotting after transfection with HeLa cell line with ATE1 siRNA.
  • Figure lid shows the results of immunoblotting of R-Bip and LC3 after transfection with HeLa cell line with poly (dA: dT).
  • Figure lie shows control and ATE1 _ / — MEF transfected with IgK-IFN ⁇ -Luc reporter plasmid expressing luciferase from the interferon- ⁇ promoter, followed by 18 hours after transfection with poly (dA: dT) dsDNA.
  • dual luciferase activity - a diagram showing a result of measurement using a luciferase reporter assay systems (dual-Luci f erase reporter assay system, Promega), and a Wallac Victor 2 (Wal lac VICTOR 2, Perkin Elmer).
  • RFP signal red
  • poly (dA: dT) dsDNA or 5′ppp dsRNA in HeLa cell line stably expressing RFP-GFP-LC3 Shows the results of immunostaining of R-Bip.
  • Figure 12b is a diagram showing the immunostaining results of R-Bip and p62 after treatment with poly (dA: dT) dsDNA or 5 'ppp dsRNA in HeLa cell line.
  • Figure 13 shows a schematic of the Bip protein expressed using the Ub fusion technique:
  • Figure 14a is a HeLa cell line stably expressing YFP-LC3
  • Figure 15a is a diagram showing the results of immunoblotting over time after the heat shock (heat shock) at 42 ° C treated HeLa cell line.
  • Figure 15b is a diagram showing the results of immunoblotting with polyubiquitin chain-specific FK antibody after treatment with HeLa cell line with various stress sources:
  • A23187 calcium ionophore
  • CCCP carbonyl cyanide m-chlorophenylhydrazone [protonophore (H + ionophore) and oxidative phosphorylation in mitochondria - ⁇ Uncoupler];
  • FIG. 15C is a diagram showing the result of performing the immunoblotting after transfection with a plasmid expressing CL1-YFP or its control group in the HeLa cell line (left).
  • Fig. 1 shows immunoprecipitation results with GFP antibodies capable of binding to both CL1-YFP and EGFP (right).
  • FIG. 15D shows polyubiquitination using FK2 antibody capable of binding to both polyubiquitin conjugates and free Ubs after treatment with poly (dA: dT) dsDNA in He cell lines, as compared to R-Bip and p62 Figure shows the immunostaining results of the protein. [Best form for implementation of the invention]
  • the present invention provides an antibody that specifically binds to an arginylat ionized protein. .
  • the protein is preferably an ER (Endopl aside Ret iculum) protein,
  • BIP BIP
  • CRT CRT
  • PE PE
  • the BIP protein has an amino acid sequence as set out in SEQ ID NO: 1
  • the CRT protein has an amino acid sequence as set out in SEQ ID NO: 2
  • the PDI protein has an amino acid sequence as set forth in SEQ ID NO: 3, but is not limited thereto.
  • the N ⁇ terminal Glul9 of the BIP protein, the N-terminal Glul8 of the CRT protein, or the ⁇ -terminal Aspl8 of the ⁇ ) ⁇ protein are arginated, and the arginated protein is ATE1 R-transferase. More preferably, the N-terminal Glul9 of the BIP protein, the N-terminal Glul8 of the CRT protein, or the N-terminal Aspl8 of the PDI protein are induced through argination or an endogenous immune response to the double stranded DNA (dsDNA). It doesn't work.
  • the arginated protein is induced by a mi sfolded cytoplasmic protein and co-located with autophagic vacuoles Argination of the N-terminal Glul8 of the BIP protein, the N-terminal Glul8 of the CRT protein, or the N-terminal Aspl8 of the PDI protein, which forms a puncta, results in autophagy N-degron to deliver the protein to the autophagosome. It is preferred to act as, but is not limited thereto.
  • the present inventors Bip (NCBI Reference Sequence: NP_005338) (SEQ ID NO: 1), CRT (NCBI Reference Sequence: NP_004334) (SEQ ID NO: 2), PDI ((NCBI Reference Sequence: NP_000909)
  • a peptide polynucleotide sequence corresponding to the N-terminal sequence of the arginated mature protein, wherein the rabbit polyclonal antibody specific for the arginated form (R-Bip, R-CRT, R-PDI) of (SEQ ID NO: 3) is REEEDKKEDVGC (SEQ ID NO: 4), REPAVYFKEQ (SEQ ID NO: 5), and RDAPEEEDHVL (SEQ ID NO: 6), respectively prepared, and then the specificity of the antibody was confirmed, the antibody of the present invention is more arginine than the non-arginated peptide It has been shown to bind more favorably to the normalized form (R-B
  • Full antibodies are structures having two full length light chains and two full length heavy chains, each light chain
  • the total antibody comprises IgA, IgD, IgE, IgM and IgG
  • IgG is a subtype and includes IgGl, IgG2, IgG3 and IgG4.
  • a fragment having a function and includes Fab, Fab 'F (ab') 2, Fv, etc.
  • the Fab is a variable region of the light and heavy chains, a constant region of the light chain and a first constant region of the chain (CH1). Domain) Has a single antigen-binding site in the structure.
  • Fab ' is at least one cysteine at the C terminus of the heavy chain CH1 domain It differs from Fab in that it has a hinge region containing residues.
  • F (ab ') 2 antibodies are produced by disulfide bonds of cysteine residues in the hinge region of Fab'.
  • Fv (var iable fragment) means a minimum antibody fragment having only the heavy chain variable region and light chain variable region.
  • Double-chain Fv (dsFv) is a disulfide bond is linked to the heavy chain variable region and light chain variable region, and short-chain Fv (scFV) is generally covalently linked to the variable region of the heavy chain and light and variable regions through a peptide linker.
  • Such antibody fragments can be obtained using proteolytic enzymes (e.g., the entire antibody can be restricted to papain and Fabs can be obtained and pepsin can be used to obtain F (ab ') 2 fragments). Can be produced through genetic recombination technology.
  • the present invention also provides a kit for diagnosing a virus or a bacterial infection comprising an antibody that specifically binds to an arginylat ionized protein.
  • the present invention also provides an immunomodulator comprising an antibody specifically binding to an arginylat ionized protein, and a kit for screening a virus or a bacterial infection therapeutic agent.
  • the protein is preferably an ER (Endoplasmic Ret iculum) protein, more preferably any one selected from the group consisting of BIP, CRT, and PDI, wherein the BIP protein has an amino acid sequence as set forth in SEQ ID NO: 1,
  • the CRT protein has an amino acid sequence set forth in SEQ ID NO: 2, and the PDI protein most preferably has an amino acid sequence set forth in SEQ ID NO: 3, but is not limited thereto.
  • the arginated protein is preferably N-terminal Glul9 of the BIP protein, N-terminal Glul8 of the CRT protein, or N-terminal Aspl8 of the PDI protein is arginated by arginine :
  • the arginated protein is BIP by ATE1 R-transferase.
  • N-terminal Glul9 of the protein, N-terminal Glul & of the CRT protein, or N-terminal Aspl8 of the PDI protein are more preferably induced through argination or endogenous immune response to double-stranded DNA (dsDNA). Do not.
  • the arginated protein is induced by a misfolded cytoplasmic protein, forms a cytoplasmic point (puncta) colocated with autophagic vacuoles, and the N-terminal Glul9, CRT protein of BIP protein.
  • Argination of the N-terminal Gplul8 or the N-terminal Aspl8 of the PDI protein preferably acts as an autophagy N-degron for delivery of the protein to the autophagosome.
  • the inventors performed analysis of putative N-degrons in ER (endoplasmic reticulum), and when analyzing the P1 'residues of the signal peptide cleavage site, approximately 27% ( 132 of 498) exposed N-terminal residues in an unstable state, confirming that they were significantly lower compared to the existing N-Degron code, which included 13 of 20 amino acids (SMSriram). et al. Nature Rev. Mo 1 Cell Biol. 12, 735 (2011)). As a result of reviewing various literatures, most of the N-end ' rule substrates identified so far are N-terminal Arg or pro-N-degrons (Asn, Gin, Cys, Asp, Glu) N-terminal Arg).
  • ATE1 1A7A was a major R-transferase for Bip, CRT and PDI (see FIGS. Le and 8b to 8d).
  • About 70% of the R-Bip produced by ATE1 1A7A was detected from the soluble fraction (see Figure If), while the non- arginated (lumen's) Bip was markedly short-lived, while the (cytoplasmic) R -Bip was relatively long in life ( Figure lg), which confirmed that Bip of lumen was metabolized to some extent through retrotranslocation and argination (see Figure lg).
  • ⁇ 1A7A overexpression readily induced argination of recombinant Bip exposed to N-terminal Ghil9, as a result of confirming whether Bip argination occurs in N-terminal GluW. It was confirmed that ATE1 1A7A mediated argination was inhibited while being stabilized by (see FIGS. Lh to lj). Thus, it was confirmed that Bip was arginated by ATE1 R-transferase at its N-terminal Glul9 in vivo.
  • argination of ER protein is induced through an intrinsic immune response to double-stranded DNA (dsDNA) (see FIGS. 2A, 9A and 9B), and induced by double-stranded DNA. It was confirmed that ATE1 plays a role in Bip argination (see FIGS. 9C and 9D). Also, unlike double-stranded DNA (dsDNA), double-stranded RNA (dsR A) has a relatively inducible activity for inducing argination. Weak spots were identified (see FIG. 11A).
  • cytoplasmic dsDNA triggers retrotranslocat ion and ATE-1 dependent argination of several Ca ++-coupled ER chaperones.
  • argination of Bip, PDI, and CRT is strongly induced by cytoplasmic poly (dA: dT) dsDNA, an immunostimulatory reagent that expresses viral dsDNAs (see FIGS. 2B, 11A-11C). It was confirmed that ATE1-dependent argination of ER presence plays an important role in cytoplasmic intrinsic immune response to dsDNA.
  • R-Bip plays a role in the autophagy pathway during DNA-induced endogenous immune response, and cytoplasmic dsDNA induces both Bip argination and autophagy.
  • R-Bip is delivered to autophagy fear, suggesting that R-Bip plays a role in autophagy degradation of cellular components (const i tuents) during dsDNA triggered intrinsic immune response. (See FIG. 3 and FIG. 12).
  • N-terminal Arg acts as an autophagy N-degron necessary for Bip to be targeted to autophagosomes, and thus argination targets Bip and other cytoplasmic ER proteins to autophagy. It was confirmed that autophagy produced N-degron (see FIGS. 4 and 14).
  • argination correlated with misfolded cytoplasmic protein As a result, argination of ER protein is induced by misfolded cytoplasmic protein. Therefore, arginated ER chaperone is metabolized with misfolded cytoplasmic protein. (turnover), it was confirmed (see Fig. 5 and 15).
  • R-Bip plays a role in autophagy clearance, confirming that its N-terminal Arg is through its ability to act as trans-acting N-degron for i sfolded protein cargo (FIG. 5E). And FIG. 15D).
  • the ER protein of the present invention generates argination at the N-terminus by ATE1 R-transferase, and the arginated ER protein is cytosolic (local cytosol) and autophagy to the target (autophagi c).
  • the cytosolic dsDNA is induced, and the cytosolic dsDNA induces argination of the ER protein in an ATE1-dependent manner, which is misfolded in the cytoplasm.
  • Kits of the present invention may include one or more other component compositions, solutions or devices suitable for analytical methods, as well as antibodies that selectively recognize arginated ER proteins for measuring expression levels of arginated ER proteins. . Specifically, the arginated ER of the present invention.
  • Kits for measuring the expression level of a protein may include a substrate, a suitable buffer, a secondary antibody labeled with a chromophore or a fluorophore, a chromogenic substrate and the like for immunological detection of the antibody.
  • the substrate may be a nitrocell membrane film, a 96 well plate synthesized with a polyvinyl resin, a 96 well plate synthesized with a polystyrene resin, a slide glass made of glass, and the like.
  • Alkaline phosphatase alkal ine phosphatase
  • the fluorescent material can be used FITC, RITC, etc.
  • the color substrate is ABTS (2, 2 '-azino-bis (3-ethylbenzothiazoline-6-6) Sulfonic acid)) or 0PD (o-phenylenediamine), TMB (tetramethyl benzidine) can be used.
  • the kit is preferably, but not limited to, i) measuring the amount by detecting fluorescence by fluorescence label attached to the antibody, i) sur face plasmon resonance (SPR) method or SPRK sur face pl asmon resonance imaging (ii) method; .
  • the antibody may be prepared by an antibody production method known to those skilled in the art for the epitope or antigen of the present invention.
  • kits of the present invention can be used to measure arginated ER proteins derived through endogenous immune response to cytoplasmic double stranded DNA (dsDNA).
  • dsDNA cytoplasmic double stranded DNA
  • the kit not only enables the diagnosis of viral or bacterial infections of the practitioner and the screening of immunomodulators and viral or bacterial infections by measuring arginated ER proteins, but also by monitoring the individual's response to treatment. It is possible to change the treatment depending on the result.
  • the kit of the present invention may include a first acquisition reagent (capture reagent) that binds to the arginated ER protein and a second acquisition drug that does not bind to the first acquisition reagent.
  • the first acquisition reagent is an antibody or an antibody that specifically binds to a metal chelate, preferably an arginated ER protein
  • the second acquisition reagent is a conjugate labeled with a chromophore, a fluorescent substance, a radioisotope, or a colloid.
  • the chromophore can be peroxidase, alkaline phosphatase or acid phosphatase (e.g. horseradi sh peroxidase) and if it is fluorescent, Oresincarboxylic acid (FCA), Fluorescein isothiocyanate (FITC), Fluorescein thiourea (Fffl),
  • a sample obtained from an individual is brought into contact with a primary acquisition reagent, preferably an antibody that specifically binds to an arginated ER protein
  • the sample may be diluted to a suitable degree prior to contact with the antibody and the antibody may be washed or separated from the complex. It can be fixed on a solid to facilitate subsequent steps.
  • the solid phase can be glass or plastic such as a micro crot iter plate, rod, bead or mi crobead.
  • the antibody may also be bound to a probe substrate or protein chip.
  • the sample may be placed in a constant temperature with the antibody and washed to determine the antibody-marker complex. This is done by placing the washed mixture with a secondary acquisition reagent, preferably a secondary antibody. Determination of the amount or presence of the antibody-marker complex can be accomplished through fluorescence, luminescence, chemi luminescence, absorbance, reflection or transmission.
  • the protein marker in the sample can be detected by performing an indirect assay method such as competition or inhibition reaction analysis with a monoclonal antibody that binds to another epitope of the protein marker.
  • the present invention such as competition or inhibition reaction analysis with a monoclonal antibody that binds to another epitope of the protein marker.
  • 3) Provides a method for screening a virus therapeutic agent comprising the step of selecting a test compound to reduce the level of arginated protein in the test compound and the virus-treated experimental group, and the virus-treated control group.
  • the sample of step 1) is preferably one or more selected from the group consisting of isolated whole blood, serum, plasma, saliva, urine, sputum, lymph, cerebrospinal fluid and intercellular fluid, but not always limited thereto.
  • the arginated protein is preferably arginated by N-terminal Glul9 of BIP protein, N-terminal Glul8 of CRT protein or N-terminal Aspl8 of PDI protein, and the level of arginated protein is specific to arginated protein. It is preferable to measure using an antibody which binds suitably.
  • the ER protein of the present invention generates argination at the N-terminus by ATE1 R-transferase, and the arginated ER protein induces cytosolic local izat ion and autophagic vacuoles to the target.
  • the cytosolic dsDNA Induced by the cytosolic dsDNA as part of the innate i une system, the cytosolic dsDNA induces argination of ER protein in an ATE1-dependent manner, and the argination is misfolded in the cytoplasm.
  • the arginated ER protein is targeted as an autophagosome substrate that induces autophagic degradat ions and induces an innate immune system.
  • the test compound When the expression level of the protein is decreased, the test compound may be used as an immunomodulator, or after the virus and the test compound are treated simultaneously, the test compound which reduces the arginated protein level may be used as a virus therapeutic agent.
  • the screening method 3 ⁇ 4 of the present invention can be screened for immunomodulators or viral therapeutic agents by processing the antibody binding to the arginated protein and then searching for the amount of bound antibody.
  • HTS high-throughput screening
  • SPR surface plasmon resonance imaging
  • the fluorescence method is a method of labeling an antibody binding to a specific antibody to the arginated protein marker with a fluorescent substance using a fluorescence scanner program and spotting the signal by spotting.
  • the fluorescent material is Cy3, Cy5, poly L-lysine-fluorescein sothiocyanat (FITC), rhodamine-B-isothiocyanate (rhodamine-B soisocyanate, ITC) ), Preferably any one selected from the group consisting of rhodamine, but is not limited thereto.
  • the SPR system can analyze the binding degree of the antibody in real time without the need to label the sample with a fluorescent material.
  • multiple samples can be analyzed simultaneously using a microalignment method.
  • the method of the present invention is a substrate that will not react with the enzyme, Proteins and the like can include washes or eluents that can be removed and retain only bound arginated protein markers.
  • Samples used for analysis include biological samples that can be distinguished from normal conditions such as serum, urine and tear saliva. Preferably from biological liquid samples such as blood, serum, plasma. Samples may be prepared to increase the detection sensitivity of arginated protein markers.
  • serum samples obtained from patients may be anion exchange chromatography, affinity chromatography, si ze exclusion chromatography, and: Liquid . It can be pretreated using a method such as chromatography, sequential al extract ion or gel electrophoresis.
  • the levels of arginated protein in the test compound-treated test group and the test compound-untreated control group, or the test compound and the virus-treated test group, and the virus-treated control group showed the levels of arginated protein in Western blot.
  • ELISA radioimmunoassay, radioimmunoassay, oukteroni immunodiffusion, rocket immunoelectrophoresis, tissue immunity staining, immunoprecipitation assay, complement fixation assay, FACS, protein chip, and the like.
  • the term “antigen-antibody complex” means a combination of an arginated protein and an antibody specific thereto, and the amount of the antigen-antibody complex formed quantitatively through the magnitude of the signal of a detection ion label. It can be measured by Such detection labels may be selected from the group consisting of enzymes, fluorescent materials, ligands, luminescent materials, niicropart icles, redox molecules, and radioisotopes, but are not necessarily limited thereto.
  • the available enzymes include ⁇ -glucuronidase, ⁇ -D-glucosidase, ⁇ -D-galactosidase, urease, peroxidase or alkaline phosphatase and acetylcholinese.
  • ⁇ -glucuronidase ⁇ -D-glucosidase
  • ⁇ -D-galactosidase urease
  • peroxidase or alkaline phosphatase and acetylcholinese Terases, glucose oxidases, nucleokinase and GDPase, RNase, glucose oxidase Luciferase, phosphofructokinase, phosphoenolpyruvate carboxylase, aspartate art aminotransferase, phosphphenolpyruvate decarboxylase, ⁇ -latamases, and the like.
  • Fluorescent materials include, but are not limited to, fluorescein, isothiocyanate, rhodamine, phycoerythrin, phycocyanin, allophycocyanin, 0-phthalaldehyde, fluorescaman, and the like.
  • Ligands include, but are not limited to, biotin derivatives.
  • Luminescent materials include, but are not limited to, acridinium ester, luciferin, luciferase, and the like.
  • Microparticles include, but are not limited to, colloidal gold and colored latex spouts.
  • Redox molecules include ferrocene, ruthenium complex, barologen, quinone, Ti ion, Cs ion, diimide, 1,4'benzoquinone, hydroquinone, K 4 W (CN) 8 , [Os (bpy) 3 ] 2 + , [RU (bpy) 3 ] 2+ , [M0 (CN) 8 ] 4-, and the like. Radioactive isotopes , 14 C,
  • Protein expression level measurement is preferably by using an ELISA method.
  • ELISA is a direct ELISA using a labeled antibody that recognizes an antigen attached to a solid support, an indirect ELISA using a labeled antibody that recognizes a capture antibody in a complex of antibodies that recognize an antigen attached to a solid support, attached to a solid support
  • Various ELISA methods include indirect sandwich ELISA using secondary antibodies.
  • the antibody is attached to a solid support and the sample is reacted, followed by the attachment of a labeled antibody that recognizes the antigen of the antigen-antibody complex to enzymatic color development or to an antibody that recognizes the antigen of the antigen-antibody complex.
  • a labeled antibody that recognizes the antigen of the antigen-antibody complex to enzymatic color development or to an antibody that recognizes the antigen of the antigen-antibody complex.
  • Detected by sandwich ELISA method by attaching labeled secondary antibody and enzymatic color development.
  • Plasmids encoding the ATE1 R-transferase subtype isoiorms were prepared by the method described in Kwon-1999 (Y. T. Kwon et al, Mo 1. Cell. Biol. 19, 823 (1999)).
  • PCR polymerase chain reaction
  • PCR polymerase chain reaction
  • Plasmids encoding Ub-X-Bipl9—106—GFP were constructed at the BamHI / Hindlll position of pEGFP-N3 and amplified by PCR.
  • Bip fragments were amplified from pENTR / hBipc (Invitrogen) using PCR to construct cDNA encoding full-length Bip-myc / his, and inserted into vector pcDNA3.1-myc / his of the EcoRV-XhoI region. It was.
  • plasmids encoding Ub-X-Bip-myc / his were constructed in the BamHI / Xbal region of pcDNA3.1-myc / his using PCR amplification. The nucleotide sequence of the plasmid thus constructed was confirmed by sequencing.
  • N3-EGFP (Addgene, 1 in cat # 608)
  • Ub-HA (Addgene, 17608: pRK5-HA-ubiquit in-WT)
  • Ub-mt-HA (Addgene, 17603: pRK5-HA-ubiquitin- K0)
  • YFP-CLl (Addgene, 11950)
  • leni 1 lar-luc Pr omega, E2231, pRL-SV40 vector).
  • NHK-GFP plasmid was obtained by Dr. It was donated by Nobuko Hosokawa (Kyoto University, Japan).
  • the following other reagents were commercially available: thapsigarginCSigma, T9033), digitonin (Sigma, D141), bafilomycin AKSigma, B1793), geldanamycin (Sigma, G3381), MG132 (Calbiochem, 474790), poly (dA dT) (Invivogen), 5ppp-RNA (I nv i vogen), salmon sperm DNA (Sigma, D1626) RNAiMaxClnvitrogen, 13778), Lipofectamine 2000 (Invitrogen, 11668), Lipofectamine LTX (Invi trogen, 15338), protein A / G plus agarose bead (Santa Cruz, sc2003), car bony 1 cyanide ch 1 or opheny 1 hydr azone (S i gma
  • Antibodies used in the present invention used those commercially available as follows:
  • Rabbit monoclonal anti-Bip (Cell Signaling, cat. # 3177, 1: 1000), rabbit polyclonal anti-GFP (Abchem, ab290, 1: 3000), mouse monoclonal ant i-LC3 (Santa Cruz sc271625, 1: 1000), rabbit polyclonal ant i-GAPDH (Santa Cruz, sc25778, 1: 2000), mouse monoclonal anti-flag (Sigma, fl804, 1: 3000), rabbit monoclonal ant i-ATEK Santa Cruz, sc-271220 , 1: 500), rabbit monoclonal ant i-IRF_3 (Cel 1 Signaling, 11904P, 1: 500), rabbit anti-phospho-IRF— 3 (Ser396) (Cel 1 Signaling, 4947S, 1: 500), mouse single Clone ant i -CHOP (Cel 1 Signaling, 2895S, 1: 200), mouse monoclonal anti-calreti
  • Argination of Bip (NCBI Reference Sequence: NP_005338) (SEQ ID NO: 1), CRT (NCBI Reference Sequence: NP_004334) (SEQ ID NO: 2), PDI ((NCBI Reference Sequence: NP—000909) (SEQ ID NO: 3)
  • Rabbit polyclonal antibodies specific for the modified forms correspond to the N-terminal sequence of the arginated mature protein through a custom service of AbFront ier Inc. (Seoul, Korea).
  • Peptide sequences REEEDKKEDVGC (SEQ ID NO: 4), REPAVYFKEQ (SEQ ID NO: 5), and RDAPEEEDHVL (SEQ ID NO: 6) were prepared.
  • immunization was performed with the peptides in rabbits and boosted at intervals of three weeks with incomplete Freunds adjuvant (IFA).
  • IFA incomplete Freunds adjuvant
  • the antibody was subjected to two steps of affinity chromatography. First, the antibody was negatively purified using non-arginated peptads, EEED KEDVGC (SEQ ID NO: 7), EPAVYFKEQ (SEQ ID NO: 8), or DAPEEEDHVLC SEQ ID NO: 9, to remove nonspecific IgG.
  • Arginated peptides REEEDKKEDVGC (SEQ ID NO: 4), REPAVYFKEQ (SEQ ID NO: 5) or RDAPEEEDHVL (SEQ ID NO: 6) by eluting the antibody at better f low-through from first affinity chromatography in 0.1 M citric acid Positively purified using
  • arginine stylized Bip, CRT, PE I a specific antibody is arginine Chemistry "immunoblotting for the cell culture, where induction stressor is not present, or present to combine with about made in putting Analysis was used to confirm the specificity of the purified antibody. Specificity was independently determined using peptide binding assays. Specifically, peptides for Bip, CRT and PDI were each diluted to 2 mg / ml in coating buffer (0.1 M carbonate pH 9.6) and incubated at 4 ° C overnight to immobilize onto 96-wel l plates. Next, incubation at 37 ° C. for 1 hour in blocking buff A (2% skim milk in TBS-T).
  • the immobilized peptide was incubated at 37 ° C for 2 hours with blocking buffer containing primary antibodies against Bip CRT or PDI in the presence or absence of competing peptides and then in horseradi sh peroxide. Incubated with conjugated goat ant i -rabbi t secondary antibody. Binding of antibodies to immobilized peptides was assessed according to optical density (OD) at 450 nm.
  • OD optical density
  • the level of R-Bip is lower than or at the boundary of detection limit in various cell lines such as HeLa cells, HEK293 cells, and mouse fibroblasts.
  • the same analysis with a Bip antibody against luminal Bip revealed high levels of const i tut ive signals, which resulted in the detection of unarginated subpopulations. It confirmed that it was a signal to express.
  • poly (dA: dT) dsDNA treatment the level of R-Bip increased significantly (determined to increase by -100 times by density measurement method), but the Bip level of the lumen remained unchanged or only slightly changed.
  • Plasma membranes of harvested cells were dissolved in lysis buffer (110 mM KOAc, 25 mM K-HEPES, pH 7.2, 2.5 mM Mg (0Ac) 2, 1) with glyconside extracted from 0.01% digitonin and Digitalis purpurea. permeabilization using mM EGTA). Cells containing bulk ER and digittonin permeated cells were centrifuged at 1,000 X g for 5 minutes to obtain pellets. After centrifugation, the resulting upper layer was centrifuged again at 15,000 X g, whereby digittonin permeated.
  • Cytoplasmic fractions containing soluble cytoplasmic protein and autophagy fears that emerged out of the ized cells were obtained.
  • Another method of obtaining cytoplasmic protein is to inflate cells with a storage lysis buffer (10 mM KOAc, 10 mM KHEPES, pH 7.2, 1.5 mM Mg (0Ac) 2) and then use a Dounce homogenizer. To tear the plasma membrane. After adjusting the buffer to 0.25 M sucrose, the cell suspension was centrifuged at 1,000 X g for 10 minutes to discard unbroken cells and nuclei, and then centrifuged at 12,000 X g for 15 minutes to remove mitochondria. The resulting conflict was ultracentrifuged at 100,000 ⁇ g for 1 hour to separate the soluble cytoplasmic protein from the microsomes showing the porous structure containing fragments of ER.
  • HeLa, PC3, HEK293 cells as well as + / + and ATE1-/-MEFs were incubated in 5% C02 incubator with DMEM (GIBCO) supplemented with 10% FBS (GIBCO).
  • DMEM fetal calf serum
  • FBS FBS
  • NETN lysis buffer lOOmMNaCl, 20mMTris— HCl, pH 8.0, O.SmMEDTA, 0.5% Nonidet P-40
  • RIPA buffer 50mMTris-HCl, pH8.0, 150 mM NaCl, 1% NP-40, 0.5% sodium deoxycholate Cells were lysed using 0.1% SDS). Total cell lysates were separated by SDS-PAGE and transferred to a polyvinylidene difluoride membrane.
  • 8W confluent cells were treated with 10 ug / ml cyclonucleamide for cyclonucleamide follow-up digestion analysis. At the indicated time point, the cells were lysed on ice for 30 minutes with RIPA buffer containing a protease inhibitor cocktail and centrifuged at 15,000 g for 20 minutes. After centrifugation, immunoblotting was performed on the 10 U g protein in the upper layer.
  • RNAi Max reagent Invitrogen
  • ATE1 Using predesigned Silencer Select siRNAs (Invitrogen), ATE1 using the following sequences Knowdown:
  • siATEl # 202 HSS117-202-sense, GAUUCCUUUGCAGUUCACCCUUGGA (SEQ ID NO: 10); HSS117-202-anti sense, UCCMGGGUGAACUGCAAAGGAAUC (SEQ ID NO: 11));
  • siATEl # 203 HSS117-203-sense, GAGAGCCAUCAUGCCUUACGGUGUU (SEQ ID NO: 12); HSS117-203-ant i sense, AACACCGUAAGGCAUGAUGGCUCUC (SEQ ID NO: 13)); and siATEl # 204 (HSS117-204-sense, ACCCACCAUCUUCAUCUUC : 14); HSS117-204-anti sense, UUUGGUGGAAACAAAGAUGGUGGGU (SEQ ID NO .: 15)).
  • Cells grown on coverslips were transfected with one poly (dA: dT) (lg / ml) to determine the intracellular location of the recombinant protein. After 16 hours of transfection, cells were fixed with 4% paraformaldehyde for 0.5 hours at silver and washed twice with PBS, 0.1 with blocking solution (1% normal goat serum and 0. Triton X-100). Incubated for 1 hour in phosphate-buffered saline (PBS), followed by primary antibody followed by secondary antibody.
  • PBS phosphate-buffered saline
  • Cells were transfected with either the IgK-IFNp-Luc reporter plasmid (Addgene) or the Renillar-Luc control plasmid.
  • the cells were simultaneously transfected with poly (dA: dT) dsDNA and pcDNA-ATEl-3. After 18 hours of transfection, luciferase activity was measured using a Dual-lucif erase reporter assay system (Promega) and a VICTOR 1420 mulit i label counter (Perkin-Elmer). The experiment was repeated at least three times. Error bars indicate standard error of the mean of three independent experiments.
  • the N-end rule pathway is known as a selective proteolytic system that targets short-lived proteins released into the cytoplasm after translation (SMSriram et al., Nature Rev. Mo I. Cell. Biol. 12,735 (2011)).
  • proteins in the secretory pathway corresponding to about one-third of human proteome are exposed to new N-terminal residues at the same time as the signal peptide is cleaved by the signal peptide peptidase and enters the ER at the same time as the translation.
  • ER is an abundant source of N-degron.
  • the inventors have found that a subset of proteins present in the N-degron ER is retrotranslocated with intact folding and cytoplasmic N-terminus until metabolized by the proteolytic machinery. Targeted by law component, it was confirmed that it participates in various processes outside ER.
  • N-end rule substrates As a result of reviewing various documents, most of the N-end rule substrates identified so far are N-terminal Arg or pro-N-degrons (Asn, Gin, Cys, Asp, Glu) -Produces terminal Arg).
  • ICE NP 003860 MRtH L ARLSAVACGLLLLLVRGQGQDSASPIRTTHTCMVLGSLVHVKGA AGVQTFtGIPFA
  • Asp / Glu-proteins include molecules such as peron (Bip, GRP94, calreticulin (CRT)) and oxidoreductases (protein disulfide isomerases (PDI) and ErdJ5) and 3 ⁇ 4 as the major Ca ++ — binding folding factors. Abundance (FIG. La, FIG. 6 and Table 3).
  • ER chaperones involved in the holding cycle are known as unfolded protein reactions (UPR: Some of the unfolded proteins response is transcriptionally induced to remove misfolded proteins by ER-associated protein degradation (ERAD) (RRKopito, Cell 88, 427 (1997)).
  • URR ER-associated protein degradation
  • RRKopito ER-associated protein degradation
  • the present inventors confirmed the turnover of Bp, a Glul9-exposed chaperone that assists translocation and folding, with a cycloheximide digestion assay.
  • the anti-R-Bip antibody binds more cyclically to the immobilized R-Bip peptide than the non-arginated Bip peptide.
  • ATE1 was found to produce four subtypes with a size of 60 kDa and optionally spliced. Were : ⁇ 1 1 ⁇ 7 ⁇ ( ⁇ 1-3), ⁇ 1 1 ⁇ 7 ⁇ / ⁇ 1-4, ATE1 1B7A / ATE1-1, ATEl 1B7B / ATEl-2 (YTKwon et al, 19, 823 (1999)) (FIG. 8A).
  • plasmids encoding ATEl R-transferase isoforms were prepared by the method described in Kwon-1999 (YTKwon et al, Mol. Cell. Biol. 19, 823 (1999)), plasmids expressing each of the four ATE1 subtypes were transfected into a HeLa cell line, followed by immunoblotting, and confirmed in vivo argination. In addition, immunoblotting was performed in the HeLa cell line expressing ATE1 1A7A and treated with cyclonucleosides, or the HeLa cell line treated with siATEl by the same method.
  • ATE1 1A7A is the major R-transferase for Bip compared to ATE1 1B7A and ATE1 1B7B . (FIG. Le, and FIGS. 8B-8D).
  • ATE1 1A7A after transfecting ATE1 1A7A into the HeLa cell line, the cells were classified into whole extracts, cell substrates, and microsomes, and then subjected to cell fraction analysis. As shown in FIG. If, ATE1 1A7A from the soluble fraction of the cytoplasm. About 70% of the generated R-Bip was found to be detected ( Figure If).
  • the Bip-f lag-KDEL or Bip-E19V-f lag-KDEL prepared above was transfected into a HeLa cell line, followed by immunoblotting.
  • ATE1 1A7A overexpression was easily induced argination of recombinant Bip exposed the N-terminal Glul9, Glul9 to Val variants stabilized by the N-end rule, ATE1 1A7A mediated argination It was confirmed that it was suppressed ( Figure lh).
  • the inventors expressed Ub-Glu-Bip-myc / his, wherein the C-terminal Gly76 of ubiquitin (Ub) was fused with Glul9 of mature Bip. Subsequently (FIG.
  • FIG. Li argination of Glu-Bip-myc / his was confirmed to be accelerated by expressing ATE1 1A7A (FIG. Li).
  • the inventors confirmed the argination after knocking down ATE1 using RNA interference.
  • Bip itself has its own N-terminus in vivo.
  • Glul9 was confirmed to be arginated by ATE1 R-transferase.
  • N-end rule pathway may have a broad role in the regulation of ER protein.
  • lipofectamine LTX alone or in various DNA forms (salmon sperm DNA (Salmi.Sp.DNA), GFP-fused mouse ⁇ —ant trypsin nul l Hong-ong (mNHK-GFP), Ubiquitin fusion at the R-GFP C_terminus (Ub-R-GFP), spontaneously misfolded substrate model (YFP-CLl), mutant antitrepsin protein well (ATZ)) was then transfected, followed by immunoblotting. It was.
  • FIGS. 2A, 9A, and 9B the argination of Bip, PDI, and CRT was examined when argination induced stress was induced when cells were transiently transfected with various dsDNA molecules. It was confirmed that the degree is triggered in various ways (Figs. 2a, 9a and 9b).
  • FIG. 9C analysis of the transfection reagent showed that argination of Bip, PDI, and CRT was triggered by dsDNA in the cytoplasm rather than in the extracellular space (FIGS. 9C, lines 2 and 3). .
  • FIGS. 9C and 9D it was confirmed that ATE1 plays a role in DNA-induced Bip argination (FIG. 9C and FIG. 9D).
  • the cell fraction analysis it was confirmed that most of the DNA-induced R-Bip is soluble in the cytoplasm (Fig. 9c).
  • dsRNA double-stranded RNA
  • Cytoplasmic dsDNA can be a signal of infection by DNA-containing microorganisms, such as viruses, thus eliciting endogenous immune responses, including phosphorylation of the transcription factor IRF3 and interferon- ⁇ synthesis induced by IRF3.
  • FIG Bip, PDI, arginine screen of CRT is in the cytoplasm immunity enhancement reagent expressing viral dsDNAs poly (dA: dT) were strongly induced by dsDNA (. Fig. 2b, Fig. 11a to Fig. 11c).
  • ATEl-knockdown using RNA interference strongly inhibited IRF3 phosphorylation induced by DNA (FIG. 2C).
  • ATE1-/-mouse embryoni cf ibroblasts (MEFs) (Kwon-2002) Induced impaired inter feron- ⁇ production was shown to be impaired (FIGS. 2E, 2F and lie).
  • ATE1-dependent argination of ER presence plays an important role in the cytoplasm's intrinsic immune response to dsDNA.
  • R-Bip plays a role in the autophagy pathway during DNA-induced endogenous immune response.
  • R-Bip immunostaining in dsDNA-treated HeLa cells revealed cytoplasmic puncta with a diameter of 0.1-1, which was similar in size to the autophagy fear (FIGS. 3A and 12A).
  • Co-staining analysis showed that the DNA-induced R-Bip and LC3 positive autophagy points (puncta) were in the same position (FIG. 3A).
  • RNA interference analysis of ATE1 and Bip confirmed that the LC3 point (puncta) and the R-Bip point (puncta) exist at the same position and in the ATE1-dependent formation (FIG.
  • the N-terminal Arg of short-lived proteins acts as a major N-degron that is recognized and bound by N-recognins for proteasome degradation. This N-end rule recognition is essential for targeting substrates to proteasomes via polyubiquitination.
  • the present inventors have found that N-terminal Arg confirmed that Bip acts as an autophagy N-degron required for Bip targeting to autophagosomes.
  • Lumen's Bip is a substrate recognition r ognin that finally binds / absorbs the misfolded ER protein and delivers its cargo to the ERAD machinery. To identify molecules that interact with arginated forms of ER saperon, Whether argination correlates with misfolding cytoplasmic protein.
  • HeLa cells expressing mutated Ub contained a significantly reduced amount of R-Bip (FIG. 5D). Therefore, it was confirmed that arginated ER chaperone is involved in the turnover of misfolded cytoplasmic protein.
  • R-Bip interacts directly or indirectly with CL1-YFP, a model substrate undergoing spontaneous mi sfolding (FIG. 15C).
  • CL1-YFP a model substrate undergoing spontaneous mi sfolding
  • R-Bip plays a role in autophagy clearance of misfolded cytoplasmic proteins, which has the ability of its N-terminal Arg to act as a trans-acting N-degron for mi sfolded protein cargoes. It was confirmed through the.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Immunology (AREA)
  • Molecular Biology (AREA)
  • Biomedical Technology (AREA)
  • Hematology (AREA)
  • Urology & Nephrology (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Biochemistry (AREA)
  • Physics & Mathematics (AREA)
  • Pathology (AREA)
  • Microbiology (AREA)
  • Analytical Chemistry (AREA)
  • Cell Biology (AREA)
  • Biotechnology (AREA)
  • General Physics & Mathematics (AREA)
  • Food Science & Technology (AREA)
  • Organic Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biophysics (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Virology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)

Abstract

본 발명은 아르기닌화 (arginylat ion)된 ER 단백질에 특이적으로 결합하는 항체 및 이의 용도에 대한 것으로, ATE1 R-transferase에 의해 ER 단백질의 N-말단에 아르기닌화가 발생하고, 상기 아르기닌화된 ER 단백질은 세포질 정위 (cytosol ic local izat ion) 및 표적에 대한 자가포식 공포 (autophagic vacuoles) 유도하는 내재 면역계 (innate immune system)의 부분으로서 세포질 (cytosolic)의 dsDNA로 유도되며, 세포질의 dsDNA는 ATE1 의존적으로 ER단백질의 아르기난화 유도하고, 상기 아르기닌화는 세포질에서 미스 폴딩 (misfolded) 단백질에 의해 자극되며, 아르기닌화된 ER 단백질은 자가소화작용퇴화 (autophagic degradat ion)을 유도하는 자가포식소체 (autophagosome)의 기질로서 표적이 되어 내재 면역계를 유도하므로, 본 발명의 아르기닌화된 ER 단백질 특이적으로 결합하는 항체는 아르기닌화된 ER 단백질을 유의적으로 탐지할 수 있으므로, 면역조절제 스크리닝용 키트, 면역조절제 및 바이러스 치료제 스크리닝 방법에 유용하게 사용될 수 있다.

Description

【명세서】
【발명의 명칭】
아르기닌화된 E R 단백질에 특이적으로 결합하는 항체,및 이의 용도 [기술분야]
본 발명은 아르기닌화 (arginylat ion)된 단백질에 특이적으로 결합하는 항체 및 ,상기 항체를 이용한 면역조절제 및, 바이러스 또는 세균감염 진단 및, 치료제 스크리닝 방법에 관한 것이다. 【배경기술】
외부 항원에 대한 인체의 면역 반응은 크게 내재면역반응 ( innate immune response) 및 적웅면역반웅 (adapt ive immune response)으로 나눌. 수 있다. 인체가 병원체에 감염된 경우, 병원체가 질병을 일으키기 위해서는 먼저 숙주와 접촉해야 하고, 이후 감염소를 만들어야 하는데, 이러한 병원체들은 그들의 표면 구조 및 병리기전이 각각 다르기 때문에, 숙주의 면역 반응계로부터 일어나는 방어 기전도 매우 다양하다.
신체의 상피표면은 병원체로부터 신체를 보호하고, 집락화 및 부착을 방지하며, 항균효소와 펩타이드를 분비하는 특화된 세포 표면 장치를 통해 세포로 들어오는 바이러스와 세균을 막는다. 또한, 이러한 장벽을 뚫은 세균, 바이러스 또는 기생충들은 즉각적으로 다양한 종류의 병원체에 결합하여 탐식작용을 할 수 있는 표면 수용체를 갖는 대식세포를 만나게 되고, 이는 염증반웅을 불러은다. 이때, 체액성 내재면역을 제공하는 보체 성분을 포함하는 혈장 단백 및 감염장소에서의 탐식작용 호중구의 축적을 일으킨다. 내재면역은 동일 병원체 또는 다른 병원체에 대한 감염을 직접적으로 관여하여 즉각적 효과 기전을 통해 제일선의 숙주방어를 수행하고, 상기 기전은 결국 신체의 빈번한 감염올 예방한다. 자가포식 (autophagy)은 새로운 형태의 세포 조절 기전으로서, 알려진 자연사,괴사 등이 세포 전체의 사멸만 다루는 것과 달리 , 미토콘드리아 형질세망 등 세포 내 소기관의 사멸 및 재생과 관련이 있다.
세포 내 소기관은 평상시에 정적인 상태를 유지한다고 생각되어 왔으나, 최근 연구에 의하면 평상시에도 끊임없이 죽고 재생되는 과정을 겪고 있음이 밝혀졌다. 이 과정을 통해 낡고 퇴행성 변화를 겪은 세포 내 소기관은 소멸되어 새로운 세포 내 소기관을 재생하는데 필요한 영양 공급원이 된다. 자가포식은 이러한 세포내 소기관의 사멸 및 재생을 통해 세포 전체를 사멸에서 보호하기도 하고, 세포 전체의 사멸을 유도하기도 한다. 그동안 자가포식에 의한 세포 내 소기관의 끊임없는 사멸과 재생의 생리적 기능 및 임상적 의미가 불분명하였으나, 최근 관련 연구가 진행되면서 자가포식과 각종 질병 또는 노화의 관련성이 제시되고 있다. 또한, 자가포식이 암, 퇴행성 신경질환 등에 중요한 역할을 한다는 것이 일부 밝혀지기 시작하였으나, 면역반응과 관련하여 자가포식이 어떠한 역할을 하는지는 알려진 바가 없다. 소포체 (endoplasmic reticulum, ER)에 존재하는 많은 수의 단백질이 세포기질 (cytosol)에서 발견되지만, 소포체에서 세포기질로 이동하는 것에 근거하는 해독후 변형 (posttranslational modi fi cat ion)에 대해서는 잘 알려져 있지 않다.
N-말단 법칙 경로 (N-end rule pathway)는 N-데그론 (N-degron)이라고 불리는 데그론의 기본 결정기 (essential determinant )로서 작용하는 N-말단 잔기 (N-terminal residue)의 단백질 분해 시스템 (proteolytic system)이다. 이들 데그론은 단백질의 폴리유비퀴틴화 (polyubiquitination) 및 단백질 분해효소 (proteasome)에 의한 선택적인 단백질 분해를 촉진하는 것으로 알려진 UBR 박스 -포함 (UBR box-containing) 단백질의 과 (family)와 같은 특정 인식 요소 [Nᅳ레코그닌 (N-recognin)]에 의해 인식된다. UBR-형태 (type)
N-레코그닌의 기질 (substrate)은 내단백질 분해 절단 (endoproteolytic cleavage)에 의해 노출된 N-말단 (terminal ) 양성으로 하전된 아르기닌 (arginine, Arg), 리신 (lysine, Lys) 및 히스티딘 (histidine, His)과 같은 1형, 및 부피가 큰 소수성 (bulky hydrophobic)인 페닐알라닌 (phenylalanine, Phe), 타이로신 (tyrosine, Tyr), 트립토판 (tryptophane, Trp) , 류신 (leucine, Leu) 및 이소류신 (isoleucine, lie)과 같은 2형 잔기를 포함한다. 이들 중에서, Arg 테그론은 카스파이제 (caspase) 또는 세퍼레이제 (separase)와 같은 펩타이드 내부 가수분해효소 (endopeptidase)에 의해 잘려서 노출되면서 생성된다. 인간 단백질의 약 1/3을 차지하는 분비단백질들의 신호 서열이 신호 펩티드 가수분해 효소에 의해 ER안으로 전좌 (translocation)되면서, 절단될 때, 새로운 Nᅳ말단기들이 노출되기 때문에 ER은 풍부한 pro-N-데그론의 출처가 된다. 원칙적으로, 상기 절단은 만약 세포질에 노출되면 N-말단 법칙 절차하에서 잠재적으로 불안정 N-말단을 생성할 수 있다. 이에, 본 발명자들은 면역조절제를 스크리닝하기 위한 방법을 개발하기 위해 노력한 결과, 아르기닌화된 ER 단백질에 특이적으로 결합하는 항체를 제작하였고, 상기 항체를 이용하여 ATE1 R-전이효소의 ER-존재 단백질인 Bip 단백질의 N-말단 아르기닌화 효과, 상기 아르기닌화된 단백질의 내재 면역계의 부분으로서 dsDNA에 의한 세포질 정위 및 표적에 대한 자가포식 공포 (autophagic vacuoles) 유도 효과를 직접적으로 확인함으로써, 상기 아르기닌화된 ER 단백질에 특이적으로 결합하는 항체를 면역조절제 및, 바이러스 또는 세균감염 진단 및, 치료제 스크리낭방법에 유용하게 사용될 수 있음을 밝힘으로써 , 본 발명을 완성하였다.
[발명의 상세한 설명】
【기술적 과제】
본 발명의 목적은 아르기닌화 (arginylation)된 단백질에 특이적으로 결합하는 항체 및 이의 용도를 제공하는 것이다. [기술적 해결방법]
상기 목적을 달성하기 위하여, 아르기닌화 (arginyl at ion)된 단백질에 특이적으로 결합하는 항체를 제공한다.
또한, 본 발명은 아르기닌화된 단백질에 특이적으로 결합하는 항체를 포함하는 바이러스 또는 세균감염 진단용 키트를 제공한다.
또한, 본 발명은 아르기닌화된 단백질에 특이적으로 결합하는 항체를 포함하는 면역조절제 스크리닝용 키트를 제공한다.
또한, 본 발명은
1) 시료내 피검화합물을 처리하는 단계 ;
2) 피검화합물을 처리한 실험군 및 피검화합물을 처리하지 않은 대조군에서 아르기닌화된 단백질의 수준을 측정하는 단계를 포함하는 면역조절제 스크리닝 방법을 제공한다.
아울러, 본 발명은
1) 시료에 바이러스를 처리하는 단계 ;
2) 바이러스가 처리된 시료에 피검화합물을 처리하는 단계 ;
3) 피검화합물 및 바이러스가 처리된 실험군, 및 바이러스가 처리된 대조군에서 아르기닌화된 단백질와 수준을 측정하는 단계를 포함하는 바이러스 치료제 스크리닝 방법을 제공한다. [유리한 효과]
ATE1 R-전달효소 ( transferase)에 의해 ER 단백질의 N-말단에 아르기닌화가 발생하고,상기 아르기닌화된 ER단백질은 세포질 정위 (cytosol i c local i zat ion)및 표적에 대한 자가포식 공포 (autophagi c vacuoles)를 유도하는 내재 면역계 ( innate i隱 une system)의 부분으로서 세포질 (cytosol i c)의 dsDNA로 유도되며, 세포질의 dsDNA는 ATE1 의존적으로 ER 단백질의 아르기닌화를 유도하고, 상기 아르기닌화는 세포질에서 미스폴딩 (mi sfolding) 단백질에 의해 자극되며, 아르기닌화된 ER 단백질은 자가소화작용퇴화 (autophagi c degradat ion)를 유도하는 자가포식소체 (autophagosome)의 기질로서 표적이 되어 내재 면역계를 유도하므로, 본 발명의 아르기닌화된 ER단백질 특이적으로 결합하는 항체는 아르기닌화된 ER 단백질을 유의적으로 탐지할 수 있으므로, 면역조절제 스크리닝용 키트, 바이러스 또는 세균 감염 진단, 면역조절제 및 바이러스 치료제 스크리닝 방법에 유용하게 사용될 수 있다.
【도면의 간단한 설명】
도 la는 다양한 종으로부터의 Bip 단백질의 서열 정렬 (sequence alignment)을 나타낸 도이다.
도 lb 및 도 lc는 100 nM 탭시가긴 (thapsigargin)이 16시간 동안 비존재 (b) 또는 존재 (c)에 있어서 시클로핵시미드 (cycloheximide) 분해 분석 결과를 나타낸 도이다.
도 Id는 Bip의 35S분석 (35S-pulse chase analysis)결과를 나타낸 도이다. 도 le는 ATE1 동형 (isoform)을 발현하는 HeLa 세포주의 면역블로팅 결과를 나타낸 도이다.
도 Π는 ATE11A7A를 발현하는 HeLa 세포주를 전체 추출물 (total extract,
To), 세포기질 부분 (cytosolic fraction, Cyt), 및 마이크로좀 부분 (microsomal fraction, Mic)으로 분류한 후, 세포분획 분석을 수행한 도이다.
도 lg는 ATE11A7A-발현 HeLa 세포주의 시클로핵시미드 분해 분석 결과를 나타낸 도이다.
도 lh는 Bip-flag-KDEL 또는 Bip-E19V-Hag-KDEL을 발현하는 HeLa 세포주의 면역블로팅 결과를 나타낸 도이다.
도 li 및 도 lj는 ATEl1A7A(i) 또는 ATE1에 대한 si NA(j)와 공발현하거나 하지 않을 때 Ubᅳ X-Bip-myc/his를 발현하는 HeLa 세포주의 면역블로팅 결과를 나타낸 도이다.
도 2a 및 도 2b는 HeLa 세포주에 플라스미드 (a) 또는, 폴리 (dA:dT) dsDNA(b)와 함께 형질감염시킨 후, 면역블로팅 결과를 나타낸 도이다.
도 2c는 HeLa 세포주에 0.5 βg/mi 폴리 (dA:dT) 또는 ATE1에 대한 10 nM siRNA와 함께 공-형질감염시킨 뒤, 인산화된 IRF3 및 R-Bip의 면역블로팅 결과를 나타낸 도이다.
2d는 HeLa 세포주에 리포펙타민 ( 1 ipofectamine) LTX가 존재 또는 비존재시 pcDNA3.1과 함께 형질감염시킨 후, 면역블로팅 결과를 나타낸 도이다.
2e는 대조군 및 ATEl—/_MEFs에 인터페론 -β 프로모터로부터 루시퍼라제를 발현하는 리포터 플라스미드 IgK-IFN β -Luc와 함께 형질감염시킨 다음, 폴리 (dA: dT) dsDNA로 형질감염시킨 후 루시페라아제 리포터 분석 결과를 나타낸 도이다.
도 2f는 IgK-IFN β -Luc-발현 HeLa 세포주에 ATE1-녹다운 (knockdown) 또는 ATE11A7A 과발현 (overexpression)하는 플라스미드와 흔합한 폴리 (dA: dT)로 처리한 후, 루시페라아제 리포터 분석 결과를 나타낸 도이다.
도 3a 및 도 3b는 RFP-GFP-LC3를 안정적으로 발현하는 HeLa 세포주에 폴리 (dA:dT)로 처리된 뒤, LC3—양성 자가포식 공포 (autophagic vacuoles)를 제시하는 RFP신호 (붉은색)과 비교하여 R-Bip(A)또는 p62(B)의 면역염색결과를 나타낸 도이다.
도 3c는 RFP-GFP-LC3를 안정적으로 발현하는 HeLa 세포주에 ATE1 및 Bip의 siRNA를 폴리 (dA:dT)로 처리된 뒤, LC3-양성 자가포식 공포 (autophagic vacuoles)를 제시하는 RFP 신호 (붉은색)과 비교하여 R-Bip의 면역염색결과를 나타낸 도이다.
도 4a는 RFP-GFP-LC3를 안정적으로 발현하는 HeLa 세포주에
Ub-X-Bip-RFP(X=Arg 또는 Val )을 발현하는 플라스미스를 형질감염 시킨 후, GFP-LC3 형광발광 (f luorescence) (녹색)과 비교하여 X-Bip-RFP 형광발광을 면역조직화학검사로 확인한 도이다.
도 4b는 Ub-X-Bip-GFP(X=Arg 또는 Val )을 일시적으로 발현하는 HeLa 세포주에서 X-Bip-RFP 형광발광 (녹색)과 비교하여 p62 형광발광 (붉은색)을 면역조직화학검사로 확인한 도이다.
도 4c는 Ub-R-Bip19106-YFP를 일시적으로 발현하는 HeLa 세포주에서 R_B i pi9-io6_YFp 형광발광 (붉은색)과 비교하여 LC3 형광발광 (녹색)을 면역조직화학검사로 확인한 도이다.
도 4d는 Ub-X-Bip19-106_GFP(X=Arg 또는 Val)를 일시적으로 발현하는 HeLa 세포주에서 세포주는 X-Bip19106-GFP 형광발광 (녹색)과 비교하여 p62 형광발광 (붉은색)을 면역조직화학검사로 확인한 도이다.
도 5a 및 도 5b는 HeLa 세포주에 겔다나마이신 (geldanamycin)(a) 또는 다양한 스트레스 원 (b)을 처리한 후, FK 항체로 면역블로팅 수행한 결과를 나타낸 도이다:
A23187: 칼슘 운반체 (calcium i onophor e);
CCCP: 카보닐 시안화물 (carbonyl cyanide) m-클로로페닐하이드라존 ( m— ch 1 oropheny 1 hydr azone ) [프로토노포어 (prot onophor e )(H+ 이온투과담체 (ionophore)) 및 미토콘 H라아에 있어서 산화적 인산화 (oxidat ive phosphorylat ion)의 공역방지제 (uncoupler)];
BTZ: 보르테조마이브 (bortezomib); 및
BafAl: 바필로마이신 (bafilomycin) A1.
도 5c는 DNA 유도 내재성 면역 반웅에서 아르기닌화와 유비퀴틴화의 상관관계를 나타낸 도이다.
도 5d는 Ub-HA 또는 Lys이 Arg로 변해 유비퀴틴화가 종결된 돌연변이를 발현하는 HeLa 세포주의 면역블로팅 결과를 나타낸 도이다.
도 5e는 HeLa세포주는 1 i /u 폴리 (dA:dT) dsDNA를 형잘전환한 다음, , FK2, R-Bip 또는 p62 항체의 면역염색을 수행한 도이다.
도 6은 CRT(a), PDI(b), GRP94(c), 및 Erdj5(d)의 서열 정렬을 나타낸 도이다. ,
도 7a는 R-Bip의 Nᅳ말단 부분에 상웅하는 11-머 (mer) R-Bip 펩티드 (R-Bip-펩티드)를 96-웰 플레이트에 고정한 뒤, 단계 희석된 항— R-Bip 항체 및, 이어서 겨자무과산화효소 (horseradish peroxide)가 결합된 항 -염소 2차 항체와 함께 배양한 다음, 고정된 R-Bip 펩티드에 결합하는 R-Bip 항체의 양을 2차 항체의 450 nm에서 O.D. 값에 기초하여 결정한 후, 펩티드 경쟁 분석 (peptide competition assay)을 수행한 도이다. 대조군으로서 Bip-펩티드, 아르기닌화되지 않은 Bip의 N-말단 부위에 상웅하는 10-머 펩티드가 사용되었다.
도 7b는 항 -R-Bip 항체가 단독 또는 R-Bip-펩티드 또는 Bip-펩티드와 흔합으로 배양한 후, 펩티드 경쟁 분석을 수행한 도이다.
도 7c는 각각 아르기닌화되거나, 아르기닌화되지 않은 CRT의 N-말단 부분에 상웅하는 R-CRT-펩티드 및 CRT-펩티드를 이용하여 펩티드 경쟁 분석을 수행한 도이다.
도 7d는 각각 아르기닌화되거나, 아르기닌화되지 않은 PDI의 N-말단 부분에 상웅하는 R-PDI-펩티드 및 PDI-펩티드를 이용하여 펩티드 경쟁 분석을 수행한 도이다.
도 7e는 아르기닌화안된 (E-펩티드), 또는 아르기난화된 (R-펩티드) Bip의 N-말단 부위에 상웅하는 펩티드에 대한 항 -R-Bip 항체의 닷블롯 분석 (Dot blott ing analysis)결과를 나타낸 도이다.
도 8a는 ATE1 유전자 및 이의 스플라이싱된 동형 ( i soform)의 개략도를 나타낸 도이다.
도 8b는 ATE11A7A을 일시적으로 발현하거나, 시클로핵시미드로 처리된 HeLa 세포주에서 R-Bip, Bip 및 LC3의 시간 경과에 따른 면역블로팅 결과를 나타낸 도이다.
도 8c는 ^ ^을 발현하는 HeLa세포주에 ATE1-녹다운 (knockdown) 시킨 후, Bip의 아르기닌화를 확인한 도이다.
도 8d는 HeLa 세포주에 ATE11A7A를 발현하는 플라스미드를 형질감염한 다음, 면역블로팅 결과를 나타낸 도이다.
도 8e는 Ub-Bi 연결점 (junct ion)에서 Ub 가수분해효소 (hydrolases)에 의해 공전좌 분열((:01;^11310 101131 cleavage)되는 Ub-X—Bip— myc/hi s와 비교한 전장의 Bip의 개략도를 나타낸 도이다.
도 9a 및 도 9b는 HeLa 세포주에 리포펙타민 LTX 단독 또는 다양한 DNA 형태를 형잘감염한 다음, 면역블로팅 결과를 나타낸 도이다.
도 9c는 HeLa 세포주에 ATE1에 대한 siRNA#204 및 NHK-GFP를 발현하는 플라스미드와 함께 공 -형질감염된 뒤, 세포기질 부분으로 분류한 다음, 면역블로팅 결과를 나타낸 도이다.
도 9d는 HeLa 세포주에 NHK-GFP 플라스미드 및 ATE1 siRNA#204의 혼합물로 공 -형질감염된 뒤, NHK-GFP 형광발광과 비교하여 R-Bip의 면역염색분석 결과를 나타낸 도이다.
도 10은 HEK293 세포주 (2.5 x 105/웰)에 200 nM 탑시가르긴이 6시간 동안 비존재 또는 존재하에 배양된 뒤, KDEL 서열에 대한 항체를 사용했을 때와 비교하여 R— Bip의 면역염색분석 결과를 나타낸 도이다.
도 11a는 HeLa 세포주에 폴리 (dA: dT) dsDNA 또는 5 'ppp-dsRNA로 형질감염된 뒤, 면역블로탕을 수행한 결과를 나타낸 도이다.
도 lib는 16시간 동안 0.5 /웰 폴리 (dA: dT) dsDNA로 처리된 HeLa 세포주 (3 X 106/웰)에서 NF- κ Β p50와 면역염색결과를 나태낸 도이다.
도 11c는 HeLa 세포주에 ATE1 siRNA로 형질감염시킨 후,, 면역블로팅을 수행한 결과를 나타낸 도이다.
도 lid는 HeLa 세포주에 폴리 (dA:dT)로 형질감염한 뒤, R— Bip 및 LC3의 면역블로팅 결과를 나타낸 도이다.
도 lie는 대조군 및 ATE1_/— MEF는 인터페론 -β 프로모터로부터 루시퍼라제를 발현하는 IgK-IFN β -Luc 리포터 플라스미드로 형질감염된 뒤, 폴리 (dA: dT) dsDNA로 형질감염시킨 다음, 18시간 후, 루시퍼라제 활성을 듀얼 -루시퍼라제 리포터 어세이 시스템 (Dual-Luci f erase Reporter Assay System, 프로메가)및 왈락 빅터 2(Wal lac VICTOR2 , 퍼킨 엘머 )를 사용하여 측정한 결과를 나타낸 도이다.
도 12a는 RFP-GFP-LC3를 안정적으로 발현하는 HeLa 세포주에 폴리 (dA: dT) dsDNA 또는 5 'ppp dsRNA로 처리한 뒤, LC3-양성 자가포식세포를 제시하는 RFP 신호 (붉은색)와 비교하여 R-Bip의 면역염색 결과를 나타낸 도이다.
도 12b는 HeLa세포주에 폴리 (dA:dT) dsDNA또는 5 'ppp dsRNA로 처리한 뒤, R-Bip 및 p62의 면역염색 결과를 나타낸 도이다. 도 13은 Ub 융합기술을 사용하여 발현된 Bip 단백질의 개략도를 나타낸 도이다:
a: 전장와 Bip 단백질;
b: 참조 Ub및 X-Bip-GFP를 생산하는 Ub부분 (moiety)의 Gly76잔기에 Ub 가수분해효소에 의해 공전좌로 절단된 Ub-X-Bip-GFP[X-Arg, Glu (원형 (nat ive) , 또는 Val]; 및
c: 참조 Ub및 X-Bip19ᅵ 106-GFP를 생산하는 Ub부분 (moiety)의 Gly76잔기에 Ub 가수분해효소에 의해 공전좌로 절단된 Ub-X-Bip19106-GFP[X-Arg, Glu (원형 (native), 또는 Val].
도 14a는 YFP-LC3를 안정적으로 발현하는 HeLa 세포주에
Ub-R— Bip19106-GFP를 발현하는 플라스미드로 형질감염시킨 다음, YFP-LC3 형광발광 (녹색)과 비교하여 R-BiP 19106-RFP 형광발광 C붉은색)을 면역조직화학검사로 확인한 도이다.
도 14b는 Ub-X-Bip19"106-RFP(X=Arg 또는 Val)을 일시적으로 발현하는 MEF에서 X-Bipl9-106-GFP 형광발광 (녹색)과 비교하여 p62(붉은색)을 면역조직화학검사로 확인한 도이다.
도 15a는 HeLa 세포주에 42°C에서 열충격 (heat shock)을 처뫼된 뒤, 시간경과에 따른 면역블로팅 결과를 나타낸 도이다.
도 15b는 HeLa세포주에 다양한 스트레스원으로 처리된 뒤, 폴리유비퀴틴 쇄-특이적 FK(polyubiquitin chain-specific FK) 항체로 면역블로팅을 수행한 결과를 나타낸 도이다:
A23187: 칼슘 운반체 (calcium ionophore);
CCCP: 카보닐 시안화물 (carbonyl cyanide) m-클로로페닐하이드라존 (m一 chlorophenylhydrazone) [프로토노포어 (protonophore )(H+ 이온투과담체 (ionophore)) 및 미토콘드리아에 있어서 산화적 인산화 (oxidative phosphorylation)-^ 공역방지제 (uncoupler)];
BTZ: 보르테조마이브 (bortezomib); 및
BafAl: 바필로마이신 (bafilomycin) A1. 도 15c는 HeLa 세포주에 CL1-YFP 또는 이의 대조군을 발현하는 플라스미드로 형질감염된 뒤/면역블로팅을 수행한 결과를 나타낸 도이다 (좌) . CL1-YFP 및 EGFP 모두에 결합할 수 있는 GFP 항체로 면역침강 결과를 나타낸 도이다 (우) .
도 15d는 He 세포주에 폴리 (dA:dT) dsDNA로 처리된 뒤, R-Bip및 p62와 비교하여, 폴리유비퀴틴 접합체 (conjugate) 및 자유 Ub 모두에 결합할 수 있는 FK2 항체를 사용하여 폴리유비퀴틴화된 단백질의 면역염색결과를 나타낸 도이다. 【발명의 실시를 위한 최선의 형태】
이하, 본 발명을 상세히 설명한다. 본 발명은 아르기닌화 (arginylat ion)된 단백질에 특이적으로 결합하는 항체를 제공한다. .
상기 단백질은 ER(Endopl aside Ret iculum) 단백질인 것이 바람직하고,
BIP, CRT 및 PE)I로 구성된 군으로부터 선택되는 어느 하나인 것이 보다 바람직하며, 상기 BIP 단백질은 서열번호 1로 기재되는 아미노산 서열을 갖고, 상기 CRT 단백질은 서열번호 2로 기재되는 아미노산 서열을 가지며, 상기 PDI 단백질은 서열번호 3으로 기재되는 아미노산 서열을 갖는 것이 가장 바람직하나 이에 한정되지 않는다.
상기 BIP 단백질의 Nᅳ말단 Glul9 , CRT 단백질의 N-말단 Glul8 또는 ΡΕ)ί 단백질의 Ν-말단 Aspl8이 아르기닌화된 것이 바람직하고, 상기 아르기닌화된 단백질은 ATE1 R-전달효소 (transferase)에 의해 BIP 단백질의 N-말단 Glul9 , CRT단백질의 N-말단 Glul8또는 PDI단백질의 N-말단 Aspl8이 아르기닌화,또는 이증가닥 DNA(dsDNA)에 대한 내재성 면역반응을 통해 유도되는 것이 보다 바람직하나 이에 한정되지 않는다.
상기 아르기닌화된 단백질은 잘못 폴딩된 (mi sfolded) 세포질 단백질에 의해 유도되고, 자가포식 공포 (autophagic vacuoles)와 함께 위치하는 세포질 점 (puncta)을 형성하고, BIP단백질의 N-말단 Glul9, CRT단백질의 N-말단 Glul8 또는 PDI 단백질의 N-말단 Aspl8의 아르기닌화는 상기 단백질을 자가포식소체로 전달하기 위한 자가 포식 N-degron으로 작용하는 것이 바람직하나 이에 한정되지 않는다. 본 발명의 구체적인 실시예에서, 본 발명자들은 Bip(NCBI Reference Sequence : NP_005338) (서열번호: 1), CRT(NCBI Reference Sequence : NP_004334) (서열번호: 2) , PDI ( (NCBI Reference Sequence : NP_000909) (서열번호: 3)의 아르기닌화된 형태 (R-Bip, R-CRT, R-PDI )에 특이적인 래빗 다클론 항체를 아르기닌화된 성숙 단백질의 N-말단 염기서열에 해당하는 펩타이드 염기서열 REEEDKKEDVGC (서열번호: 4) , REPAVYFKEQ (서열반호: 5), RDAPEEEDHVL (서열번호: 6)를 이용하여 각각 제조한 다음, 항체의 특이도를 확인한 결과, 본 발명의 항체는 아르기닌화되지 않은 펩타이드보다 아르기닌화된 형태 (R-Bip, R-CRT, R-PDI ) 펩타이드에 더 친화적으로 결합하는 것을 확인하였다 (도 7 참조) . 본 발명의 항체는 면역학적으로 특정 항원과 반웅성올 갖는 면역 글로불린 분자를 포함하고, 상기 항원을 특이적으로 인식하는 수용체 역할을 하는 단백질 분자를 의미하며, 다클론항체, 단일클론항체, 전체 (whole) 항체 및 항체 단편을 모두 포함한다. 또한, 키메라성 항체 (예를 들면, 인간화 뮤린 항체) 및 이종결합항체 (예를 들면, 양특이성 항체)와 같은 유전공학에 의해 생산된 형태를 포함한다. 전체 항체는 2개의 전체 길이의 경쇄 및 2개의 전체 길이의 중쇄를 가지는 구조이며, 각각의 경쇄는 중쇄와 다이설파이드 결합으로 연결되어 있다. 상기 전체 항체는 IgA, IgD, IgE, IgM및 IgG를 포함하며, IgG는 아형 (subtype)으로, IgGl , IgG2, IgG3 및 IgG4를 포함한다. 상기 항체 단편은 항원결합 기능을 보유하고 있는 단편을 의미하며 , Fab, Fab ' F(ab ' )2및 Fv등을 포함한다. 상기 Fab는 경쇄 및 중쇄의 가변영역과 경쇄의 불변 영역 및 증쇄의 첫 번째 불변 영역 (CH1 도메인)을 가지는 구조로 1개의 항원 결합 부위를 가진다. Fab'는 중쇄 CH1 도메인의 C말단에 하나 이상의 시스테인 잔기를 포함하는 힌지 영역 (hinge region)을 가진다는 점에서 Fab와 차이가 있다. F(ab ' )2 항체는 Fab '의 힌지 영역의 시스테인 잔기가디설파이드 결합을 이루면서 생성된다. Fv(var iable fragment )는 중쇄 가변부위 및 경쇄 가변부위만을 가지고 있는 최소의 항체조각을 의미한다. 이중쇄 Fv(dsFv)는 디설파이드 결합으로 중쇄 가변부위와 경쇄 가변부위가 연결되어 있고 단쇄 Fv(scFV)는 일반적으로 펩타이드 링커를 통하여 중쇄의 가변 영역과 경쇄와 가변 영역이 공유 결합으로 연결되어 있다. 이러한 항체 단편은 단백질 가수분해 효소를 이용해서 얻을 수 있고 (예를 들어, 전체 항체를 파파인으로 제한 절단하며 Fab를 얻을 수 있고 펩신으로 절단하면 F(ab ' )2 단편을 얻을 수 있다), 바람직하게는 유전자 재조합기술을 통하여 제작할 수 있다. 또한, 본 발명은 아르기닌화 (arginylat ion)된 단백질에 특이적으로 결할하는 항체를 포함하는 바이러스 또는세균감염 진단용 키트를 제공한다. 또한, 본 발명은 아르기닌화 (arginylat ion)된 단백질에 특이적으로 결합하는 항체를 포함하는 면역조절제 및, 바이러스 또는 세균감염 치료제 스크리닝용 키트를 제공한다.
상기 단백질은 ER(Endoplasmic Ret iculum) 단백질인 것이 바람직하고, BIP, CRT 및 PDI로 구성된 군으로부터 선택되는 어느 하나인 것이 보다 바람직하며, 상기 BIP 단백질은 서열번호 1로 기재되는 아미노산 서열을 갖고, 상기 CRT 단백질은 서열번호 2로 기재되는 아미노산 서열을 가지며, 상기 PDI 단백질은 서열번호 3으로 기재되는 아미노산 서열을 갖는 것이 가장 바람직하나 이에 한정되지 않는다.
상기 아르기닌화된 단백질은 BIP 단백질의 N-말단 Glul9 , CRT 단백질의 N-말단 Glul8또는 PDI단백질의 N-말단 Aspl8이 아르기닌화된 것이 바람직하고 : 상기 아르기닌화된 단백질은 ATE1 R-transferase에 의해 BIP 단백질의 N—말단 Glul9 , CRT 단백질의 N-말단 Glul& 또는 PDI 단백질의 N-말단 Aspl8이 아르기닌화, 또는 이중가닥 DNA(dsDNA)에 대한 내재성 면역반웅을 통해 유도되는 것이 보다 바람직하나 이에 한정되지 않는다. 상기 아르기닌화된 단백질은 잘못 폴딩된 (misfolded) 세포질 단백질에 의해 유도되고, 자가포식 공포 (autophagic vacuoles)와 함께 위치하는 세포질 점 (puncta)을 형성하고, BIP단백질의 N-말단 Glul9, CRT단백질의 N-말단 Glul8 또는 PDI 단백질의 N-말단 Aspl8의 아르기닌화는 상기 단백질을 자가포식소체로 전달하기 위한 자가 포식 N-degron으로 작용하는 것이 바람직하나 이에 한정되지 않는다.
본 발명의 구체적인 실시예에서, 발명자들은 ER( endoplasmic reticulum) 내 추정되는 N-데그론 (N-degrons)의 분석을 수행한 결과, 시그널 펩타이드 분할 부위의 P1' 잔기를 분석했올 때 대략 27%(498개 중 132개)가 불안정화 상태의 N-말단 잔기를 노출시키는 것을 확인하였으며, 이는 20개 아미노산 중 : 13개가 포함되었던 기존 N-데그론 코드와 비교했을 때 유의하게 낮은수준임을 확언하였다 (S.M.Sriram et al. Nature Rev. Mo 1 Cell Biol. 12, 735(2011)) (표 1 시지.표 4 참조). 이에, 다양한 문헌을 검토한 결과, 지금까지 확인된 N-end ' rule기질의 대부분이 N-말단 Arg또는 pro-N- degrons(Asn, Gin, Cys, Asp, Glu) (이들의 해독 후 변형이 N-말단 Arg을 생성함)을 지님을 확인하였다.
또한, 신생 폴리펩타이드의 전좌 (translocation) 및 폴딩 (folding)을 보조하는 Glul9 노출 샤페론인 Bip의 전환 (turnover)을 시클로핵시미드 (cycloheximide) 분해 분석을 수행한 결과, Bip 대사 (turnover)가 프로테아좀과 연관되지 않은 다른 분해경로와 관련될 수도 있음을 확인하였다 (도 lb 내지 도 Id 참조).
또한, 아르기닌화의 생리학적 기질을 확인한 결과, ATE11A7A가 Bip, CRT및 PDI에 대한 주요 R-전달효소 (transferase)인 것을 확인하였고 (도 le, 및 도 8b 내지 8d참조), 또한, 세포질의 가용성 분획으로부터 ATE11A7A로 생성된 R-Bip의 약 70%정도가 검색되는 것을 확인하였으며 (도 If 참조), 아르기닌화 되지 않은 (루멘의) Bip는 현저하게 수명이 짧은 반면, (세포질의) R-Bip는 상대적으로 수명이 길었으며 (도 lg), 이는 루멘의 Bip는 역전좌 (retrotranslocation) 및 아르기닌화를 통해 어느 정도 대사된다는 것을 확인하였다 (도 lg 참조). 또한ᅳ Bip 아르기닌화가 N—말단 GluW에서 발생하는지의 여부를 확인한 결과, ATE11A7A 과발현은 N-말단 Ghil9을 노출시킨 재조합 Bip의 아르기닌화를 쉽게 유도되었으며, Ghil9에서 Val로의 변이체는 N-end rule에 의해서 안정화되면서 ATE11A7A 매개 아르기닌화를 억제됨을 확인하였다 (도 lh 내지 도 lj 참조) . 따라서, Bip가 생체 내에서 ( in vivo) 자체의 N-말단 Glul9에서 ATE1 R-transferase에 의해 아르기닌화된다는 것을-확인하였다.
또한, 본 발명자들은 Bip 아르기닌화는 6시간에 이르는 ER 스트레스에 의해서도 감지가 가능한 수준으로 유도되지는 않았으며, 이는 R-Bip의 주요 역할이 최종적으로 미스 폴딩된 ER 단백질을 제거하는 것이 아니라 ER 외부의 프로세스에 참여하는 것임을 확인하였다 (도 8b 참조) .
또한, 아르기닌화를 유도하는 스트레스를 확인한 결과, 이중가닥 DNA(dsDNA)에 대한 내재성 면역 반응을 통한 ER 단백질의 아르기닌화가 유도되고 (도 2a, 도 9a 및 도 9b 참조), 이중가닥 DNA로 유도된 Bip 아르기닌화에서 ATE1가 그 역할을 한다는 것을 확인하였으며 (도 9c 및 도 9d 참조), 또한, 이중가닥 DNA(dsDNA)와는 달리, 이중가닥 RNA(dsR A)는 아르기닌화를 유도하는 활성이 비교적 약한 쇳을 확인하였다 (도 11a 참조) . 이 결과들은 세포질의 dsDNA가 여러 Ca++ 결합 ER 샤페론의 역전좌 (retrotranslocat ion)및 ATE-1의존성 아르기닌화를 촉발함을 시사한다. 또한, 본 발명자들은 Bip, PDI , CRT의 아르기닌화는 바이러스의 dsDNAs를 표현하는 면역증강성 시약인 세포질의 폴리 (dA: dT) dsDNA에 의해 강하게 유도되므로 (도 2b, 도 11a 내지 도 11c 참조), ER 존재물의 ATE1 의존성 아르기닌화가 세포질의 dsDNA에 대한 내재성 면역 반웅에 있어서 중요한 역할을 한다는 것을 확인하였다.
또한, 본 발명자들은 DNA로 유도된 내재성 면역 반웅 동안의 자가포식 경로에서 R-Bip가 역할을 하는지의 여부를 확인한 결과, 세포질의 dsDNA가 Bip의 아르기닌화 및 자가포식 두 가지 모두를 유도한 다음 R-Bip가 자가포식 공포로 전달된다는 것을 시사하며, 이는 dsDNA 촉발 내재성 면역 반응 동안의 세포 구성성분 (const i tuents)의 자가포식 분해에서 R-Bip가 역할을 한다는 것을 확인하였다 (도 3 및 도 12 참조) .
또한, 본 발명자들은 N-말단 Arg이 Bip가 자가포식소체에 대해 표적화되기 위해 필요한 자가포식 N-degron으로 작용 유무를 확인한 결과, 아르기닌화가 Bip와 다른 세포질 ER 단백질들까지도 자가포식에 대한 표적으로 만드는 자가포식 N-degron을 생성함을 확인하였다 (도 4 및 도 14 참조) .
또한, 본 발명자들은 아르기닌화가 미스 폴딩된 세포질 단백질과 상관관계에 있는지의 여부를 확인한 결과, 미스 폴딩된 세포질 단백질에 의해 ER 단백질의 아르기닌화가 유도되므로, 아르기닌화된 ER샤페론은 미스 폴딩돤 세포질 단백질와 대사 (turnover )에 관련되어 있음을 확인하였다 (도 5 및 도 15 참조) .
또한, 본 발명자들은 미스 폴딩된 세포질 단백질의 자가포식성 청소에서 R-Bip가 하는 역할 : 판별하기 위해 R-Bip , 유비퀴틴화 단백질, 자가포식소체 사이의 공동 국재를 조사한 결과, 미스 폴딩된 세포질 단백질의 자가포식 청소에서 R-Bip가 그 역할을 하며, 이는 그것의 N -말단 Arg이 폴딩오류 (i sfolded) 단백질 화물에 대한 trans—act ing N— degron으로서 하는 능력을 통해 이루어지는 것임을 확인하였다 (도 5e 및 도 15d 참조) .
따라서, 본 발명의 ER 단백질은 ATE1 R-transferase에 의해 N-말단에 아르기닌화가 발생하고,상기 아르기닌화된 ER단백질은 세포질 정위 (cytosol i c local i zat ion)및 표적에 대한 자가포식 공포 (autophagi c vacuoles)를 유도하는 내재 면역계 ( innate immune system)의 부분으로서 세포질 (cytosol i c)의 dsDNA로 유도되며, 세포질의 dsDNA는 ATE1 의존적으로 ER 단백질의 아르기닌화를 유도하고, 상기 아르기닌화는 세포질에서 미스폴딩 (mi sfolding) 단백질에 의해 자극되며, 아르기닌화된 ER 단백질은 자가소화작용퇴화 (autophagi c degradat ion)를 유도하는 자가포식소체 (autophagosome)의 기질로서 표적이 되어 내재 면역계를 유도하므로, 본 발명의 아르기닌화된 ER단백질 특이적으로 결합하는 항체는 아르기닌화된 ER 단백질을 유의적으로 탐지할 수 있으므로, 바이러스 또는 세균감염 진단 및, 면역조절쎄 및, 바이러스 또는 세균감염 치료제 스크리닝용 키트에 유용하게 사용될 수 있다. 본 발명의 키트에는 아르기닌화된 ER 단백질의 발현 수준을 측정하기 위하여 선택적으로 아르기닌화된 ER 단백질를 인지하는 항체뿐만 아니라 분석 방법에 적합한 한 종류 또는 그 이상의 다른 구성 성분 조성물, 용액 또는 장치가 포함될 수 있다. 구체적으로, 본 발명의 아르기닌화된 ER. 단백질의 발현 수준을 측정하기 위한 키트는 항체의 면역학적 검출을 위하여 기질, 적당한 완충용액 , 발색 효소 또는 형광물질로 표지된 2차 항체, 발색 기질 등을 포함할 수 있다. 상기에서 기질은 니트로셀를로오스 막, 폴리비닐 수지로 합성된 96 웰 플레이트, 폴리스티렌 수지로 합성된 96 웰 플레이트 및 유리로 된 슬라이드글라스 등이 이용될 수 있고, 발색 효소는 퍼옥시다아제 (peroxidase) , 알칼라인 포스파타아제 (alkal ine phosphatase)가 사용될 수 있고, 형광물질은 FITC , RITC 등이 사용될 수 있고, 발색 기질액은 ABTS(2 , 2 ' -아지노 -비스 (3-에틸벤조티아졸린 -6—설폰산) ) 또는 0PD(o-페닐렌디아민), TMB (테트라메틸 벤지딘)가사용될 수 있다.
상기 키트는 i ) SPR( sur face plasmon resonance) 방법 또는 SPRK sur face pl asmon resonance imaging) 방법, 또는 i i ) 항체에 부착된 형광표지에 의한 형광을 검출함으로써 양이 측정되는 것이 바람직하나 이에 한정되지 아니한다. 상기 항체는 본 발명의 에피토프 또는 항원을 대상으로 당업자에게 알려진 항체 제조방법에 의하여 제조될 수 있다.
본 발명의 키트는 세포질의 이중가닥 DNA(dsDNA)에 대한 내재성 면역 반웅을 통해 유도되는 아르기닌화된 ER 단백질을 측정하는데 사용될 수 있다. 상기 키트는 아르기닌화된 ER 단백질을 측정을 통해, 진료 행위자의 바이러스 또는 세균감염 진단 및, 면역조절제 및, 바이러스 또는 세균감염 치료제 스크리닝을 가능하게 할 뿐 아니라, 치료에 대한 개체의 반응을 모니터하여 그 결과에 따라 치료를 변경하는 것을 가능하게 한다.
본 발명의 키트는 상기 아르기닌화된 ER 단백질에 결합하는 1차 획득 시약 (capture reagent ) 및 1차 획득시약에 결합하지 않는 2차 획득 사약을 포함할 수 있다. 상기 1차 획득시약은 항체 또는 금속킬레이트, 바람직하게는 아르기닌화된 ER 단백질에 특이적으로 결합하는 항체이고, 2차 획득시약은 발색효소, 형광물질, 방사성 동위원소 또는 콜로이드로 표지한 접합체 (conjugate)로 2차 항체이다. 발색효소는 퍼록시다제 (peroxidase), 알칼라인 포스파타제 (alkal ine phosphatase) 또는 산성 포스파타제 (ac id phosphatase) (예: 양고추넁이 퍼록시다제 (horseradi sh peroxidase) )일 수 있고 형광물질인 경우, 플루오레신카복실산 (FCA) , 플루오레신 이소티오시아네이트 (FITC) , 플루오레신 티오우레아 (Fffl) ,
7-아세록시쿠마린 -3-일, 플루오레신 -5-일, 플루오레신 -6-일, 2 ',7 ' -디클로로플루오레신 -5-일,
2 ',7 ' -디클로로플루오레신 -6-일,디하이드로쩨트라메틸로사민ᅳ4-일,
테트라메틸로다민 -5-일, 테트라메틸로다민 -6-일,
4, 4-디플루오로 -5 , 7-디메틸 -4-보라 -3a , 4aᅳ디아자 -S-인다센ᅳ3-에틸 또는 4, 4-디플루오로 -5,그디페닐 -4-보라 -3a , 4a-다아자 -s—인다센 -3ᅳ에틸이 가능하다 . 개체로부터 수득된 시료를 1차 획득시약, 바람직하게는 아르기닌화된 ER 단백질에 특이적으로 결합하는 항체와 접촉시키는 경우, 시료는 항체와 접촉 전에 알맞은 정도로 희석될수 있고 항체는 세척이나 복합체의 분리 등 그 이후의 단계를 용이하게 하기 위해고형상에 고정될 수 있다. 고형상은 유리나 풀라스틱 예를 들어 미세역가 플레이트 (mi crot i ter plate) , 막대, 비드 (bead) 또는 미세비드 (mi crobead) 등이 될 수 있다. 항체는 또한 프로브 기질이나 단백질 칩에 결합될 수 있다. 시료를 항체와 정온배치한 후 세척하여 항체 -마커 복합체를 측정할 수 있다. 이는 세척된 흔합물을 2차 획득시약, 바람직하게는 2차 항체와 정은 배치하여 수행된다. 항체 -마커 복합체의 양 측정이나 존재 검출은 형광, 발광, 화학발광 (chemi luminescence) , 흡광도, 반사 또는 투과를 통해 이루어질 수 있다. 상기 방법 외에도 시료 내의 단백질 마커는 간접적인 분석방법 예를 들어, 단백질 마커의 다른 에피토프에 결합하는 모노클론 항체와 경쟁 또는 억제 반웅 분석을 실시하여 검출할 수 있다. 또한, 본 발명은
1) 시료내 피검화합물을 처리하는 단계;
2) 피검화합물을 처리한 실험군 및 피검화합물을 처리하지 않은 대조군에서 아르기닌화된 단백질의 수준을 측정하는 단계를 포함하는 면역조절제 스크리닝 방법을 제공한다.
또한, 본 발명은
1) 시료에 바이러스를 처리하는 단계 ;
2) 바이러스가 처리된 시료에 피검화합물을 처리하는 단계 ;
3) 피검화합물 및 바이러스가 처리된 실험군, 및 바이러스가 처리된 대조군에서 아르기닌화된 단백질의 수준을 감소시키는 피검화합물을 선별하는 단계를 포함하는 바이러스 치료제 스크리닝 방법을 제공한다.
상기 단계 1)의 시료는 분리된 전혈, 혈청, 혈장,타액,뇨, 객담, 림프액, 뇌척수액 및 세포간액으로 구성된 군으로부터 선택되는 어느 하나 이상인 것이 바람직하나 이에 한정되지 않는다.
상기 아르기닌화된 단백질은 BIP 단백질의 N-말단 Glul9, CRT 단백질의 N-말단 Glul8또는 PDI단백질의 N-말단 Aspl8이 아르기닌화된 것이 바람직하고 상기 아르기닌화된 단백질의 수준은 아르기닌화된 단백질에 특이적으로 결합하는 항체를 이용하여 측정하는 것이 바람직하다.
본 발명의 ER 단백질은 ATE1 R-transferase에 의해 N-말단에 아르기닌화가 발생하고,상기 아르기닌화된 ER단백질은 세포질 정위 (cytosol ic local izat ion)및 표적에 대한 자가포식 공포 (autophagic vacuoles)를 유도하는 내재 면역계 ( innate i隱 une system)의 부분으로서 세포질 (cytosol ic)의 dsDNA로 유도되며, 세포질의 dsDNA는 ATE1 의존적으로 ER 단백질의 아르기닌화를 유도하고, 상기 아르기닌화는 세포질에서 미스폴딩 (mi sfolding) 단백질에 의해 자극되며, 아르기닌화된 ER 단백질은 자가소화작용퇴화 (autophagic degradat ion)를 유도하는 자가포식소체 (autophagosome)의 기질로서 표적이 되어 내재 면역계를 유도하므로, 피검화합물을 처리한 후, 아르기닌화된 단백질의 발현 수준을 감소시킬 경우, 상기 피검화합물을 면역조절제로 사용할 수 있고, 또는 바이러스 및 피검화합물을 동시에 처리한 후, 아르기닌화된 단백질 수준을 감소시키는 피검화합물은 바이러스 치료제로 사용될 수 밌으므로, 상기 아르기닌화된 단백질의 발현 수준을 측정을 통해 면역조절제 또는 바이러스 치료제 스크리닝에 유용하게 이용될 수 있다. 또한, 본 발명의 스크리닝 방 ¾은 상기 아르기닌화된 단백질에 결합하는 항체를 처리한 후 결합한 항체의 양을 탐색함으로써 면역조절제 또는 바이러스 치료제를 스크리닝할 수 있다.
상기 결합한 항체의 양을 탐색하는 방밥으로는 초고속 스크리닝 (highthroughput screening, HTS) 시스템을 이용하는 것이 바람직하고, 여기에는 형광표지에 의한 형광을 검출함으로써 수행되는 형광법, 형광물질의 표지없이 표면의플라즈몬 공명 변화를 실시간으로 측정하는 SPR( sur face plasmon resonance) 방법 또는 SPR시스템을 영상화하여 확인하는 SPRKsurface plasmon resonance imaging) 방법올 이용하는 것이 바람직하나 이에 한정되지 않는다.
상기 형광법은 형광 스캐너 프로그램을 이용하여 상기 아르기닌화된 단백질 마커에 특이적 항체에 결합하는 항체를 형광물질로 라벨링한 후 스포팅하여 신호를 확인하는 방법으로, 아 방법을 적용하여 결합 정도를 확인할 수 있다. 상기 형광물질은 Cy3 , Cy5 , 폴리 L-라이신-플루오레세인 이소티오시아네이트 (poly L-lysine-f luoresceini sothiocyanat e , FITC) , 로다민 -B-이소티오시아네이트 (rhodamine-Bi sothiocyanate , ITC) , 로다민 (rhodamine)으로 이루어진 군으로부터 선택된 어느 하나인 것 바람직하나 이에 한정되지 않는다.
상기 SPR 시스템은 형광법과는 달리 시료를 형광물질로 표지할 필요가 없이 항체의 결합 정도를 실시간으로 분석하는 것이 가능하다. SPRI의 경우에는 미세정렬 방법을 이용하여 동시다발적인 시료 분석이 가능하다.
또한, 본 발명의 방법은 효소와 발색 반웅할 기질 및 결합되지 않은 단백질등은 제거하고 결합된 아르기닌화된 단백질 마커만을 보유핥 수 있는 세척액 또는 용리액을 포함할 수 있다. 분석을 위해 사용되는 시료는 혈청,뇨, 눈물 타액 등 정상적인 상태와 구별될 수 있는 생체 시료를 포함한다. 바람직하게는 생물학적 액체 시료, 예를들어 혈액, 혈청, 혈장으로부터 측정될 수 있다. 시료는 아르기닌화된 단백질 마커의 탐지감도를 증가시키도록 준비될 수 있는데 예를 들어 환자로부터 수득한 혈청 시료는 음이온 교환 크로마토그래피, 친화도 크로마토그래피, 크기별 배제 크로마토그래피 (si ze exclusion chromatography) , :액체. 크로마토그래피, 연속주줄 (sequent i al extract ion) 또는 젤 전기영동 등의 방법올 이용하여 전 처리될 수 있다.
또한, 피검화합물올 처리한 실험군 및 피검화합물을 처리하지 않은 대조군에서 아르기닌화된 단백질의 수준, 또는 피검화합물 및 바이러스가 처리된 실험군, 및 바이러스가 처리된 대조군에서 아르기닌화된 단백질의 수준은 웨스턴 블랏, ELISA, 방사선면역분석, 방사 면역 확산법, 오우크테로니 면역 확산법,로케트 면역전기영동,조직면역 염색,면역침전 분석법,보체 고정 분석법, FACS, 단백질 칩등이 있으나 이로 제한되는 것은 아니다. 상기 분석 방법들을 통하여, 정상 대조군에서의 항원 -항체 복합체의 형성량과 대조군에서의 항원 -항체 복합체의 형성량을 비교할 수 있고, 아르기닌화된 단백질의 발현량을 감소시키는 물질을 판단하여, 면역조절제 및 바이러스 치료제를 스크리닝할 수 있다.
본 발명에서 용어, "항원 -항체 복합체 "는 아르기닌화된 단백질과 이에 특이적인 항체의 결합물을 의미하고, 항원 -항체 복합체의 형성량은 검출 라밸 (detect ion label )의 시그널의 크기를 통해서 정량적으로 측정 가능하다. 이러한 검출 라벨은 효소, 형광물, 리간드, 발광물, 미소입자 (niicropart icle) , 레독스 분자 및 방사선 동위원소로 이루어진 그룹 중에서 선택할 수 있으며, 반드시 이로 제한되는 것은 아니다. 검출 라벨로서 효소가 사용되는 경우 이용 가능한 효소에는 β -글루쿠로니다제, β -D-글루코시다제, β -D-갈락토시다제, 우레아제, 퍼옥시다아제 또는 알칼라인 포스파타아제, 아세틸콜린에스테라제, 글루코즈 옥시다제, 핵소키나제와 GDPase, RNase , 글루코즈 옥시다제와 루시페라제, 포스포프럭토키나제, 포스포에놀피루베이트 카복실라제, 아스파르테아트 아미노트랜스페라제, 포스페놀피루베이트 데카복실라제, β -라타마제 등이 있으며 이로 제한되지 않는다. 형광물에는 플루오레신, 이소티오시아네이트, 로다민, 피코에리테린, 피코시아닌, 알로피코시아닌, 0-프탈데히드, 플루오레스카만 등이 있으며이로 제한되지 않는다. 리간드에는 바이오틴 유도체 등이 있으며 이로 제한되지 않는다. 발광물에는 아크리디늄 에스테르, 루시페린, 루시퍼라아제 등이 있으며 이로 제한되지 않는다. 미소입자에는 콜로이드 금, 착색된 라텍스 둥이 있으며 이로 제한되지 않는다. 레독스 분자에는 페로센, 루테늄 착화합물, 바아올로젠, 퀴논, Ti이온, Cs이온, 디이미드, 1 ,4ᅳ벤조퀴논, 하이드로퀴논, K4W(CN)8, [Os(bpy)3]2+ , [RU(bpy)3]2+ , [M0(CN)8]4-등이 포함되며 이로 제한되지 않는다. 방사산동위원소에는 , 14C,
32p , 35S ; 3 1, 51Cr ; 57CO ; 58CO ; 59ρ6 ; 90γ , 125J; 131 j; 186Re 등이 포함되며 이로 제한되지 않는다 .
단백질 발현수준 측정은 바람직하게는, ELISA 법을 이용하는 것이다. ELISA는 고체 지지체에 부착된 항원을 인지하는 표지된 항체를 이용하는 직접적 ELISA, 고체 지지체에 부착된 항원을 인지하는 항체의 복합체에서 포획 항체를 인지하는 표지된 항체를 이용하는 간접적 ELISA, 고체 지지체에 부착된 항체와 항원의 복합체에서 항원을 인지하는 표지된 또 다른 항체를 이용하는 직접적 샌드위치 ELISA,고체 지지체에 부착된 항체와 항원의 복합체에서 항원을 인지하는 또 다른 항체와반웅시킨 후 이 항체를 인지하는 표지된 2차 항체를 이용하는 간접적 샌드위치 ELISA 등 다양한 ELISA 방법을 포함한다. 보다 바람직하게는, 고체 지지체에 항체를 부착시키고 시료를 반웅시킨 후 항원 -항체 복합체의 항원을 인지하는 표지된 항체를 부착시켜 효소적으로 발색시키거나 항원 -항체 복합체의 항원을 인지하는 항체에 대해 표지된 2차 항체를 부착시켜 효소 적으로 발색시키는 샌드위치 ELISA 방법에 의해서 검출한다.
이하, 본 발명을 하기 실시예 및 실험예에 의해 상세히 설명한다. 단, 하기 실시예 및 실험예는 본 발명을 예.시하는 것일 뿐, 하기 실시예 및 실험예에 의해 본 발명의 범위가 제한되는 것은 아니다.
<실시예 1>플라스미드 및 기타 시약에 준비
ATE1 R-전달효소 (transferase) 아형 ( isoiorms)을 인코딩하는 플라스미드는 Kwon-1999에 기술된 방법으로 준비하였다 (Y.T.Kwon et al, Mo 1. Cell. Biol. 19, 823(1999)). 또한, Cᅳ말단 KDEL ER 잔류 신호가 flag-KDEL로 대체된, 전체길이 Bip-flag-KDEL를 인코딩하는 플라스미드를 구축하기 위해 Bip-flag-KDEL절편을 중합효소 연쇄반웅 (PCR: polymerase chain reaction)에 의해 pENTR/hBipc( Invi trogen)로부터 증폭되었고, 백터 pcDNA3.0의 Hindlll/BamHI-KDEL 에 삽입하였다.
또한, QuickChange XL 방법 (Stratagene)을 사용하여 Bip에서의 Glul9-to-Val 점돌연변이를 생성하였다. Ub-X-Bip-GFP 및
Ub-X-Bipl9— 106— GFP을 인코딩하는 플라스미드는 pEGFP— N3의 BamHI/Hindlll 위치에 구축하여 PCR을 이용해서 증폭하였다. 또한, 전체길이의 Bip-myc/his 을 인코딩하는 cDNA를 구축하기 위해 Bip 절편을 PCR을 이용하여 pENTR/hBipc(Invitrogen)로부터 증폭하였고, EcoRV-XhoI 부위의 백터 pcDNA3.1-myc/his 에 삽입하였다.
아울러, Ub-X-Bip-myc/his를 인코딩하는 플라스미드는 PCR 증폭을 사용하여 pcDNA3.1-myc/his의 BamHI/ Xbal 부위 안에 구축했다. 이렇게 구축된 플라스미드의 염기서열을 염기서열분석법 (sequencing)으로 확인하였다.
또한, 하기 플라스미드들은 시판되고 있는 것들을. 이용하였다: N3-EGFP(Addgene, cat #608으 1), Ub-HA(Addgene , 17608: pRK5-HA-ubiquit in-WT) , Ub-mt-HA(Addgene, 17603: pRK5-HA-ubiquitin-K0) , YFP-CLl(Addgene, 11950), Ig -IFN β-LucCAddgene, 14886) , leni 1 lar-luc (Pr omega, E2231, pRL-SV40 vector) .
또한, NHK-GFP 플라스미드는 Dr. Nobuko Hosokawa( Kyoto University, Japan)로 부터 기증받았다. 아을러, 하기 기타 시약은 시판되는 것을 구매하여 이용하였다: thapsigarginCSigma, T9033) , digitonin(Sigma, D141) , bafilomycin AKSigma, B1793) , geldanamycin( Sigma, G3381), MG132(Calbiochem, 474790) , poly(dA:dT)(Invivogen) , 5ppp-RNA ( I nv i vogen ) , salmon sperm DNA (Sigma, D1626) RNAiMaxClnvitrogen, 13778), Lipofectamine 2000(Invitrogen, 11668), Lipofectamine LTX( Invi trogen, 15338) , protein A/G plus agarose bead(Santa Cruz, sc2003) , car bony 1 cyanide ch 1 or opheny 1 hydr azone ( S i gma , C2759) , A23187(Sigma, C7522), bortezomib(BTZ, Selleckchem, S1013) , hydrogen peroxide(Sigma, H1009) , Dual-luci ferase reporter assay system (Pr omega, E1910).
<실시예 2>항체의 준비
본 발명에서 사용되는 항체는 하기와 같이 시판되고 있는 것들을 이용하였다:
래빗 단일클론 anti-Bip(Cell Signaling, cat. #3177, 1:1000), 래빗 다클론 anti-GFP(Abchem, ab290, 1:3000),마우스 단일클론 ant i-LC3(Santa Cruz sc271625, 1:1000), 래빗 다클론 ant i-GAPDH( Santa Cruz, sc25778, 1:2000), 마우스 단일클론 anti-flag(Sigma, fl804, 1:3000), 래빗 단일클론 ant i-ATEK Santa Cruz, sc-271220, 1:500), 래빗 단일클론 ant i-IRF_3(Cel 1 Signaling, 11904P, 1:500), 래빗 anti-phospho-IRF— 3(Ser396)(Cel 1 Signaling, 4947S, 1:500), 마우스 단일클론 ant i -CHOP (Cel 1 Signaling, 2895S, 1:200), 마우스 단일클론 anti-calreticulin/CRT(BD Biosciences, 612136, 1:5000)ᅳ 마우스 단일클론 anti-polyubiquitylated FK2 clone(Mi 11 ipore, cat. #04-263), 래빗 단일클론 anti-PDKCell Signaling, 2446S, 1:1000).
또한, 이차 항체도 하기와 같이 시판되고 있는 것들을 이용하였다:
alexa f luor 488 goat ant i -rabbit IgGdnvitrogen, A11034, 1:200), alexa f luor 555 donkey ant i -goat IgGdnvitrogen, A21432, 1:200), alexa f luor 555 goat ant i -mouse IgGdnvitrogen, A21424, 1:200), ant i -rabbit IgG-HRP(Cell Signal ing, 7074, 1 : 10000) , ant i -mouse IgG-HR (Cel l Signal ing, 7076, 1 : 10000) .
<실시예 3>아르기닌화된 Bip, CRT, PI)I에 대한항체의 제작
Bip(NCBI Reference Sequence : NP_005338) (서열번호: 1), CRT(NCBI Reference Sequence : NP_004334) (서열번호: 2), PDI ( (NCBI Reference Sequence : NP—000909) (서열번호: 3)의 아르기닌화된 형태 (R-Bip , R-CRT, R-PDI )에 특이적인 래빗 다클론 항체는 AbFront ier Inc . (대한민국, 서울)의 커스텀 서비스를 통해서 아르기닌화된 성숙 단백질의 N-말단 염기서열에 해당하는 펩타이드 염기서열 REEEDKKEDVGC (서열번호: 4), REPAVYFKEQ (서열번호: 5), RDAPEEEDHVL (서열번호: 6)를 이용하여 각각 제조하였다.
구체적으로, 래빗에서 상기 펩타이드로 면역법을 수행하였고, 불완전 프로인트 보강제 ( IFA: incomplete Freunds adjuvant )로 3주 간격으로 부스팅 (boost ing)하였다. 고정된 Protein A을 사용한 IgG 정제 후, 해당 항체에 2단계 친화성 크로마토그래피를 실시하였다. 첫째, 아르기닌화되지 않은 펩타아드인 EEED KEDVGC (서열번호: 7), EPAVYFKEQ (서열번호: 8), 또는 DAPEEEDHVLC서열번호: 9)를 사용하여 항체를 음성적으로 정제하여, 비특이적 IgG를 제거하였다. 첫 번째 친화성 크로마토그래피로부터 나은 f low-through에 있는 항체를 0.1 M 구연산에서 용출시킴으로써 아르기닌화된 펩타이드인 REEEDKKEDVGC (서열번호: 4), REPAVYFKEQ (서열번호: 5) 또는 RDAPEEEDHVL (서열번호: 6)를 사용하여 양성적으로 정제하였다.
<실시예 4> 아르기닌화된 Bip, CRT, PDI에 대한 특이적으로 결합하는 항체의 확인
상기 <실시예 3〉에서 제작한 아르기닌화된 Bip, CRT, PE)I에 대해 특이적으로 결합하는 항체가 아르기닌화 유도 스트레스원이 존재하거나 존재하지 않는 곳에서 배양된 세포에 대한'면역블로팅 분석을 이용하여 정제된 항체의 특이도를 확인하였다. 특이도는 펩타이드결합 분석법을 이용하여 독립적으로 규명되었다. 구체적으로, Bip, CRT 및 PDI 에 대한 펩타이드를 각각 코팅 버퍼 (0. 1 M carbonate pH 9.6)에 2 mg/ml로 희석하였고, 4°C에서 오버나이트로 인큐베이션하여 96-wel l 플레이트에 고정시킨 다음, 블로킹 버파 A (2% skim mi lk in TBS-T)에서 37°C 로 1시간 동안 인큐베이션하였다. TBS-T로 세척한 후 고정화된 펩타이드를 경쟁 펩타이드가 존재하거나 존재하지 않는 조건에서 Bip CRT 또는 PDI 에 대한 일차 항체를 함유한 블로킹 버퍼로 37°C로 2시간 동안 인큐베이션 한 다음, horseradi sh peroxide 에 접합된 goat ant i -rabbi t 이차 항체로 인큐베이션하였다. 고정화된 펩타이드에 대한 항체의 결합은 450 nm에서의 광학밀도 (O.D. )에 따라 평가하였다.
그 결과, R-Bip의 수준은 HeLa세포, HEK293세포, 마우스 섬유아세포 등 다양한 세포주에서의 검출한계보다 낮거나 그 경계에 있는 것을 확인하였다. 내강 ( luminal ) Bip에 대한 Bip 항체 (Cel l signal ing, cat #3177)로 동일한 분석을 실시한 결과, 높은 수준의 지속적인 신호 (const i tut ive signals)가 감지되었으며, 이는 아르기닌화되지 않은 아집단을 표현하는 신호인 것을 확인하였다. 또한, 폴리 (dA:dT) dsDNA처리 결과, R-Bip의 수준은 크게 증가한 반면 (밀도 측정법에 의해 -100배까지 증가한 것으로 판별), 내강의 Bip 수준은 변함이 없거나 약간만 변하였다. 이는 내강 ( lumen)에서 ant i-R-Bip 항체가 아르기닌화되지 않은 Bip을 인식하지 않음을 나타낸다. 유사한 분석들에서도 ant i-R-CRT 항체는 R-CRT에 대한 특이도가 강한 것으로 나타났다 (도 7) . 이와 대조적으로, ant i-PDI 항체를 사용한 면역블로팅 분석은 지속적인 (const i tut ive) 수준의 R-PDI를 검출했지만, 세포를 폴리 (dA:dT) dsDNA로 처리했을 때에는 아르기닌화된 PDT와 아르기닌화되지 않은 PDI 간 비율이 현저하게 증가하였다. 기본 R-PDI 시그널이 아르기닌화된 PE)I에 대해 내인성 R-PDI 또는 교차 반응성을 나타내는지의 여부는 아직 확인되지 않았다. 이 결과들은 펩타이드 결합 -결합 분석 (pept ide binding-binding assay)에서 확증되었으며, 이 분석에서 본 발명자들은 상기 항체들이 플레이트에 고정된 R-Bip 펩타이드 (REEEDKKEDVGC) (서열번호: 4) , R-CRT 펩타이드 (REPAVYFKEQ) (서열번호: 5)에 결합하는 능력을 측정하였다. 면역블로팅 분석의 결과와 일관되게 이 결합 분석에서도 anti-R-Bip 항체는 아르기닌화되지 않은 Bip 펩타아드보다 고정화된 (i隱 obilized) R-Bip 펩타이드에 더 친화적으로 결합하는 것으로 나타났다. Anti-R-Bip 항체와 대조적으로 anti-R-CRT 및 anti-PDI 항체는 아르기닌화된 종에 대해 덜 강한 선호도를 나타내는 것을 확인 하였다.
<실시예 5>준세포 분획 (Subcellular fractionation)
세포질의 단백질을 획득하기 위해 세포를 트립신 처리한 다음, 1,500 X g로 원심분리하여 펠렛을 얻었다. 수확된 세포의 원형질막을 0.01% 디지토닌 (digitonin), Digitalis purpurea에서 추출한 배당체 (glycoside)가 들어간 용해 버퍼 (110 mM KOAc, 25 mM K-HEPES, pH7.2, 2.5 mM Mg(0Ac)2, 1 mM EGTA)를 사용하여 투과화시켰다. 벌크 (bulk) ER를 포함하며 디지토닌이 투과된 세포를 1,000 X g로 5분간 원심분리 하여 펠렛을 얻었다 /원심분리 후 그 결과로 나온 상층부를 15,000 X g로 다시 원심분리 하여, 디지토닌이 투과화된 세포의 밖으로 나온 가용성 세포질 단백질 및 자가포식 공포를 함유하고 있는 세포질 분획을 획득하였다. 세포질의 단백질을 획득하는 또 하나의 방법은 저장성 용해 버퍼 (10 mM KOAc, 10 mM KHEPES, pH7.2, 1.5 mM Mg(0Ac)2)로 세포를 부풀린 다음, 다운스 균질기 (Dounce homogenizer)를 사용하여 원형질막을 찢어내는 것아다. 버퍼를 0.25 M수크로오스로 조정한 후, 세포 부유물을 1,000 X g로 10분간 원심분리 하여 깨지지 않은 세포와 핵을 버린 다음, 12,000 X g로 15분간 원심분리하여 미토콘드리아를 제거하였다. 결과로 나온 상충부를 100,000 X g로 1시간 동안 초원심분리 (ultracentrifuged)하여, ER의 조각들을 함유하면서 다공질 구조를 나타내는 마이크로솜으로부터 가용성 세포질 단백질을 분리하였다.
<실시예 6>세포 배양, 면역블로팅 및 면역침강
HeLa, PC3, HEK293세포뿐 아니라 +/+및 ATE1-/- MEFs를 10% FBS(GIBCO)가 보충된 DMEM(GIBCO)로 5% C02 인큐베이터에서 배양하였다. 면역블로팅을 위해 NETN용해 버퍼 (lOOmMNaCl, 20mMTris— HCl, pH 8.0, O.SmMEDTA, 0.5%Nonidet P-40)또는 RIPA버퍼 (50mMTris-HCl, pH8.0, 150 mM NaCl , 1% NP-40, 0.5% sodium deoxycholate, 0.1% SDS)를 사용하여 세포를 용해하였다. 전체 세포 용해물을 SDS-PAGE로 분리하였고, 폴리비닐리덴 다이플로라이드 (polyvinylidene difluoride) 멤브레인으로 트랜스퍼하였다. 면역침강을 위해 세포 용해물을 일차 항체로 4°C에서 4시간 동안 인큐베이션 한 다음, 단백질 A/G 아가로스 비드 (agarose bead) (Santa Cruz)로 인큐베이션 하였다. 항체 -비드 복합체에 결합된 단백질을 저온의 NETN 버 로 세척하였고, 면역침강 분석을 위해 SDS-PAGE로 분리하였다.
<실시예 7>단백질 분해 분석법 (Protein degradation assays)
필스 추적 분석을 위해 80% 합류를 이룬 세포를 100 nM thapsigargin로 6시간 동안 처리하여 Bip의 전사를 유도하였고, 35S methionine/cysteine( 5S Express protein labeling mix; Perkin_Elmer)'로 12분간 .필스표지 한 다음, 사이클로핵사마이드 존재 하 추적, 추출물의 제조, 면역침강, NuPAGE 10%-Bis-Tris SDS-PAGE (Invitrogen) ,자가방사기록법 (autoradiography),그리고 3¾의 정량 (quantitation) (Molecular Imager FX 시스템, Bio-Rad, Hercules, CA)을 기술된 바에 따라 실시하였다. 사이클로핵사마이드 추적 분해 분석을 위해 8W 합류를 이룬 세포를 10 ug/ml 사이클로핵사마이드로 처리하였다. 제시된 시점에 세포를 단백질분해효소 저해제 흔합물 (protease inhibitor cocktail)을 함유한 RIPA 버퍼로 얼음 위에서 30분간 용해한 다음, 15,000 g로 20분간 원심분리 하였다. 원심분리 후, 상층부에 있는 10 Ug 단백질에 면역블로팅을 실시하였다. <실시예 8> RNA간섭 분석
6-well 플레이트 내 세포 (1 X lOVwell)는 RNAi Max 시약 (Invitrogen)을 사용하여 100 pmol siRNA로 형질감염시켰다. 미리 설계된 Silencer Select siRNAs (Invitrogen)를 사용하여, ATE1을 하기와 같은 염기서열을 이용하여 넉다운 (knowdown) 하였다:
siATEl #202(HSS117-202-sense, GAUUCCUUUGCAGUUCACCCUUGGA (서열번호: 10); HSS117-202-anti sense, UCCMGGGUGAACUGCAAAGGAAUC (서열번호: 11));
siATEl #203(HSS117-203-sense, GAGAGCCAUCAUGCCUUACGGUGUU (서열번호: 12); HSS117-203-ant i sense, AACACCGUAAGGCAUGAUGGCUCUC (서열번호 : 13) ); 및 siATEl #204 (HSS117-204-sense, ACCCACCAUCUUUGUUUCCACCAAA (서열번호: 14); HSS117-204-anti sense, UUUGGUGGAAACAAAGAUGGUGGGU (서열번호: 15)).
<실시예 9>면역조직화학검사 (Immunohistochemistry)
배양된 세포에서 ER에 존재하는 단백질의 아르기닌화된 형태에 대한 면역조직화학검사가 표준 절차를 이용하여 수행되었다 (Tasaki et al - ,Annu,Rev.Biochem. I, 261(2012)).
구체적으로, . 세포를 PBS로 2회 세척하고, 4% 파라포름알데히드 (paraformaldehyde)로 상온에서 10분간 고정한 다음, 0.25% Triton X-100으로 ᅳ 15분간 처리하고ᅳ 블로킹 용액 (3% BSA in PBS)에서 인큐베이션한 다음, 일차항체로 인큐베이션한 뒤에 Alexa Fluor-488- labeled goat ant i -rabbit IgG(Invitrogen)으로 인큐베이션하였다. 공초 ¾ 이미지는 공초점 레이저 주사 현미경 510 Meta(Zeiss)으로 취득하고, Zeiss LSM Image Browser (ver. 4.2.0.121)를 사용하여 분석하였다.
재조합 단백질의 세포내 위치를 판별하기 위해 커버슬립 위에서 자란 세포를 한쪽 폴리 (dA:dT)(l g/ml)로 형질감염시켰다. 형질감염 16시간 후, 세포를 4% 파라포름알데히드 (paraformaldehyde)로 상은에서 0.5시간 동안 고정시켰고, PBS로 2회 세척하였으며,블로킹 용액 (1% normal goat serum및 0. Triton X-100이 들어간 0.1 Μ 인산완층식염수 (PBS: phosphate-buffered saline))에서 1시간 동안 인큐베이션한 다음, 일차 항체에 이어 이차 항체로 인큐베이션하였다. 두 ImageJ(l) 플러그인 (phigins)인, 공동국재화 파인더 (colocal ization finder) (Chr istophe Laummonerie와 Jerome Mut-terer이 개발) 및 JACoP (Just Another Co- local izat ion Plugin, 2)를 사용하여 형광 이미지의 동일 위치화를 평가하였다.
<실시예 10>루시페라아제 리포터 분석법
세포를 IgK-IFNp-Luc 리포터 플라스미드 (Addgene) 또는 Renillar-Luc 대조 플라스미드 중 하나로 형질감염시켰다. 이 세포를 폴리 (dA:dT) dsDNA와 pcDNA-ATEl-3로 동시에 형질감염시켰다. 형질감염 18시간 경과 후, 이중-루시페라아제 (Dual-lucif erase) 리포터 분석 시스템 (Promega) 및 VICTOR 1420형광리더기 (mult i label counter) (Perkin-Elmer)를 사용하여 루시페라아제 활성을 측정하였다. 실험은 최소 3회 반복하였다. 에러 바 (error bar)는 3회 독립적 실험의 평균의 표준오차를 가리킨다.
<실험예 1> ERCendoplasmic reticulum) 내 추정되는 N-데그론 (N-degrons)의 분석 ,
N-말단 법칙 (N-end rule) 경로는 해독 (translation) 후 세포질 내로 방출된 단수명 단백질을 표적으로 하는 선택적 단백질분해 시스템으로 알려져 았다 (S.M.Sriram et al . , Nature Rev. Mo I. Cell. Biol . 12,735(2011)). 하지만 인간 프로테음 중 3분의 1 정도에 해당하는 분비 경로에 있는 단백질들은 시그널 펩타이드 펩티다아제에 의해 시그널 펩타이드가 분할된 후 해독과 동시에 ER로 들어감에 따라 해독과 동시에 새로운 N-말단 잔기를 노출시키게 되므로, ER은 N-데그론 (degron)의 풍부한 원천이다.
따라서, 본 발명자는 N-데그론을 지닌 ER에 존재하는 단백질의 아집단은, 포의 단백질분해 기작 (machinery)에 의해 대사될 때까지, 온전한 폴딩과 함께 역전좌 (retrotranslocation)되고 세포질 N-말단 법칙 구성요소에 의해 표적화되아 ER외부의 다양한 프로세스에 참여하는지 확인하였다.
구체적으로. 루멘 (lumen)에서 추정 N-말단 분해 결정기가 생성되는 전반적 빈도를 평가하기 위해, ER로 들어가는 498개의 인간 단백질이 목록에 포함되어 있는 Apercu 데이터베이스를 이용하였다 (M.Scott et al. Bio informatics 20, 937(2004)). 그 결과, 표 1 내지 표 4에 나타낸 바와 같이, 시그널 펩타이드 분할 부위의 P1' 잔기를 분석했올 때 대략 27%(498개 중 132개)가 불안정화 상태의 N-말단 잔기를 노출시키는 것을 확인하였으며, 이는 20개 아미노산 중 13개가 포함되었던 기존 N-데그론 코드와 비교했을 때 유의하게 낮은 수준임을 확인하였다 (S.M.Sriram et al . Nature Rev. Mo 1 Cell Biol. 12, 735(2011)) (표 1 내지 표 4).
이에, 다양한 문헌을 검토한 결과, 지금까지 확인된 N-end rule 기질의 대부분이 N-말단 Arg 또는 pro-N- degrons(Asn, Gin, Cys, Asp, Glu) (이들의 해독 후 변형이 N-말단 Arg을 생성함)을 지님을 확인하였다.
[표 1]
E -rcsiding proteins that carry arginylyation-|5ermissive destabilizing N-fcrminals residues. Asp and Giu.
Figure imgf000033_0001
[표 2] ER-rcsiding proteins carrying tertiary destabilizing N-tcrminals residues (Asn, Gin. and Cys) whose modifications can generate argin lation-permissive residues ( Asp, Glu, and oxidized Cys).
[protein name INCBI Access I'N-tormlnat sequenced
SS 4 NP 006271 AA ASLGAtALLtLSSLSRCSAEACLEPQlTPSYYTTSOAVlSTETWtVEISLTC^NR QNW^
00103β
PCS 5 NP 006191 GWGSRCCCPGRLOLLCVtALLGGCLL^C TRVYTNHWAVKIAGGFPEAN lASKYGPINlG GST2 NP 002404 MAGNSlLLAAVStLSACTOSyFALQVG ARUCY VTPPAVTGSPeFE VFRAQQNCVEFYPfFIIT
KDEL2 M IFRLTGDLSHLAAtVfLLLKfWKT SCAGISGKSQLLFALVmKYLDLFTSFISLYNTSM hypothetical protein
UGT2B7 NP 001065 ^VKWTSViLLlQLSFCFSSGNCGKVLNWAAEYSHVVMNI T!LDELlQRGHENnVUASSASILFD
ICE NP 003860 MRtH L ARLSAVACGLLLLLVRGQGQDSASPIRTTHTCMVLGSLVHVKGA AGVQTFtGIPFA
VP EB3
VLCS-H2 NP 036386
pregnancy specific bea -elycopro
toin NP 008836 IVteTLSAPPCTQRiKWKGLLLTASLLNFWNLP AQVTIEAEPTKVSEGKOVLLLVHNLPQNLTG
P OC NP 006219 MKViLCDLL SLFSSVFSSCQ DCLTCQEKLHPAtDSFDLEVCILECEe VFPSPLWTPCTKV
Misugumtn 23 NP 076997 P^SStSSPWG HVPKAtL^^VAL!LLHSALAQS ROPAPPGQQK EAPVOVLTQtGRSV GT immunoglobulin J chain NP 653247 MKNHLLFWGVlAVRKAVHVKAOEDERlVLVDNKCKCA ITSRHR^SEDPNEm RNlRH
HRC NP 002143 MGHH PWLHASVLWAGVASLLtPPAMTQQtRGOGLGFRN 4STGVAGLSEEASAEL HHL
G6PE NP 004276 MWNMUVAMCLAlXOCLOAQELQOHVSIIt GATGDLAKKYUWQdLFOLrLDEAGRGHSFSFH
ERO!-L beta NP 063944 SQOV RAGAGQGVAAAyQLL\nVSFLRS\^^AQVTGVLOOGLCDlD$tONPNTYK(FPK(K tQ
CRAAP NP 057526 MVFLPLKWSI^IMSFLLSSLLALL STPSWCQSTEASP RSDGTPFPWNKI LPE IPVMYDL
CASQ1 NP 001222 MGPRA GLRLALLLLLVLGtPKSGVOGQEGLDFPEYDGVDRVlN^^
car oxypeptidase E precursor NP 001864 MAG GGSALU^LCGALAAdGWLLGAEAQEPGAPAAGMR RLQQEDGiSFEYHRYPEL EA amytoid beta (A4) precursor-tike pr
NP 005157
otein 1 tGPASPAARGLSR PGQPPLPLLLPLLLLLL AQPAIGSUVGGSPGAAEAPGSAQVAGLCG LT
3BH2 MGWSCLVTGAGGLLGQRIVRLLVEEKeLKElRALOKAFRPELREeFSKLQ
[표 3]
Figure imgf000035_0001
[표 4]
Human ER-rcsiding proteins whose arginylation- ennissive residues (Asp and Glu) are not cvolutionariiy conserved.
Figure imgf000036_0001
또한, 아르기닌화를 겪는 무언가가 존재하는지의 여부를 실험적으로 검사하기. 위해서 두 아르기닌화 기질 (Asp 및 Glu) 증에 하나를 지닌 25개 Asp/Ghi-단백질로 목록을 줄인 다음, 진화적으로 L-Arg을 수용하는 능력이 보전된 11개의 Asp/Glu-단백질로 좁혔다. 증요한 점은, 11개
Asp/Glu-단백질에는 분자人>페론 (Bip, GRP94, calreticulin (CRT)) 및 산화환원효소 (단백질 이황화 이성질화효소 (PDI: protein disulfide isomerases), ErdJ5)와 ¾은 주요 Ca++—결합 폴딩 인자가 풍부하였다는 것이다 (도 la, 도 6 및 표 3).
이하에서 좀 더 규명하기로선택한 3가지 단백질 (Bip, PDI, CRT)모두가 생체 .내쎄서 (in vivo)아르기닌화 되는 것을 확인하였으며, 이는 ER에 존재하는 다른 물질들 또한 N-end rule 변형을 겪을 수 있음을 시사한다.
<실험예 2> Glul9노출샤페론인 Bip의 전환 (turnover) 확인
홀딩 사이클에 포함되는 일부 ER 샤페론은 미폴딩 단백질 반웅 (UPR: unfolded proteins response) 중에도 어느 정도는 전사적으로 유도되어 소포체 관련 단백질 분해 (ER-associated protein degradation; ERAD)에 의해 미스 폴딩된 단백질을 제거한다 (R.R.Kopito, Cell 88, 427(1997)). 하지만, ER 단백질 품질 관리에 대한 광범위한 연구에도 불구하고, 샤페론 자체의 대사적 운명에 대해서는 여전히 이해가 부족하다.
따라서 본 발명자들은 신생 폴리펩타이드와 전좌 (trans location) 및 폴딩 (folding)을 보조하는 Glul9 노출 샤페론인 Bip의 전환 (turnover)을 시클로핵시미드 (cycloheximide) 분해 분석을 통해 확인하였다.
그 결과, 도 lb에 나타낸 바와 같이, 시클로핵시미드 (cycloheximide) 분해 분석와 결과, 랩시가긴 (thapsigargin) 비존재하에서 Bip의 반감기 (t08, hr)는 2-5시간인 것을 확인하였다 (도 lb). 또한, 도 lc에 나타낸 바와 같이, 미폴딩 단백질 반웅 (UPR)을 유발하는 ER 스트레스 유도물질 (stressor) 탭시가긴에 의해 전사적으로 활성화된 후에도 Bip은 분명히 단백질분해의 플럭스 (flux) 상에 존재함을 확인하였다. 그 다음에는 랩시가긴 처리된 세포를 35S-Met/Cys으로 12분간 펄스표지 (pulse-labeled)한 동안에 펄스추적 분석 (pulse-chase analysis)을 이용한 후, 시간 경과에 따른 면역침강을 실시하여 그 짧은 반감기를 판별하였다. 가용성 35S-Met/Cys 표지 Bip의 반감기 (t0-60, min)는 ~25-45분이었다 (도 Id). 프로테아좀 억제 (MG132)는 추적 중에 반감기 (t0-60, min)의 유의한 증가 없이 펄스 표지 (labeling) 중의 대사적 안정성을 가리키는 제로타임레벨 (zero time level)을 증가시켰으며, 이는 Bip 대사 (turnover)가 프로테아좀과 연관되지 않은 다른 분해경로와 관련될 수도 있음을 확인하였다.
<실험예 3> ΑΊΈ1 R-transferase에 의한 아르기닌화의 생리학적 기질 확인 인간 Bip의 아르기닌화 허용성 (arginylat ion-permissive) PI' 잔기인
Ghil9는, 마우스 (Glu), 오리너구리 (Ornithorhynchus anat.inus) (Asp) , 금화조 (Taeniopygia guttata) (Asp) , 아프리카발톱개구리 (Xenopus laevis) (Asp) , 제브라피쉬 (Danio rer io) (Glu) , 초파리 (Drosophi la melanogaster) (Glu) , 예쁜꼬마선충 (Caenorhabditis elegans) (Glu) 등의 다른 종에서는 잘 보존 (conserved)된다 (도 la, 도 6 및 표 3). 추출을 준비하는 동안 ER 단백질들이 세포질의 R-transferases에 인위적으로 노출되는 것이 가능하지만, 일관되게도, 2D-SDS PAGE에서 분리된 총 단백질의 질량분석 (mass spectrometr ic analysis)에서는 Bip및 PDI의 아르기닌화된 형태가 동정되었다 (R.G.Hu et al., J. Biol. Chem .282,8237(2006)).
<3-l>아르기닌화된 Bip, CRT, PI)I에 대한항체의 제작
본 발명자들은 Bip가 Glul9에서의 아르기닌화에 대한 생체 내 (in vivo) 기질인지의 여부를 판별하기 위해, R-Bip N-말단 잔기에 상웅하는 펩타이드 (REEEDKKEDVGC) (서열번호: 4)를 이용하여 Bip의 아르기닌화된 형태 (R-Bip)는 인식하면서도 아르기닌화 되지 않은 형태는 인식하지 못하도록 설계된 항체 R-Bip를 제조한 다음, 항체의 특이성을 확인하였다.
그 결과, anti-R-Bip 항체는 아르기닌화되지 않은 Bip 펩타이드보다 고정화된 (i隱 obilized) R-Bip 펩타이드에 더 ¾화적으로 결합하는 것을 확인하였다 ·
<3-2> ATE1아형 과발현을통한 R-Bip가생성 여부확인
본 발명자들은 다양한 세포주의 면역블로팅 분석 결과, R-Bip 시그널이 나타나지 않았고, 이는 Bip 아르기닌화가 스트레스에 의해 유도될 수도 있음을 확인하였다. - 이에, 본 발명자들은 ATE1 아형을 과발현함으로써 R-Bip가 생성될 수 있는지의 여부를 판별하였으며, 이전 연구에서, ATE1는 크기가 60 kDa이며 선택적으로 스플라이싱된 4개의 아형을 생산하는 것을 확인하였다: ΑΤΕ11Α7Α(ΑΤΕ1-3), ΑΤΕ11Α7Β/ΑΤΕ1-4, ATE11B7A/ATE1-1, ATEl1B7B/ATEl-2(Y.T.Kwon et al, 19, 823(1999)) (도 8a).
이에, ATEl R- transferase 아형 ( isoforms)을 인코딩하는 플라스미드는 Kwon-1999에 기술된 방법으로 준비한 후 (Y.T.Kwon et al, Mol .Cell .Biol . 19, 823( 1999) ), 상기 4가지 ATE1 아형을 각각을 발현하는 플라스미드를 HeLa 세포주에 형질감염한 후,면역블로팅 수행한 후, 생체 내 ( in vivo)아르기닌화를 확인하였다. 또한, 상기 동일한 방법으로 ATE11A7A를 발현하고, 시클로핵시미드를 처리한 HeLa 세포주, 또는 siATEl를 처리한 HeLa 세포주에서 면역블로팅을 수행하였다.
그 결과, 도 le, 및 도 8b 내지 8d에 나타낸 바와 같이, ATE11B7A 및 ATE11B7B에 비해 ATE11A7A가 Bip에 대한 주요 R-transferase인 것을 확인하였다. (도 le , 및 도 8b 내지 8d) .
또한, HeLa 세포주에 ATE11A7A를 형질감염한 후, 전체 추출물, 세포기질 부분 및 마이크로좀 부분으로 분류한 후, 세포분획 분석법을 수행한 결과, 도 If에 나타낸 바와 같이, 세포질의 가용성 분획으로부터 ATE11A7A로 생성된 R-Bip의 약 70% 정도가 검색되는 것을 확인하였다 (도 If ) .
아울러, ATE11A7A발현 세포의 시클로핵시미드 (cycloheximide)분해 분석법 결과, 도 lg에 나타낸 바와 같이, 아르기닌화 되지 않은 (루멘의) Bip는 현저하게 수명이 짧은 반면, (세포질의) R-Bip는 상대적으로 수명이 길었으 (도 lg) , 이는 루멘의 Bip는 역전좌 (retrotranslocat ion) 및 아르기닌화를 통해 어느 정도 대사된다는 것을 확인하였다 (도 lg) .
<실험예 4> N-말단 Glul9에서 Bip 아르기닌화 발생 여부 확인
본 발명자들은 Bip 아르기닌화가 N-말단 Glul9에서 발생하는지의 여부를 확인하였다.
구체적으로, 상기 제작한 Bip-f lag-KDEL또는 Bip-E19V-f lag-KDEL을 HeLa 세포주에 형질감염한 후, 면역블로팅을 수행하였다.
그 결과, 도 lh에 나타낸 바와 같이, ATE11A7A 과발현은 N-말단 Glul9을 노출시킨 재조합 Bip의 아르기닌화를 쉽게 유도되었으며, Glul9에서 Val로의 변이체는 N-end rule에 의해서 안정화되면서 ATE11A7A 매개 아르기닌화를 억제됨을 확인하였다 (도 lh) . 또한, 세포질에서의 Bip 아르기닌화를 좀 더 규명하기 위해, 본 발명자들은 Ub-Glu-Bip-myc/his를 발현하였는데, 여기에서 유비퀴틴 (Ub)의 C-말단 Gly76 가 성숙한 Bip의 Glul9와 융합시킨 후 (도 8e) , 상기 동일한 방법으로, Ub— Glu-Bipᅳ myc/his를 발현하는 HeLa 세포주에서 ATE11A7A를 과발현시킨 다음, 면역블로팅을 수행하였다. 한편, Ub 융합 기법에서, 리보솜에서 나온 신생 Ub-Glu-Bip-myc/his은 해독과 동시에 탈유비퀴틴화 효소에 의해 Ub와 Glu-Bip-myc/his으로 분할된다 (Tasaki et Ά\. ,Annu.J?ev.Bi och n. S , 261(2012)).
그 결과, 도 li에 나타낸 바와같이, Glu-Bip-myc/his의 아르기닌화는 ATE11A7A를 발현함으로써 가속화됨을 확인하였다 (도 li). 또한, 본 발명자들은 RNA 간섭 (interference)을 이용한 ATE1을 낙다운 (Knockdown)시킨 후, 아르기닌화를 확인하였다.
그 결과, 도 lj에 나타낸 바와 같이, Glu— Bip-myc/his의 아르기닌화는 ATEl-knockdown에 의해 감소되는 것을 확인하였고, 이와 대조적으로, Glu-to-Val 변이체를 지닌 Ub-Val-Bip-myc/his는 쉽게 아르기닌화되지 않는 것을 확인하였다. 영구적으로 아르기닌화된 변이체인 Ub-Arg-Bip-myc/his는 본질적으로 ATE1 과발현 또는 knockdown 과 관계없이 R-Bip 시그널을 생성함을 확인하였다 (도 li, lg).
이 결과들을 바탕으로, Bip가 생체 내에서 (in vivo) 자체의 N-말단
Glul9에서 ATE1 R-전달효소에 의해 아르기닌화된다는 것을 확인하였다.
<실험예 5> ATE1에 의한 PDI 및 CRT의 아르기닌화 확인
CRT의 일부가 세포질에서 아르기닌화 형태로 존재한다고 밝혀졌다 (M.B.Decca et al . , J.Biol.Che . 282,8237(2007)). 이 소견을 확장하기 위해, RDAPEEEDHVL (서열번호: 6) 및 REPAVYFKEQ (서열번호: 5)를 이용하여 PDI 및 CRT와 아르기닌화된 형태에 대해 특이적인 항체를 제작하였다 (도 7). Bip와는 달리 다양한 세포주들에서 분석이 가능할 정도로 충분한 양의 R-PDI 및 R-CRT를 지속적으로 생성되었고 (도 2b, 도 8d, 도 9a, 및 도 lla) , 이는 아르기닌화된 ER 단백질들이 세포질에서 어떤 뚜렷한 생리학적 기능을 가지고 있음을 확인하였다. 그렇더라도, 두 가지 모두 ATE11B7A 및 ATE11B7B보다 ATE11A7^1 의해 더 효율적으로 아르기닌화 되는 것을 확인하였다 (도 8d) .
이 결과들을 바탕으로, ER 단백질의 조절에 있어서 N— end rule 경로가 폭넓은 역할을 가질 수도 있음을 확인하였다.
<실험예 6> 세포질의 이중가닥 DNA(dsDNA)에 대한 내재성 면역 반웅을 통한 ER단백질의 아르기닌확유도 확인
상기 <실험예 3>에서 확인한 바와 같이, Bip 아르기닌화는 6시간에 이르는 ER 스트레스에 의해서도 감지가 가능한 수준으로 유도되지는 않았으며 (도 8b), 이는 R-Bip의 주요 역할이 최종적으로 미스 폴딩된 ER 단백질을 제거하는 것이 아니라 ER 외부의 프로세스에 참여하는 것임을 확인하였다 (도 8b) .
또한, HeLa 세포주에 리포펙타민 LTX 단독 또는 다양한 DNA 형태 (salmon sperm DNA(Salmi .Sp.DNA) , GFP-융합된 마우스 α—항트립신 (ant itrypsin) nul l Hong- ong(mNHK-GFP) , R-GFP C_말단에 유비퀴틴 융합 (Ub-R-GFP), 자발적으로 미스폴딩된 기질 모델 (YFP-CLl) , 돌연변이 항트렙신 단백잘 (ATZ) )를 형질감염시킨 후, 면역블롯팅을 수행하였다.
그 결과, 도 2a, 도 9a 및 도 9b 에 나타낸 바와 같이, 아르기닌화를 유도하는 스트레스를 조사하편서, Bip, PDI , CRT의 아르기닌화는 세포가 다양한 dsDNA 분자들에 일시적으로 형질감염 되었을 때 그 정도가 다양하게 촉발됨을 확인하였다 (도 2a, 도 9a 및 도 9b) . 또한, 도 9c에 나타낸 바와 같이, 형질감염 시약으로 분석한 결과, Bip , PDI , CRT의 아르기닌화는 세포 외의 공간이 아닌 세포질에 있는 dsDNA에 의해 촉발되는 것을 확인하였다 (도 9c, 라인 2 및 3) .
아울러, HeLa 세포주에 ATE1에 대한 siRNA #RNA 및 NHK-GFP를 발현하는 플라스미드를 함께 공동형질감혐 시킨 후, 세포기질 부분을 분류한 다음, R A 간섭 분석을 수행하였다.
그 결과, 도 9c 및 도 9d에 나타낸 바와 같이, DNA로 유도된 Bip 아르기닌화에서 ATE1가 그 역할을 한다는 것을 확인하였다 (도 9c 및 도 9d) . 또한, 세포 분획 분석 결과, DNA로 유도된 R-Bip의 대부분이 세포질에서 가용성인 것을 확인하였다 (도 9c) .
또한, 이중가닥 DNA(dsDNA)와는 달리, 이중가닥 RNA(dsRNA)는 아르기닌화를 유도하는 활성이 비교적 약한 것으로 나타났다 (도 11a) . 상기 결과로부터 세포질의 dsDNA가 여러 Ca++ 결합 ER 사페론의 역전좌 (retrotranslocat ion) 및 ATE—1 와존성 아르기닌화를 촉발함을 확인하였다.
세포질의 dsDNA는 바이러스와 같은 DNA 함유 미생물에 꾀해 감염되었음을 나타내는 신호가 될 수 있으며, 따라서 내재성 면역 반웅을 이끌어내는데, 여기에는 전사인자 IRF3의 인산화 및 IRF3에 의해 유도되는 인터페론 -β 합성이 포함된다 (Hou-2011) . 일관되게도 Bip , PDI , CRT의 아르기닌화는 바이러스의 dsDNAs를 표현하는 면역증강성 시약인 세포질의 폴리 (dA:dT) dsDNA에 의해 강하게 유도되었다 (도 2b, 도 11a 내지. 도 11c) . 또한, RNA 간섭을 이용한 ATEl-knockdown은 DNA로 유도되는 IRF3 인산화를 강하게 억제하였다 (도 2c) . 인터페론 -β 프로모터가 루시페라아제 발현을 유도하는 이중 루시페라아제 리포터 분석법 (Dual-luci ferase reporter assay)의 결과, ATE1-/- 마우스 배아 ^유아세포 (MEFs : mouse embryoni c f ibroblasts) (Kwon-2002)는 DNA로 유도되는 inter feron-β 생산기능이 손상된 것으로 나타났다 (도 2e , 도 2f 및 도 lie) . 따라서, ER 존재물의 ATE1 의존성 아르기닌화가 세포질의 dsDNA에 대한 내재성 면역 반응에 있어서 중요한 역할을 한다는 것을 확인하였다.
<실험예 7> 아르기닌화된 Bip의 자가포식 공포 (autophagic vacuoles)와 함께 위치하는 (공동국재화) 세포질 점 (puncta) 형성 확인 본 발명자들은 세포질의 폴리 (dA: dT)가 LC3의 합성 뿐 아니라, LC3의 불활성화 형태인 LC3-I를 LC3-I I로 전환 (convers ion)되도록 유도한다는 것을 발견하였는데, 여기에서 LC3-I I는 자가포식 이중막 구조와 접합할 수 있는 지질화된 형태이다 (도 lid) . 자가포식 유도는 다른 유형의 dsDNA에서도 유사하게 관찰되었는데, 이는 DNA 함유 미생물쎄 대한 내재성 면역 반웅에서의 자가포식의 일반적 역할을 시사한다.
이에 따라 본 발명자들은 DNA로 유도된 내재성 면역 반웅 동안의 자가포식 경로에서 R-Bip가 역할을 하는지의 여부를 검사하였다. 실제로, dsDNA처리한 HeLa세포에서의 R-Bip면역염색 결과, 직경이 0. 1-1 인 세포질 점 (puncta)이 드러났으며, 이 크기와 모양은 자가포식 공포와 유사하였다 (도 3a및 도 12a) . 공동염색 (co— staining)분석은 DNA로 유도된 R-Bip와 LC3양성 자가포식 점 (puncta)이 동일한 위치에 있음을 보여주었다 (도 3a) . ATE1 및 Bip의 RNA간섭 분석법에서, LC3 점 (puncta)과 R-Bip 점 (puncta)의 ATE1의존성 형성 및 동일위치에 존재함이 확증되었다 (도 3c) . 미스 폴딩된 세포질 단백질을 자가포식소체로 전달하는 일을 매개하는 자가포식 어댑터 (adaptor ) P62/SQTSM와의 공동염색법 (co-staining)을 사용하여 자가포식 공포와 R-Bip 점 (puncta)이 동일 위치에 존재함를 추가로 확인하였다 (도 3b 및 도 12b) . 따라서, 세포질의 dsDNA가 Bip의 아르기닌화 및 자가포식 두 가지 모두를 유도한 다음 R-Bip가 자가포식 공포로 전달된다는 것을 확인하였으며, 이는 dsDNA 촉발 내재성 면역 반웅 동안와 세포 구성성분 (const i tuent s)의 자가포식 분해에서 R-Bip가 역할올 한다는 것을 확인하였다.
<실험예 8> R-Bip의 N-말단의 N-degron으로서 작용 확인
N-end rule 경로에서, 단수명 단백질의 N-말단 Arg은 프로테아좀성 분해에 대한 N-recognins에 의해 인식되고 결합되는 주요 N-degron으로서 작용한다. 이 N-end rule 인식은 폴리유비퀴틴화를 통하여 기질을 프로테아좀에 대해 표적화는 시키는데 필수적이다. Ub 의존성 선택적 단백질분해에서 N-말단 Arg이 하는 역할을 고려하여, 본 발명자들은 N-말단 Arg이 Bip가 자가포식소체에 대해 표적화되기 위해 필요한 자가포식 N-degron으로 작용 유무를 확인하였다.
구체적으로, RFP-GFP-LC3을 안정적으로 발현하는 HeLa 세포를 해독과 동시에 Ub와 X-Bip-GFP로 분할되는 Ub-X-Bip-GFP (X= Arg, Glu, 또는 Val )를 발현하는 플라스미드로 형질감염시켰다 (도 13b) . X-Bip-RFP와 LC3의 공동국재화 분석 결과, Arg-Bip-GFP는 쉽게 자가포식소체로 전달되는 것으로 나타났다 (도 4a) . 뚜렷하게 대조적으로, Arg-to-Val 변이는 그와 같은 자가포식 공포에 대한 동시국소화를 무효화시켰다 (도 4a) . 자가포식 N-degron으로서의 N-말단 Arg의 활성을 시험하는 독립적 분석으로서, Arg-Bip-GFP과 p62를 동시염색 (costained)을 수행하였다. Val -Bip-GFP염색은 분산되어 보인 반면, Arg-Bip-GFP은 p62점 (puncta)과 충실하게 공유국소화하는 세포질 점 (puncta)을 형성하였다 (도 4b) . Arg-Bip— GFP와 비교했을 때, Glu-Bip-GFP는 제한된 정도의 R-Bip 양성 점 (puncta)을 형성하였는데, 이는 부분적 아르기닌화로 인한 것을 확인하였다. 하지만, Ub-Glu-Bip-GFP으로부터의 R-Bip 양성 점 (puncta)은 p62 양성 점 (puncta)과 예외없이 동일한 위치에 존재하였다 (도 4b) . 일반적 자가포식 전달 결정기로서의 N-말단 Arg를 더욱 규명하기 위해 Ub-X-Bip19 106ᅳ GFP(X= Glu , Arg, or Val )를 제작하였으며, 여기서는 Ub의 C-말단 Gly76이 ATPase 및 기질 결합 도메인이 없는 N-말단 88 잔기 -Bip 절편과 융합된다 (도 13c) . N-end rule 의존성 공동국재화는 Ub-X-Bip19106-GFP에서도 유사하게 관찰되었다 (도 4c , 도 4d 및 도 14) . 따라서, 아르기닌화가 Bip와 다른 세포질 ER 단백질들까지도 자가포식에 대한 표적으로 만드는 자가포식 N-degron을 생성함을 확인하였다.
<실험예 9> 미스 폴딩된 세포질 단백질에 의해 ER 단백질의 아르기닌화 유도확인
루멘의 Bip는 최종적으로 미스 폴딩된 ER 단백질올 결합하여 /흡수하여 그 화물을 ERAD 기작 (machinery)으로 전달하는 기질 인식 r ognin이다. 아르기닌화된 형태의 ER 사페론과 상호작용하는 분자를 동정하기 위해, 아르기닌화가 미스 폴딩돤 세포질 단백질과 상관관계에 있는지의 여부를 확인하였다.
실제로, Hsp90 억제제인 겔다나마이신 (geldanamycin, 폴딩오류 (misfolded) 단백질의 형성을 촉진하는 것으로 알려져 있음)으로 처리된 HeLa세포는 Bipᅳ CRT, PI)I에 대해 아르기닌화 증가를 나타냈다 (도 5a) , 미스 폴딩된 단백질을 생성하는 열쇼크 (heat shock)로 이 세포를 처리했을 때에도 유사한 상관관계가 나타났다 (도 15a) . 그 다음에는 아르기닌화가 유비퀴틴화 증가와 상관관계에 있는지의 여부에 관한 질문에 대해 아르기닌화를 유도하는 스트레스 유발인자를 동정하기 위한 스크리닝에서 Bip, CRT, PDI의 아르기닌화가 긴 시간 동안의 (예를 들어, 16시간 동안) 프로테아좀 억제와 강한 상관관계에 있음을 관찰하였으며, 이것의 직접적인 결과는 다른 단백질 기질들과 마찬가지로 미스 폴딩된 단백질의 유비퀴틴화가 증가하는 것이다 (도 5b 및 도 15b) . 또한 DNA 유도 내재성 면역 반웅 중에도 아르기닌화와 유비퀴틴화의 상관관계가 관찰되었으며 (도 5c), 이는 DNA 유도 내재성 면역 반웅 중 ER 단백질의 아르기닌화를 촉발하는 것이 유비퀴틴화의 증가일 수도 있음을 시사한다. 마지막으로, 유비퀴틴화가 교란된 경우 아르기닌화가 억제되는지 여부를 검사하였다. 변이된 Ub를 발현하는 HeLa 세포는 (여기에서는 7가지 Lys 잔기 모두가 Arg으로 변하여 Ub 사슬 신장을 방해함) 유의하게 감소된 양의 R-Bip를 함유하였다 (도 5d) . 따라서, 아르기닌화된 ER 샤페론을 미스 폴딩된 세포질 단백질의 대사 (turnover)에 연루시킴을 확인하였다.
<실시예 8> 자가포식소체에서 R-Bip 및 유비퀴틴화된 단백질의 공유국소화 확인
미스 폴딩된 /손상된 세포질 단백질의 일부는 프로테아좀에 대한 좋은 기질이 아니며, 그 이유 중 하나는 웅집되기 쉬운 성질 때문이다. 최근 연구들은 이 프로테아좀 저항성 기질이 p62와 같은 자가포식 어댑터에 의해 자가포식으로 향하게 됨을 보여주었다. 지금까지, 기질이 자가포식소체로 전달되기 위해서는 특이적 degrons이 필요한 지 여부와 (Ub' 리가아제에 대한 N-degrons 처럼), 어떻게 자가포식 어댑터가 정상적인 프로테아좀성 기질이 아닌 자가포식성 단백질 기질을 선택적으로 인식 /결합하는지는 알려지지 않은 상태이다. 미스 폴딩된 세포질 단백질의 자가포식성 청소에서 R— Bip가 하는 역할을 판별하기 위해 R-Bip, 유비퀴틴화 단백질, 자가포식소체 사이의 공동 국재를 조사하였다.
구체적으로, 폴리 (dA: dT) dsDNA로 처리된 HeLa 세포를 Ub 특이작 FK2 항체로 염색하였을 때, 이 염색은 LC3 및 p62에 대해 양성인 자가포식 공포와 동일하게 위치하는 점 (puncta) 유사 구조를 나타내면서 (도 5e 및 도 15d), 자가포식성 분해가 될 운명인 유비퀴틴화 단백질꾀 아집단을 나타냈다. 추가 분석은 Ub 및 LC3/p62 두 가지 모두에 양성인 자가포식성 공포는 예외없이 R-Bip점 (puncta)과 함께 위치함을 보여주었다 (도 5e및 도 15d) . 이 결과들은 자가포식성 분해의 프로세스에서 R-Bip가 유비퀴틴화된 단백질과 연관되어 있음을 시사한다. 이에 따라, R-Bip가 미스 폴딩된 단백질과 상호작용 하는지의 여부에 의문하게 되었다. 면역침강 분석 결과, R-Bip는 자연발생적 (spontaneous) 폴딩오류 (mi sfolding)를 겪는 모형 기질인 CL1-YFP와 직접적으로 또는 간접적으로 상호작용하는 것으로 나타났다 (도 15c) . 따라서, 미스 폴딩된 세포질 단백질의 자가포식 청소에서 R-Bip가 그 역할을 하며, 이는 그것의 N -말단 Arg이 폴딩오류 (mi sfolded) 단백질 화물에 대한 trans-act ing N-degron으로서 하는 능력을 통해 이루어지는 것을 확인하였다.

Claims

【청구의 범위】
【청구항 1】
아르기닌화 (arginylat ion)된 단백질에 특이적으로 결합하는 항체.
【청구항 2】
제 1항에 있어서, 상기 단백질은 BIP, CRT 및 PE)I로 구성된 군으로부터 선택되는 어느 하나인 것을 특징으로 하는 항체.
【청구항 3】
제 2항에 있어서 , 상기 BIP 단백질은 서열번호 1로 기재되는 아미노산 서열을 갖고, 상기 CRT 단백질은 서열번호 2로 기재되는 아미노산 서열을 가지며, 상기 PDI 단백질은 서열번호 3으로 기재되는 아미노산 서열을 갖는 것을특징으로 하는 항체.
【청구항 4】
제 2항에 있어서, 상기 BIP단백질은 N-말단 Glul9, CRT단백질은 N-말단 Glul8 또는 PDI 단백질은 N-말단 Aspl8이 아르기닌화된 것을 특징으로 하는 항체.
[청구항 5】
제 1항에 있어서, 상기 아르기닌화된 단쌕질은 ATE1 R-transferase에 의해 BIP단백질의 N-말단 Glul9 , CRT단백질의 N-말단 Glul8또는 PDI단백질의 N-말단 Aspl8이 아르기닌화되는 것을 특징으로 하는 항체 .
【청구항 6】
제 1항에 있어세 상기 아르기닌화된 단백질은 이중가닥 DNA(dsDNA)에 대한 내재성 면역반웅을 통해 유도되는 것을 특징으로 하는 항체.
【청구항 7】
제 1항에 있어서, 상기 아르기닌화된 단백질은 자가포식 공포 (autophagic vacuoles)와 함께 위치하는 세포질 점 (puncta)을 형성하는 것을 특징으로 하는 항체.
【청구항 8】
제 1항에 있어서, BIP단백질의 N-말단 Gkil9, CRT단백질의 N-말단 Glul8 또는 PDI 단백질의 N-말단 AsplS이 아르기닌화된 단백질은 자가포식 N-degron으로 작용하는 것을 특징으로 하는 항체 .
【청구항 9】
제 1항에 있어서, 상기 아르기닌화된 단백질은 미스 폴딩 (misfolding)된 세포질 단백질에 의해 유도되는 것을 특징으로 하는 항체.
【청구항 10】
제 1항의 항체를 포함하는 바이러스 또는 세균감염 진단용 키트.
[청구항 11】
제 1항의 항체를 포함하는 면역조절제 스크리닝용 키트.
【청구항 12】
1) 시료내 피검화합물을 처리하는 단계 ;
2) 피검화합물을 처리한 실험군 및 피검화합물을 처리하지 않은 대조군에서 아르기닌화된 단백질의 수준을 측정하는 단계를 포함하는 면역조절제 스크리닝 방법.
【청구항 13】
제 12항에 있어서,상기 단계 1)와 시료는 분리된 전혈, 혈청, 혈장, 타액 뇨, 객담, 림프액, 뇌척수액 및 세포간액으로 구성된 군으로부터 선택되는 어느 하나 이상인 것을 특징으로 하는 방법 .
【청구항 14】
제 12항에 있어서, 상기 단계 2)와 아르기닌화된 단백질은 BIP 단백질의
Nᅳ말단 Glul9, CRT 단백질의 N-말단 Glul8 또는 PDI 단백질의 N-말단 Aspl8이 아르기닌화된 것을 특징으로 하는 방법.
【청구항 15】
제 12항에 있어서, 상기 단계 2)의 아르기 i화된 단백질의 수준은 아르기닌화된 단백질에 특이적으로 결합하는 항체를 이용하여 측정하는 것을 특징으로 하는 방법 .
[청구항 16】
1) 시료에 바이러스를 처리하는 단계 ;
2) 바이러스가 처리된 시료에 피검화합물을 처리하는 단계;
3) 피검화합물 및 바이러스가 처리된 실험군, 및 바이러스가 처리된 대조군에서 아르기닌화된 단백질의 수준을 감소시키는 피검화합물을 선별하는 단계를 포함하는 바이러스 치료제 스크리닝 방법 .
PCT/KR2015/009820 2015-09-18 2015-09-18 아르기닌화된 er 단백질에 특이적으로 결합하는 항체 및 이의 용도 Ceased WO2017047846A1 (ko)

Priority Applications (1)

Application Number Priority Date Filing Date Title
PCT/KR2015/009820 WO2017047846A1 (ko) 2015-09-18 2015-09-18 아르기닌화된 er 단백질에 특이적으로 결합하는 항체 및 이의 용도

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
PCT/KR2015/009820 WO2017047846A1 (ko) 2015-09-18 2015-09-18 아르기닌화된 er 단백질에 특이적으로 결합하는 항체 및 이의 용도

Publications (1)

Publication Number Publication Date
WO2017047846A1 true WO2017047846A1 (ko) 2017-03-23

Family

ID=58289100

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2015/009820 Ceased WO2017047846A1 (ko) 2015-09-18 2015-09-18 아르기닌화된 er 단백질에 특이적으로 결합하는 항체 및 이의 용도

Country Status (1)

Country Link
WO (1) WO2017047846A1 (ko)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20210039290A (ko) 2019-10-01 2021-04-09 고려대학교 산학협력단 아미노 말단 분해 경로에 있는 단백질들의 대량생산을 위한 재조합 벡터 및 이의 용도
US11666661B2 (en) 2018-03-23 2023-06-06 The Regents Of The University Of California Methods and compounds for targeted autophagy

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20100048485A1 (en) * 2002-10-30 2010-02-25 Meso Scale Technologies Llc Substrates of n-end rule ubiquitylation and methods for measuring the ubiquitylation of these substrate

Patent Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20100048485A1 (en) * 2002-10-30 2010-02-25 Meso Scale Technologies Llc Substrates of n-end rule ubiquitylation and methods for measuring the ubiquitylation of these substrate

Non-Patent Citations (4)

* Cited by examiner, † Cited by third party
Title
BRODSKY: "Cleaning up: ER-associated Degradation to the Rescue", CELL, vol. 151, 2012, pages 1163 - 1167, XP028960561 *
CHA-MOLSTAD ET AL.: "Amino-terminal Arginylation Targets Endoplasmic Reticulum Chaperone BiP for Autophagy through p62 Binding", NATURE CELL BIOLOGY, vol. 17, no. 7, July 2015 (2015-07-01), pages 917 - 929, XP055330035 *
HWANG ET AL.: "N-terminal Acetylation of Cellular Proteins Creates Specific Degradation Signals", SCIENCE, vol. 327, 2010, pages 973 - 977, XP055369420 *
ZHANG ET AL.: "Cell Surface Relocalization of the Endoplasmic Reticulum Chaperone and Unfolded Protein Response Regulator GRP78/BiP", THE JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 285, no. 20, 2010, pages 15065 - 15075, XP055140936 *

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11666661B2 (en) 2018-03-23 2023-06-06 The Regents Of The University Of California Methods and compounds for targeted autophagy
KR20210039290A (ko) 2019-10-01 2021-04-09 고려대학교 산학협력단 아미노 말단 분해 경로에 있는 단백질들의 대량생산을 위한 재조합 벡터 및 이의 용도

Similar Documents

Publication Publication Date Title
Cha-Molstad et al. Amino-terminal arginylation targets endoplasmic reticulum chaperone BiP for autophagy through p62 binding
US9347954B2 (en) Antibody capable of binding to specific region of periostin, and method of measuring periostin using the same
US20120271124A1 (en) Thrombospondin Fragments and Uses Thereof In Clinical Assays for Cancer and Generation of Antibodies and Other Binding Agents
KR20170002500A (ko) 항muc1 항체 또는 그의 항원 결합성 단편 및 그 용도
US20230032690A1 (en) New tau species
Kovalchuk et al. Trafficking of the amino acid transporter B0,+(SLC6A14) to the plasma membrane involves an exclusive interaction with SEC24C for its exit from the endoplasmic reticulum
JP7546255B2 (ja) 癌を検出する方法および検出試薬
JP2024038346A (ja) 血液から癌を診断する方法
Mai et al. Native autoantigen complex detects pemphigoid autoantibodies
KR101734931B1 (ko) 아르기닌화된 er 단백질에 특이적으로 결합하는 항체 및 이의 용도
WO2017047846A1 (ko) 아르기닌화된 er 단백질에 특이적으로 결합하는 항체 및 이의 용도
US8911954B2 (en) Polypeptide linker and method of analyzing target material using the same
Kitauchi et al. Glycoprotein quality control-related proteins effectively inhibit fibrillation of amyloid beta 1–42
US9784751B2 (en) Method for detecting neurological disease associated with cognitive impairment by measuring EphA4 extracellular domain
de Souza et al. Glycosylation affects the rate of traffic of the Shaker potassium channel through the secretory pathway
EP3362473B1 (en) Use of a fibrinogen capture agent to detect a ciz1 b-variant
Midorikawa et al. Monitoring the glycosylation of α‐amino‐3‐hydroxy‐5‐methyl‐4‐isoxazole‐propionate‐type glutamate receptors using specific antibodies reveals a novel regulatory mechanism of N‐glycosylation occupancy by molecular chaperones in mice
Ikezaki et al. C-Mannosylated tryptophan-containing WSPW peptide binds to actinin-4 and alters E-cadherin subcellular localization in lung epithelial-like A549 cells
US9097716B2 (en) Assay for anti-TR antibodies
US12306184B2 (en) Biomarkers of membranous glomerulonephritis
WO2007055340A1 (ja) Ptx3高感度測定法
Watanabe et al. Characterization of the glycosylphosphatidylinositol-anchor signal sequence of human Cryptic with a hydrophilic extension
WO2014125879A1 (ja) c-MET遺伝子増幅細胞の検出方法
CN119684430A (zh) 一种抗原多肽、由其制备的抗体及其在检测cd8中的应用

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 15904176

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 15904176

Country of ref document: EP

Kind code of ref document: A1