WO2017044858A2 - Inhibitors of cyclin-dependent kinases - Google Patents

Inhibitors of cyclin-dependent kinases Download PDF

Info

Publication number
WO2017044858A2
WO2017044858A2 PCT/US2016/051118 US2016051118W WO2017044858A2 WO 2017044858 A2 WO2017044858 A2 WO 2017044858A2 US 2016051118 W US2016051118 W US 2016051118W WO 2017044858 A2 WO2017044858 A2 WO 2017044858A2
Authority
WO
WIPO (PCT)
Prior art keywords
optionally substituted
compound
acceptable salt
ring
pharmaceutically acceptable
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2016/051118
Other languages
French (fr)
Other versions
WO2017044858A3 (en
Inventor
Mingfeng HAO
Nathanael S. Gray
Tinghu Zhang
Nicholas P. KWIATKOWSKI
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Dana Farber Cancer Institute Inc
Original Assignee
Dana Farber Cancer Institute Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to EP16845194.6A priority Critical patent/EP3347018B1/en
Priority to CA2996978A priority patent/CA2996978A1/en
Priority to JP2018512916A priority patent/JP7028766B2/en
Priority to EP21193645.5A priority patent/EP4019515A1/en
Priority to US15/758,982 priority patent/US11142507B2/en
Priority to AU2016319125A priority patent/AU2016319125B2/en
Application filed by Dana Farber Cancer Institute Inc filed Critical Dana Farber Cancer Institute Inc
Publication of WO2017044858A2 publication Critical patent/WO2017044858A2/en
Publication of WO2017044858A3 publication Critical patent/WO2017044858A3/en
Anticipated expiration legal-status Critical
Priority to US17/378,622 priority patent/US20220055998A1/en
Priority to JP2021127000A priority patent/JP2022020611A/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D277/00Heterocyclic compounds containing 1,3-thiazole or hydrogenated 1,3-thiazole rings
    • C07D277/02Heterocyclic compounds containing 1,3-thiazole or hydrogenated 1,3-thiazole rings not condensed with other rings
    • C07D277/20Heterocyclic compounds containing 1,3-thiazole or hydrogenated 1,3-thiazole rings not condensed with other rings having two or three double bonds between ring members or between ring members and non-ring members
    • C07D277/32Heterocyclic compounds containing 1,3-thiazole or hydrogenated 1,3-thiazole rings not condensed with other rings having two or three double bonds between ring members or between ring members and non-ring members with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to ring carbon atoms
    • C07D277/38Nitrogen atoms
    • C07D277/44Acylated amino or imino radicals
    • C07D277/46Acylated amino or imino radicals by carboxylic acids, or sulfur or nitrogen analogues thereof
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/495Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
    • A61K31/4965Non-condensed pyrazines
    • A61K31/497Non-condensed pyrazines containing further heterocyclic rings
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D417/00Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and sulfur atoms as the only ring hetero atoms, not provided for by group C07D415/00
    • C07D417/02Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and sulfur atoms as the only ring hetero atoms, not provided for by group C07D415/00 containing two hetero rings
    • C07D417/04Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and sulfur atoms as the only ring hetero atoms, not provided for by group C07D415/00 containing two hetero rings directly linked by a ring-member-to-ring-member bond
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D417/00Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and sulfur atoms as the only ring hetero atoms, not provided for by group C07D415/00
    • C07D417/02Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and sulfur atoms as the only ring hetero atoms, not provided for by group C07D415/00 containing two hetero rings
    • C07D417/12Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and sulfur atoms as the only ring hetero atoms, not provided for by group C07D415/00 containing two hetero rings linked by a chain containing hetero atoms as chain links
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D417/00Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and sulfur atoms as the only ring hetero atoms, not provided for by group C07D415/00
    • C07D417/14Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and sulfur atoms as the only ring hetero atoms, not provided for by group C07D415/00 containing three or more hetero rings

Definitions

  • CDK cyclin-dependent kinase
  • CDK7 has consolidated kinase activities, regulating both the ceil cycle and transcription.
  • CDK7 exists as a
  • CAK CD l/2-activating kinase
  • CDK7 forms the kinase core of the RNA polymerase (RNAP) II general transcription factor complex and is charged with phosphorylatmg the C-terminal domain (CTD) of RNAP II, a requisite step in gene transcriptional initiation (Serizawa.
  • RNAP RNA polymerase
  • CTD C-terminal domain
  • CDK12 and CDK13 were identified in cDNA screens for cell cycle regulators.
  • CDK12 and CDK13 play an important role in cancer development.
  • a comprehensive genomic approach identified CDK.12 to be one of the most frequently somatically mutated genes in high-grade serous ovarian cancer, the most fatal form of the disease (Erratum, Nature, 2011, 474(7353), 609-615).
  • CDK! 2 has also been found to contribute to the development of breast cancer. Notably, CDK!
  • CDK12 is also implicated in the modification of tamoxifen sensitivity in estrogen-positive breast cancer via the modulation of the mitogen-activated protein kinase pathway (loms et al. Carcinogenesis, 2009,
  • CDKs Cyclin dependent kinases
  • CDK7, CDK12, and CDK13 are key- regulators of the cell cycle, Their successive activation and inactivation drives the cycle forward.
  • the activity of CDKs is regulated by multiple mechanisms such as positive and negative phosphorylation, binding of regulatory proteins like cyclins, and CDK inhibitors.
  • Most CDKs require the phosphorylation of a threonine residue located in the T-loop to achieve full kinase activity. This threonine residue is conserved in all CDKs that function in cell cycle regulation. The enzyme responsible for this phosphorylation is therefore termed CDK-activating-kinase or CAK.
  • CAK complexes have been found to be composed of CDK7, CDK 1 2, CDK ! 3. cyclin H, and MAT1. Besides its CAK function, C DK?, CDK 12, and CDK13 also play a role in transcription and possibly in D A repair. This suggests that the CDK7, CDK12, and CDK13 enzyme complexes are involved in multiple functions in the cell, e.g., cell cycle control, apoptosis, transcription regulation, and DNA repair.
  • the present invention provides compounds of Formulae ( ⁇ ), (IT), (I), (II), and pharmaceutically acceptable salts, solvates, hydrates, polymorphs, co-crystals, tautomers, stereoisomers, isotopically labeled derivatives, prodrugs, and compositions thereof.
  • the compounds of Formulae ( ⁇ '), ( ⁇ '), (I), (II), and pharmaceutically acceptable salts, solvates, hydrates, polymorphs, co-crystals, tautomers, stereoisomers, isotopically labeled derivatives, prodrugs, and compositions thereof may inhibit the activity of a kinase.
  • the compounds described herein may in certain embodiments selectively inhibit specific CDK subtypes, for example, CDK7, C DK 1 2. or CDK13.
  • the compounds of Formulae (F), (IT), (I), and (II) are selective for CDK7 compared to other kinases.
  • the compounds of Formulae ( ⁇ ), (IV), (I), and (II) are selective for CDK12 and/or CDK13 compared to other kinases.
  • the present invention also provides methods of using the inventive compounds, and pharmaceutically acceptable salts, solvates, hydrates, polymorphs, co-crystals, tautomers, stereoisomers, isotopically labeled derivatives, prodrugs, and compositions thereof, to study the inhibition of a kinase (e.g., CDK7, CDK12, and/or CDK i 3) and as therapeutics for the prevention and/or treatment of diseases associated with the overexpression and/or aberrant activity of a kinase ⁇ e.g., CDK7, CDK12, and/or CDK13).
  • a kinase e.g., CDK7, CDK12, and/or CDK13
  • the inventive compounds are used for the prevention and/or treatment of proliferative diseases ⁇ e.g., cancers (e.g., leukemia, acute lymphoblastic leukemia, lymphoma, Burkitt's lymphoma, melanoma, multiple myeloma, breast cancer, Ewing's sarcoma, osteosarcoma, brain cancer, neuroblastoma, lung cancer, colorectal cancer), benign neoplasms, diseases associated with angiogenesis, inflammatory diseases, autoinflammatory diseases, and autoimmune diseases) in a subject.
  • cancers e.g., leukemia, acute lymphoblastic leukemia, lymphoma, Burkitt's lymphoma, melanoma, multiple myeloma, breast cancer, Ewing's sarcoma, osteosarcoma, brain cancer, neuroblastoma, lung cancer, colorectal cancer
  • benign neoplasms e.g., diseases associated with angiogenesis
  • CDK7, CDK12, and CD 13 Since the discovery of selective inhibitors of CDK7, CDK12, and CD 13 has been hampered by the high sequence and structural similarities of the kinase domain of CD family members, the developmen t of selective inhibitors of the transcriptional cyclin- dependent kinases (tCDKs) will allow dissection of their individual contributions to the regulation of transcription and evaluation of their therapeutic potential.
  • tCDKs transcriptional cyclin- dependent kinases
  • inventive compounds' selectivity for CD 7, CD 12, and'Or CD 1 3 may be due to the compounds' ability to covendinglv modify a specific cysteine residue of these kinases (e.g., Cys312 of CDK7, Cysl 039 of CDK12, Cysl Ol 7 of CDK13).
  • the present invention provides compounds of Formula ( ):
  • the present invention provides compounds of Formula (1):
  • the present invention provides compounds of Formula ( ⁇ ):
  • R ! , R 2 , R A , R B , Ring A, Ring B, L 2 , X, al, and bl are as defined herein.
  • the present invention provides compounds of Formula (II):
  • R 1 , R 2 , R A , R , Ring A, Ring B, L 2 , X, al, and bl are as defined herein.
  • the present disclosure provides pharmaceutical compositions including a compound described herein, and optionally a pharmaceutically acceptable excipient.
  • the pharmaceutical compositions described herein include a therapeutically or prophylactically effective amount of a compound described herein.
  • the pharmaceutical composition may be useful for treating a proliferative disease in a subject in need thereof, preventing a proliferative disease in a subject in need thereof, inhibiting the activity of a protein kinase in a subject, biological sample, tissue, or cell, and/or inducing apoptosis in a cell.
  • the proliferative disease is an inflammatory disease. I certain embodiments, the inflammatory disease is rheumatoid arthritis, Crohn's disease, or fibrosis,
  • the present invention provides methods for treating and/or preventing a proliferative disease.
  • proliferative diseases which may be treated include cancer, benign neoplasms, diseases associated with angiogenesis, inflammatory diseases, automflammatory diseases, and autoimmune diseases.
  • the cancer is selected from the group consisting of pancreatic cancer, lung cancer (e.g., small cell lung cancer (SCLC), and non-small cell lung cancer), prostate cancer, breast cancer, ovarian cancer, kidney cancer, liver cancer, Ewing's sarcoma, osteosarcoma, brain cancer, neuroblastoma, and colorectal cancer.
  • Another aspect of the invention relates to methods of inhibiting the activity of a kinase (e.g., CDK (e.g., CDK7, CDK.I2, CDK13)) using a compound described herein in a kinase (e.g., CDK (e.g., CDK7, CDK.I2, CDK13)) using a compound described herein in a kinase (e.g., CDK (e.g., CDK7, CDK.I2, CDK13)) using a compound described herein in a kinase (e.g., CDK7, CDK.I2, CDK13)) using a compound described herein in a kinase (e.g., CDK7, CDK.I2, CDK13)) using a compound described herein in a kinase (e.g., CDK (e.g., CDK7, CDK.I2, CDK13)) using a compound described
  • the method involves the selective inhibition of CD 7. In certain embodiments, the method involves the selective inhibition of CDK 12. In certain embodiments, the method involves the selective inhibition of CDK 1.3. [0018] Also provided by the present invention are methods of inhibiting the transcription of one or more genes in the cell of a biological sample or subject using a compound described herein. The transcription of genes affected by the activity of CDK7 may be inhibited by a compound of the invention.
  • these genes are one or more selected from the group consisting of MYC, RUNX1 , MYB, TALI, GAT A3, LF2, HNRPDL, p21 , ASCL1, MYCN, INSM1 , EUROD1, NEUROG1, FOXG l, FOXA1, SOX2, SOX4, BCL1 1 A, OTX2, GAT2, PHOX2B, PLK2, TAF1 , CTGF, WEE1, SDIM, JUN, PIMl, IL8, and FOSL
  • the transcription of genes affected by the activity of CD 12 may be inhibited by a compound of the invention.
  • these genes are one or more selected from the group consisting of BRCA1, FANCI, ATR, FANCD2, APEX! , NEK9, CHEK1, CHEK2, ATM, RAD51C, RAD51D, ORC3L, MDCL TERF2, ERCC4, FANCF, PARP9, RUNX1, MYB, TALI , MCL1, MYC, BCL2, ETS1, and EWS-FLL
  • the transcription of genes affected by the activity of CDK13 may be inhibited by a compound of the invention.
  • the gene is SNORA38.
  • the present invention also provides methods of inhibiting cell growth in a biological sample or subject.
  • the present invention provides methods of inducing apoptosis of a cell in a biological sample or subject.
  • the present invention provides methods for administering to a subject in need thereof an effective amount of a compound, or pharmaceutical composition thereof, as described herein. Also described are methods for contacting a cell with an effective amount of a compound, or pharmaceutical composition thereof, as described herein. In certain embodiments, a method described herein further includes administering to the subject an additional pharmaceutical agent. In certain embodiments, a method described herein further includes contacting the cell with an additional pharmaceutical agent. The methods described herein may further include performing radiotherapy, immunotherapy, and/or transplantation on the subject.
  • the present invention provides compounds of Formulae ( ⁇ ), ( ⁇ ), (I), (II), and pharmaceutically acceptable salts, solvates, hydrates, polymorphs, co- crystals, tautomers, stereoisomers, isotopically labeled derivatives, prodrugs, and
  • compositions thereof for use in the treatment of a disease (e.g., a proliferative disease such as cancer) in a subject.
  • a disease e.g., a proliferative disease such as cancer
  • kits comprising a container with a compound, or pharmaceutical composition thereof, as described herein.
  • the kits described herein may include a single dose or multiple doses of the compound or pharmaceutical composition.
  • the kits may be useful in a method of the disclosure.
  • the kit further includes instructions for using the compound or pharmaceutical composition.
  • a kit described herein may also include information (e.g. prescribing information) as required by a regulatory agency such as the U.S. Food and Drug Administration (FDA).
  • FDA U.S. Food and Drug Administration
  • Figure 1 shows the chemical structures of exemplary compounds described herein and the IC 50 values of the exemplar compounds in inhibiting select cyclin-dependent kinases.
  • FIG. 2 A shows that compound B12 exhibits binding of intracellular CDK 12 and CDK13 at concentrations between 62.5 nJVI to 1 ⁇ treatment.
  • Jurkat cells treated with compound B12 for 6 hours show decreased pulldown of CDK12 and CDK13 - associated cyclin K by biotin-THZl relative to DMSO-treated cells.
  • B12 cellular treatment blocks biotin-THZl from binding CDK12 and CDK13 -associated cyclin K complexes by successful binding of these complexes in cells at these concentrations.
  • Cyclin H (Cyc H) pulldown was not affected, indicating that CD 7 binding is not affected.
  • Figure 2B shows the structure of compound B12.
  • Figure 3 shows the binding of compounds B12, B15, and B16 (relative to DMSO control) to CD 12 and CDK13 -associated cyclin K at concentrations of 100 nM, 50 nM, 25 nM, and 12.5 nM.
  • Jurkat cells were treated with each compound (or DMSO) for 6 hours, followed by lysis and pulldown with biotin-THZl, and subsequent wester blotting for cyclin K (Cyc K) and cyclin H (Cyc H).
  • Compound B12 exhibits binding to CDK12 and CDK i 3 - associated cyclin K, while compounds B15 and B16 do not.
  • Compound B12 is able to block pulldown of CDK 12 and CDK13 -associated cyclin K down to 25 nM treatmen t, while compounds B15 and B16 show very little effect on cyclin K pulldown. These results indicate that at concentrations as low as 25 nM B12 successfully targets intracellular CD 12 and CDK13 -associated cyclin K complexes.
  • Figure 4 shows binding of intracellular CDK 12 and CDK13 -associated cyclin K complexes by exemplified compounds.
  • Jurkat cells were treated with each compound at a concentration of 500 nM for 6 hours, followed by lysing and pulldown with biotin- ⁇ , and subsequent western blotting for cyclin (Cyc ) and cyclin H (Cyc H).
  • Compounds Bl, B3, B4, B5, B6, B8, B9, and B12 show a loss in CDK12 and CDK13 -associated cyclin K pulldown, indicating that these compounds successfully bind CD 12 and CDK13 - associated cyclin K complexes in cells thus blocking biotin-THZl pull down, while compounds B5, B8, and B9 show a more pronounced loss of cyclin H pulldown, indicating that these compounds successfully target CDK7 -cyclin H complexes in cells and interfere with biotin-THZl pull down.
  • FIG. 5 shows exemplar ' results of growth assays of select compounds described herein.
  • Jurkat cells were plated at 30,000 cells/well and treated with a titration of compounds indicated. Cells were allowed to grow for 72 hours. Cells were assayed using CELLTITER GLO (Promega) to determine cell viability by measuring the amount of ATP present, which is an indicator of cell metabolic activity.
  • Top panel luminescent values (y-axis);
  • Figure 6 shows exemplary mass spectrum labeling of CDK12 with compound B12.
  • Compound B12 is able to label CDK12 once treated with a 5 -fold excess of compound B12 for 1 hour at 4 C C.
  • Figure 7 shows the binding of intracellular CDK12 and CDK1.3 -associated cyclin complexes by exemplified compounds.
  • Jurkat cells were treated wit each compound at a concentration of 500 nM for 6 hours, followed by lysing and pull down with biotin-THZl, and subsequent western blotting for cyclin K (Cyc K) and cyclin H (Cyc H).
  • Cyc K cyclin K
  • Cyc H cyclin H
  • Compounds that decrease the pull down efficiency of CDK12 and CDK13 -associated cyclin K complexes indicate those compounds successfully targeted intracellular CD 12 and CDK13 -associated cyclin K complexes and therefore were able to block biotin-THZl pull down of these complexes.
  • Figure 8 shows the binding of intracellular CD 12 and CD 13 -associated cyclin K complexes by exemplified compounds.
  • Jurkat cells were treated with each compound at a concentration of 500 nM for 6 hours, followed by lysing and pull down with biotin-THZl, and subsequent western blotting for cyclin K (Cyc K) and cyclin H (Cyc H).
  • Cyc K cyclin K
  • Cyc H cyclin H
  • compound THZ 5-31 and MFH 2-90-1 show a loss in cyclin K pulldown by biotin-THZl , indicating that these compounds successfully targeted CDK1.2 and CDK13 -associated complexes in cells and block biotin-THZ l binding.
  • compounds THZ 5-31, MFH 2-90-1, THZ-CE B-15, and THZ-CE B-16 show a loss in cyclin K pull down by biotin-THZl, indicating that these compounds successfully targeted CD 12 and CDK13 -associated complexes in cells and block biotin-THZl binding.
  • Figure 9 shows the binding of intracellular CDK12 and CDK13 -associated cyclin K complexes by exemplified compounds.
  • Jurkat cells were treated with each compound at a concentration of 500 nM for 4 hours, followed by lysing and pull down with biotin-THZl, and subsequent western blotting for cyclin K (Cyc K) and cyclin H (Cyc H).
  • Cyc K cyclin K
  • Cyc H cyclin H
  • Compounds that decrease the pull down efficiency of CDK12 and CDK13 -associated cyclin K complexes indicate those compounds successfully targeted intracellular CDK12 and CDK13 -associated cyclin K complexes and therefore were able to block biotin-THZl pull down of these complexes.
  • Compounds described herein can comprise one or more asymmetric centers, and thus ca exist in various isomeric forms, e.g., enantiomers and/or diastereomers.
  • the compounds described herein can be in the form of an individual enantiomer, diastereomer or geometric isomer, or can be in the form of a mixture of stereoisomers, including racemic mixtures and mixtures enriched in one or more stereoisomer.
  • Isomers can be isolated from mixtures by methods know to those skilled in the art, including chiral high pressure liquid chromatography (HPLC) and the formation and crystallization of chiral salts; or preferred isomers can be prepared by asymmetric syntheses. See, for example, Jacques et al,
  • Ci.g is intended to encompass, Ci, C 2 , C 3 , C , C 5 , C*, Ci-g,
  • aliphatic includes both saturated and unsaturated, straight chain (i.e., unbranched), branched, acyclic, cyclic, or polycyclic aliphatic hydrocarbons, which are optionally substituted with one or more functional groups.
  • aliphatic is intended herein to include, but is not limited to, alkyl, alkenyl, alkynyl, cyeloalkyl, cycloalkenyl, and cycloalkynyl moieties.
  • alkyl includes straight, branched and cyclic alkyl groups.
  • alkyl alkenyl
  • alkynyl alkynyl
  • lower alkyl is used to indicate those alkyl groups (cyclic, acyclic, substituted, unsubstituted, branched or unbranched) having 1-6 carbon atoms.
  • the alkyl, alkenyi, and alkynyl groups employed in the disclosure contain 1-20 aliphatic carbon atoms. In certain other embodiments, the alkyl, alkenyi, and alkynyl groups employed in the disclosure contain 1-10 aliphatic carbon atoms. In yet other embodiments, the alkyl, alkenyi, and alkynyl groups employed in the disclosure contain 1-8 aliphatic carbon atoms. In still other embodiments, the alkyl, alkenyi, and alkynyl groups employed in the disclosure contain 1-6 aliphatic carbon atoms.
  • the alkyl, alkenyi, and alkynyl groups employed in the disclosure contain 1 -4 carbon atoms.
  • Illustrative aliphatic groups thus include, but are not limited to, for example, methyl, ethyl, n-propyl, isopropyl, cyclopropyl, -CH 2 -cyclopropyl, vinyl, allyl, n-butyl, sec- butyl, isobutyl, tert-butyl, cyclobutyl, -CH 2 -cyclobutyl, n-pentyl, sec-pentyl, isopentyl, tert- pentyl, cyclopentyl, -CH 2 -cyclopentyl, n-hexyl, sec-hexyl, cyclohexyl, -CH 2 -cyclohexyl moieties and the like, which again, may bear one or more substituents.
  • Alkenyi groups include, but are not limited to, for example, ethenyl, propenvl, butenyl, l-methyl-2-buten-l-yl, and the like.
  • Representative alkynyl groups include, but are not limited to, ethynyl, 2- propynyl (propargyl), 1-propynyl, and the like.
  • alkyl refers to a radical of a straight-chain or branched saturated hydrocarbon group having from 1 to 10 carbon atoms (“C ⁇ _io alkyl”). In some embodiments, an alkyl group has 1 to 9 carbon atoms ("Q-9 alkyl”). In some embodiments, an alkyl group has 1 to 8 carbon atoms ("Q-s alkyl”). In some embodiments, an alkyl group has 1 to 7 carbon atoms (“Q-7 alkyl”). In some embodiments, an alkyl group has 1 to 6 carbon atoms (“Ci-6 alkyl”). In some embodiments, an alkyl group has 1 to 5 carbon atoms (“Ci_5 alkyl”).
  • an alkyl group has 1 to 4 carbon atoms ("C ⁇ alkyl”). In some embodiments, an alkyl group has 1 to 3 carbon atoms ("C1-3 alkyl”). In some embodiments, an alkyl group has 1 to 2 carbon atoms (“C ⁇ _ 2 alkyl”). In some embodiments, an alkyl group has 1 carbon atom ("Q alkyl”). In some embodiments, an alkyl group has 2 to 6 carbon atoms (“C 2 -6 alkyl”).
  • Q -e alkyl groups include methyl (Q), ethyl (C 2 ), propyl (C3) (e.g., n-propyl, isopropyl), butyl (C 4 ) ⁇ e.g., n-butyl, tert-butyl, sec-butyl, iso-butyi), pentyl (C5) (e.g., n-pentyl, 3-pentanyl, amyl, neopentyl, 3-methyl-2-butany2, tertiary amyl), and hexyl (Ce) (e.g., n-hexyl).
  • alkyl groups include n-heptyl (C 7 ), n- octyl (C 8 ), and the like. Unless otherwise specified, each instance of an alkyl group is independently unsubstituted (an "unsubstituted alkyl") or substituted (a "substituted alkyl") with one or more substituents (e.g., halogen, such as F).
  • substituents e.g., halogen, such as F
  • the alkyl group is an unsubstituted Cno alkyl (such as unsubstituted Ci-e alkyl, e.g., -CH 3 (Me), unsubstituted ethyl (Et), unsubstituted propyl (Pr, e.g., unsubstituted n-propy] ( «-Pr), unsubstituted isopropyl (/-Pr)), unsubstituted butyl (Bu, e.g., unsubstituted n-butyl (ra-Bu), unsubstituted te/ -butyl (tert-B or i-Bu), unsubstituted sec-butyl (sec-Bu), unsubstituted isobutyl (/-Bu)).
  • the alkyl group is a substituted Ci_io alkyl (such as substituted C e alkyl, e
  • alkenyl refers to a radical of a straight-chain or branched hydrocarbon group having from 2 to 20 carbon atoms, one or more carbon-carbon double bonds, and no triple bonds ("C2-20 alkenyl”).
  • an alkenyl group has 2 to 10 carbon atoms ("C2-io alkenyl”).
  • an alkenyl group has 2 to 9 carbon atoms ("C2-9 alkenyl”).
  • an alkenyl group has 2 to 8 carbon atoms (“C2-8 alkenyl”).
  • an alkenyl group has 2 to 7 carbon atoms (“C2-7 alkenyl”).
  • an alkenyl group has 2 to 6 carbon atoms (“C2-6 alkenyl”).
  • an alkenyl group has 2 to 5 carbon atoms ("C2-5 alkenyl"). In some
  • an alkenyl group has 2 to 4 carbon atoms (“C2-4 alkenyl").
  • an alkenyl group has 2 to 3 carbon atoms ("C2-.3 alkenyl").
  • a alkenyl group has 2 carbon atoms ("C2 alkenyl”).
  • the one or more carbon- carbon double bonds can be internal (such as in 2-butenyl) or terminal (such as in 1-butenyl).
  • Examples of C2-4 alkenyl groups include ethenyl (C2), 1-propenyl (C 3 ), 2-propenyl (C 3 ), 1- butenyl (C 4 ), 2-butenyl (C ), butadienyl (C4), and the like.
  • Examples of C2-6 alkenyl groups include the aforementioned C2-4 alkenyl groups as well as pentenyl (C5), pentadienyl (C5), hexenyl (Ce), and the like.
  • alkenyl examples include heptenyl (C?), octenyl (C 8 ), octatrienyl (Cg), and the like.
  • each instance of an alkenyl group is independently optionally substituted, i.e., unsubstituted (an "unsubstituted alkenyl") or substituted (a "substituted alkenyl") with one or more substituents.
  • the alkenyl group is unsubstituted €2- 1 0 alkenyl.
  • the alkenyl group is substituted C2-10 alkenyl.
  • Alkynyl refers to a radical of a straight-chain or branched hydrocarbon group having from 2 to 20 carbon atoms, one or more carbon-carbon triple bonds, and optionally one or more double bonds ("C2-20 alkynyl”).
  • an alkynyl group has 2 to 10 carbon atoms ("C2- 1 0 alkynyl”).
  • an alkynyl group has 2 to 9 carbon atoms ("C2-9 alkynyl”).
  • an alkynyl group has 2 to 8 carbon atoms (“C 2- 8 alkynyl”).
  • an alkynyl group has 2 to 7 carbon atoms ("C2-7 alkynyl”). In some embodiments, an alkynyl group has 2 to 6 carbon atoms ("C2-6 alkynyl”). In some embodiments, an alkynyl group has 2 to 5 carbon atoms (“C2-5 alkynyl”). In some
  • an alkynyl group has 2 to 4 carbon atoms (“C2-4 alkynyl").
  • an alkynyl group has 2 to 3 carbon atoms ("C2-3 alkynyl").
  • an alkynyl group has 2 carbon atoms ("C 2 alkynyl").
  • the one or more carbon- carbon triple bonds can be internal (such as in 2-butynyl) or terminal (such as in 1 -butynyl).
  • Examples of C 2- alkynyl groups include, without limitation, ethyny] (C 2 ), 1-propynyl (C3), 2- propynyl (C3), 1-butynyl (C 4 ), 2-butynyl (C 4 ), and the like.
  • Examples of € alkenyl groups include the aforementioned C 2-4 alkynyl groups as well as pentynyl (C 3 ⁇ 4 ), hexynyl (Ce), and the like.
  • alkynyl examples include heptynyl (C 7 ), octynyl (C 8 ), and the like.
  • each instance of an alkynyl group is independently optionally substituted, i.e., unsubstituted (an "unsubstituted alkynyl") or substituted (a "substituted alkynyl") with one or more substituents.
  • the alkynyl group is unsubstituted C 2-1 o alkynyl.
  • the alkynyl group is substituted C 2-1 o alkynyl.
  • Carbocyclyl or “carbocyclic” refers to a radical of a non-aromatic cyclic hydrocarbon group having from 3 to 10 ring carbon atoms ("C3 0 carbocyclyl”) and zero heteroatoms in the non-aromattc ring system, in some embodiments, a carbocyclyl group has 3 to 8 ring carbon atoms ("C 3-8 carbocyclyl”). In some embodiments, a carbocyclyl group has 3 to 6 ring carbon atoms (“C 3 _6 carbocyclyl”). In some embodiments, a carbocyclyl group has 3 to 6 ring carbon atoms ("C3-6 carbocyclyl”).
  • a carbocyclyl group has 5 to 10 ring carbon atoms (" €'5 0 carbocyclyl").
  • Exemplary C3-6 carbocyclyl groups include, without limitation, cyclopropyl (C3), cyclopropenyl (C3), cyclobutyl (C 4 ), cvclobutenyl (C 4 ), cyclopentyl (C5), cyclopentenyl (C5), cyclohexyl 3 ⁇ 4, cyclohexenyl (Cg), cyclohexadienyl (Ce), and the like.
  • Exemplary €3.8 carbocyclyl groups include, without limitation, the aforementioned C3-6 carbocyclyl groups as well as cycloheptyl (C 7 ), cycloheptenyl (C 7 ), cycloheptadienyl (C 7 ), cycloheptatrienyl (C 7 ), cyclooctyl (C 8 ), cyclooctenyl (C 8 ),
  • carbocyclyl groups include, without limitation, the aforementioned €3.8 carbocyclyl groups as well as cyclononyl (C 9 ), cyclononenyl (C9), eyclodecyl (Cio), cyclodecenyl (Cio), octahydro- lH-indenyl (C9), decahydronaphthalenyl (Cio), spiro[4.5]decanyl (Cio), and the like.
  • the carbocyclyl group is either monocyclic (“monocyclic carbocyclyl”) or contain a fused, bridged or spiro ring system such as a bicyclic system (“bicyclic carbocyclyl”) and can be saturated or can be partially unsaturated.
  • "Carbocyclyl” also includes ring systems wherein the carbocyclic ring, as defined above, is fused with one or more aryl or heteroaiyl groups wherein the point of attachment is on the carbocyclic ring, and in such instances, the number of carbons continue to designate the number of carbons in the carbocycitc ring system. Unless otherwise specified, each instance of a carbocyclyl group is independently optionally substituted, i.e.,
  • the carbocyclyl group is unsubstituted C3.10 carbocyclyl. In certain embodiments, the carbocyclyl group is substituted C3..10 carbocyclyl.
  • carbocyclyl is a monocyclic, saturated carbocyclyl group having from 3 to 10 ring carbon atoms ("C3.10 cycloalkyl”). In some embodiments, a
  • cycloalkyl group has 3 to 8 ring carbon atoms ("C3 cycloalkyl”). In some embodiments, a cycloalkyl group has 3 to 6 ring carbon atoms ("C3-6 cycloalkyl”). In some embodiments, a cycloalkyl group has 5 to 6 ring carbon atoms ("C5-6 cycloalkyl”). In some embodiments, a cycloalkyl group has 5 to 10 ring carbon atoms (" €5 0 cycloalkyl”). Examples of C5..6 cycloalkyl groups include cyclopentyl (C5) and cyclohexyl (C5).
  • C3-6 cycloalkyl groups include the aforementioned C5-6 cycloalkyl groups as well as cyclopropyl (C3) and cyclobutyl (C 4 ).
  • Examples of C 3-8 cycloalkyl groups include the aforementioned C 3- 6 cycloalkyl groups as well as eycloheptyl (C 7 ) and cvclooctyl (Cs).
  • each instance of a cycloalkyl group is independently unsubstituted (an "unsubstituted cycloalkyl") or substituted (a "substituted cycloalkyl") with one or more substituents.
  • the cycloalkyl group is unsubstituted C3.10 cycloalkyl.
  • the cycloalkyl group is substituted C3 0 cycloalkyl.
  • Heterocyclyi refers to a radical of a 3- to 10-membered non- aromatic ring system having ring carbon atoms and 1 to 4 ring heteroatoms, wherein each heteroatom is independently selected from nitrogen, oxygen, sulfur, boron, phosphorus, and silicon ("3-10 membered heterocyclyi").
  • the point of attachment can be a carbon or nitrogen atom, as valency permits.
  • a heterocyclyi group can either be monocyclic ("monocyclic heterocyclyi”) or a fused, bridged, or spiro ring system, such as a bicyclic system ("bicyclic heterocyclyi”), and can be saturated or can be partially unsaturated.
  • Heterocyclyi bicyclic ring systems can include one or more heteroatoms in one or both rings.
  • Heterocyclyi also includes ring systems wherein the heterocyclic ring, as deiined above, is fused with one or more carbocyclyl groups wherem the point of attachment is either on the carbocyclyl or heterocyclic ring, or ring systems wherem the heterocyclic ring, as defined above, is fused with one or more aryl or heteroaryl groups, wherein the point of attachment is on the heterocyclic ring, and in such instances, the number of ring members continue to designate the number of ring members in the heterocyclic ring system.
  • each instance of heterocyclyl is independently optionally substituted, i.e., unsubstituted (an "unsubstituted heterocyclyl") or substituted (a "substituted heterocyclyi") with one or more substituents.
  • the heterocyclyl group is unsubstituted 3-1.0 membered heterocyclyl.
  • the heterocyclyl group is substituted 3-10 membered heterocyclyl.
  • a heterocyclyl group is a 5-10 membered, non-aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms, wherem each heteroatom is independently selected from nitrogen, oxygen, sulfur, boron, phosphorus, and silicon ("5-10 membered heterocyclyl").
  • a heterocyclyl group is a 5-8 membered non-aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur ("5-8 membered heterocyclyl").
  • a heterocyclyl group is a 5-6 membered non-aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur ("5-6 membered heterocyclyl").
  • the 5-6 membered heterocyclyl has 1.-3 ring heteroatoms selected from nitrogen, oxygen, and sulfur.
  • the 5-6 membered heterocyclyl has 1 -2 ring heteroatoms selected from nitrogen, oxygen, and sulfur.
  • the 5-6 membered heterocyclyl has one ring heteroatom selected from nitrogen, oxygen, and sulfur.
  • Exemplaiy 3-membered heterocyclyl groups containing one heteroatom include, without limitation, azirdiiiyl, oxiranyl, thiiranyl.
  • Exemplary 4-membered heterocyclyl groups containing one heteroatom include, without limitation, azetidinyl, oxetanyl and thietanyl.
  • Exemplary 5-membered heterocyclyl groups containing one heteroatom include, without limitation, tetrahydrofuranyl, dihydrofuranyl, tetrahydrothiophenyl, dihydrothiophenyl, pyrrolidinyl, dihydropyrrolyl, and pyrrolyl-2,5-dione.
  • Exemplaiy 5-membered heterocyclyl groups containing two heteroatoms include, without limitation, dioxolanyl, oxasulfuranyl, disulfuranyl, and oxazolidin-2-one.
  • Exemplary 5-membered heterocyclyl groups containing three heteroatoms include, without limitation, triazolinyl, oxadiazoimyi, and thiadiazolinyl.
  • Exemplary 6-membered heterocyclyl groups containing one heteroatom include, without limitation, piperidinyl, tetrahydropyranyl, dihydropyridinyl, and thianyl.
  • Exemplary 6- inembered heierocyclyl groups containing two heteroatoms include, without limitation, piperazinyl, morpholmyl, dithiany], and dioxanyl.
  • Exemplary 6-membered heierocyclyl groups containing two heteroatoms include, without limitation, triazinanyl.
  • Exemplary 7- membered heierocyclyl groups containing one heteroatom include, without limitation, azepanyl, oxepanyl and thiepanyl.
  • Exemplar ⁇ ' 8-membered heterocyclyl groups containing one heteroatom include, without limitation, azocanyl, oxecanyl and thiocanyl.
  • Exemplar ' 5- membered heterocyclyl groups fused to a Cf, aryl ring include, without limitation, indolinyl, isoindolinyl, dihydrobenzofuranyl, dihydrobenzothienyl, benzoxazolmony], and the like.
  • Exemplary 6-membered heterocyclyl groups fused to an aryl ring include, without limitation, tetrahydroquinolinyi, tetrahydroisoquinoiinyl, and the like.
  • Aryl refers to a radical of a monocyclic or poly cyclic (e.g., bicyclic or tricyclic) 4n+2 aromatic ring system (e.g., having 6, 10, or 14 pi electrons shared in a cyclic array) having 6-14 ring carbon atoms and zero heteroatoms provided in the aromatic ring system ("C6-14 aryl").
  • an aryl group has six ring carbon atoms ("Q, ary '; e.g., phenyl).
  • an aryl group has ten ring carbon atoms ("do aryl”; e.g., naphthyl such as 1-naphthyl and 2-naphthyl). In some embodiments, an aryl group has fourteen ring carbon atoms ("C14 aryl”; e.g., anthracyl).
  • Aryl also includes ring systems wherein the aryl ring, as defined above, is fused with one or more carbocyclyl or heterocyclyl groups, wherein the radical or point of attachment is on the aryl ring, and in such instances, the number of carbon atoms continue to designate the number of carbon atoms in the ary l ring system. Unless otherwise specified, each instance of an aryl group is independently optionally substituted, i.e., unsubstituted (an "unsubstituted aryl”) or substituted (a
  • substituted aryl with one or more substituents.
  • the aryl group is unsubstituted C6- - 4 aryl.
  • the aryl group is substituted Q,-i4 aryl.
  • Aralkyl refers to an optionally substituted alkyl group substituted by an optionally substituted aryl group. In certain embodiments, the aralkyl is optionally substituted benzyl. In certain embodiments, the aralkyl is benzyl. In certain embodiments, the aralkyl is optionally substituted phenethyl. In certain embodiments, the aralkyl is phenethyl.
  • Heteroaryl refers to a radical of a 5-10 membered, monocyclic or bicyclic 4n+2 aromatic ring system (e.g., having 6 or 10 pi electrons shared in a cyclic array) having ring carbon atoms and 1-4 ring heteroatoms provided in the aromatic ring system, wherein each heteroatom is independently selected from nitrogen, oxygen and sulfur ("5-10 membered heteroaryl").
  • the point of attachment can be a carbon or nitrogen atom, as valency permits.
  • Heteroaryl bicyclic ring systems can include one or more heteroatoms in one or both rings.
  • Heteroaryl includes ring systems wherein the heteroaryl ring, as defined above, is fused with one or more carbocyclyl or heterocyclyl groups wherein the point of attachment is on the heteroaryl ring, and in such instances, the number of ring members continue to designate the number of ring members in the heteroaryl ring system.
  • Heteroaryl also includes ring systems wherein the heteroaryl ring, as defined above, is fused with one or more aryl groups wherein the point of attachment is either on the ary l or heteroaryl ring, and in such instances, the number of ring members designates the number of ring members in the fused (aryl/heteroaryl) ring system.
  • Bicyclic heteroaryl groups wherein one ring does not contain a heteroatom e.g., indolyl, quinolinyl, carbazolyl, and the like
  • the point of attachment can be on either ring, i.e., either the ring bearing a heteroatom (e.g., 2-indolyl) or the ring that does not contain a heteroatom (e.g., 5- indolyl).
  • a heteroaryl group is a 5-10 membered aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms provided in the aromatic ring system, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur ("5-10 membered heteroaryl").
  • a heteroaryl group is a 5-8 membered aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms provided in the aromatic ring system, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur ("5-8 membered heteroaryl").
  • a heteroaryl group is a 5-6 membered aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms provided in the aromatic ring system, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur ("5-6 membered heteroaryl").
  • the 5- 6 membered heteroaryl has 1-3 ring heteroatoms selected from nitrogen, oxygen, and sulfur.
  • the 5-6 membered heteroaryl has 1-2 ring heteroatoms selected from nitrogen, oxygen, and sulfur.
  • the 5-6 membered heteroaryl has 1 ring heteroatom selected from nitrogen, oxygen, and sulfur.
  • each instance of a heteroaryl group is independently optionally substituted, i.e., unsubstituted (an "unsubstituted heteroaryl") or substituted (a "substituted heteroaryl") with one or more substituents.
  • the heteroaryl group is unsubstituted 5-14 membered heteroaryl. In certain embodiments, the heteroaryl group is substituted 5-14 membered heteroaryl.
  • Exemplary 5-membered heteroaryl groups containing one heteroatom include, without limitation, pyrrolyl, furanyl, and thiophenyl.
  • Exemplary 5-membered heteroaryl groups containing two heteroatoms include, without limitation, imidazolyl, pyrazolyl, oxazolyl, isoxazolyl, thiazolyl, and isothiazolyl.
  • Exemplary 5-membered heteroaryl groups containing three heteroatoms include, without limitation, triazolyl, oxadiazolyl, and thiadiazolyl.
  • Exemplar ⁇ ' 5-membered heteroaiyl groups containing four heteroatoms include, without limitation, tetrazolyl.
  • Exemplary 6-membered heteroaryl groups containing one heteroatom include, without limitation, pyridinyl.
  • Exemplary 6-membered heteroaryl groups containing two heteroatoms include, without limitation, pyridazinyl, pyrimidinyl, and pyrazinyl.
  • Exemplar 6-membered heteroaryl groups containing three or four heteroatoms include, without limitation, triazinyl and tetrazinyl, respectively.
  • Exemplary 7-membered heteroaryl groups containing one heteroatom include, without limitation, azepinyl, oxepinyl, and thiepinyl.
  • Exemplary 5,6-bicyciic heteroaryl groups include, without limitation, indoiyl, isoindolyl, indazolyl, benzotriazolyl, benzothiophenyl, isobenzothiophenyl, benzofuranyl, benzoisofurany], benzimidazolyl, benzoxazolyl, benzisoxazolyl, benzoxadiazolyl, benzthiazolyl, benzisothiazolyl, benzthiadiazolyl, indolizinyl, and purinyl.
  • Exemplary 6,6- bicyclic heteroaryl groups include, without limitation, naphthyridmyl, pteridinyl, quinolmyl, isoquinolinyl, cinnolinyl, quinoxalmyl, phthalazinyl, and quinazolinyl.
  • Heteroaralkyl is a subset of alkyl and heteroaryl and refers to an optionally substituted alkyl group substituted by an optionally substituted heteroaryl group.
  • Unsaturated or “partially unsaturated” refers to a group that includes at least one double or triple bond.
  • a “partially unsaturated” ring system is further intended to encompass rings having multiple sites of unsaturation, but is not intended to include aromatic groups (e.g., aryl or heteroaryl groups).
  • saturated refers to a group that does not contain a double or triple bond, i.e., contains all single bonds.
  • Alkyl, alkenyl, alkyny], carbocyclyl, heterocyclyl, aryl, and heteroaryl groups, which are divalent linking groups, are further referred to using the suffix -ene, e.g., alkylene, alkenylene, alkynylene, carbocyclylene, heterocyclylene, arylene, and heteroarylene.
  • alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl groups are optionally substituted (e.g., "substituted” or “unsubstituted” alkyl, "substituted” or “unsubstituted” alkenyl, "substituted” or “unsubstituted” alkynyl, "substituted” or “unsubstituted” carbocyclyl, "substituted” or “unsubstituted” heterocyclyl, "substituted” or “unsubstituted” aryl or “substituted” or “unsubstituted” heteroary] group).
  • substituted means that at least one hydrogen present on a group (e.g., a carbon or nitrogen atom) is replaced with a permissible substituent, e.g., a substituent which upon substitution results in a stable compound, e.g., a compound which does not spontaneously undergo transformation such as by rearrangement, cyclization, elimination, or other reaction.
  • a "substituted" group has a substituent at one or more substitutable positions of the group, and when more than one position in any given structure is substituted, the substituent is either the same or different at each position.
  • substituted is contemplated to include substitution with all permissible substituents of organic compounds, any of the substituents described herein that results in the formation of a stable compound.
  • the present disclosure contemplates any and all such combinations in order to arrive at a stable compound.
  • heteroatoms such as nitrogen may have hydrogen substituents and/or any suitable substituent as described herein which satisfy the valencies of the heteroatoms and results in the formation of a stable moiety.
  • the substituent is a carbon atom substituent.
  • the substituent is a nitrogen atom substituent.
  • the substituent is an oxygen atom substituent.
  • the substituent is a sulfur atom substituent.
  • Exemplary carbon atom substituents include, but are not limited to, halogen, -CN, -NO2, -N 3 , -SO2H, -SO3H, -OH, -GR aa , -ON(R bb ) 2 , -N(R bb ) 2 , N( R h V , -N(OR cc )R bb ,
  • R a is, independently, selected from CMO alkyl, CMO perhaloalkyl, C 2- io alkenyl, €2- 10 alkynyl, C3..10 carbocyclyl, 3-14 membered heterocyclyl, Ce-w aryl, and 5- 14 membered heteroaryl, or two R aa groups are joined to form a 3-14 membered heterocyclyl or 5-14 membered heteroaryl ring, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl,
  • each instance of R bb is, independently, selected from hydrogen, -OH, -OR* 8 ,
  • each instance of R cc is, independently, selected from hydrogen, Cuo alkyl, C O perhaloalkyl, C 2-10 alkenyl, C 2- io alkynyl, C3. 0 carbocyclyl, 3-14 membered heterocyclyl, Cg. 14 aryl, and 5-14 membered heteroaryl, or two R cc groups are joined to form a 3-14 membered heterocyclyl or 5-14 membered heteroaryl ring, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 R M groups;
  • each instance of R ee is, independently, selected from Ci-6 alkyl, d-e perhaloalkyl, C 2- 6 alkenyl, C 2- 6 alkynyl, C3..10 earboeyclyl, Cg-io aryl, 3-10 membered heterocyclyi, and 3-10 membered heteroaryl, wherem each alkyl, alkenyl, alkynyl, earboeyclyl, heteroeyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 R 88 groups;
  • each instance of R * is, independently, selected from hydrogen, d-e alkyl, G_e perhaloalkyl, C 2 .g alkenyl, C 2 .g alkynyl, C3 0 earboeyclyl, 3-10 membered heterocyclyi, Cg-io aryl and 5-10 membered heteroaryl, or two R 1 ' groups are joined to form a 3-14 membered heterocyclyi or 5-14 membered heteroaryl ring, wherein each alkyl, alkenyl, alkynyl, earboeyclyl, heterocyclyi, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 R gg groups; and
  • each instance of R ss is, independently, halogen, -CN, -NO2, -N3, ⁇ SQ 2 H, -SO3H, -OH, -OCi-6 alkyl, ON(d ,, alkyl) 2 , N(C alkyl) 2 , N(G ;> alkyl).
  • -, ' X Ni l(G ⁇ , alkyl) 2 + X , S 2 (G trench alkyl) + X , M S, X , -N(OCi -6 alky])(d- 6 alkyl), N(OH)(C ,, alkyl), -NH(OH), -SH, SC.
  • a "counterion” or “anionic counterion” is a negatively charged group associated with a positively charged group in order to maintain electronic neutrality.
  • An anionic counterion may be monovalent (i.e., including one formal negative charge).
  • An anionic counterion may also be multivalent (i.e., including more than one formal negative charge), such as divalent or trivalent.
  • Exemplary counterions include halide ions (e.g., F ⁇ , CF, Br , F), NO 3 " , C V, OH " , H 2 P04 ⁇ , HC0 3 , HS04 ⁇ , sulfonate ions (e.g., methansulfonate, trifluoromethanesulfonate, / - toluenesulfonate, benzenesulfonate, 10-camphor sulfonate, naphthalene-2-sulfonate, naphthalene-l-sulfonic acid-5-sulfonate, ethan-l-sulfonic acid-2-sulfonate, and the like), carboxylate ions (e.g., acetate, propanoate, benzoate, gly cerate, lactate, tartrate, glycoiate, gluconate, and the like), BF 4 " , PF_f , PF
  • Exemplary counterions which may be multivalent include CO 3 2 ⁇ , 1 ⁇ .. ) , , P0 4 3 ⁇ B 4 0 7 2 ⁇ , S0 4 2 ⁇ , S 2 0 3 ⁇ , carboxylate anions (e.g., tartrate, citrate, fumarate, maleate, maiate, malonate, gluconate, succinate, glutarate, adipate, pimelate, suberate, azelate, sebacate, salicylate, phthalates, aspartate, glutamate, and the like), and carboranes.
  • carboxylate anions e.g., tartrate, citrate, fumarate, maleate, maiate, malonate, gluconate, succinate, glutarate, adipate, pimelate, suberate, azelate, sebacate, salicylate, phthalates, aspartate, glutamate, and the like
  • carboranes e.g., tartrate, citrate, fum
  • Halo or "halogen” refers to fluorine (fluoro, -F), chlorine (chloro, -CI), bromine (bromo, -Br), or iodine (iodo, -I).
  • hydroxy! or "hydroxy” refers to the group -OH.
  • substituted hydroxy! or “substituted hydroxyl,” by extension, refers to a hydroxy! group wherein the oxygen atom directly attached to the parent molecule is substituted with a group other than hydrogen, and includes groups selected from -OR 88 , -ON(R bb ) 2 , -0C( O)SR 88 ,
  • amino refers to the group -NH 2 .
  • substituted amino by extension, refers to a monosubstituted amino, a disubstituted amino, or a trisubstituted amino. In certain embodiments, the "substituted amino” is a monosubstituted amino or a
  • Nitrogen atoms ca be substituted or unsubstituted as valency permits, and include primary, secondary, tertiary, and quaternary nitrogen atoms.
  • Exemplary nitrogen atom substituents include, but are not limited to, hydrogen, -OH, -OR 38 , -N(R CC ) 2 , -CN, -C(-0)N(R cc ) 2 , C();:R a , -S0 2 R aa , -C(-NR bb )R aa , - ⁇ C(-NR cc )OR aa ,
  • the substituent present on a nitrogen atom is a nitrogen protecting group (also referred to as an amino protecting group).
  • Nitrogen protecting groups such as sulfonamide groups include, but are not limited to, jp-toluenesulfonamide (Ts), benzenesulfonamide, 2,3,6,-trimethyl-4- methoxybenzenesulfonamide (Mtr), 2,4,6-trimethoxybenzenesulfonamide (Mtb), 2,6- dimethyl-4-methoxybenzenesulfonamide (Pme), 2,3,5,6-tetramethyl-4- methoxybenzenesulfonamide (Mte), 4-methoxybenzenesulfonamide (Mbs), 2,4,6- trimethylbenzenesulfonamide (Mts), 2,6-dimethoxy-4-methylbenzenesulfonamide (iMds), 2,2,5,7,8-pentamethylchroman-6-sulfonamide (Pmc), methane
  • Ts jp-toluenesulfonamide
  • Mtr
  • nitrogen protecting groups include, but are not limited to, phenothiazinyl-(lO)- acyl derivative, N'-p ⁇ toluenesulfonylammoacyl derivative, iV-phenylaminothioacyl derivative, N-benzoylphenylalanyl derivative, N-acetylmethionine derivative, 4,5-diphenyl-3-oxazolin-2- one, N-phthalimide, N-dithiasuccinimide (Dts), N-2,3-diphenylmaleimide, N-2,5- dimethylpyrroie, N-l,l,4,4-tetramethyldisilylazacyclopentane adduct (STABASE), 5- substituted l,3-dimethyl-l,3,5-triazacyc3ohexan-2-one, 5-substituted l,3-dibenzyl-l,3,5- triazacyclohex
  • Dpp diphenylphosphinamide
  • Mpt dimethylthiophosphinamide
  • diphenylthiophosphinamide Ppt
  • dialkyl phosphoramidates dibenzyl phosphoramidate, diphenyl phosphoramidate, benzenesulfenamide, o-nitrobenzenesulfenamide (Nps), 2,4- dinitrobenzenesulfenamide, pentachlorobenzenesulfenamide, 2-nitro-4- methoxybenzenesulfenamide, triphenylmethylsulfenamide, and 3-nttTopyrtdinesulfenamide
  • oxygen atom substituent present on an oxygen atom is an oxygen protecting group (also referred to as a hydroxy] protecting group).
  • Oxygen protecting groups are well known in the art and include those described in detail in Protecting Groups in Organic Synthesis, T. W. Greene and P. G. M.
  • oxygen protecting groups include, but are not limited to, methyl, t-butyloxycarbonyl (BOC or Boc), methoxylmethyl (MOM), methylthiomethyl (MTM), t-butylthiomethyl,
  • DEIPS diethylisopropylsilyl
  • TDMS dimethyl thexylsilyl
  • TDPS t- butyldiphenylsilyl
  • tribenzylsily tri- j-xylylsilyl, triphenylsilyl
  • DPMS diphenylmethylsilyl
  • TMPS t-butylmethoxyphenylsilyl
  • formate benzoyl formate, acetate, chloroacetate, dichloroacetate, trichloroacetate, trifl oroacetate, methoxyacetate, triphenylmethoxyacetate, phenoxyaeetate, 7-chlorophenoxyacetate, 3-phenylpropionate, 4- oxopentanoate (levulinate), 4,4-(ethylenedithio)pentanoate (levulmoyldithioacetal), pivaloate, adamantoate, crotonate, 4-methoxycrotonate, benzoate, p-phenylbenzoate, 2,4,6- trimethylbenzoate (mesitoate), alkyl methyl carbonate, 9-fluorenylmethyl carbonate (Fmoc), alkyl ethyl carbonate, alkyl 2,2,
  • V,N',N ! - tetramethylphosphorodiamidate alkyl N-phenylcarbamate, borate, dimethylphosphinothioyl, alkyl 2,4-dmitrophenylsulfenate, sulfate, methanesulfonate (mesylate), benzylsulfonate, and tosylate (Ts).
  • R co are as defined herein.
  • the sulfur atom substituent present on a sulfur atom is a sulfur protecting group (also referred to as a thiol protecting group).
  • Sulfur protecting groups are well known in the art and include those described in detail in Protecting
  • a “hydrocarbon chain” refers to a substituted or unsubstituted divalent alkyl, alkenyl, or alkynyl group.
  • a hydrocarbon chain includes (1) one or more chains of carbon atoms immediately between the two radicals of the hydrocarbon chain; (2) optionally one or more hydrogen atoms on the chain(s) of carbon atoms; and (3) optionally one or more substituents ("non-chain substituents," which are not hydrogen) on the chain(s) of carbon atoms.
  • a chain of carbon atoms consists of consecutively comiected carbon atoms ("chain atoms" or "carbon units”) and does not include hydrogen atoms or heteroatoms.
  • a non-chain substituent of a hydrocarbon chain may include any atoms, including hydrogen atoms, carbon atoms, and heteroatoms.
  • hydrocarbon chain -C A H(C B H 2 C C H3)- includes one chain atom C A , one hydrogen atom on C A , and non-chain substituent -(C B H 2 C C H3).
  • C x hydrocarbon chain wherein x is a positive integer, refers to a hydrocarbon chain that includes x number of ch ain atom(s) between the two radicals of the hydrocarbon chain. If there is more than one possible value of x, the smallest possible value of x is used for the the hydrocarbon chain.
  • -CH(C 2 H5)- is a Q hydrocarbon chain, and is a C 3 hydrocarbon chain.
  • a C3-10 hydrocarbon chain refers to a hydrocarbon chain where the number of chain atoms of the shortest chain of carbon atoms immediately between the two radicals of the hydrocarbon chain is 3, 4, 5, 6, 7, 8, 9, or 10.
  • a hydrocarbon chain may be saturated (e.g., -(CH 2 ) 4 -).
  • a hydrocarbon chain may also be unsaturated and include one or more C ⁇ C and/or C ⁇ C bonds anywhere in the hydrocarbon chain.
  • the hydrocarbon chain is unsubstituted (e.g., -C ⁇ C- or -(CH 2 ) 4 -).
  • the hydrocarbon chain is substituted (e.g., -CH(C 2 H5)- and -CF 2 -). Any two substituents on the hydrocarbon chain may be joined to form an optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, or optionally substituted heteroaryl ring.
  • a hydrocarbon chain is all examples of a hydrocarbon chain.
  • the resulting group is referred to as a C x hydrocarbon chain wherein a chain atom is replaced with a heteroatom, as opposed to a C x -i hydrocarbon chain.
  • 3 ⁇ 4 ⁇ ⁇ is a C hydrocarbon chain wherein one chain atom is replaced with an oxygen atom
  • leaving group is given its ordinary meaning in the art of synthetic organic chemistry and refers to an atom or a group capable of being displaced by a nucleophile.
  • Suitable leaving groups include, but are not limited to, halogen (such as F, CI, Br, or I (iodine)), alkoxycarbonyloxy, aryloxycarbonyloxy, alkanesulfonyloxy, arenesulfonyloxy, alkyl-carbonyloxy (e.g., acetoxy), arylcarbonyloxy, aryloxy, methoxy, N,0- dirnethylhydroxylamino, pixyl, and haloformates.
  • halogen such as F, CI, Br, or I (iodine)
  • the leaving group is a brosylate, such as j p-bromobenzenesulfonyloxy.
  • the leaving group is a nosylate, such as 2-nitrobenzenesulfonyloxy.
  • the leaving group may also be a phosphineoxide (e.g., formed during a Mitsunobu reaction) or an internal leaving group such as an epoxide or cyclic sulfate.
  • phosphineoxide e.g., formed during a Mitsunobu reaction
  • an internal leaving group such as an epoxide or cyclic sulfate.
  • Other non-limiting examples of leaving groups are water, ammonia, alcohols, ether moieties, thioether moieties, zinc haiides, magnesium moieties, diazonium salts, and copper moieties.
  • pharmaceutically acceptable salt refers to those salts which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of humans and lower animals without undue toxicity, irritation, allergic response, and the like, and are commensurate with a reasonable benefit/risk ratio.
  • Pharmaceutically acceptable salts are well known in the art. For example, Berge et al. describe pharmaceutically acceptable salts in detail in J. Pharmaceutical Sciences, 1977, 66, 1 -19, incorporated herein by reference.
  • Pharmaceutically acceptable salts of the compounds described herein include those derived from suitable inorganic and organic acids and bases.
  • Examples of pharmaceutically acceptable, non-toxic acid addition salts are salts of an amino group formed with inorganic acids such as hydrochloric acid, hydrobromic acid, phosphoric acid, sulfuric acid, and perchloric acid or with organic acids such as acetic acid, oxalic acid, maieic acid, tartaric acid, citric acid, succinic acid, or malonic acid or by using other methods know in the art such as ion exchange.
  • Other pharmaceutically acceptable salts include adipate, alginate, ascorbate, aspartate, benzenesulfonate, benzoate, bisulfate, borate, but rate, camphorate,
  • Salts derived from appropriate bases include alkali metal, alkaline earth metal, ammonium and ⁇ (Ci-4 alkyl) 4 " salts.
  • Representative alkali or alkaline earth metal salts include sodium, lithium, potassium, calcium, magnesium, and the like.
  • Further pharmaceutically acceptable salts include, when appropriate, nontoxic ammonium, quaternary ammonium, and amine cations formed using counterfoils such as halide, hydroxide, carboxylate, sulfate, phosphate, nitrate, lower alkyl sulfonate, and aryl sulfonate.
  • solvate refers to forms of the compound that are associated with a sol vent, usually by a solvolysis reaction. This physical association may include hydrogen bonding.
  • Conventional solvents include water, methanol, ethanol, acetic acid, DMSO, THF, diethyl ether, and the like.
  • the compounds described herein may be prepared, e.g., in crystalline form, and may be solvated.
  • Suitable solvates include pharmaceutically acceptable solvates and further include both stoichiometric solvates and non-stoichiometric solvates. In certain instances, the solvate will be capable of isolation, for example, when one or more solvent molecules are incorporated in the crystal lattice of a crystalline solid.
  • “Solvate” encompasses both solution-phase and isolatable solvates. Representative solvates include hydrates, ethanolates, and methanolates.
  • hydrate refers to a compound that is associated with water.
  • the number of the water molecules contained in a hydrate of a compound is in a definite ratio to the number of the compound molecules in the hydrate. Therefore, a hydrate of a compound may be represented, for example, by the general formula R x H 2 0, wherein R is the compound, and x is a number greater than 0.
  • a given compound may form more than one type of hydrate, including, e.g., monohydrates (x is 1 ), lower hydrates (x is a number greater than 0 and smaller than 1 , e.g., hemihydrates (R-0.5 H 2 O ), and polyhydrates (x is a number greater than 1, e.g., dihydrates (R-2 H 2 0) and hexahydrates (R-6 H 2 0)).
  • monohydrates x is 1
  • lower hydrates x is a number greater than 0 and smaller than 1 , e.g., hemihydrates (R-0.5 H 2 O )
  • polyhydrates x is a number greater than 1, e.g., dihydrates (R-2 H 2 0) and hexahydrates (R-6 H 2 0)).
  • tautomers refers to two or more interconvertible compounds resulting from at least one formal migration of a hydrogen atom and at least one change in valency (e.g., a single bond to a double bond, a triple bond to a single bond, or vice versa).
  • the exact ratio of the tautomers depends on several factors, including temperature, solvent, and pH. Tautomerizations (i.e., the reaction providing a tautomeric pair) may catalyzed by acid or base.
  • Exemplary tautomerizations include keto-to-enol, amide-to-imide, lactam-to-lactim, enamine-to-imine, and enamine-to-(a different enamine) tautomerizations.
  • stereoisomers that are not mirror images of one another are termed “diastereomers” and those that are non-superimposable mirror images of each other are termed “enantiomers.”
  • enantiomers When a compound has an asymmetric center, for example, it is bonded to four different groups, a pair of enantiomers is possible.
  • An enantiomer can be characterized by the absolute configuration of its asymmetric center and is described by the R- and S-sequencing rules of Cahn and Prelog, or by the manner in which the molecule rotates the plane of polarized light and designated as dextrorotatory or levorotatory (i.e., as (+) or (-)-isomers respectively).
  • a chiral compound can exist as either individual enantiomer or as a mixture thereof.
  • a mixture containing equal proportions of the enantiomers is called a "racemic mixture.”
  • polymorphs refers to a crystalline form of a compound (or a salt, hydrate, or solvate thereof) in a particular crystal packing arrangement. All polymorphs have the same elemental composition, Different crystalline forms usually have different X-ray diffraction patterns, infrared spectra, melting points, density, hardness, crystal shape, optical and electrical properties, stability, and solubility, Reciysiallization solvent, rate of crystallization, storage temperature, and other factors may cause one crystal form to dominate.
  • Various polymorphs of a compound can be prepared by crystallization under different conditions.
  • co-crystal refers to a crystalline structure composed of at least two components
  • a co-crystal may contain a compound of the present invention and one or more other component, including but not limited to, atoms, ions, molecules, or solvent molecules.
  • a co-crystal may contain a compound of the present invention and one or more componen ts related to said compound, including not limited to, an isomer, tautomer, salt, solvate, hydrate, synthetic precursor, synthetic derivative, fragment or impurity of said compound.
  • isotopically labeled derivative or “isotopically labeled” refers to a compound wherein one or more atoms in the compound (or in an associated ion or molecule of a salt, hydrate, or solvate) has been replaced with an isotope of the same element.
  • the isotope will be enriched, or present in a higher percentage of all atoms of the element or of all atoms at the position in the molecule in a sample, relative to an unlabeled variant.
  • the enriched isotope will be a stable isotope.
  • the enriched isotope will be an unstable or radioactive isotope (e.g., a radionuclide).
  • the enriched isotope may be detected by a measurement technique, including but not limited to nuclear magnetic resonance, mass spectrometry, infrared spectroscopy, or a technique that measures radioactive decay.
  • prodrugs refers to compounds that have cleavable groups and become by solvolysis or under physiological conditions the compounds described herein, which are pharmaceutically active in vivo. Such examples include, but are not limited to, choline ester derivatives and the like, N-alkylmorpholine esters and the like. Other derivatives of the compounds described herein have activity in both their acid and acid derivative forms, but in the acid sensitive form often offer advantages of solubility, tissue compatibility, or delayed release in the mammalian organism (see, Bundgard, H., Design of Prodrugs, pp. 7-9, 21-24, Elsevier, Amsterdam 1985).
  • Prodrugs include acid derivatives well known to practitioners of the art, such as, for example, esters prepared by reaction of the parent acid with a suitable alcohol, or amides prepared by reaction of the parent acid compound with a substituted or unsubstituted amine, or acid anhydrides, or mixed anhydrides. Simple aliphatic or aromatic esters, amides, and anhydrides derived from acidic groups pendant on the compounds described herein are particular prodrugs. In some cases it is desirable to prepare double ester type prodrugs such as (acyloxy)alkyl esters or ((alkoxycarbonyl)oxy)alkylesters.
  • Cj -Cg alkyl, C2-C8 alkenyl, C 2 -C 8 alkynyl, aryl, C7-C12 substituted aryl, and C7-C12 aryl alkyl esters of the compounds described herein may be preferred.
  • inhibitor refers to the ability of a compound to reduce, slow, halt or prevent activity of a particular biological process (e.g., CDK kinase activity)) in a cell relative to vehicle.
  • a compound, pharmaceutical composition, method, use, or kit When a compound, pharmaceutical composition, method, use, or kit is referred to as “selectively,” “specifically,” or “competitively” binding a first protein kinase, the compound, pharmaceutical composition, method, use, or kit binds the first protein kinase (e.g., CDK) with a higher binding affinity (e.g. , not less than about 2-fold, not less than about 5-fold, not less than about 10-fold, not less than about 30-fold, not less than about 100-fold, not less than about 1,000-fold, or not less than about 10,000-fold) than binding a second protein or second chromatin that is different from the first protein and the first chromatin.
  • a higher binding affinity e.g. , not less than about 2-fold, not less than about 5-fold, not less than about 10-fold, not less than about 30-fold, not less than about 100-fold, not less than about 1,000-fold, or not less than about 10,000-fold
  • a compound, pharmaceutical composition, method, use, or kit When a compound, pharmaceutical composition, method, use, or kit is referred to as “selectively,” “specifically,” or “competitively” modulating (e.g., increasing or inhibiting) the activity of a first protein kinase, the compound, pharmaceutica] composition, method, use, or kit modulates the activity of the first protein kinase (e.g.
  • CDK CDK to a greater extent (e.g., not less than about 2-fold, not less than about 5-fold, not less than about 10-fold, not less than about 30-fold, not less than about 100-fold, not less than about 1 , 000-fold, or not less than about 10,000-fold) than the activity of a second protein kinase that is different from the first protein kinase.
  • abnormal activity refers to activity deviating from normal activity, that is, abnormal activity.
  • increased activity refers to activity higher than normal activity.
  • composition and “formulation” are used interchangeably.
  • a "subject" to which administration is contemplated refers to a human (i.e., male or female of any age group, e.g., pediatric subject (e.g., infant, child, or adolescent) or adult subject (e.g., young adult, middle-aged adult, or senior adult)) or non-human animal.
  • the non-human animal is a mammal (e.g., primate (e.g., cynomolgus monkey or rhesus monkey), commercially relevant mammal (e.g., cattle, pig, horse, sheep, goat, cat, or dog), or bird (e.g., commercially relevant bird, such as chicken, duck, goose, or turkey)).
  • primate e.g., cynomolgus monkey or rhesus monkey
  • commercially relevant mammal e.g., cattle, pig, horse, sheep, goat, cat, or dog
  • bird e.g., commercially relevant bird, such as
  • the non-human animal is a fish, reptile, or amphibian.
  • the non-human animal may be a male or female at any stage of development.
  • the non-human animal may be a transgenic animal or genetically engineered animal.
  • a "patient” refers to a human subject in need of treatment of a disease.
  • tissue sample refers to any sample including tissue samples (such as tissue sections and needle biopsies of a tissue); cell samples (e.g., cytological smears (such as Pap or blood smears) or samples of cells obtained by microdissection); samples of whole organisms (such as samples of yeasts or bacteria); or cell fractions, fragments or organelles (such as obtained by lysing cells and separating the components thereof by centrifugation or otherwise).
  • tissue samples such as tissue sections and needle biopsies of a tissue
  • cell samples e.g., cytological smears (such as Pap or blood smears) or samples of cells obtained by microdissection) or samples of cells obtained by microdissection
  • samples of whole organisms such as samples of yeasts or bacteria
  • cell fractions, fragments or organelles such as obtained by lysing cells and separating the components thereof by centrifugation or otherwise.
  • biological samples include blood, serum, urine, semen, fecal matter, cerebrospinal fluid, interstitial fluid, mucous, tears, sweat, pus, biopsied tissue (e.g., obtained by a surgical biopsy or needle biopsy), nipple aspirates, milk, vaginal fluid, saliva, swabs (such as buccal swabs), or any material containing biomolecules that is derived from another biological sample.
  • biopsied tissue e.g., obtained by a surgical biopsy or needle biopsy
  • nipple aspirates milk, vaginal fluid, saliva, swabs (such as buccal swabs), or any material containing biomolecules that is derived from another biological sample.
  • administer refers to implanting, absorbing, ingesting, injecting, inhaling, or otherwise introducing a compound described herein, or a composition thereof, into, in, or on a subject.
  • treatment refers to reversing, alleviating, delaying the onset of, or inhibiting the progress of a disease described herein .
  • treatment may be administered after one or more signs or symptoms of the disease have developed or have been observed.
  • treatment may be administered in the absence of signs or symptoms of the disease.
  • treatment may be administered to a susceptible subject prior to the onset of symptoms (e.g., in light of a histor of symptoms and/or in light of exposure to a pathogen). Treatment may also be continued after symptoms have resolved, for example, to delay or prevent recurrence.
  • an "effective amount" of a compound described herein refers to an amount sufficient to elicit the desired biological response, i.e. , treating the condition.
  • the effective amount of a compound described herein may vary depending on such factors as the desired biological endpoint, the pharmacokinetics of the compound, the condition being treated, the mode of administration, and the age and healt of the subject.
  • an effective amount is a therapeutically effective amount.
  • an effective amount is a prophylactic treatment.
  • an effective amount is the amount of a compound described herein in a single dose.
  • an effective amount is the combined amounts of a compound described herein in multiple doses.
  • a “therapeutically effective amount” of a compound described herein is an amount sufficient to provide a therapeutic benefit in the treatment of a condition or to delay or minimize one or more symptoms associated with the condition.
  • a therapeutically effective amount of a compound means an amount of therapeutic agent, alone or in combination with other therapies, which provides a therapeutic benefit in the treatment of the condition.
  • the term "therapeutically effective amount” can encompass an amount that improves overall therapy, reduces or avoids symptoms, signs, or causes of the condition, and/or enhances the therapeutic efficacy of another therapeutic agent.
  • a prophyiacticaliy effective amount of a compound described herein is an amount sufficient to prevent a condition, or one or more symptoms associated with the condition or prevent its recurrence.
  • a prophyiacticaliy effective amount of a compound means an amount of a therapeutic agent, alone or in combination with other agents, whic provides a prophylactic benefit in the prevention of the condition.
  • the term “prophyiacticaliy effective amount” can encompass an amount that improves overall prophylaxis or enhances the prophylactic efficacy of another prophylactic agent.
  • a "proliferative disease” refers to a disease that occurs due to abnormal growth or extension by the multiplication of cells (Walker, Cambridge Dictionary of Biology;
  • a proliferative disease may be associated with: 1) the pathological proliferation of normally quiescent cells; 2) the pathological migration of cells from their normal location (e.g., metastasis of neoplastic cells); 3) the pathological expression of proteolytic enzymes such as the matrix
  • proliferative diseases include cancers (i.e., "malignant neoplasms"), benign neoplasms, diseases associated with angiogenesis, inflammatory diseases, and autoimmune diseases.
  • angiogenesis refers to the physiological process through whic new blood vessels form from pre-existing vessels.
  • Angiogenesis is distinct from vasculogenesis, which is the de novo fonnation of endothelial cells from mesoderm cell precursors. The first vessels in a developing embryo form through vasculogenesis, after which angiogenesis is responsible for most blood vessel growth during normal or abnormal development.
  • Angiogenesis is a vital process in growth and development, as well as in wound healing and in the fonnation of granulation tissue.
  • angiogenesis is also a fundamental step in the transition of tumors from a benign state to a malignant one, leading to the use of angiogenesis inhibitors in the treatment of cancer.
  • Angiogenesis may be chemically stimulated by angiogenic proteins, such as growth factors (e.g., VEGF).
  • angiogenic proteins such as growth factors (e.g., VEGF).
  • VEGF growth factors
  • “Pathological angiogenesis” refers to abnormal (e.g., excessive or insufficient) angiogenesis that amounts to and/or is associated with a disease.
  • neoplasm and “tumor” are used herein interchangeably and refer to an abnormal mass of tissue wherein the growth of the mass surpasses and is not coordinated as in the growth of normal tissue.
  • a neoplasm or tumor may be “benign” or “malignant,” depending on the follo wing characteristics: degree of cellular differen tiation (including morphology and functionality), rate of growth, local invasion, and metastasis.
  • a “benign neoplasm” is generally well differentiated, has characteristically slower growth than a malignant neoplasm, and remains localized to the site of origin. In addition, a benign neoplasm does not have the capacity to infiltrate, invade, or metastasize to distant sites.
  • Exemplary benign neoplasms include, but are not limited to, lipoma, chondroma, adenomas, acrochordon, senile angiomas, seborrheic keratoses, lentigos, and sebaceous hyperplasias.
  • certain "benign" tumors may later give rise to malignant neoplasms, which may result from additional genetic changes in a subpopulation of the tumor's neoplastic cells, and these tumors are referred to as "pre-malignant neoplasms.”
  • An exemplary pre-malignant neoplasm is a teratoma.
  • a malignant neoplasm is generally poorly differentiated (anaplasia) and has characteristically rapid growth accompanied by progressive infiltration, invasion, and destruction of the surrounding tissue. Furthermore, a malignant neoplasm generally has the capacity to metastasize to distant sites.
  • the term “metastasis,” “metastatic,” or “metastasize” refers to the spread or migration of cancerous cells from a primary or original tumor to another organ or tissue and is typically identifiable by the presence of a "secondary tumor” or “secondary cell mass” of the tissue type of the primary or original tumor and not of that of the organ or tissue in which the secondary (metastatic) tumor is located.
  • a prostate cancer that has migrated to bone is said to be metastasized prostate cancer and includes cancerous prostate cancer cells growing in bone tissue.
  • cancer refers to a class of diseases characterized by the development of abnormal cells that proliferate uncontrollably and have the ability to infiltrate and destroy normal body tissues. See, e.g., Stedman 's Medical Dictionary, 25th ed.; Hensyl edL; Williams & Wilkins: Philadelphia, 1990. Exemplary cancers include, but are not limited to, hematological malignancies.
  • Additional exemplary cancers include, but are not limited to, acoustic neuroma; adenocarcinoma; adrenal gland cancer; anal cancer; angiosarcoma (e.g., lymphangiosarcoma, lymphangioendotheliosarcoma, hemangiosarcoma); appendix cancer; benign monoclonal gammopathy; biliar cancer (e.g., c olangiocarcinoma); bladder cancer; breast cancer (e.g., adenocarcinoma of the breast, papillary carcinoma of the breast, mammary cancer, medullary carcinoma of the breast, triple negative breast cancer (TNBC)); brain cancer (e.g., meningioma, glioblastomas, glioma (e.g., astrocytoma,
  • angiosarcoma e.g., lymphangiosarcoma, lymphangioendotheliosarcoma, hemangiosarcom
  • adenocarcinoma adenocarcinoma
  • Ewing's sarcoma ocular cancer (e.g., intraocular melanoma,
  • retinoblastoma familiar hypereosinophilia; gall bladder cancer; gastric cancer (e.g., stomach adenocarcinoma); gastrointestinal stromal tumor (GIST); germ cell cancer; head and neck cancer (e.g., head and neck squamous cell carcinoma, oral cancer (e.g., oral squamous cell carcinoma), throat cancer (e.g., laryngeal cancer, pharyngeal cancer, nasopharyngeal cancer, oropharyngeal cancer)); heavy chain disease (e.g., alpha chain disease, gamma chain disease, mu chain disease; hemangioblastoma; hypopharynx cancer; inflammatory myofibroblastic tumors; immunocytic amyloidosis; kidney cancer (e.g., nepliroblastoma a.k.a.
  • kidney cancer e.g., nepliroblastoma a.k.a.
  • liver cancer e.g., hepatocellular cancer (HCC), malignant hepatoma
  • lung cancer e.g., bronchogenic carcinoma, small cell lung cancer (SCLC), non-small cell lung cancer (NSCLC), adenocarcinoma of the lung
  • leiomyosarcoma LMS
  • mastocytosis e.g., systemic mastocytosis
  • muscle cancer myelodysplastic syndrome (MDS);
  • MPD myeloproliferative disorder
  • PV polycythemia vera
  • ET essential thrombocytosis
  • ALM agnogenic myeloid metaplasia
  • myelofibrosis MF
  • chronic idiopathic myelofibrosis chronic myelocytic leukemia (CML), chronic neutrophilic leukemia (CNL), hypereosinophilic syndrome (HES)
  • neuroblastoma e.g., neurofibromatosis ( F) type 1 or type 2, schwannomatosis
  • neuroendocrine cancer e.g., gastroenteropancreatic neuroendocrine tumor (GEP- ET), carcinoid tumor
  • osteosarcoma e.g., bone cancer
  • ovarian cancer e.g., cystadenocarcmoma, ovarian embryonal carcinoma, ovarian adenocarcinoma
  • papillary adenocarcinoma pancreatic cancer
  • pancreatic cancer e.g., pancreatic adenocarcinoma, intraductal papillary mucinous neoplasm (IPMN), Islet cell tumors
  • hematological malignancy refers to tumors that affect blood, bone marrow, and/or lymph nodes.
  • exemplary hematological malignancies include, but are not limited to, leukemia, such as acute lymphoblastic leukemia (ALL) (e.g., B-cell ALL, T-cell ALL), acute myelocytic leukemia (AML) (e.g., B-cell AML, T-cell AML), chronic lymphoblastic leukemia (ALL) (e.g., B-cell ALL, T-cell ALL), acute myelocytic leukemia (AML) (e.g., B-cell AML, T-cell AML), chronic lymphoblastic leukemia (ALL) (e.g., B-cell ALL, T-cell ALL), acute myelocytic leukemia (AML) (e.g., B-cell AML, T-cell AML), chronic lymphoblastic leukemia (ALL) (e.g., B-cell ALL, T-cell ALL),
  • lymphoma such as Hodgkin lymphoma (HL) (e.g., B-cell HL, T-cell HL) and non-Hodgkin lymphoma (NHL) (e.g., B-cell NHL, such as diffuse large cell lymphoma (DLCL) (e.g., diffuse large B-cell lymphoma (DLBCL, e.g., activated B-cell (ABC) DLBCL (ABC-DLBCL))), follicular lymphoma, chronic lymphocytic leukemia/small lymphocytic lymphoma (CLL/SLL), mantle cell lymphoma (MCL), margmal zone B-cell lymphoma (e.g., mucos
  • T-cell NHL such as precursor T-lymphoblastic lymphoma leukemia, peripheral T-cell lymphoma (PTCL) (e.g., cutaneous T-cell lymphoma (CTCL) (e.g., mycosis fungoides, Sezary syndrome), angioimmunoblastic T-cell lymphoma, extranodal natural killer T-cell lymphoma, enteropathy type T-cell lymphoma, subcutaneous panniculitis-like T-cell lymphoma, and anaplastic large cell lymphoma); lymphoma of an immune privileged site (e.g., cerebral lymphoma, ocular lymphom
  • inflammatory disease refers to a disease caused by, resulting from, or resulting in inflammation.
  • inflammatory disease may also refer to a dysregulated inflammatory reaction that causes an exaggerated response by macrophages, granulocytes, and/or T-lymphocytes leading to abnormal tissue damage and/or cell death.
  • An inflammatory disease can be either an acute or chronic inflammator condition and can result from infections or non-infectious causes.
  • Inflammatory diseases include, without limitation, atherosclerosis, arteriosclerosis, autoimmune disorders, multiple sclerosis, systemic lupus erythematosus, polymyalgia rheumatica (PMR), gouty arthritis, degenerative arthritis, tendonitis, bursitis, psoriasis, cystic fibrosis, arthrosteitis, rheumatoid arthritis, inflammatory arthritis, Sjogren's syndrome, giant cell arteritis, progressive systemic sclerosis
  • scleroderma ankylosing spondylitis, polymyositis, dermatomyositis, pemphigus, pemphigoid, diabetes (e.g., Type I), myasthenia gravis, Hashimoto's thyroiditis, Graves' disease, Goodpasture's disease, mixed connective tissue disease, sclerosing cholangitis, inflammatory bowel disease, Crohn's disease, ulcerative colitis, pernicious anemia, inflammatory dermatoses, usual interstitial pneumonitis (UIP), asbestosis, silicosis, bronchiectasis, berylliosis, talcosis, pneumoconiosis, sarcoidosis, desquamative interstitial pneumonia, lymphoid interstitial pneumonia, giant cell interstitial pneumonia, cellular interstitial pneumonia, extrinsic allergic alveolitis, Wegener's granulomatosis and related forms of angiitis
  • chorioamnionitis conjunctivitis, dacrvoadenitis, beatomyositis, endocarditis, endometritis, enteritis, enterocolitis, epicondylitis, epididymitis, fasciitis, fibrositis, gastritis, gastroenteritis, gingivitis, ileitis, ulceris, laryngitis, myelitis, myocarditis, nephritis, omphalitis, oophoritis, orchitis, osteitis, otitis, pancreatitis, parotitis, pericarditis, pharyngitis, pleuritis, phlebitis, pneumonitis, proctitis, prostatitis, rhinitis, salpingitis, sinusitis, stomatitis, synovitis, testitis, tonsillitis, urethritis, urocystitis,
  • autoimmune disease refers to a disease arising from an inappropriate immune response of the body of a subject against substances and tissues normally present in the body. In other words, the immune system mistakes some part of the body as a pathogen and attacks its own cells. This may be restricted to certain organs (e.g., in autoimmune thyroiditis) or involve a particular tissue in different places (e.g., Goodpasture's disease which may affect the basement membrane in both the lung and kidney).
  • the treatment of autoimmune diseases is typically with immunosuppression, e.g. , medications which decrease the immune response.
  • autoimmune diseases include, but are not limited to, glomerulonephritis,
  • kinase is a class of enzyme that transfers a phosphate group from a high energy donor molecules, such as ATP, to a specific substrate, referred to as phosphorylation.
  • Kinases are part of the larger family of phosphotransferases.
  • One of the largest groups of kinases are protein kinases, which act on and modify the activity of specific proteins.
  • Kinases are used extensively to transmit signals and control complex processes in cells.
  • Various other kinases act on small molecules such as lipids, carbohydrates, amino acids, and nucleotides, either for signaling or to prime them for metabolic pathways.
  • Kinases are often named after their substrates. More than 500 different protein kinases have been identified in humans.
  • Exemplary human protein kinases include, but are not limited to, AAK1 , ABL, ACK, ACTR2, ACTR2B, AKT1, AKT2, AKT3, ALK, ALK1, ALK2, ALK4, ALK7, AMPKal, AMPKa2, A KRD3, ANPa, ANPb, ARAF, ARAFps, ARG, AurA, AurApsl, AurAps2, AurB, AurBpsl , AurC, AXL, BARK1 , BARK2, BIKE, BLK, BMPR1 A, BMPRlApsl , BMPR1 Aps2, BMPR1B, BMPR2, BMX, BRAF, BRAFps, BRK, BRSK1, BRSK2, BTK, BUB1, BUBR1, CaMKla, CaMKlb, CaMKld, CaMKlg, CaMK2a, CaMK2b, CaMK2d
  • PITSLRE PKACa, PKACb, PKACg, PKCa, PKCb, PKCd, PKCe, PKCg, PKCh, PKCi, PKCips, PKCt, PKCz, PKDl, PKD2, PKD3, PKG1, PKG2, PKN1, PKN2, PKN3, PKR, PLK1, PL lpsl, PLKlps2, PLK2, PLK3, PLK4, PRKX, PRKXps, PRKY, PRP4, PRP4ps, PRPK, PSKH1, PSKHlps, PSKH2, PYK2, QIK, QSK, RAF1, RAFlps, RET, RHOK, RIPK1, R1PK2, RIPK3, RNAseL, ROC 1, ROC 2, RON, ROR1, ROR2, ROS, RSKl, R.SK-I ,, RSI 2,, R.S .22 S ELSK3 ?
  • TSSKps2, TTBK1, TTBK2, TTK, TT TXK, TYK2, ⁇ 22, TYR03, TYR03ps, ULK1, ULK2, UL 3, UL 4, VACAMKL, VR l, VRK2, VRK3, VRK3ps, Weel, Weel B, WeelBps, Weelpsl, Weel ps2, Wnkl, Wnk2, Wnk3, Wnk4, YANK , YAN 2, YA.N 3, YES, YESps, YSK1, ZAK, ZAP 70, ZCl/HGK, ZC2/TNIK, ZC3/MINK, and ZC4/NRK.
  • SRC family kinase refers to a family of non-receptor tyrosine protein kinases that includes nine members: SRCA subfamily that includes c-SRC (proto-oncogene tyrosine-protein kinase SRC), YES (proto-oncogene tyrosine-protein kinase Yes), FYN (proto-oncogene tyrosine-protein kinase FYN), and FGR (Gardner-Rasheed feline sarcoma viral (v-FGR) oncogene homolog); SRCB subfamily that includes LCK (lymphocyte-specific protein tyrosine kinase), HCK (tyrosine-protein kinase HCK, hemopoietic cell kinase), BLK (tyrosine-protein kinase BLK), and LYN (tyrosine-protein kinase LYN); and
  • CDK refers to a cyclin-dependent kinase.
  • a CDK binds a cyclin (e.g., Cyclin H), which is a regulatory protein.
  • CDKs phosphorylate their substrates at serines and threonines.
  • the consensus sequence for the phosphorylation site in the amino acid sequence of a CDK substrate is [S/T*]PX[K/R], where S/T* is the phosphorylated serine or threonine, P is proline, X is any amino acid, K is lysine, and R is arginine.
  • CDKs include CDK1, CDK2, CDK3, CDK4, CDK5, CDK6, CDK?, CDK 8, CDK 9.
  • CDK7 cyclin-dependent Idnase 7, is a CDK, wherein the substrate is Cyclin H, MAT1 (e.g., MNAT1), or Cyclin H and MAT1.
  • CDK7 is alternatively referred to as CAK1 , HCAK, M015, STK1, CDKN7, and p39M015.
  • Non-limiting examples of the nucleotide and protein sequences for human CDK7 are described in GenBank Accession Number: NP 001790, incorporated herein by reference.
  • the amino acid sequence of this CDK7 is as follows:
  • CDK12 cyclin-dependent kinase 12
  • CD 12 is a CDK, wherein the substrate is Cyclin K or flavopiridol.
  • CD 12 is alternatively referred to as Cdc2-reiated kinase, CDC2 -related protein kinase 7, Cell division cycle 2-related protein kinase 7, Cell division protein kinase 12, CRK7, CRKR, CRKRS, cyclin-dependent kinase 12, or KIAA0904.
  • Non-limiting examples of the nucleotide and protein sequences for huma CDK 12 are described in Umprot Number: Q9NYV4, which is incorporated herein by reference. The amino acid sequence of this
  • CDK12 is as follows:
  • CDK 1 cyclin-dependent kinase 3
  • CDK 13 is alternatively referred to as CHED; CDC2L; CDC2L5; or hCDK13.
  • Non-limiting examples of the nucleotide and protein sequences for human CDK12 are described in GenBank Accession Number M80629, which is incorporated herein by reference. The amino acid sequence of this CDK13 is as follows:
  • CDKs Cyclin dependent kinases
  • Their successive activation and inactivation drives the cycle forward.
  • the activity of CDKs is regulated by multiple mechanisms such as positive and negative phosphorylation, binding of regulatory proteins like eyclins, and CDK inhibitors.
  • CD 7 plays a critical role in the regulation of RNA polymerase II-mediated transcription of protei -encoding genes.
  • CDK7, CDK12, and/or CDK 13 signaling causes defects in transcription.
  • the present invention provides selective CDK7, CDK12, and/or CDK! 3 inhibitors, which covalently modify a cysteine residue located outside of the canonical kinase domain (i.e., Cys312 of CDK7, Cysl039 of CDK12, and Cysl017 of CDK 13).
  • Selective covalent inhibitors of these kinases may be useful in the treatment of various proliferative diseases including cancer.
  • the present in vention provides compounds, which inhibit the activity of a kinase, for the prevention and/or treatment of a subject with a proliferative disease.
  • the inventive compounds inhibit the activity of a cyclin-dependent kinase (CDK).
  • the inventive compounds inhibit the activity of a cyclin-dependent kinase 7 (CDK7).
  • the inventive compounds inhibit the activity of a cyclin-dependent kinase 12 (CDK12).
  • the inventive compounds inhibit the activity of a cyclin-dependent kinase 13 (CDK13).
  • the present invention also provides methods of using the compounds described herein, e.g., as biological probes to study the inhibition of the activity of a kinase (e.g., CDK (e.g. CDK7, CDK12, and/or CDK13)), and as therapeutics, e.g., in the prevention and/or treatment of diseases associated with the overexpression and/or aberrant activity of a kinase (e.g., CDK (e.g.
  • the diseases are proliferative diseases.
  • the proliferative diseases that may be treated and/or prevented include, but are not limited to, cancers (e.g., breast cancer, leukemia, melanoma, multiple myeloma), benign neoplasms, diseases associated with angiogenesis, inflammator diseases, autoinflammatory diseases, and autoimmune diseases. Also provided by the present disclosure are cancers (e.g., breast cancer, leukemia, melanoma, multiple myeloma), benign neoplasms, diseases associated with angiogenesis, inflammator diseases, autoinflammatory diseases, and autoimmune diseases. Also provided by the present disclosure are cancers (e.g., breast cancer, leukemia, melanoma, multiple myeloma), benign neoplasms, diseases associated with angiogenesis, inflammator diseases, autoinflammatory diseases, and autoimmune diseases. Also provided by the present disclosure are cancers (e.g., breast cancer, leukemia, melanoma, multiple myelo
  • compositions, kits, methods, and uses including a compound of Formulae ( ⁇ ), (IT), (I), and (11) as described herein.
  • a compound described herein is a compound of any one of Formulae (!'), (IF), (I), (II), or a
  • a compound described herein is a compound of Formula ( ⁇ ), or a pharmaceutically acceptable salt thereof.
  • a compound described herein is a compound of Formula (I), or a pharmaceutically acceptable salt thereof.
  • a compound described herein is a compound of Formula (IT), or a pharmaceutically acceptable salt thereof.
  • a compound described herein is a compound of Formula (II), or a pharmaceutically acceptable salt thereof.
  • a compound described herein is of Formula ( ⁇ ):
  • R 1 is hydrogen, halogen, or optionally substituted alkyl
  • M is O, S, or NR M ;
  • R M is hydrogen, optionally substituted alkyl, optionally substituted aikenyi, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl , optionally substituted aeyl, or a nitrogen protecting group;
  • Ring A is optionally substituted monocyclic carbocyclyl, optionally substituted monocyclic heterocyclyl, optionally substituted phenyl, or optionally substituted monocyclic heteroaryl;
  • Ring B is optionally substituted monocyclic carbocyclyl, optionally substituted monocyclic heterocyclyl, optionally substituted phenyl, or optionally substituted monocyclic heteroaryl;
  • Ring C is optionally substituted monocyclic carbocyclyl, optionally substituted monocyclic heterocyclyl, optionally substituted monocyclic or bicyclic aryl, or optionally substituted monocyclic or bicyclic heteroaryl;
  • each instance of R A , R B , and R c is independently hydrogen, halogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl, -OR a , -N(R a ) 2 , -SR a , -CN, -SCN, -N0 2 , -N 3 , or optionally substituted acyl;
  • each instance of R a is independently hydrogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted acyl, a nitrogen protecting group when attached to a nitrogen atom, an oxygen protectmg group when attached to an oxygen atom, or a sulfur protecting group when attached to a sulfur atom, or two instances of R a are joined to form a substituted or un substituted, heterocyclic ring, or substituted or unsubstituted, heteroaryl ring; each of al , bl, and cl is independently 0, 1 , 2, 3, 4, 5, or 6, as valency permits;
  • X is xm -C 2 R 2 - xa , C! I C! i ⁇ , xm i 2 K i X "', xm -CH 2 -0-CH 2 - xa , xm C!
  • each of R Li , R L2 , and R LX is independently hydrogen, optionally substituted Ci_ alkyl, or a nitrogen protecting group;
  • R L a is hydrogen, optionally substituted Ci.g alkyl, or a nitrogen protecting group
  • each occurrence of R L3b is independently hydrogen, halogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyciyl, optionally substituted aryl, or optionally substituted heteroaryl, or two R Ljb groups are joined to form an optionally substituted carbocyclic or optionally
  • L 4 is a bond or an optionally substituted, branched or unbranched Ci-6 hydrocarbon chain; each of R ' , R “ , and R ' is independently hydrogen, halogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclvi, optionally substituted heterocvciyl, optionally substituted aryl, optionally substituted heteroaryl, -CN, -CH 2 OR EE , -CH 2 (R EE ) 2 , -CH 2 SR EE - OR EE , -N(R E ) 2 , -Si(R E ) 3 , and -SR EE , wherein each occurrence of R EE is
  • R El and R Ej , or R E2 and R E3 , or R E1 and R E2 are joined to form an optionally substituted carbocyelic or optionally substituted heterocyclic ring;
  • ll E4 is a leaving group
  • R Ej is halogen
  • R E6 is hydrogen, optionally substituted Ci-g alkyl, or a nitrogen protecting group
  • each instance of Y is independently O, S, or NR E/ , wherein R E ' is hydrogen, optionally substituted Cj_6 alkyl, or a nitrogen protecting group;
  • a is 1 or 2;
  • each instance of z is independently 0, 1, 2, 3, 4, 5, or 6, as valency permits.
  • a compound described herein is of Formula (I):
  • R 1 is hydrogen, halogen, or optionally substituted alkyl
  • M is O, S, or NR M ;
  • Ring A is optionally substituted monocyclic carbocyclyl, optionally substituted monocyclic heterocyclyl, optionally substituted phenyl, or optionally substituted monocyclic heteroaryl
  • Ring B is optionally substituted monocyclic carbocyclyl, optionally substituted monocyclic heterocyclyl, optionally substituted phenyl, or optionally substituted monocyclic heteroaryl
  • Ring C is optionally substituted monocyclic carbocyclyl, optionally substituted monocyclic heterocyclyl, optionally substituted phenyl, or optionally substituted monocyclic heteroaryl;
  • each instance of R A , R , and R is independently hydrogen, halogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl, -QR a , -N(R a ) 2 , -SR. 4 , -CN, -SCN, -N0 2 , -N 3 , or optionally substituted acyl;
  • each instance of R a is independently hydrogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted acyl, a nitrogen protecting group when attached to a nitrogen atom, an oxygen protecting group when attached to an oxygen atom, or a sulfur protecting group when attached to a sulfur atom, or two instances of R a are joined to form a substituted or unsubstituted, heterocyclic ring, or substituted or unsubstituted, heteroaryl ring; each of al, bl, and cl is independently 0, 1, 2, 3, 4, 5, or 6, as valency permits;
  • X is -0-, -S-, -NR LX -, xm O h Xi! , xm S O I; v ", or xm - R LX -CH 2 - xa ; wherein xa indicates the point of attachment is to Ring A; and xm indicates the point of attachment is to the heteroaryl ring with M;
  • each of R L ', R 1'2 , and R LX is independently hydrogen, optionally substituted Ci_e alkyl, or a nitrogen protecting group;
  • R 2 is any of Fonnulae (i-l)-(i-46):
  • R LJA is hydrogen, substituted or unsubstituted d-e alkyl, or a nitrogen protecting group
  • each occurrence of R L3D is independently hydrogen, halogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, or optionally substituted heteroaryl, or two R L3b groups are joined to form an optionally substituted carbocyclic or optionally substituted heterocyclic ring;
  • L 4 is a bond or an optionally substituted, branched or unbranclied Cj.6 hydrocarbon chain
  • each of R El , R t2 , and R B3 is independently hydrogen, halogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl, -CN, -CH 2 OR EE , -CH 2 (R EE ) 2 , -CH 2 SR E -OR EE , -N(R EE ) 2 , -Si(R EE ) 3 , and ⁇ SR EE , wherein each occurrence of R Et is independently hydrogen, optionally substituted alkyl, optionally substituted alkoxy, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, or optionally substituted heteroaryl, or two R Et groups are joined to form an optionally
  • R E4 is a leaving group
  • R E ' is halogen
  • R E6 is hydrogen, substituted or unsubstituted C ⁇ _ ⁇ 5 alkyl, or a nitrogen protecting group
  • each instance of Y is independently O, S, or NR E ', wherein R t? is hydrogen, substituted or unsubstituted C, _6 alkyl, or a nitrogen protecting group;
  • a is 1 or 2;
  • each instance of z is independently 0, 1 , 2, 3, 4, 5, or 6, as valency permits,
  • a com ound described herein is of Formula (IT):
  • R 1 is hydrogen, halogen, or optionally substituted alkyl
  • M is O, S, or NR M ;
  • R M is hydrogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl , optionally substituted acyl, or a nitrogen protecting group;
  • Ring A is optionally substituted monocyclic carbocyclyl, optionally substituted monocyclic heterocyclyi, optionally substituted phenyl, or optionally substituted monocyclic heteroaryl;
  • Ring B is optionally substituted monocyclic carbocyclyl, optionally substituted monocyclic heterocyclyi, optionally substituted phenyl, or optionally substituted monocyclic heteroaryl;
  • each instance of R a is independently hydrogen, optionally substituted acyl, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyi, optionally substituted aryl, optionally substituted heteroaryl, a nitrogen protecting group when attached to a nitrogen atom, an oxygen protecting group when attached to an oxygen atom, or a sulfur protecting group when attached to a sulfur atom, or two instances of R a are joined to form a substituted or unsubstituted, heterocyclic ring, or substituted or unsubstituted, heteroaryl ring;
  • each of al and bl is independently 0, 1, 2, 3, 4, 5, or 6, as valency permits;
  • X is a bond, -0-, -S-, -NR LX -, X,H O CI I, x:: , xm S Ci i, v ", or xm NR i C ⁇ ⁇ 2 xa : wherein xa indicates the point of attachment is to Ring A; and CTi indicates the point of attachment is to the heteroaryl ring with M;
  • each of l 1'2 and R LX is independently hydrogen, optionally substituted Ci_6 alkyl, or a nitrogen protecting group;
  • R' is any of Formulae (i-l)-(i- 1):
  • L 4 is a bond or an optionally substituted, branched or unbranched C e hydrocarbon chain; each of R E1 , R E2 , and R E3 is independently hydrogen, halogen, optionally substituted alkyl, optionally substituted alkeny], optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocvciyl, optionally substituted aryl, optionally substituted heteroaryl, -CN, -CH 2 OR EE , -CH 2 N(R ,- ,': ) 2 , -CH 2 SR E - OR EE , - (R EE ) 2 , -St(R EE ) 3 , and -SR EE , wherein each occurrence of R EE is
  • R El and R Ej , or R E2 and R E3 , or R Ei and R E2 are joined to form an optionally substituted carbocyclic or optionally substituted heterocyclic ring;
  • R E4 is a leaving group
  • R E5 is halogen
  • R E6 is hydrogen, optionally substituted Ci-g alkyl, or a nitrogen protecting group
  • each instance of Y is independently O, S, or NR E? , wherein R E? is hydrogen, optionally substituted C alkyl, or a nitrogen protecting group;
  • a is 1 or 2;
  • each instance of z is independently 0, 1, 2, 3, 4, 5, or 6, as valency permits.
  • R 1 is hydrogen, halogen, or optionally substituted alkyl
  • M is O, S, or NR M ;
  • acyl is hydrogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl , optionally substituted acyl, or a nitrogen protecting group;
  • Ring A is optionally substituted monocyclic carbocyclyl, optionally substituted monocyclic heterocyclyi, optionally substituted phenyl, or optionally substituted monocyclic heteroaryl;
  • Ring B is optionally substituted monocyclic carbocyclyl, optionally substituted monocyclic heterocyclyi, optionally substituted phenyl, or optionally substituted monocyclic heteroaryl;
  • each instance of R a is independently hydrogen, optionally substituted acyl, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyi, optionally substituted aryl, optionally substituted heteroaryl, a nitrogen protecting group when attached to a nitrogen atom, an oxygen protecting group when attached to an oxygen atom, or a sulfur protecting group when attached to a sulfur atom, or two instances of R a are joined to form a substituted or unsubstituted, heterocyclic ring, or substituted or unsubstituted, heteroaryl ring;
  • each of al and bl is independently 0, 1, 2, 3, 4, 5, or 6, as valency permits;
  • X is -0-, -S-, NR LX — , xm O h Xi! , xm S O I; v ", or xm - R LX -CH 2 - xa ; wherein xa indicates the point of attachment is to Ring A; and xm indicates the point of attachment is to the heteroaryl ring with M;
  • each of R L and R LX is independently hydrogen, optionally substituted C, _6 alkyl, or a nitrogen protecting group;
  • R 2 is any of Fonnulae (i-l)-(i-4
  • R Ljb is independently hydrogen, halogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, or optionally substituted heteroaryl, or two R 1'311 groups are joined to form an optionally substituted carbocyclic or optionally substituted heterocyclic ring;
  • L 4 is a bond or an optionally substituted, branched or unbranched Q.6 hydrocarbon chain
  • each of R E1 , R E2 , and R E3 is independently hydrogen, halogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl, -CN, -CH 2 OR EE , -CH 2 N(R EE ) 2 , -CH 2 SR EE , -OR EE , -N(R EE ) 2 , -Si(R EE ) 3 , and -SR EE , wherein each occurrence of R EE is independently hydrogen, optionally substituted alkyl, optionally substituted alkoxy, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, or optionally substituted heteroaryl, or two R EE groups are
  • R E1 and R E3 , or R E2 and R R ', or R Ei and R E2 are joined to form an optionally substituted carbocyclic or optionally substituted heterocyclic ring;
  • R E4 is a leaving group
  • R t:! is halogen
  • R E6 is hydrogen, substituted or unsubstituted C e alkyl, or a nitrogen protecting group
  • each instance of Y is independently O, S, or NR E ', wherein R E? is hydrogen, substituted or unsubstituted d ..(, alkyl, or a nitrogen protecting group;
  • a is 1 or 2;
  • each instance of z is independently 0, 1, 2, 3, 4, 5, or 6, as valency permits.
  • R ! is hydrogen, halogen, or optionally substituted alkyl.
  • R 1 is hydrogen, halogen, or optionally substituted alkyl.
  • R 1 is hydrogen.
  • R 1 is halogen.
  • R 1 is F.
  • R 1 is CI.
  • R 1 is Br.
  • R 1 is I.
  • R' is optionally substituted alkyl.
  • R ! is unsubstituted alkyl.
  • R l is unsubstituted Ci-ealkyl.
  • R 1 is methyl
  • R 1 is substituted alkyl.
  • R' is substituted C h alky!.
  • M is O.
  • M is S.
  • M is NR , wherein R M is as defined herein.
  • M is NFL
  • M is NR M , wherein R M is optionally substituted alkyl.
  • M is NR M , wherein R M is unsubstituted alkyl.
  • M is NCH 3 .
  • M is NAc.
  • Compounds of any one of Formulae ( ⁇ ), (IF), (I), and (II) include Ring A attached to linker X.
  • Compounds of any one of Formulae (I)-(H) include Ring A attached to linker X.
  • Ring A may be optionally substituted monocyclic carbocyclyl, optionally substituted monocyclic heterocyclyl, optionally substituted phenyl, or optionally substituted monocyclic heteroaiyl. In certain embodiments, Ring A is optionally substituted monocyclic carbocyclyl. In certain embodiments, Ring A is optionally substituted cyclohexyl. In certain embodiments, Ring A is optionally substituted monocyclic heterocyclyl.
  • Ring A is optionally substituted piperidinyl. In certain embodiments, Ring A is optionally substituted piperizinyl. In certain embodiments, Ring A is optionally substituted tetrahydropyranyl. In certain embodiments, Ring A is optionally substituted phenyl. In certain embodiments. Ring A is phenyl substituted with only X. In certain embodiments, Ring A is optionally substituted monocyclic heteroaiyl. In certain embodiments, Ring A is optionally substituted 5-membered heteroaiyl. In certain embodiments. Ring A is optionally substituted 6-membered heteroaryl. In certain embodiments, Ring A is optionally substituted pyridine. In certain embodiments, Ring A is optionally substituted pyrimidine.
  • Ring A is of Formula (x-i);
  • each of V i0 , V u , V 12 , V 13 , and V 14 is independently O, S, N, R AS , C, or CR ⁇ , as valency permits;
  • each instance of R A l is independently selected from the group consisting of hydrogen, substituted or unsubstituted acyl, substituted or unsubstituted alkyl, substituted or
  • R A2 is independently selected from the group consisting of hydrogen, halogen, substituted or unsubstituted acyl, substituted or unsubstituted alkyl, substituted or unsubstituted alkenyl, substituted or unsubstituted alkynyl, substituted or unsubstituted carbocyclyL substituted or unsubstituted heterocyclyl, substituted or unsubstituted aryi, substituted or unsubstituted heteroaryl, -CN, -OR A2a , -N(R A2a ) 2 , and -SR ⁇ 3 ; and
  • each occurrence of R A2a is independently selected from the group consisting of hydrogen, substituted or unsubstituted acyl, substituted or unsubstituted alkyl, substituted or unsubstituted alkenyl, substituted or unsubstituted alkynyl, substituted or unsubstituted carbocycly], substituted or unsubstituted heterocyclyl, substituted or unsubstituted aryl, substituted or unsubstituted heteroaryl, a nitrogen protecting group when attached to a nitrogen atom, an oxygen protecting group when attached to an oxygen atom, and a sulfur protecting group when attached to a sulfur atom, or two R A2a groups are joined to form a substituted or unsubstituted heterocyclic ring.
  • V i0 , V u , V 12 , V 13 , and V 14 is selected from the group consisting of O, S, N, Ring A is of the formula:
  • Ring A is of the formula
  • Ring A is of the formula:
  • V 10 , V' 1 , V !2 , V 13 , and V 14 are each independently selected from the group consisting of O, S, N, and NR A! .
  • Ring A is of the formula;
  • Ring A is of the formula:
  • Ring A is of Formula (x-ii):
  • Ri ng A is of the formula:
  • Ring A is of the formula:
  • Ring A is of the formula; R . In certain embodiment is of the formula: . In certain embodiments, Ring A is of the formula:
  • V i0 , V u , V' ⁇ V i3 , and V K are each independently selected from the group consisting of O, S, N, and NR A! .
  • Ring A is of the formula:
  • Ring A is of the formula:
  • V 10 , V 1 ', V 12 , V li , and V 14 are each independently selected from the group consisting of N and NR A1 .
  • Ring A is of the formula:
  • Ring A may also be a substituted or unsubstituted 6- membered heteroaryl ring.
  • Ring A is of the formula:
  • V 1 ", V", V 12 , V iJ , V 14 , and V 1S is independently N, C, or CR ⁇ , as valency permits, wherein R A2 is as defined herein, In certain embodiments, only one i 0 , V u , V 12 , V 1 V' 4 , and V !5 is N. In certain embodiments, Ring A is of the formula: , wherein k is 0, 1, 2, 3, or 4, and R * * is as defined herein. In certain
  • Ring A is of the formula:
  • V , V 1 , V , V J , V , and V are N.
  • I* 1 certain embodiments, only three of V 10 , V u , V
  • Ring A is of the formula:
  • R A and al are as defined herein.
  • a2 is 5; and Rgi is of the formula
  • Ring wherein R A and al are as defined here
  • al is 1; and Ring A is one of the fonnulae:
  • a2 is 5; and Rgi is of the formula
  • Ring A is optionally substituted monocyclic heterocyclyl. In certain embodiments, Ring A is optionally substituted 5-membered heterocyclyl. In certain embodiments, Ring A is optionally substituted 6-membered heterocyclyl. In certain embodiments, Ring A is optionally substituted 6-membered heterocyclyl with one heteroatom selected from the group of S, O, and N.
  • Ring A is of the formula:
  • H A is S, O, or NR HA ;
  • R HA is hydrogen, optionally substituted alkyl, or a nitrogen protecting group; and
  • R A and al are as defined herein.
  • Ring a
  • H A , R A and al are as defined herein.
  • Ring a
  • H A , R A and al are as defined herein.
  • H A is S. In certain embodiments, H A is O. In certain embodiments, H A is R HA . In certain embodiments, Ring
  • Ring A is of the formula:
  • R HA is hydrogen, optionally substituted alkyl, or a nitrogen protecting
  • Ring A is of the formula
  • R A is hydrogen. In certain embodiments, R A is halogen. In certain embodiments, R A is F. In certain embodiments, R A is CI. In certain embodiments, R A is Br. In certain embodiments, R A is I. In certain embodiments, R A is optionally substituted alkyl. In certain embodiments, R A is unsubstituted alkyl.
  • R A is methyl, ethyl, //-propyl, / ' -propyl, n-butyl, s-butyl, t-butyl, n-pentyl, -pentyl, neo-pentyl, i- pentyl, s-pentyl, or 3 -pentyl.
  • R A is /-butyl.
  • R A is substituted alkyl.
  • R A is haloalkyl.
  • R A is -CF 3 , -CHF 2 , or -CH 2 F.
  • R A is optionally substituted alkenyl. In certain embodiments, R A is optionally substituted alkynyl. In certain embodiments, R A is optionally carbocyclyl. In certain embodiments, R A is optionally substituted heterocyclyl. In certain embodiments, R A is optionally substituted aryl. In certain embodiments, R A is optionally substituted heteroaryl. In certain embodiments, R A is -OR a , wherein R a is as defined herein. In certain embodiments, R A is -OH. In certain embodiments, R A is -OR a , wherein R a is optionally substituted alkyl or an oxygen protecting group.
  • R A is -OR 3 , wherein R a is unsubstituted alkyl. In certain embodiments, R A is - OCH3. In certain embodiments, R A is -N(R a ) 2 , wherein R a is as defined herein. In certain embodiments, R A is -NH 2 . In certain embodiments, R A is -N(R ) 2 , wherein eacn instance of R a is optionally substituted alkyl or a nitrogen protecting group. In certain embodiments, R A is -N(CH 3 ) 2 . In certain embodiments, R A is -NHR a , wherein R a is optionally substituted alkyl or a nitrogen protecting group. In certain embodiments, R A is -NHCH3.
  • At least one instance of R Al is H (hydrogen). In certain embodiments, at least one instance of R Al is halogen. In certain embodiments, at least one instance of R Ai is F (fluorine). In certain embodiments, at least one instance of R Ai is CI (chlorine). In certain embodiments, at least one instance of R A1 is Br (bromine). In certain embodiments, at least one instance of R Ai is I (iodine). In certain embodiments, at least one instance of R Al is substituted acyl. In certain embodiments, at least one instance of R Al is unsubstituted acyl. In certain embodiments, at least one instance of R A l is acetyl.
  • At least one instance of R Al is substituted acetyl. In certain embodiments, at least one instance of R Al is substituted alkyl. In certain embodiments, at least one instance of R Ai is unsubstituted alkyl. In certain embodiments, at least one instance of R Al is Cs_6 alkyl. In certain embodiments, at least one instance of R A1 is methyl. In certain embodiments, at least one instance of R Al is ethyl. In certain embodiments, at least one instance of R Al is propyl. In certain embodiments, at least one instance of R Al is butyl. In certain embodiments, at least one instance of R Al is substituted alken l.
  • At least one instance of R A1 is unsubstituted alkenyl. In certain embodiments, at least one instance of R A1 is vinyl. In certain embodiments, at least one instance of R A! is substituted alkynyl. In certain embodiments, at least one instance of R Al is unsubstituted alkynyl. In certain embodiments, at least one instance of R A1 is ethynyl. In certain embodiments, at least one instance of R A1 is substituted carbocyclyi. In certain embodiments, at least one instance of R Ai is unsubstituted carbocyclyi. In certain embodiments, at least one instance of R Al is substituted heterocyclyl.
  • At least one instance of R Ai is unsubstituted heterocyclyl. In certain embodiments, at least one instance of R" 1 is substituted aryl. In certain embodiments, at least one instance of R A1 is unsubstituted aryl. In certain embodiments, at least one instance of R A! is substituted phenyl. In certain embodiments, at least one instance of R Al is unsubstituted phenyl. In certain embodiments, at least one instance of R A1 is substituted heteroaryl. In certain embodiments, at least one instance of R Al is unsubstituted heteroaryl. In certain embodiments, at least one instance of R Ai is substituted pyridyl. In certain embodiments, at least one instance of R Al is unsubstituted pyridyl. In certain embodiments, at least one instance of R is a nitrogen protecting group. In certain embodiments, at least one instance of R A1 is BOC.
  • At least one R AI is hydrogen, substituted or unsubstituted d- 6 alkyl, or a nitrogen protecting group.
  • all instances of R Al are each independently hydrogen, substituted or unsubstituted C ⁇ -6 alkyl, or a nitrogen protecting group.
  • all instances of R A! are hydrogen.
  • At least one R A2 is H. In certain embodiments, at least one R A2 is halogen. In certain embodiments, at least one R A2 is F. In certain embodiments, at least one R A2 is CI. In certain embodiments, at least one R A2 is Br. In certain embodiments, at least one R A2 is I (iodine). In certain embodiments, at least one R Ai is substituted acyl. In certain embodiments, at least one R A2 is unsubstituted acyl. In certain embodiments, at least one R A2 is acetyl. In certain embodiments, at least one R A is substituted acetyl. In certain
  • At least one R ⁇ is substituted alkyl. In certain embodiments, at least one R A2 is unsubstituted alkyl. In certain embodiments, at least one R* 2 is d-6 alkyl. In certain embodiments, at least one R A2 is methyl. In certain embodiments, at least one R A2 is ethyl. In certain embodiments, at least one R A2 is propyl. In certain embodiments, at least one R" is butyl. In certain embodiments, at least one R '42 is substituted alkenyl. In certain embodiments, at least one R A2 is unsubstituted alkenyl. In certain embodiments, at least one R A2 is vinyl.
  • At least one R A2 is substituted alkynyl. In certain embodiments, at least one R A2 is unsubstituted alkynyl. In certain embodiments, at least one R '42 is ethynyl. In certain embodiments, at least one R: 42 is substituted carbocyclyl. In certain embodiments, at least one A is unsubstituted carbocyclyl. In certain embodiments, at least one A is substituted heterocyclyl. In certain embodiments, at least one R j 2 is unsubstituted
  • At least one R A2 is substituted aryl. In certain embodiments, at least one R A2 is unsubstituted aryl. In certain embodiments, at least one R A2 is substituted phenyl. In certain embodiments, at least one R A2 is unsubstituted phenyl. In certain embodiments, at least one R A2 is substituted heteroaryl. In certain embodiments, at least one R A is unsubstituted heteroaryl. In certain embodiments, at least one R A is substituted pyridyl. In certain embodiments, at least one R A is unsubstituted pyridyl.
  • At least one R A2 is -OR A a , wherein R 4215 is as defined herein. In certain embodiments, at least one R "42 is -OR ⁇ 3 , wherein R A2a is hydrogen. In certain embodiments, at least one R A2 is -OR A2a , wherein R A a is substituted or unsubstituted d-6 alkyl. In certain embodiments, at least one R A2 is -OR '423 , wherein R A2a is unsubstituted Ci-6 alkyl. In certain embodiments, at least one is -OCH 3 . In certain embodiments, at least one R" is - N(R A a ) 2 . In certain embodiments, at least one R A2 is -SR* 23 . In certain embodiments, all instances of ,A' 2 are hydrogen,
  • R'" are hydrogen.
  • R is hydrogen; and at least one R A2 is substituted or unsubstituted alkyl.
  • R' is hydrogen; and at least one A A i 2 i ⁇ s unsubstituted alkyl.
  • R A1 is hydrogen; and at least one R Ai is methyl, ethyl, or n-propyl.
  • R Ai is hydrogen; and at least one R" is ⁇ OR a , wherein R A a is as defined herein.
  • R Ai is hydrogen; and at least one R A2 is-OR A2a , wherein R 1 is substituted or unsubstituted C alkyl.
  • R Al is hydrogen; and at least one R is-OR , ⁇ A"2 3 a, wherein R , A A2a is unsubstituted Ci R Al is hydrogen; and at least one R A2 is-OCH 3 .
  • Compounds of any one of Formulae ( ⁇ ), (IF), (I), and (II) include Ring B between linker L 1 and linker ⁇ .
  • Compounds of any one of Formulae ( ⁇ )-( ⁇ ) include Ring B between linker L l and linker L 2 .
  • Ring B may be optionally substituted monocyclic carbocyclyl, optionally substituted monocyclic heterocyclvl, optionally substituted phenyl, or optionally substituted monocyclic heteroaryl.
  • Ring B is optionally substituted monocyclic carbocyclyl.
  • Ring B is optionally substituted monocyclic heterocyclvl.
  • Ring B is optionally substituted pyrrolidinyl.
  • Ring B is optionally substituted phenyl. In certain embodiments, Ring B is optionally substituted monocyclic heteroaryl. In certain embodiments, Ring B is phenyl substituted with only L l and L 2 . In certain embodiments, Ring B is optionally substituted cyclohexyl. In certain embodiments, Ring B is optionally substituted piperidinyl. In certain embodiments, Ring B is optionally substituted piperizinyl. In certain embodiments. Ring B is optionally substituted pyridmyl. In certain embodiments. Ring B is optionally substituted pyrirnidinyl.
  • Ring B is
  • each ring atom is optionally substituted. In certain embodiment , wherein each ring atom is optionally
  • Ring B is or V , wherein each ring atom is optionally substituted, and L 1 and L may attach to Ring B at either indicated
  • Ring B is , wherein each ring atom is optionally substituted, and L and R may attach to Ring B at either indicated
  • Ring B is , wherein each ring atom is optionally substituted, and L and R 2 isattached to Ring B at either position indicated.
  • Ring B is , wherein each ring atom is optionally substituted, and L and L ' may attach to Ring B at either indicated
  • Ring B is , wherein each ring atom is optionally substituted, and L 1 and 1 may attach to Ring B at either indicated position.
  • Ring C between linker L l and R .
  • Ring C may be optionally substituted monocyclic carbocyclyl, optionally substituted monocyclic heterocyclvl, optionally substituted phenyl, or optionally substituted monocyclic heteroaryl.
  • Ring C is optionally substituted monocyclic carbocyclyl. in certain embodiments, Ring C is optionally substituted monocyclic heterocyclvl. In certain embodiments, Ring C is optionally substituted monocyclic aryl. In certain embodiments, Ring C is optionally substituted phenyl. In certain embodiments, Ring C is optionally substituted bicyclic aryl. In certain embodiments, Ring C is optionally substituted 2,3- dihydro-lH-indene. In certain embodiments, Ring C is optionally substituted naphthalene. In
  • Ring C is: . In certain embodiments,
  • Ring C is optionally substituted monocyclic heteroaryl. In certain embodiments, Ring C is phenyl substituted with only L 1 and R 2 . In certain embodiments, Ring C is optionally substituted cyclohexyl. In certain embodiments, Ring C is optionally substituted pyridinone. In certain
  • Ring C is: . In certain embodiments, Ring C is: . In certain embodiments, Ring C is: . In certain embodiments, Ring C is optionally substituted piperidinyl. In certain embodiments. Ring C is optionally substituted piperizinyl. In certain embodiments, Ring C is optionally substituted pyridinyl. In certain embodiments, Ring C is optionally substituted pyrimidinyl. In certain embodiments, Ring C is optionally substituted bicyclic heteroaryl. In certain smbodiments, Ring C is optionally substituted indoiyl. In certain embodiments, Ring C is
  • Ring C is: .
  • L ! is -CH 2 -.
  • L l is -0-.
  • L ! is -S-.
  • L 1 is -NR Li -.
  • l) is ⁇ -NR Ll -.
  • lb indicates the point of attachment is to Ring B; and k indicates the point of attachment is to Ring C.
  • R u is hydrogen.
  • R L! is optionally substituted Ci-g alkyl.
  • R Li is unsubstituted C ⁇ _6 alkyl.
  • R Li is methyl.
  • R L1 is substituted C alkyl.
  • R L1 is a nitrogen protecting group.
  • R L2 is hydrogen. In certain embodiments, R 1'2 is optionally substituted Ci.g alkyl. In certain embodiments, R L is unsubstituted Ci.g alkyl. In certain embodiments, R L2 is methyl. In certain embodiments, R L2 is substituted Ci-6 alkyl. In certain embodiments, R L2 is a nitrogen protecting group.
  • X is a bond. In certain embodiments, for Formula ( ⁇ ), X is " ""-CF ⁇ CF ⁇ -- ⁇ . In certain embodiments, for Formula ( ⁇ ), X is xm ⁇ CH - m . In certain embodiments, for Formula ( ⁇ ), X is *"* ⁇ CH 2 ⁇ -NR LX ⁇ :ra . In certain embodiments, for Formula (V), X is xm -CHr-NH- ' *", In certain embodiments, for Formula ( ⁇ ), X is xm -CH 2 -0-CH 2 - M .
  • X is xm I I n M i CH 2 - ra .
  • X is -0-.
  • X is -S-,
  • X is -NR L -
  • X is -O-CH2-.
  • X is -S-CH2-.
  • X is -NR LX -CH2-. In certain embodiments, X is -NH-CH 2 -.
  • al is 1. In certain embodiments, al is 2. In certain embodiments, al is 3.
  • bl is 1. In certain embodiments, bl is 2. In certain embodiments, bl is 3.
  • cl is 1. In certain embodiments, cl is 2. In certain embodiments, cl is 3.
  • R B is optionally substituted alkyl. In certain embodiments, R B is optionally substituted Ci-Ce alkyl. In certain embodiments, R B is unsubstituted C ⁇ -Ce alkyl. In certain embodiments, R B is methyl or ethyl. In certain embodiments, R B is substituted Q-Ce alkyl. In certain embodiments, R B is hydroxy C Cg alkyl. In certain embodiments, R B is -CH 2 OH. In certain embodiments, R B is -CH 2 CH 2 OH. In certain embodiments, R B is -N(R a ) 2 , wherein R a is as defined herein.
  • R B is - NHR a , wherein R a is as defined herein. In certain embodiments, R B is -NHR a , wherein R a is hydrogen or optionally substituted Ci-Cg alkyl. In certain embodiments, R B is -NH 2 . In certain embodiments, R B is -NHR a , wherem R a is optionally substituted C ⁇ ⁇ Ce alkyl. In certain embodiments, R B is -NHR a , wherem R a is unsubstituted CpCe alkyl. In certain embodiments, R B is -NHR 8 , wherein R a is methyl or ethyl.
  • R B is - NHCH3. In certain embodiments, R B is -NHR a , wherein R a is a nitrogen protecting group. In certain embodiments, R B is -N(CH 3 )R a , wherein R a is optionally substituted Ci-Cg alkyl. In certain embodiments, R B is -N(CH 3 )R a , wherein R 3 is unsubstituted Q-C6 alkyl. In certain embodiments, R B is -N(CH 3 )R a , wherein R a is methyl or ethyl. In certain embodiments, R B is -N(CH 3 )2. In certain embodiments, R is - N(CH 3 )R a , wherein R a is a nitrogen protecting group.
  • R c is optionally substituted alkyl. In certain embodiments, R c is optionally substituted Ci-Cg alkyl. In certain embodiments, R c is unsubstituted Q-Ce alkyl. In certain embodiments, R is methyl or ethyl. In certain embodiments, R c is substituted Ci-Ce alkyl. In certain embodiments, R c is hydroxy Ci-Cf, alkyl. In certain embodiments, R c is -CH 2 OH. In certain embodiments, R c is -CH2CH2OH. In certain embodiments, R c is -N(R a )2, wherein R a is as defined herein.
  • R c is - NHR a , wherein R a is as defined herein. In certain embodiments, R c is -NHR a , wherem R a is hydrogen or optionally substituted Ci-C alkyl. In certain embodiments, R c is -N3 ⁇ 4. In certain embodiments, R c is -NHR a , wherein R a is optionally substituted CrC alkyl. In certain embodiments, R c is -NHR a , wherein R a is unsubstituted CpCe alkyl. in certain embodiments, R c is -NHR a , wherein R a is methyl or ethyl.
  • R c is - M ICH.:. In certain embodiments, R c is ⁇ NHR a , wherein R a is a nitrogen protecting group. In certain embodiments, R c is -N(CH 3 )R a , wherein R a is optionally substituted Q-C alkyl. In certain embodiments, R c is -N(CH 3 )R a , wherein R a is unsubstituted C-. -C alkyl. In certain embodiments, R c is -N(CH 3 )R a , wherein R a is methyl or ethyl. In certain embodiments, R c is -N(CH 3 ) 2 . In certain embodiments, R c is - N(CH 3 )R a , wherein R a is a nitrogen protecting group.
  • Compounds of Formula (I 1 ) include R attached to Ring C.
  • Compounds of Formula (I) include R 2 attached to Ring C.
  • Compounds of Formula (I) include R 2 attached to Ring B.
  • Compounds of Formula ( ⁇ ) include R 2 attached to Ring B.
  • R 2 comprises an eiectrophilic moiety.
  • R 2 comprises a Michael acceptor moiety.
  • the eiectrophilic moiety may react with a cysteine residue of a kinase (e.g., CDK (e.g., CDK7)) to allow for covalent attachment of the compound to the kinase.
  • a kinase e.g., CDK (e.g., CDK7)
  • the eiectrophilic moiety may react with a cysteine residue of a kinase (e.g., CDK (e.g., CDK7)). In certain embodiments, the eiectrophilic moiety (e.g., Michael acceptor moiety) may react with the Cys312 residue of CDK7.
  • the covalent attachment is irreversible. In certain embodiments, the covalent attachment is reversible.
  • R 2 may be any one
  • R 2 is of Formula (i-1): 0-1) ⁇ In
  • R 1 is of Formula (i-2): (I ⁇ 2).
  • R 2 is of Formula (i-2): (I ⁇ 2).
  • R 2 is of Formula (i-3): (i-3). In certain embodiments, R 2 is of Formula (i- ): (1-4). In certain embodiments, R 2 is of Formula (i-5): N (i-5). In certain embodiments, R 2 is
  • R 2 is of Formula (i-7) (1-7).
  • R is of Formula (i-8): In certain embodiments, is of Formula i-9 : R L4 i-9 . In certain embodiments, R 2 is of
  • R ' is of Formula (1-12): (i-12).
  • R * is of Formula 1-14 : i-14 .
  • R z is of Fonnula i-15) (i-15),
  • R is of Formula (1-16): certain embodiments, R " is of Formula (i-17): (i-17).
  • R' is of Formula (1-19): (i-20).
  • 2 is of Formula (i-21): (i-21).
  • R is of (i-23).
  • R is of Formula (1-24):
  • R ' is of Form (i-25). In certain embodiments, is of Formula (i-26): (i-26). In certain embodiments, R is of (1-28). in certain embodiments, R is of Formula (i-29):
  • R z is of Formul a (i-31): (i-31).
  • R z is of
  • R 2 is of Formula (1-33):
  • R 2 is of Formula (1-35): (1-35). In certain embodiments, R 2
  • R ' is of Formula (1-37):
  • R is of Formula (i-39): ? (i-39). In certain embodiments, R A L '
  • R 2 is of Fonnula (i-la): (i-la).
  • R is of Formula (i ⁇ lb): R 3 (i-lb). In certain embodiments, 2
  • R 2 is of Formula (i-ld):
  • R is of Formula (i-le): (! ⁇ 1 ⁇ ).
  • is of Formula (i-lf): (i-lf).
  • R" is of
  • R? is of Formula i-lh : i-lh. In certain embodiments, R is In certain embodiments, R is of Formula (i-la): (i-la). In certain mbodiments, R " is of Formula (i-l ): (i-lb). In certain embodiments, R z is of
  • R is of Formula (i-18a): (i-18a).
  • R is of Formula i-18b : i-18b .
  • R is of Formula i-18b : i-18b .
  • R is of Formula i-18b : i-18b .
  • R 1 is of Formula (i-15a): (i-15a).
  • R" is of Formula i-15b): (i-15b). In certain embodiments, R is
  • R 2 may contain linker L J or L 4 .
  • L 3 is a bond.
  • L 3 is an optionally substituted Q.4 hydrocarbon chain.
  • L 3 is an optionally substituted Q -4 hydrocarbon chain, wherem one carbon unit of the hydrocarbon chain is replaced with -NR L3a - (e.g., -NH-).
  • L 3 is of the formula: -(CH 2 )!- 4 - R L3a - (e.g., -(CH 2 )i-4-NH-) or -K R 1 3 ⁇ 4 '-C ! i 2 )i 4 ⁇ (e.g. , -NH-C]3 ⁇ 4)i-4-).
  • L 3 is -NR L3a -.
  • Linker L 3 may contain groups R Lja or R Ljb .
  • R L3a is hydrogen.
  • at least one instance of R L3b is hydrogen.
  • each instance of R L3b is hydrogen.
  • at least one instance of R L3b is -CI, -Br, or -I.
  • each instance of R L3b is -CI, -Br, or -I.
  • at least one instance of R L3b is -F.
  • each instance of R L3b is -F, In certain embodiments, at least one instance of R L3 is optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, or optionally substituted heteroaryl. In certain embodiments, two R L3 ° groups are joined to form an optionally substituted carbocyclic or optionally substituted heterocyclic ring.
  • R may contain groups R Ei , R E2 , and/or R E3 ,
  • R E1 is hydrogen.
  • R E2 is hydrogen.
  • R E3 is hydrogen.
  • R El is -CI, -Br, or -L
  • R E2 is -CI, -Br, or -L
  • R E3 is -CI, -Br, or -I.
  • R Ei is -F.
  • R B2 is -F.
  • R Ej is ⁇ F.
  • R E1 is optionally substituted alkyl (e.g.
  • R E2 is optionally substituted alkyl (e.g. , substituted or unsubstituted C e alkyl).
  • R t3 is optionally substituted alkyl (e.g., substituted or unsubstituted Ci-6 alkyl).
  • R El is optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl, -CN, -CI3 ⁇ 4OR EE , -CH 2 N(R EE ) 2 , - CH 2 SR EE , -OR EE , -N(R EE ) 2 , -Si(R EE ) 3 , or -SR E .
  • R E2 is optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl, -CN, -CH 2 OR EE , -CH 2 N(R EE ) 2 , -CH 2 SR EE , -ORTM, -N(R EE ) 2 , -St(R EE ) 3 , or -SR EE .
  • R Ej is optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl, -CN, -CH 2 OR EE , -CH 2 N(R EE ) 2 , -CH 2 SR EE , -OR EE , - N(R EE ) 2 , -Si(R EE ) 3 , or -SR EE .
  • R Ei is -N(R EE ) 2 .
  • R is -N(R ) 2 . In certain embodiments, R is ⁇ N(R ) 2 . In certain embodiments, R E1 is - ⁇ (03 ⁇ 4) 2 . In certain embodiments, R Ei is -N(CH3) 2 . In certain embodiments, R Ej is -N(CH 3 ) 2 . In certain embodiments, R El is -CH 2 N(R EE ) 2 . In certain embodiments, R E2 is - CH 2 N(R EE ) 2 . In certain embodiments, R E3 is - CH 2 N(R EE ) 2 . In certain embodiments, R Ei is - CH 2 N(CH 3 ) 2 .
  • R E2 is - CH 2 N(CH 3 ) 2 .
  • R F'3 is - 0 ⁇ 2 ⁇ ( ⁇ 1 ⁇ 4) 2 .
  • R El is -CN.
  • R E2 is -CN.
  • R E3 is -CN.
  • R Ei and R E3 are joined to form an optionally substituted carbocyclic ring.
  • R El and R E3 are joined to form a optionally substituted heterocyclic ring.
  • R E2 and R E3 are joined to form an optionally substituted carbocyclic ring.
  • R E2 and R Ej are joined to form an optionally substituted heterocyclic ring.
  • R El and R E2 are joined to form a optionally substituted carbocyclic ring.
  • R El and R E2 are joined to form an optionally substituted heterocyclic ring.
  • R may contain group R E4 , where R E4 is a leaving group.
  • R 1'4 is -CI, -Br, or -I.
  • R 1'4 is -F.
  • R 2 may contain group R E5 , where R E5 is a halogen.
  • R E5 is - CI, -Br, or -I.
  • R E5 is -F.
  • R may contain group R Et> .
  • R E6 is hydrogen.
  • R Eo is substituted or unsubstituted CpCg alkyl.
  • R E6 is a nitrogen protecting group.
  • a is 1. In certain embodiments, a is 2.
  • z is 0. In certain embodiments, z is 1. In certain embodiments, z is 2. In certain embodiments, z is 3, 4, 5, or 6. [00186! R ma " contain group Y. In certain embodiments, Y is O. In certain embodiments, Y is S. In certain embodiments, Y is NR E '. In certain embodiments, Y is NH.In certain embodiments, a compound of Formula ( ⁇ ) is of Formula (I).
  • the compound of Formula (I) is the formula :
  • the compound of Formula (I) is the formula:
  • the compound of Formula (I) is the formula:
  • a compound of Formula (I) is of Formula (I-i):
  • L 1 , L 2 , X, Ring A, Ring C, R ! , R 2 , R A , R B , R , al, bl, and el are as defined herein.
  • a compound of Formula (1) is of Formula (I-ii):
  • Ring C, R ! , R 2 , R A , R , R c , al, bl, and cl are as defined herein.
  • a compound of Formula (1) is of Formula (I-ii-a):
  • a compound of Formula (I) is of the formula:
  • a compound of Formula (I) is of the formula:
  • L 1 , L, 2 , X, R l , R ⁇ R A , R B , R C , al, bl, and cl are as defined herein.
  • a compound of Formula (I) is of the formula:
  • L 1 , L, 2 , X, R l , R ⁇ R A , R B , R C , al, bl, and cl are as defined herein.
  • a compound of Formula (I) is of the form ula:
  • a compound of Formula (I) is of the form ula:
  • L 1 , L, 2 , X, R l , R ⁇ R A , R B , R C , al, bl, and cl are as defined herein.
  • a compound of Formula (I) is of the form ula:
  • a compound of Formula (I) is of Formula (I-
  • a compound of Formula (I) is of the form ula:
  • a compound of Formula (1) is of Formula (I-ii-c):
  • a compound of Formula (I) is of the formula:
  • L 1 , L 2 , X, R l , R ⁇ R A , R B , R C , al, bl, and cl are as defined herein.
  • a compound of Formula (I) is of Formula (I-iii):
  • a compound of Formula (I) is of Formula (I-
  • L l , L 2 , X, Ring A, Ring C, R ! , R , R A , R , R c , al, bl , and cl are as defined herein.
  • a compound of Formula (I) is of Formula (I ⁇ iv-a):
  • a compound of Formula (I) is of the formula:
  • a compound of Formula (I) is of Formula (I-iv-b):
  • a compound of Formula (I) is of the form ula:
  • L 1 , L 2 , X, R 1 , R , R A , R B , R c , al, bl , and cl are as defined herein.
  • a compound of Formula (I) is of Formula (I-v):
  • a compound of Formula (I) is of Formula (I-v-a):
  • a compound of Formula (1) is of the form ula:
  • a compound of Formula (1) is of Formula (I-v-b):
  • a compound of Formula (I) is of the formula:
  • L 1 , L, 2 , X, R l , R R A , R B , R C , al, bl, and cl are as defined herein.
  • a compound of Formula ( ⁇ ') is of of Formula (I'-A):
  • L l , L 2 , X, Ring A, R 1 , R 2 , R A , R B , R c , al, bl, and cl are as defined herein,
  • a com ound of Formula ( ⁇ ) is of the formula:
  • L 1 , L 2 , X, R 1 , R , R A , R B , R c , bl, and cl are as defined herein.
  • a compound of Formula (1 ? ) is of of of Formula (l'-i):
  • L 1 , L 2 , X, Ring A, R l , R 2 , R A , R B , R c , al , bl, and cl are as defined herein,
  • a compound of Formula ( ⁇ ) is of of Formula (I'-ii):
  • L 1 , L 2 , X, Ring A, l l , R 2 , R A , R B , R c , al , bl, and cl are as defined herein.
  • a compound of Formula ( ⁇ ) is of of Formula (I'-ili)
  • a compound of Formula ( ⁇ ') is of the formula
  • L l , L 2 , X, R ! , R 2 , R A , R B , R c , bi , and cl are as defined herein.
  • a compound of Formula (II') is of Formula (II),
  • the compound of Formula (II) is the formula:
  • the compound of Formula (II) is the formula:
  • the compound of Formula (II) is the formula:
  • a compound of Formula (II) is of Formula (Il-i):
  • a compound of Formula (II) is of the formula:
  • a compound of Formula (II) is of the formula:
  • a compound of Formula ( ⁇ ) is of Formula (II' ⁇ i):
  • the compound of Formula ( ⁇ ) is of the formula:
  • a compound of Formula (II) is of Formula (Il-i!):
  • a compound of Formula (II) is of the formula:
  • a compound of Formula (II) is of the formula:
  • a compound of Formula (II) is of Formula (II-iii):
  • a compound of Formula (II) is of the formula:
  • a compound of Formula (II) is of the formula:
  • a compound of Formula ( ⁇ ) is of the formula:
  • a compound of Formula (I) is of the formula:
  • a compound of Formula ( ⁇ ) is of the formula:
  • a compound of Formula (II 1 ) is of the formula:
  • a compound of Formula (II) is of the formula:
  • compositions described herein may be useful in treating and/or preventing proliferative diseases (e.g., cancers (e.g., leukemia, acute lymphoblastic leukemia, lymphoma, Burkitt's lymphoma, melanoma, multiple myeloma, breast cancer, Ewing's sarcoma, osteosarcoma, brain cancer, neuroblastoma, lung cancer, colorectal cancer), benign neoplasms, diseases associated with angiogenesis, inflammatory diseases, autoinflammatory diseases, and autoimmune diseases) in a subject.
  • cancers e.g., leukemia, acute lymphoblastic leukemia, lymphoma, Burkitt's lymphoma, melanoma, multiple myeloma, breast cancer, Ewing's sarcoma, osteosarcoma, brain cancer, neuroblastoma, lung cancer, colorectal cancer
  • benign neoplasms e.g., diseases associated with angio
  • compositions described herein may also be useful for inhibiting the activity of a protein kinase (e.g., CDK (e.g., CD 7, CDK12, and/or CDK13)) in a subject, biological sample, tissue, or cell.
  • a protein kinase e.g., CDK (e.g., CD 7, CDK12, and/or CDK13)
  • the compositions described herein may also be useful for inducing apoptosis in a cell.
  • compositions comprising a compound described herein (e.g., a compound of any one of Formulae (V), (IT), (I), (II), , or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, and optionally a pharmaceutically acceptable excipient.
  • the pharmaceutical composition of the invention comprises a compound described herein, or a pharmaceutically acceptable salt thereof, and optionally a pharmaceutically acceptable excipient.
  • a pharmaceutical composition described herein comprises a compound described herein, or a pharmaceutically acceptable salt thereof, and a pharmaceutically acceptable excipient.
  • stereoisomer, isotopically labeled derivative, or prodrug thereof is provided in an effective amount in the pharmaceutical composition.
  • the effective amount is a therapeutically effective amount (e.g., amount effective for treating a proliferative disease in a subject in need thereof).
  • the effective amount is an amount effective for inhibiting the activity of a protein kinase (e.g., CDK (e.g., CDK.7, CDK12, and/or CDK 13)) in a subject in need thereof.
  • the effective amount is an amount effective for inhibiting the activity of a protem kinase (e.g., CDK (e.g., CDK7, CDK12, and/or CDK13)) in a cell.
  • the effective amount is an amount effective for inducing apoptosis in a cell. In certain embodiments, the effective amount is a prophylactically effective amount (e.g., amount effective for preventing a proliferative disease in a subject in need thereof and/or for keeping a subject in need thereof in remission of a proliferative disease).
  • the protein kinase being inhibited is a CDK.
  • the protem kinase being inhibited is CDK1, CD 2, CDK3, CDK4, CDK5, CDK6, CDK7, CDK8, CDK9, CDK10, CDK1 1, CDK12, CDK13, CDK14, CDK15, CDK16, CDK17, CDK18, CDK19, or CDK20.
  • the protein kinase being inhibited is CDK7.
  • the protem kinase being mhibited is CDK12.
  • the protein kinase being inhibited is CDK13.
  • the protein kinase being inhibited is a Src family kinase. In certain embodiments, the protein kinase being inhibited is SRC. In certain embodiments, the protein kinase being inhibited is FGR. In certain embodiments, the protein kinase being inhibited is BUB IB. In certain embodiments, the protein kinase being inhibited is CHEK2. In certain embodiments, the protein kinase being inhibited is HIPK4. In certain embodiments, the protein kinase being inhibited is PRKCQ. in certain embodiments, the protein kinase being inhibited is RET.
  • the protein kinase being inhibited is MELK. In certain embodiments, the protein kinase being inhibited is IRAKI, IRAK4, BMX, or PI3K. In certain embodiments, the protem kinase being inhibited is ABL, ARG, BLK, CSK, EphB l, EphB2, FGR, FRK, FYN, SRC, YES, LCK, LYN, MAP2K5, NLK, p38a, SNRK, or TEC. In certain
  • the protein kinase being inhibited is ABL1 (H396P)-phosphorylated, ABL1 - phosphorylated, BLK, EPHA4, EPHB2, EPHB3, EPHB4, PGR, JAK3(JH1 domain-catalytic), KIT, K1T(L576P), KIT(V559D), PDGFRB, SRC, YES, ABLl(H396P)-nonphosphorylated, ABLl(Y253F)-phosphorylated, ABL1 -nonphosphorylated, FRK, LYN, ABL1(Q252H)- nanphosphor lated, DDR1 , EPHB1 , ERBB4, p38-alpha, ABL2, ABL1 (Q252H)- phosphorylated, SIK, EPHA8, MEK5, ABLl(E255K)-phosphorylated, ABL1(F317L) ⁇ nonphosphor lated, FYN, LCK, EPHA2,
  • the protein Idnase being inhibited is ABLl (F317L)-nonphosphorylated, ABL1 (H396P)-nonphosphorylated, ABL1 (H396P)-phosphorylated, ABL1 -phosphorylated, BLK, EPHA4, EPHB2, EPHB3, EPHB4, K3(j i !
  • KIT KIT(L576P), K1T(V559D), LYN, PDGFRB, SRC, YES, ABL 1 -nonphosphorylated, ABL1(Y253F)- phosphorylated, ERBB3, FGR, FRK, p38-alpha, ABL ' l(F317I)-nonphosphorylated, DDRl , EPHA2, ABLl(Q252H) ⁇ phosphorylated, MEK5, ABLl(Q252H)-nonphosphoiylated, ABL2, FYN, EPHB1, ABLl(E255K phosphoryiated, ABLl(F317L)-phosphoiyiated, EPHAl, ABLl(M351T)-phosphoiylated, ERBB4, TXK, LCK, EPHA8, SIK, EPHA5, EGFR(L861Q), CSFl R-autoinhibited, BRAF(V600E),
  • the effective amount is an amount effective for inhibiting the activity of a protein Idnase (e.g., CDK (e.g., CDK7, CDK12, and/or CDK13)) by at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, or at least about 98%.
  • a protein Idnase e.g., CDK (e.g., CDK7, CDK12, and/or CDK13)
  • the effective amount is an amount effective for inhibiting the activity of a protein kinase (e.g., CDK (e.g., CDK7, CDK12, and/or CDK13)) by not more than 10%, not more than 20%, not more than 30%, not more than 40%, not more than 50%, not more than 60%, not more than 70%, not more than 80%, not more than 90%, not more than 95%, or not more than 98%.
  • a protein kinase e.g., CDK (e.g., CDK7, CDK12, and/or CDK13)
  • CDK protein kinase
  • the effective amount is an amount effective for inhibiting the activity of a protein kinase (e.g., CDK (e.g., CDK7, CDK12, and/or CDK13)) by a range between a percentage described in this paragraph and another percentage described in this paragraph, inclusive.
  • a protein kinase e.g., CDK (e.g., CDK7, CDK12, and/or CDK13)
  • CDK protein kinase
  • CDK e.g., CDK7, CDK12, and/or CDK13
  • CDK protein kinase
  • compositions can be prepared, packaged, and/or sold in bulk, as a single unit dose, and/or as a plurality of single unit doses.
  • a "unit dose” is a discrete amount of the pharmaceutical composition comprising a predetermined amount of the active ingredient.
  • the amount of the active ingredient is generally equal to the dosage of the active ingredient which would be administered to a subject and/or a convenient fraction of such a dosage, such as one-half or one -third of such a dosage,
  • compositions described herein will vary, depending upon the identity, size, and'or condition of the subject treated and further depending upon the route by which the composition is to be administered.
  • the composition may comprise between about 0.1% and about 100% (w/w) of the active ingredient.
  • compositions used in the manufacture of provided pharmaceutical compositions include inert diluents, dispersing and/or granulating agents, surface active agents and'or emulsiiiers, disintegrating agents, binding agents, preservatives, buffering agents, lubricating agents, and/or oils. Excipients such as cocoa butter and suppository waxes, coloring agents, coating agents, sweetening, flavoring, and perfuming agents may also be present in the composition.
  • Exemplar ⁇ ' diluents include calcium carbonate, sodium carbonate, calcium phosphate, dicalcium phosphate, calcium sulfate, calcium hydrogen phosphate, sodium phosphate lactose, sucrose, cellulose, microcrystalline cellulose, kaolin, mannitol, sorbitol, inositol, sodium chloride, dry starch, cornstarch, powdered sugar, and mixtures thereof.
  • Exemplary granulating and/or dispersing agents include potato starch, com starch, tapioca starch, sodium starch glycolate, clays, alginic acid, guar gum, citrus pulp, agar, bentonite, cellulose, and wood products, natural sponge, cation-exchange resins, calcium carbonate, silicates, sodium carbonate, cross-linked poly(vinyl-pyrrolidone) (crospovidone), sodium carboxymethyl starch (sodium starch glycolate), carboxymethyl cellulose, cross- linked sodium carboxymethyl cellulose (croscarmellose), methylcellulose, pregelatinized starch (starch 1500), microcrystalline starch, water insoluble starch, calcium carboxymethyl cellulose, magnesium aluminum silicate (Veegum), sodium lauryl sulfate, quaternary ammonium compounds, and mixtures thereof.
  • crospovidone cross-linked poly(vinyl-pyrrolidone)
  • sodium carboxymethyl starch sodium starch glycolate
  • Exemplary surface active agents and/or emulsifiers include natural emulsifiers (e.g., acacia, agar, alginic acid, sodium alginate, tragacantli, chondrux, cholesterol, xanthan, pectin, gelatin, egg yolk, casein, wool fat, cholesterol, wax, and lecithin), colloidal clays (e.g., bentonite (aluminum silicate) and Veegum (magnesium aluminum silicate)), long chain amino acid derivatives, high molecular weight alcohols (e.g.
  • natural emulsifiers e.g., acacia, agar, alginic acid, sodium alginate, tragacantli, chondrux, cholesterol, xanthan, pectin, gelatin, egg yolk, casein, wool fat, cholesterol, wax, and lecithin
  • colloidal clays e.g., bentonite (aluminum silicate
  • stearyl alcohol cetyl alcohol, oleyl alcohol, triacetin monostearate, ethylene glycol distearate, glyceryl monostearate, and propylene glycol monostearate, polyvinyl alcohol
  • carbomers e.g., carboxy polymethylene, polyacrylic acid, acrylic acid polymer, and carboxyvrnyl polymer
  • carrageenan cellulosic derivatives (e.g., carboxymethylcellulose sodium, powdered cellulose, hydroxymethyl cellulose, hydroxypropyl cellulose, hydroxypropyl methylcellulose, methylcellulose), sorbitan fatty acid esters (e.g., polyoxyethylene sorbitan monolaurate (Tween ® 20), polyoxyethylene sorbitan (Tween ® 60), polyoxyethylene sorbitan monooleate (Tween ® 80), sorbitan monopalmitate (Span ® 40), sorbitan monostearate (Span ® 60), sorbit
  • Exemplar ' binding agents include starch (e.g., cornstarch and starch paste), gelatin, sugars (e.g., sucrose, glucose, dextrose, dextrin, molasses, lactose, lactitol, mannitol, etc.), natural and synthetic gums (e.g., acacia, sodium alginate, extract of Irish moss, panwar gum, ghatti gum, mucilage of isapol husks, carboxymethylcellulose, methylcellulose,
  • methylcellulose methylcellulose, microcrystalline cellulose, cellulose acetate, poly(vinyl-pyrrolidone), magnesium aluminum silicate (Veegum ® ), and larch arabogalactan), alginates, polyethylene oxide, polyethylene glycol, inorganic calcium salts, silicic acid, polymethacrylates, waxes, water, alcohol, and/or mixtures thereof.
  • Exemplary preservatives include antioxidants, chelating agents, antimicrobial preservatives, antifungal preservatives, antiprotozoan preservatives, alcohol preservati es, acidic preservatives, and other preservatives.
  • the preservative is an antioxidant.
  • the preservative is a chelating agent.
  • antioxidants include alpha tocopherol, ascorbic acid, ascorbyl palmitate, butylated hydroxyanisole, butylated hydroxytoluene, monot iogiycerol, potassium
  • metabisulfite propionic acid, propyl gallate, sodium ascorbate, sodium bisulfite, sodium metabisulfite, and sodium sulfite.
  • Exemplary chelating agents include emylenediamrnetetraacetic acid (EDTA) and salts and hydrates thereof (e.g., sodium edetate, disodium edetate, trisodium edetate, calcium disodium edetate, dipotassium edetate, and the like), citric acid and salts and hydrates thereof (e.g., citric acid monohydrate), fumaric acid and salts and hydrates thereof, malic acid and salts and hydrates thereof, phosphoric acid and salts and hydrates thereof, and tartaric acid and salts and hydrates thereof.
  • EDTA emylenediamrnetetraacetic acid
  • salts and hydrates thereof e.g., sodium edetate, disodium edetate, trisodium edetate, calcium disodium edetate, dipotassium edetate, and the like
  • citric acid and salts and hydrates thereof e.g
  • antimicrobial preservatives include benzalkonium chloride, benzethomum chloride, benzyl alcohol, bronopol, cetrimide, cetylpyridinium chloride, chlorhexidine, chlorobutanol, chlorocresol, chloroxylenol, cresol, ethyl alcohol, glycerin, liexetidiiie, imidurea, phenol, phenoxyethanol, phenyletliyl alcohol, phenylmercuric nitrate, propylene glycol, and thimerosal.
  • Exemplary antifungal preservatives include butyl paraben, methyl paraben, ethyl paraben, propyl paraben, benzoic acid, hydroxybenzoic acid, potassium benzoate, potassium sorbate, sodium benzoate, sodium propionate, and sorbic acid.
  • Exemplary alcohol preservatives include ethanol, polyethylene glycol, phenol, phenolic compounds, bisphenol, chlorobutanol, hydroxybenzoate, and phenylethyl alcohol.
  • Exemplary acidic preservatives include vitamin A, vitamin C, vitamin E, beta- carotene, citric acid, acetic acid, dehydroacetic acid, ascorbic acid, sorbic acid, and phytic acid.
  • preservatives include tocopherol, tocopherol acetate, deteroxime mesylate, cetrimide, butylated hydroxyanisol (BHA), butylated hydroxytoluened (BHT),
  • Exemplaiy buffering agents include citrate buffer solutions, acetate buffer solutions, phosphate buffer solutions, ammonium chloride, calcium carbonate, calcium chloride, calcium citrate, calcium glubionate, calcium gluceptate, calcium gluconate, D-gluconic acid, calcium glycerophosphate, calcium lactate, propanoic acid, calcium levulinate, pentanoic acid, dibasic calcium phosphate, phosphoric acid, tribasic calcium phosphate, calcium hydroxide phosphate, potassium acetate, potassium chloride, potassium gluconate, potassium mixtures, dibasic potassium phosphate, monobasic potassium phosphate, potassium phosphate mixtures, sodium acetate, sodium bicarbonate, sodium chloride, sodium citrate, sodium lactate, dibasic sodium phosphate, monobasic sodium phosphate, sodium phosphate mixtures, tromethamine, magnesium hydroxide, aluminum hydroxide, alginic acid, pyrogen- free water, isot
  • Exemplary lubricating agents include magnesium stearate, calcium stearate, stearic acid, silica, talc, malt, glyceryl behanate, hydrogenated vegetable oils, polyethylene glycol, sodium benzoate, sodium acetate, sodium chloride, leucine, magnesium lauryl sulfate, sodium lauryl sulfate, and mixtures thereof.
  • Exemplary natural oils include almond, apricot kernel, avocado, babassu, bergamot, black current seed, borage, cade, camomile, canola, caraway, carnauha, castor, cinnamon, cocoa butter, coconut, cod liver, coffee, corn, cotton seed, emu, eucalyptus, evening primrose, fish, flaxseed, geraniol, gourd, grape seed, hazel nut, hyssop, isopropyl myristate, jojoba, kukui nut, lavandin, lavender, lemon, litsea cubeba, macademia nut, mallow, mango seed, meadowfoam seed, mink, nutmeg, olive, orange, orange roughy, palm, palm kernel, peach kernel, peanut, poppy seed, pumpkin seed, rapeseed, rice bran, rosemary, safflower, sandalwood, sasquana, savoury,
  • Exemplary synthetic oils include, but are not limited to, butyl stearate, caprylic triglyceride, capric triglyceride, cyclomethicone, diethyl sebacate, dimethicone 360, isopropyl myristate, mineral oil, octyldodecanol, oleyl alcohol, silicone oil, and mixtures thereof,
  • Liquid dosage forms for oral and parenteral administration include pharmaceutically acceptable emulsions, microemulsions, solutions, suspensions, syrups and elixirs.
  • the liquid dosage forms may comprise inert diluents commonly used in the art such as, for example, water or other solvents, solubilizing agents and emulsifiers such as ethyl alcohol, isopropyl alcohol, ethyl carbonate, ethyl acetate, benzyl alcohol, benzyl benzoate, propylene glycol, 1,3-butylene glycol, dimethylformamide, oils (e.g., cottonseed, groundnut, corn, germ, olive, castor, and sesame oils), glycerol, tetrahydrofurfuryl alcohol, polyethylene glycols and fatty acid esters of sorbitan, and mixtures thereof.
  • inert diluents commonly used in the art such as, for example, water or other solvents, so
  • the oral compositions can include adjuvants such as wetting agents, emulsifying and suspending agents, sweetening, flavoring, and perfuming agents.
  • adjuvants such as wetting agents, emulsifying and suspending agents, sweetening, flavoring, and perfuming agents.
  • the conjugates described herein are mixed with solubilizing agents such as Creinophor , alcohols, oils, modified oils, glycols, polysorbates, cyclodextrins, polymers, and mixtures thereof,
  • Injectable preparations for example, sterile injectable aqueous or oleaginous suspensions can be formulated according to the known art using suitable dispersing or wetting agents and suspending agents.
  • the sterile injectable preparation can be a sterile injectable solution, suspension, or emulsion in a nontoxic parenterally acceptable diluent or solvent, for example, as a solution in 1,3-butanediol.
  • the acceptable vehicles and solvents that can be employed are water, Ringer's solution, U.S.P., and isotonic sodium chloride solution.
  • sterile, fixed oils are conventionally employed as a solvent or suspending medium.
  • any bland fixed oil can be employed including synthetic mono- or di-glycerides.
  • fatty acids such as oleic acid are used in the preparation of injectables.
  • the injectable formulations can be sterilized, for example, by filtration through a bacterial-retaining filter, or by incorporating sterilizing agents in the form of sterile solid compositions which can be dissolved or dispersed in sterile water or other sterile injectable medium prior to use.
  • compositions for rectal or vaginal administration are typically suppositories which can be prepared by mixing the conjugates described herein with suitable non-irritating excipients or carriers such as cocoa butter, polyethylene glycol, or a suppository wax which are solid at ambient temperature but liquid at body temperature and therefore melt in the rectum or vaginal cavity and release the active ingredient.
  • suitable non-irritating excipients or carriers such as cocoa butter, polyethylene glycol, or a suppository wax which are solid at ambient temperature but liquid at body temperature and therefore melt in the rectum or vaginal cavity and release the active ingredient.
  • Solid dosage forms for oral administration include capsules, tablets, pills, powders, and granules.
  • the active ingredient is mixed with at least one inert, pharmaceutically acceptable excipient or carrier such as sodium citrate or dicalcium phosphate and/or (a) fillers or extenders such as starches, lactose, sucrose, glucose, mannitol, and silicic acid, (b) binders such as, for example, carboxymethylcellulose, alginates, gelatin, polyvinylpyrroHdinone, sucrose, and acacia, (c) humectants such as glycerol, (d) disintegrating agents such as agar, calcium carbonate, potato or tapioca starch, alginic acid, certain silicates, and sodium carbonate, (e) solution retarding agents such as paraffin, (f) absorption accelerators such as quaternary ammonium compounds, (g) wetting agents such as, for example, cetyl alcohol and
  • Solid compositions of a similar type can be employed as fillers in soft and hard-filled gelatin capsules using such excipients as lactose or milk sugar as well as high molecular weight polyethylene glycols and the like.
  • the solid dosage forms of tablets, dragees, capsules, pills, and granules can be prepared with coatings and shells such as enteric coatings and other coatings well known in the art of pharmacology. They may optionally comprise opacifying agents and can be of a composition that they release the active ingredient(s) only, or preferentially, in a certain part of the intestinal tract, optionally, in a delayed manner.
  • encapsulating compositions which can be used include polymeric substances and waxes.
  • Solid compositions of a similar type can be employed as fillers in soft and hard- filled gelatin capsules using such excipients as lactose or milk sugar as well as high molecular weight polyethylene glycols and the like.
  • the active ingredient can be in a micro-encapsulated form with one or more excipients as noted above.
  • the solid dosage forms of tablets, dragees, capsules, pills, and granules can be prepared with coatings and shells such as enteric coatings, release controlling coatings, and other coatings well known in the pharmaceutical formulating art.
  • the active ingredient in such solid dosage forms can be admixed with at least one inert diluent such as sucrose, lactose, or starch.
  • Such dosage forms may comprise, as is normal practice, additional substances other than inert diluents, e.g., tabieting lubricants and other tableting aids such a magnesium stearate and microcrystalline cellulose.
  • the dosage forms may comprise buffering agents. They may optionally comprise opacifying agents and can be of a composition that they release the active ingredient(s) only, or preferentially, in a certain part of the intestinal tract, optionally, in a delayed manner.
  • encapsulating agents examples include polymeric substances and waxes.
  • Dosage forms for topical and/or transdermal administration of a compound described herein may include ointments, pastes, creams, lotions, gels, powders, solutions, sprays, inhalants, and/or patches.
  • the active ingredient is admixed under sterile conditions with a pharmaceutically acceptable carrier or excipient and'Or any needed preservatives and'or buffers as can be required.
  • the present disclosure contemplates the use of transdermal patches, which often have the added advantage of providing controlled delivery of an active ingredient to the body.
  • Such dosage forms can be prepared, for example, by dissolving and/or dispensing the active ingredient in the proper medium.
  • the rate can be controlled by either providing a rate controlling membrane and/or by dispersing the active ingredient in a polymer matrix and/or gel.
  • Suitable devices for use in delivering intradermal pharmaceutical compositions described herein include short needle devices.
  • Intradermal compositions can be administered by devices which limit the effective penetration length of a needle into the skin.
  • conventional syringes can be used in the classical mantoux method of intradermal administration.
  • Jet injection devices which deliver liquid formulations to the dermis via a liquid jet injector and'or via a needle which pierces the stratum corneum and produces a jet which reaches the dermis are suitable.
  • Ballistic powder/particle delivery devices which use compressed gas to accelerate the compound in powder form through the outer layers of the skin to the dermis are suitable.
  • Formulations suitable for topical administration include, but are not limited to, liquid and/or semi-liquid preparations such as liniments, lotions, oil-in-water and'Or water-in-oil emulsions such as creams, ointments, and/or pastes, and'or solutions and/or suspensions.
  • Topically administrable formulations may, for example, comprise from about 1 % to about 10% (w/w) active ingredient, although the concentration of the active ingredient can be as high as the solubility limit of the active ingredient in the solvent.
  • Formulations for topical administration may further comprise one or more of the additional ingredients described herein.
  • a pharmaceutical composition described herein can be prepared, packaged, and'or sold in a formulation suitable for pulmonary administration via the buccal cavity.
  • a formulation may comprise dry particles which comprise the active ingredient and which have a diameter in the range from about 0.5 to about 7 nanometers, or from about 1 to about 6 nanometers.
  • Such compositions are conveniently in the form of dry powders for
  • a device comprising a dry powder reservoir to which a stream of propellant can be directed to disperse the powder and'or using a self-propelling
  • solvent/powder dispensing container such as a device comprising the active ingredient dissolved and/or suspended in a low-boiling propellant in a sealed container.
  • Such powders comprise particles wherein at least 98% of the particles by weight have a diameter greater than 0.5 nanometers and at least 95% of the particles by number have a diameter less than 7 nanometers. Alternatively, at least 95% of the particles by weight have a diameter greater tha 1 nanometer and at least 90% of the particles by number have a diameter less than 6 nanometers.
  • Dry powder compositions may include a solid fine powder diluent such as sugar and are conveniently provided in a unit dose form,
  • Low boiling propellants generally include liquid propellants having a boiling point of below 65 °F at atmospheric pressure.
  • the propellant may constitute 50 to 99.9% (w/w) of the composition, and the active ingredient may constitute 0.1 to 20% (w/w) of the composition.
  • the propellant may further comprise additional ingredients such as a liquid non-ionic and/or solid anionic surfactant and/or a solid diluent (which may have a particle size of the same order as particles comprising the active ingredient).
  • compositions described herein formulated for pulmonary delivery may provide the active ingredient in the form of droplets of a solution and/or suspension.
  • Such formulations can be prepared, packaged, and/or sold as aqueous and/or dilute alcoholic solutions and/or suspensions, optionally sterile, comprising the active ingredient, and may conveniently be administered using any nebulization and/or atomization device.
  • Such formulations may further comprise one or more additional ingredients including, but not limited to, a flavoring agent such as saccharin sodium, a volatile oil, a buffering agent, a surface active agent, and/or a preservative such as methylhydroxybenzoate.
  • the droplets provided by this route of administration may have an average diameter in the range from about 0.1 to about 200 nanometers.
  • Formulations described herein as being useful for pulmonary deliver ⁇ ' are useful for intranasal delivery of a pharmaceutical composition described herein.
  • Another formulation suitable for intranasal administration is a coarse powder comprising the active ingredient and having an average particle from about 0.2 to 500 micrometers. Such a formulation is administered by rapid inhalation through the nasal passage from a container of the po wder held close to the nares.
  • Formulations for nasal administration may, for example, comprise from about as little as 0.1% (w/w) to as much as 100% (w/w) of the active ingredient, and may comprise one or more of the additional ingredients described herein.
  • a pharmaceutical composition described herein can be prepared, packaged, and/or sold in a formulation for buccal administration.
  • Such formulations may, for example, be in the form of tablets and/or lozenges made using conventional methods, and may contain, for example, 0.1 to 20% (w/w) active ingredient, the balance comprising an orally dissolvable and/or degradable composition and, optionally, one or more of the additional ingredients described herein.
  • the balance comprising an orally dissolvable and/or degradable composition and, optionally, one or more of the additional ingredients described herein.
  • formulations for buccal administration may comprise a powder and/or an aerosolized and/or atomized solution and/or suspension comprising the active ingredient.
  • Such powdered, aerosolized, and/or aerosolized formulations, when dispersed, may have an average particle and/or droplet size in the range from about 0.1 to about 200 nanometers, and may further comprise one or more of the additional ingredients described herein.
  • a pharmaceutical composition described herein can be prepared, packaged, and/or sold in a formulation for ophthalmic administration.
  • Such formulations may, for example, be in the form of eye drops including, for example, a 0.1 -1.0% (w/w) solution and/or suspension of the active ingredient in an aqueous or oily liquid earner or excipient.
  • Such drops may further comprise buffering agents, salts, and/or one or more other of the additional ingredients described herein.
  • Other opthalmieally-administrable formulations which are useful include those which comprise the active ingredient in microcrystaiime fonn and/or in a liposomal preparation. Ear drops and/or eye drops are also contemplated as being within the scope of this disclosure.
  • compositions are principally directed to pharmaceutical compositions which are suitable for administration to humans, such compositions are generally suitable for administration to animals of all sorts. Modification of pharmaceutical compositions suitable for administration to humans in order to render the compositions suitable for administration to various animals is well understood, and the ordinarily skilled veterinary pharmacologist can design and/or perform such modification with ordinary experimentation.
  • the compounds provided herein are typically formulated in dosage unit fonn for ease of administration and uniformity of dosage. It will be understood, however, that the total daily usage of the compositions described herein will be decided by a physician within the scope of sound medical judgment.
  • the specific therapeutically effective dose level for any particular subject or organism will depend upon a variety of factors including the disease being treated and the severity of the disorder; the activity of the specific active ingredient employed; the specific composition employed; the age, body weight, general health, sex, and diet of the subject; the time of administration, route of administration, and rate of excretion of the speci fic active ingredient employed; the duration of the treatment; drugs used in combination or coincidental with the specific active ingredient employed; and like factors well known in the medical arts.
  • enteral e.g., oral
  • parenteral intravenous, intramuscular, intra-arterial
  • intramedullary intrathecal, subcutaneous, intraventricular, transdermal, interdermal, rectal, intravaginal, intraperitoneal, topical (as by powders, ointments, creams, and/or drops), mucosal, nasal, bucal, sublingual; by intratracheal instillation, bronchial instillation, and/or inhalation; and/or as an oral spray, nasal spray, and/or aerosol.
  • oral administration e.g., systemic intravenous injection
  • regional administration via blood and/or lymph supply e.g., systemic intravenous injection
  • the compound or pharmaceutical composition described herein is suitable for topical administration to the eye of a subject.
  • any two doses of the multiple doses include different or substantially the same amounts of a compound described herein.
  • the frequency of administering the multiple doses to the subject or applying the multiple doses to the tissue or cell is three doses a day, two doses a day, one dose a day, one dose every other day, one dose every third day, one dose every week, one dose every two weeks, one dose every three weeks, or one dose every four weeks.
  • the frequency of administering the multiple doses to the subject or applying the multiple doses to the tissue or cell is one dose per day. In certain embodiments, the frequency of administering the multiple doses to the subject or applying the multiple doses to the tissue or cell is two doses per day .
  • the frequency of administering the multiple doses to the subject or applying the multiple doses to the tissue or cell is three doses per day.
  • the duration between the first dose and last dose of the multiple doses is one day, two days, four days, one week, two weeks, three weeks, one month, two months, three months, four months, six months, nine months, one year, two years, three years, four years, five years, seven years, ten years, fifteen years, twenty years, or the lifetime of the subject, biological sample, tissue, or cell.
  • the duration between the first dose and last dose of the multiple doses is three months, six months, or one year.
  • the duration between the first dose and last dose of the multiple doses is the lifetime of the subject, biological sample, tissue, or cell.
  • a dose (e.g. , a single dose, or any dose of multiple doses) described herein includes independently between 0.1 ig and 1 g, between 0.001 mg and 0.01 mg, between 0.01 mg and 0.1 mg, between 0.1 mg and 1 mg, between 1 mg and 3 mg, between 3 mg and 10 mg, between 10 mg and 30 mg, between 30 mg and 100 mg, between 100 mg and 300 mg, between 300 mg and 1,000 mg, or between 1 g and 10 g, inclusive, of a compound described herein.
  • a dose described herein includes independently between 1 mg and 3 mg, inclusive, of a compound described herein. In certain embodiments, a dose described herein includes independently between 3 mg and 10 mg, inclusive, of a compound described herein. In certain embodiments, a dose described herein includes independently between 10 mg and 30 mg, inclusive, of a compound described herein. In certain embodiments, a dose described herein includes independently between 30 mg and 100 mg, inclusive, of a compound described herein.
  • Dose ranges as described herein provide guidance for the administration of provided pharmaceutical compositions to an adult.
  • the amount to be administered to, for example, a child or an adolescent can be determined by a medical practitioner or person skilled in the art and can be lower or the same as that administered to an adult.
  • a dose described herein is a dose for an adult human whose body weight is approximately 70 kg.
  • a compound or composition, as described herein, may be administered in combination with one or more additional pharmaceutical agents (e.g. , therapeutically and/or prophylactically active agents) useful in treating and/or preventing a proliferative disease.
  • additional pharmaceutical agents e.g., therapeutically and/or prophylactically active agents
  • the compounds or compositions can be administered in combination with additional pharmaceutical agents that improve their activity (e.g., activity (e.g., potency and/or efficacy) in treating a proliferative disease in a subject in need thereof, in preventing a proliferative disease in a subject in need thereof, and/or in inhibiting the activity of a protein kinase (e.g., CDK (e.g.
  • a pharmaceutical composition described herein including a compound described herein and an additional pharmaceutical agent shows a synergistic effect that is absent in a
  • composition including one of the compound and the additional
  • the compound or composition can be administered concurrently with, prior to, or subsequent to one or more additional pharmaceutical agents, which are different from the compound or composition and may be useful as, e.g., combination therapies in treating and/'or preventing a proliferative disease.
  • Pharmaceutical agents include therapeutically active agents.
  • Pharmaceutical agents also include prophylactically active agents.
  • Pharmaceutical agents include small organic molecules such as drug compounds (e.g., compounds approved for human or veterinary use by the U.S.
  • the additional pharmaceutical agent is a pharmaceutical agent useful in treating a proliferative disease.
  • the additional pharmaceutical agent is a pharmaceutical agent useful in preventing a proliferative disease.
  • the additional pharmaceutical agent is a pharmaceutical agent useful in inhibiting the activity of a protein kinase ⁇ e.g., CDK (e.g., CDK7, CDK12, and/or CDK 13)) in a subject, biological sample, tissue, or cell.
  • the additional pharmaceutical agent is a pharmaceutical agent useful in inducing apoptosis in a cell.
  • the additional phannaceutical agent is a pharmaceutical agent approved by a regulator ⁇ ' agency (e.g., the US FDA) for treating and/or preventing a proliferative disease.
  • Each additional pharmaceutical agent may be administered at a dose and/or on a time schedule determined for that pharmaceutical agent.
  • the additional pharmaceutical agent(s) may also be administered together with each other and/or with the compound or composition described herein in a single dose or administered separately in different doses.
  • the particular combination to employ in a regimen will take into account compatibility of the compound described herein with the additional pharmaceutical agent(s) and/or the desired therapeutic and/or prophylactic effect to be achieved.
  • it is expected that the additional pharmaceutical agent(s) in combination be utilized at levels that do not exceed the levels at which they are utilized individually. In some embodiments, the levels utilized in combination will be lower than those utilized individually.
  • the additional pharmaceutical agent is a cytotoxic agent, in certain embodiments, the additional pharmaceutical agent is an anti-proliferative agent (e.g., anti-cancer agent). In certain embodiments, the additional pharmaceutical agent is an anti- leukemia agent. In certain embodiments, the additional pharmaceutical agent is
  • ABITREXATE metalhotrexate
  • ADE a compound having the following properties: doxorubicin hydrochloride
  • Adriamycin RDF doxorubicin hydrochloride
  • Ambochlorin chlorambucil
  • ARRANON nelarabine
  • ARZERRA foatumumab
  • BOSIJLIF (bosutimb), BUSULFEX (busulfan), CAMPATH (alemtiizumab), CERUBIDINE (daunorubicin hydrochloride), CLAFEN (cyclophosphamide), CLOFAREX (clofarabine), CLOLAR (clofarabine), CVP, CYTOSAR-U (cytarabine), CYTOXAIM (cyclophosphamide), ERWINAZE (Asparaginase Erwinia Chrysanthemi), FLUDARA (fiudarabine phosphate), FOLEX (methotrexate), FOLEX PFS (methotrexate), GAZYVA (obinutuzumab), GLEEVEC (imatinib mesylate), Hyper-CVAD, ICLUSIG (ponatinib hydrochloride), IMBRUVICA (ibrutinib), LEUKERAN (chlorambucil), LINFOLI
  • the additional pharmaceutical agent is an anti-lymphoma agent.
  • the additional pharmaceutical agent is ABITREXATE (methotrexate), ABVD, ABVE, ABVE-PC, ADCETRIS (brentuximab vedotin), ADRIAMYCIN PFS (doxorubicin hydrochloride), ADRIAMYCIN RDF (doxorubicin hydrochloride),
  • AMBOCHLORIN chlorambucil
  • AMBOCLORIN chlorambucil
  • ARRANON
  • the additional pharmaceutical agent is ZEVALIN (ibritumomab tiuxetan), ZOLINZA (vorinostat), ZYDELIG (idelalisib), or a combination thereof.
  • the additional pharmaceutical agent is ZEVALIN (ibritumomab tiuxetan), ZOLINZA (vorinostat), ZYDELIG (idelalisib), or a combination thereof.
  • the additional pharmaceutical agent is ibritumomab tiuxetan), ZOLINZA (vorinostat), ZYDELIG (idelalisib), or a combination thereof.
  • the additional pharmaceutical agent is ibritumomab tiuxetan), ZOLINZA (vorinostat), ZYDELIG (idelalisib), or a combination thereof.
  • AB3TREXATE metalhotrexate
  • ABRAXANE paciitaxel albumin-stabilized nanoparticle formulation
  • AC, AC-T, ADE paciitaxel albumin-stabilized nanoparticle formulation
  • AC, AC-T, ADE paciitaxel albumin-stabilized nanoparticle formulation
  • AC, AC-T, ADE paciitaxel albumin-stabilized nanoparticle formulation
  • AC, AC-T AC-T, ADE
  • ADRIAMYCIN PFS doxorabicin hydrochloride
  • ADRUCIL fluorouracil
  • AFINITOR everolimus
  • AFINITOR DISPERZ everoltmus
  • ALDARA imiquimod
  • ALIMTA pemetrexed disodium
  • AREDIA pamidronate
  • ARIMIDEX anastrozole
  • AROMASIN exemestane
  • CERVARTX (recombinant HPV bivalent vaccine), CLAFEN (cyclophosphamide), CMF, COMETRIQ (cabozantinib-s-malate), COSMEGEN (dactinomycin), CYFOS (ifosfamide), CYRAMZA (ramucirumab), CYTOSAR-U (cytarabine), CYTOXAN (cyclophosphamide), DACOGEN (decitabine), DEGARELIX, DOXIL (doxorubicin hydrochloride liposome), DOXORUBICIN HYDROCHLORIDE, DOX-SL (doxorubicin hydrochloride liposome), DTIC-DOME (dacarbazine), EFUDEX (fluorouracil), ELLENCE (epirubicin hydrochloride), ELOXATIN (oxaliplatin), ERBITUX (cetuximab), ERIVEDGE (vismodegib), ETOPOPHOS (etop
  • GARDASIL recombinant human papillomavirus (HPV) quadrivalent vaccine
  • METHAZOLASTONE (temozolomide), METHOTREXATE LPF (methotrexate), MEXATE (methotrexate), MEXATE-AQ (methotrexate), MITOXANTRONE HYDROCHLORIDE, MITOZYTREX (mitomycin c), MOZOBIL (plerixafor), MUSTARGEN (mechiorethamine hydrochloride), MUTAMYCIN (mitomycin c), MYLOSAR (azacitidine), NAVELBINE (vinorelbine tartrate), NEOSAR (cyclophosphamide), NEXAVAR (sorafenib tosylate), NOLVADEX (tamoxifen citrate), NOVALDEX (tamoxifen citrate), OFF, PAD, PARAPLAT (carboplatin), PARAPLATIN (carboplatin), PEG-INTRON (peginterferon alfa-2b),
  • PEMETREXED DISODIUM PERJETA (perruzumab), PLATINOL (cisplatin), PLATINOL- AQ (cisplatin), POMALYST (pomalidomide), prednisone, PROLEUKIN (aldesleukin), PROLIA (denosumab), PROVENGE (sipuleucel-t), REVL1MID (lenalidomide),
  • the additional pharmaceutical agent is a kinase inhibitor.
  • the additional pharmaceutical agent is a protein kinase inhibitor (e.g., tyrosine protein kinase inhibitor).
  • the additional pharmaceutical agent is an inhibitor of a Src family kinase.
  • the additional pharmaceutical agent is a CD inhibitor.
  • the additional pharmaceutical agent is a CDK7 inhibitor, in certain embodiments, the additional pharmaceutical agent is a CDK 12 inhibitor. In certain embodiments, the additional pharmaceutical agent is a CDK 13 inhibitor. In certain embodiments, the additional pharmaceutical agent is an inhibitor of one or more protein kinases selected from the group consisting of IRAKI, IRAK4, BMX, and PI3 , In certain embodiments, the additional pharmaceutical agent is an inhibitor of one or more protein kinases selected from the group consisting of BUB I B, CDK2, CDK9, CHEK2, PGR, HIPK4, PRKCQ, RET, SRC, and MELK.
  • the additional pharmaceutical agent is an inhibitor of one or more protein kinases selected from the group consisting of ABL, ARG, BLK, CSK, EphBl, EphB2, FOR, FRK, FYN, SRC, YES, LCK, LYN, MAP2K5, NLK, p38a, S RK, and TEC,
  • the additional pharmaceutical agent is an inhibitor of one or more protein kinases selected from the group consisting of ABLl(H396P)-phosphorylated, ABL1- phosphorylated, BLK, EPHA4, EPHB2, EPHB3, EPHB4, FGR, JAK3(JH1 domain-catalytic), KIT, KIT(L576P), KIT(V559D), PDGFRB, SRC, YES, ABLl(H396P)-nonphosphorylated, ABLl(Y253F)-phosphorylated, ABLl-nonphosphorylated, FRK, LYN, ABLl(H396P
  • the additional pharmaceutical agent is an inhibitor of one or more protein kinases selected from the group consisting of ABLl(F317L)-nonphosphorylated, ABL 1 (H396P)-nonphosphorylated, ABL1 (H396P)-phosphorylated, ABL1 -phosphoryiated, BLK, EPHA4, EPHB2, EPHB3, EPHB4, K3(j i !
  • KIT KIT(L576P), K1T(V559D), LYN, PDGFRB, SRC, YES, ABLl-nonphosphorylated, ABL1(Y253F)- phosphorylated, ERBB3, FGR, FRK, p38-alpha, ABLl(F317T)-nonphosphorylated, DDR1, EPHA2, ABLl (Q252H)-phosphorylated, MEK5, ABLl (Q252H)-nonphosphorylated, ABL2, FYN, EPHB1 , ABLl(E255K)-phosphorylated, ABL,l (F317L)-phosphorylated, EPHAl , ABLl(M351T)-phosphorylated, ERBB4, TXK, LCK, EPHA8, SIK, EPHA5, EGFR(L861Q), CSFl R-autoinhibited, BRAF(V600E), BRK, CSK, KIT
  • the additional pharmaceutical agent is an a ti-angiogenesis agent, antiinflammatory agent, immunosuppressant, anti-bacterial agent, anti-viral agent, cardiovascular agent, cholesterol-lowering agent, anti-diabetic agent, anti-allergic agent, pain-relieving agent, or a combination thereof.
  • the compounds described herein or pharmaceutical compositions can be administered or used in combination with an ant -cancer therapy including, but not limited to, transplantation (e.g., bone marrow transplantation, stem cell transplantation), surgery, radiation therapy, immunotherapy, and chemotherapy.
  • kits e.g., pharmaceutical packs.
  • the kits provided may comprise a pharmaceutical composition or compound described herein and a container (e.g., a vial, ampule, bottle, syringe, and/or dispenser package, or other suitable container).
  • a container e.g., a vial, ampule, bottle, syringe, and/or dispenser package, or other suitable container.
  • provided kits may optionally further include a second container comprising a pharmaceutical excipient for dilution or suspension of a
  • the pharmaceutical composition or compound described herein in some embodiments, are combined to form one unit dosage form.
  • the present invention also provides methods for the treatment or prevention of a proliferative disease (e.g., cancers (e.g., leukemia, acute lymphoblastic leukemia, lymphoma, Burkitt's lymphoma, melanoma, multiple myeloma, breast cancer, Ewing's sarcoma, osteosarcoma, brain cancer, neuroblastoma, lung cancer, colorectal cancer), benign neoplasms, diseases associated with angiogenesis, inflammatory diseases, autoinflammatory diseases, and autoimmune diseases).
  • a proliferative disease e.g., cancers (e.g., leukemia, acute lymphoblastic leukemia, lymphoma, Burkitt's lymphoma, melanoma, multiple myeloma, breast cancer, Ewing's sarcoma, osteosarcoma, brain cancer, neuroblastoma, lung cancer, colorectal cancer), benign neoplasms, diseases associated with
  • the compounds described herein may exhibit kinase inhibitory activity; the ability to inhibit cyclin-dependent kinase (CDK); the ability to inhibit cyclin-dependent kinase 7 (CDK7); the ability to inhibit cyclin-dependent kinase 7 (CDK7), without inhibiting another cyclin-dependent kinase (CDK); the ability to inhibit cyclin-dependent kinase 12 (CDK12); the ability to inhibit cyclin-dependent kinase 12 (CDK12), without inhibiting another cyclin- dependent kinase (CDK); the ability to inhibit cyclin-dependent kinase 13 (CDK13); the ability to inhibit cyclin-dependent kinase 13 (CDK13), without inliibiting another cyclin- dependent kinase (CDK); the ability to inhibit cyclin-dependent kinases 12 and 13 (CDK12 and CDK13); the ability to inhibit cyclin-dependent kinases 12 and 13 (CD
  • a therapeutic effect and/or preventative effect in the treatment of cancers without inhibiting another cyclin-dependent kinase (CDK); a therapeutic effect and/or preventative effect in the treatment of cancers; a therapeutic effect and/or preventative effect in the treatment of Myc-dependent cancers; and/or a therapeutic profile (e.g., optimum safety and curative effect) that is superior to existing chemotherapeutic agents.
  • CDK cyclin-dependent kinase
  • the compounds described herein are able to bind (e.g., covalently modify) the protein kinase being inhibited.
  • the R 2 group of a compound described herein is able to bind (e.g., covalently modify) to the protein kinase.
  • the R 2 group of a compound described herein is able to covalently bind a cysteine residue of the protein kinase.
  • the compound is capable of covalently modifying CD 7 (e.g., Cys312 of CDK7).
  • the R 2 group of a compound described herein is able to covalently modify residue Cys312 of CD 7.
  • the compound is capable of covalently modifying CD 12 (e.g., Cysl039 of CDK12).
  • the R 2 group of a compound described herein is able to covalently modify residue Cysl039 of CDK12.
  • the compound is capable of covalently modifying CDK13 (e.g., CyslOl? of CD 13).
  • the R 2 group of a compound described herein is able to covalently modify residue Cysl Ol 7 of CDK13.
  • the present disclosure provides methods of inhibiting the activity of a protein kinase in a subject, the methods comprising administering to the subject an effective amount (e.g., therapeutically effective amount) of a compound, or pharmaceutical composition thereof, as described herein.
  • an effective amount e.g., therapeutically effective amount
  • the present disclosure provides methods of inhibiting the activity of a protein kinase in a biological sample, the methods comprising contacting the biological sample with an effective amount of a compound, or pharmaceutical composition thereof, as described herein.
  • the present disclosure provides methods of inhibiting the activity of a protein kinase in a tissue, the methods comprising contacting the tissue with an effective amount of a compound, or pharmaceutical composition thereof, as described herein.
  • the present disclosure provides methods of inhibiting the activity of a protein kinase in a cell, the methods comprising contacting the cell with an effective amount of a compound, or pharmaceutical composition thereof, as described herein.
  • the subject being treated is a mammal.
  • the subject is a human.
  • the subject is a domesticated animal, such as a dog, cat, cow, pig, horse, sheep, or goat.
  • the subject is a companion animal such as a dog or cat.
  • the subject is a livestock animal such as a cow, pig, horse, sheep, or goat.
  • the subject is a zoo animal.
  • the subject is a research animal such as a rodent, dog, or non-human primate.
  • the subject is a non-human transgenic animal such as a transgenic mouse or transgenic pig.
  • the biological sample being contacted with the compound or composition is breast tissue, bone marrow, lymph node, lymph tissue, spleen, or blood.
  • the cell being contacted with the compound or composition is in vitro. In certain embodiments, the cell being contacted with the compound or composition is in vivo. In certain embodiments, the cell being contacted with the compound or composition is ex vivo. In certain embodiments, the cell being contacted with the compound or composition is a malignant cell (e.g., malignant blood cell). In certain embodiments, the cell being contacted with the compound or composition is a malignant hematopoietic stem cell (e.g., malignant myeloid cell or malignant lymphoid cell). In certain embodiments, the cell being contacted with the compound or composition is a malignant lymphocyte (e.g., malignant T-cell or malignant B-cell).
  • a malignant lymphocyte e.g., malignant T-cell or malignant B-cell.
  • the cell being contacted with the compound or composition is a malignant red blood cell, malignant white blood cell, or malignant platelet. In certain embodiments, the cell being contacted with the compound or composition is a malignant neutrophil, malignant macrophage, or malignant plasma cell. In certain embodiments, the cell being contacted with the compound or composition is a carcinoma cell. In certain embodiments, the cell being contacted with the compound or composition is a carcinoma breast cell. In certain embodiments, the cell being contacted with the compound or composition is a sarcoma cell. In certain embodiments, the cell being contacted with the compound or composition is a sarcoma cell from breast tissue.
  • the proliferative disease to be treated or prevented using the compounds described herein may be associated with overexpression of a kinase, such as cyclin-dependent kinase (CD ).
  • a kinase such as cyclin-dependent kinase (CD )
  • CDKs cyclin dependent kinases
  • CDKs are CDC2 (also known as CDK1 ) homologous serine-threonine kinase proteins that are able to utilize ATP as a substrate in the phosphorylation of diverse polypeptides in a sequence-dependent context.
  • Cyclins are a family of proteins characterized by a homology region, containing approximately 100 amino acids, termed the "cyclin box" which is used in binding to, and defining selectivity for, specific CD partner proteins.
  • Modulation of the expression levels, degradation rates, protein levels, and activity levels of various CDKs and cyclins throughout the cell cycle leads to the cyclical formation of a series of CDK/cyclin complexes, in which the CDKs are enzymatically active.
  • the formation of these complexes controls passage through discrete cell cycle checkpoints and thereby enables the process of cell division to continue. Failure to satisfy the prerequisite biochemical criteria at a given cell cycle checkpoint, i.e., failure to form a required
  • CDK/cyclin complex can lead to cell cycle arrest and/or cellular apoptosis. Aberrant cellular proliferation can often be attributed to loss of correct cell cycle control. Inhibition of CDK enzymatic activity therefore provides a means by which abnormally dividing cells can have their division arrested and/or be killed.
  • CDK7 a member of the CDK family, was originally isolated as the catalytic subunit of the trimeric CDK-activating kinase (CAK) complex.
  • This complex consisting of CDK7, cyclin H, and MAT1, is responsible for activation of the mitotic promoting factor in vitro.
  • TFIIH basal transcription repair factor IIH
  • TFIIH is a multi-subunit protein complex identifi ed as a factor required for RN A polymerase II (RN AP ID-catalyzed transcription, and subsequently this complex was found to play a key role in nucleotide excision repair.
  • CDK7 is a component of at least three complexes, i.e., the trimeric CAK complex, the quaternary complex with the XPD (or ERCC2, a protein involved in transcription-coupled nucleotide excision repair), and the nine-subunit TFIIH complex.
  • the two functions of CDK7 in CAK and CTD phosphorylation support critical facets of cellular proliferation, cell cycling, and transcription.
  • Overexpression of CDK7 may inhibit apoptosis, promote transcription and cell proliferation, and/or disrupt DNA repair, and therefore, cause proliferative diseases.
  • the proliferative disease to be treated or prevented using the compounds described herein may be associated with overexpression of a CDK ⁇ e.g., CDK7).
  • Cdkl 2 and Cdkl 3 are Cdc2-related proteins that share 92% identity in their kinase domains (Chen et al., Exp. Neurol, , 2014, 261, 10-21).
  • CDK 12 plays a critical role in cell processes, for example, regulating transcription and splicing machinery by stabilizing the RNAPII and DNA interaction, and regulating DNA damage response (DDR) and maintenance of genomic stability by modulating the expression of DDR genes.
  • CDKl 2 Overexpression of CDKl 2 has been found to correlate, both at the transcriptional and protein level, with pathological parameters of breast cancer disease.
  • a proliferative disease may be associated with aberrant activity of a CDK (e.g., CDK7, CDK12, and/or CDKl 3).
  • Aberrant activity of a CDK e.g., CDK7, CDK12, and/or CDKl 3
  • CDK e.g., CDK7, CDK12, and/or CDKl 3
  • Deregulation of cell cycle progression is a characteristic of a proliferative disease, and a majority of proliferative diseases have abnormalities in some component of CDK (e.g., CDK7, CDK 12, and/or CDKl 3) activity, frequently through elevated and/or inappropriate CDK activation.
  • CDK7 is not overexpressed, and the activity of CDK7 is elevated and/or inappropriate.
  • CDK7 is overexpressed, and the activity of CDK7 is elevated and/or inappropriate, in certain embodiments, CDKl 2 is not overexpressed, and the activity of CDKl 2 is elevated and/or inappropriate.
  • CDKl 2 is overexpressed, and the activity of CDKl 2 is elevated and or inappropriate.
  • CDKl 3 is not overexpressed, and the activity of CDKl 3 is elevated and/or inappropriate, in certain other embodiments, CDKl 3 is overexpressed, and the activity of CDKl 3 is elevated and/or inappropriate.
  • the compounds described herein, and pharmaceutically acceptable salts, solvates, hydrates, polymorphs, co-crystals, tautomers, stereoisomers, isotopically labeled derivatives, prodrugs, and compositions thereof, may inhibit the activity of CDK7 and be useful in treating and/or preventing proliferative diseases.
  • the compounds described herein, and pharmaceutically acceptable salts, solvates, hydrates, polymorphs, co-crystals, tautomers, stereoisomers, isotopically labeled derivatives, prodrugs, and compositions thereof, may inhibit the activit of CDK12 and/or CDK13 and be useful in treating and/or preventing proliferative diseases.
  • a proliferative disease may also be associated with inhibition of apoptosis of a cell in a biological sample or subject. All types of biological samples described herein or known in the art are contemplated as being within the scope of the invention.
  • Apoptosis is the process of programmed cell death. Inhibition of apoptosis may result in uncontrolled cell proliferation and, therefore, may cause proliferative diseases.
  • the cell cycle CDKs (CDKl, 2, 4, and 6) are activated by phosphorylation by CDK7/cyclin H (also called CAK). Inhibition of CDK.7 would therefore result in cell-cycle arrest at multiple points in the cell cycle due to failure to activate the cell cycle CDKs.
  • CDK 7 activates transcription by phosphorylating the CTD of RNAP II. Inhibition of CTD phosphorylation has been shown to inhibit transcription and reduce expression of short lived proteins, including those involved in apoptosis regulation, it is appreciated in the art that stalling of RMA polymerase may activate p53 (also known as protein 53 or tumor protein 53, a tumor suppressor protein that is encoded in humans by the TP53 gene), leading to apoptosis. Thus, inhibition of the activity of CDK7 are expected to cause cytotoxicity by inducing apoptosis.
  • p53 also known as protein 53 or tumor protein 53, a tumor suppressor protein that is encoded in humans by the TP53 gene
  • the compounds described herein, and pharmaceutically acceptable salts, solvates, hydrates, polymorphs, co-crystals, tautomers, stereoisomers, isotopically labeled derivatives, prodrugs, and compositions thereof, may induce apoptosis, and therefore, be useful in treating and/or preventing proliferative diseases.
  • CycK/Cdkl2 complex regulates phosphorylation of Ser2 in the C-terminal domain of RNA polymerase II and expression of a small subset of human genes, as revealed in expression microarrays. Through regulation of expression of DNA damage response genes (i.e. oncogenes), CycK/Cdkl2 protects cells from genomic instability.
  • DNA damage response genes i.e. oncogenes
  • the DNA damage response genes are BRCAl, BRCA2, HER1, HER2, ATR, FANCI, or FANCD2. In certain embodiments, the DNA damage response genes are BRCAl, HER2, ATR, FANCI, and FANCD2. In certain embodiments, the DNA damage response genes are BRCAl . In certain embodiments, the DNA damage response genes are HER2.
  • the proliferative disease to be treated or prevented using the compounds described herein is cancer. All types of cancers disclosed herein or known in the art are contemplated as being within the scope of the invention.
  • the proliferative disease is a cancer associated with BCL-2 anti-apoptotic proteins (e.g., MCL-1 and/or XIAP) (e.g., cancer associated with dependence on BCL-2 anti-apoptotic proteins).
  • the proliferative disease is a cancer associated with overexpression of MYC (a gene that codes for a transcription factor), in certain embodiments, the cancer is a MYC-dependent cancer.
  • the proliferative disease is a cancer associated with amplification of BRCAl. In certain embodiments, the proliferative disease is a cancer associated with amplification of HER2. In certain embodiments, the proliferative disease is a hematological malignancy. In certain embodiments, the proliferative disease is a blood cancer. In certain embodiments, the proliferative disease is a hematological malignancy. In certain embodiments, the proliferative disease is leukemia. In certain embodiments, the proliferative disease is chronic lymphocytic leukemia (CLL). In certain embodiments, the proliferative disease is acute lymphoblastic leukemia (ALL).
  • ALL acute lymphoblastic leukemia
  • the proliferative disease is T-cell acute lymphoblastic leukemia (T-ALL). In certain embodiments, the proliferative disease is chronic myelogenous leukemia (CML). in certain embodiments, the proliferative disease is acute myelogenous leukemia (AML). In certain embodiments, the proliferative disease is acute monocytic leukemia (AMoL). In certain embodiments, the proliferative disease is lymphoma. In some embodiments, the proliferative disease is Burkitt's lymphoma. In certain embodiments, the proliferative disease is a Hodgkm's lymphoma.
  • the proliferative disease is a non- Hodgkin's lymphoma. In certain embodiments, the proliferative disease is multiple myeloma. In certain embodiments, the proliferative disease is melanoma. In certain embodiments, the proliferative disease is colorectal cancer. In certain embodiments, the proliferative disease is breast cancer. In certain embodiments, the proliferative disease is recurring breast cancer. In certain embodiments, the proliferative disease is mutant breast cancer. In certain
  • the proliferative disease is HER2+ breast cancer. In certain embodiments, the proliferative disease is HER2- breast cancer. In certain embodiments, the proliferative disease is triple-negative breast cancer (TNBC). In certain embodiments, the proliferative disease is a bone cancer. In certain embodiments, the proliferative disease is osteosarcoma. In certain embodiments, the proliferative disease is E wing's sarcoma. In some embodiments, the proliferative disease is a brain cancer. In some embodiments, the proliferative disease is neuroblastoma. In some embodiments, the proliferative disease is a lung cancer. In some embodiments, the proliferative disease is small cell lung cancer (SCLC). In some
  • the proliferative disease is non-small cell lung cancer. In some embodiments, the proliferative disease is a benign neoplasm. All types of benign neoplasms disclosed herein or known in the art are contemplated as being within the scope of the invention. In some embodiments, the proliferative disease is associated with angiogenesis. All types of
  • the proliferative disease is an inflammatory disease. All types of inflammatory diseases disclosed herein or known in the art are contemplated as being within the scope of the invention. In certain embodiments, the inflammatory disease is rheumatoid arthritis.
  • the proliferative disease is an acute inflammatory disease.
  • the acute inflammatory disease is rheumatoid arthritis, chron's disease, or fibrosis.
  • the proliferative disease is an autoinflammatory disease. All types of automflamrnatory diseases disclosed herein or known in the art are contemplated as being within the scope of the invention.
  • the proliferative disease is an autoimmune disease. All types of autoimmune diseases disclosed herein or known in the art are contemplated as being within the scope of the invention.
  • the kinase is a CD , In certain embodiments, the kinase is CDK7. In certain embodiments, the kinase is CD 12. In certain embodiments, the kinase is CDK13. In certain embodiments, the activity of the kinase is aberrant activity of the kinase. In certain embodiments, the activity of th e kinase is increased activity of the kinase. In certain embodiments, the inhibition of the activity of the kinase is irreversible. In other embodiments, the inhibition of the activity of the kinase is reversible. In certain embodiments, the methods of inhibiting the activity of the kinase include attaching a compound described herein to the kinase.
  • genes affected by the activity of CDK7 may be inhibited by a compound of the invention.
  • the genes which may have their transcription inhibited by the activity of CDK7 are one or more selected from the group consisting of MY C, RlJNXl , MYB, TALI , GATA3, KLF2, HNRPDL, p21, ASCL1, MYCN, INSM1, NEUROD1 , NEUROG1, FOXGl , FOXA1 , SOX2, SOX4, BCL11A, OTX2, GAT2, PHOX2B, PLK2, TAF1, CTGF, WEE1, SDIM, JUN, PIM1, IL8, and FOS1.
  • the genes which may have their transcription inhibited by the activity of CD 7 include MYC, KLF2, E2F2, CD 6, CCND3, E2F3, HNRPDL, TET1, IL7R, BRCA1 , BRCA2, HER1, and HER2.
  • the transcription of genes affected by the activity of CDK12 may be inhibited by a compound of the invention.
  • the genes which may have their transcription inhibited by the activity of CDK 12 are one or more selected from the group consisting of BRCA1, FANCI, ATR, FANCD2, APEX1, NEK9, CHEKl, CHEK2, ATM, RAD51C, RAD51 D, ORC3L, MDC1 , TERF2, ERCC4, FANCF, PARP9, RUNX1, MYB, TAL L MCL1, MYC, BCL2, ETS 1, and EWS-FLI.
  • the transcription of genes affected by the activity of CDK13 may be inhibited by a compound of the invention.
  • the gene is SNORA38.
  • the present inven tion also provides methods of inhibiting cell growth in a biological sample, tissue, cell, or subject.
  • the present invention provides methods of inducing apoptosis of a cell in a biological sample, tissue, cell, or subject.
  • the methods described herein include administering to a subject or contacting a biological sample with an effective amount of a compound described herein, or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, or a
  • the methods described herein include administering to a subject or contacting a biological sample with an effective amount of a compound described herein, or a pharmaceutically acceptable salt thereof, or a pharmaceutical composition thereof.
  • the compound is contacted with a biological sample.
  • the compound is administered to a subject.
  • the compound is administered in combination with one or more additional pharmaceutical agents described herein.
  • the additional pharmaceutical agent may be an anti-proliferative agent.
  • the additional pharmaceutical agent is an and -cancer agent.
  • the additional pharmaceutical agent may also be a kinase inhibitor.
  • the additional pharmaceutical agent is an inhibitor of a CDK.
  • the additional pharmaceutical agent is an inhibitor of CDK7.
  • the additional pharmaceutical agent is a selective inhibitor of CDK7. In certain embodiments, the additional pharmaceutical agent is a nonselective inhibitor of CDK7. In certain embodiments, the additional pharmaceutical agent is an inhibitor of CDK12. In certain embodiments, the additional pharmaceutical agent is a selective inhibitor of CDK12. In certain embodiments, the additional pharmaceutical agent is a nonselective inhibitor of CDK! 2. In certain embodiments, the additional pharmaceutical agent is an inhibitor of CDK13. In certain embodiments, the additional pharmaceutical agent is a selective inhibitor of CDK13. In certain embodiments, the additional pharmaceutical agent is a nonselective inhibitor of CDK13. In certain embodiments, the additional pharmaceutical agent is an inhibitor of another CDK.
  • the additional pharmaceutical agent is a selective inhibitor of another CDK. In certain embodiments, the additional pharmaceutical agent is a nonselective inhibitor of another CDK. In certain embodiments, the additional pharmaceutical agent is flavopiridol, triptolide, SNS-032 (BMS-387032), PHA-767491, PHA-793887, BS-181, (5)-CR8, (R)-CR8, or NU6140. In certain embodiments, the additional pharmaceutical agent is an inhibitor of a mitogen-activated protein kinase (MAPK). In certain embodiments, the additional pharmaceutical agent is an inhibitor of a glycogen synthase kinase 3 (GSK3).
  • MPK mitogen-activated protein kinase
  • the additional pharmaceutical agent is an inhibitor of an AGC kinase. In certain embodiments, the additional pharmaceutical agent is an inhibitor of a calmodultn-dependent kinase (CaM Kinase). In certain embodiments, the additional pharmaceutical agent is an inhibitor of a casein Idnase 1. In certain embodiments, the additional pharmaceutical agent is an inhibitor of a STE kinase. In certain embodiments, the additional pharmaceutical agent is a inhibitor of a tyrosine kinase.
  • the additional pharmaceutical agent is a topoisomerase inhibitor, a MCL1 inhibitor, a BCL-2 inhibitor, a BCL-xL inhibitor, a BRD4 inhibitor, a BRCA1 inhibitor, BRCA2 inhibitor, HER1 inhibitor, HER2 inhibitor, a CD 9 inhibitor, a Jumonji histone demethylase inhibitor, or a DNA damage inducer.
  • the additional pharmaceutical agent is etoposide, obatoclax, navitoclax, JQ1, 4-(((5'-chloro-2'- (((1 R,4R) ⁇ 4 ⁇ (((K)- 1 -metiioxypropan-2-yl)amino)cyclohexyl)amino)-[2,4'-bipyridin]-6- yl)amino)memyl)tetrahydro-2H-pyran-4-carbonitrile, JIB04, or cisplatin.
  • the additional pharmaceutical agent is etoposide, obatoclax, or navitoclax
  • the disease to be treated is breast cancer, e.g., triple-negative breast cancer, HER2 positive breast cancer, HER2 negative breast cancer, ER -positive breast cancer, ER-negative breast cancer, or ER/PR-positive breast cancer.
  • the additional pharmaceutical agent is etoposide, obatoclax, or navitoclax
  • the disease to be treated is breast cancer, e.g., triple-negative breast cancer, HER2 positive breast cancer, HER2 negative breast cancer, ER -positive breast cancer, ER-negative breast cancer, or ER/PR-positive breast cancer.
  • the additional pharmaceutical agent is etoposide, obatoclax, or navitoclax
  • the disease to be treated is breast cancer, e.g., triple-negative breast cancer, HER2 positive breast cancer, HER2 negative breast cancer, ER -positive breast cancer, ER-negative breast cancer
  • a pharmaceutical composition described herein further comprises a combination of the additional pharmaceutical agents described herein.
  • inventive compounds or compositions may synergistically augment inhibition of CD 7 induced by the additional pharmaceutical agent(s) in the biological sample or subject.
  • inventive compounds or compositions may synergistically augment inhibition of CD 12 induced by the additional pharmaceutical agent(s) in the biological sample or subject.
  • inventive compounds or compositions may synergistically augment inhibition of CD 12 and/or CDK13 induced by the additional pharmaceutical agent(s) in the biological sample or subject.
  • the combination of the inventive compounds or compositions and the additional pharmaceutical agent(s) may be useful in treating proliferative diseases resistant to a treatment using the additional pharmaceutical agent(s) without the inventive compounds or compositions.
  • the activity of a protein kinase is non-selectively inhibited by the compounds or pharmaceutical compositions described herein. In some embodiments, the activity of the protein kinase being inhibited is selectively inhibited by the compounds or pharmaceutical compositions described herein, compared to the activit of a different protein (e.g., a different protein kinase).
  • the activity of CDK is selectively inhibited by a compound or pharmaceutical composition described herein, compared to the activity of a different protein
  • the activity of CDK7 is selectively inhibited by a compound or pharmaceutical composition described herein, compared to the activity of a different CDK protein.
  • the activity of CDK7 is selectively inhibited by a compound or pharmaceutical composition described herein, compared to the activity of CDK12. In certain embodiments, the activity of CDK7 is selectively inhibited by a compound or pharmaceutical composition described herein, compared to the activity of CDK13. In certain embodiments, the activity of CDK7 is selectively inhibited by a compound or pharmaceutical composition described herein, compared to the activity of CDK12 and the activity of CDK13. In certain
  • the activity of CDK 12 is selectively inhibited by a compound or
  • the activity of CDK13 is selectively inhibited by a compound or
  • the activity of CDK 12 and the activity of CDK 13 are selectively inhibited by a compound or pharmaceutical composition described herein, compared to the activity of CDK7,
  • the selectivity of a compound or pharmaceutical composition described herein in inhibiting the activity of a protein kinase over a different protein may be measured by the quotient of the IC50 value of the compound or
  • the selectivity of a compound or pharmaceutical composition described herein for a protein kinase over a different protein may also be measured by the quotient of the K & value of an adduct of the compound or pharmaceutical composition and the different protein over the K d value of an adduct of the compound or pharmaceutical composition and the protein kinase.
  • the selectivity is at least 2-fold, at least 3-fold, at least 5-fold, at least 10-fold, at least 30-fold, at least 100-fold, at least 300-fold, at least 1,000-fold, at least 3,000-fold, at least 10,000-fold, at least 30,000-fold, or at least 100,000-fold. In certain embodiments, the selectivity is not more than 100,000-fold, not more than 10,000-fold, not more than 1,000-fold, not more than 100-fold, not more than 10-fold, or not more than 2-fold. Combinations of the above-referenced ranges (e.g., at least 2-fold and not more than 10,000- fold) are also within the scope of the disclosure,
  • a kit described herein includes a first container comprising a compound or pharmaceutical composition described herein.
  • a kit described herein is useful in treating a proliferative disease (e.g., cancers (e.g., leukemia, acute lymphoblastic leukemia, lymphoma, Burkitt's lymphoma, melanoma, multiple myeloma, breast cancer, Ewing's sarcoma, osteosarcoma, brain cancer, neuroblastoma, lung cancer, colorectal cancer), benign neoplasms, diseases associated with angiogenesis, inflammatory diseases, automfiammatory diseases, and autoimmune diseases) in a subject in need thereof, preventing a proliferative disease in a subject in need thereof, inhibiting the activity of a protein kinase (e.g., CDK (e.g., CDK7, CDK12, or CDK13)) in a subject, biological sample,
  • a protein kinase e
  • kits described herein further includes instructions for using the compound or pharmaceutical composition included in the kit.
  • a kit described herein may also include information as required by a regulatory agency such as the U.S. Food and Drug Administration (FDA).
  • the information included in the kits is prescribing information.
  • kits and instructions provide for treating a proliferative disease in a subject in need thereof, preventing a proliferative disease in a subject in need thereof, inhibiting the activity of a protein kinase (e.g., CDK (e.g., CDK7, CDK12, or CDK13)) in a subject, biological sample, tissue, or cell, and'or inducing apoptosis in a cell.
  • a kit described herein may include one or more additional pharmaceutical agents described herein as a separate composition.
  • Jurkat cells were treated with DMSO or concentration of compound indicated, 6 hours after treatment, cells were washed and harvested by resuspending in lysis buffer (50 mM Hepes pH 7.4, 150 mM NaCl, 1% NP-40, 5 mM EDTA, protease and phosphatase inhibitors) and lysing on ice 30 minutes. Lysates were cleared by centrifugation at 15,000 rpm 30 minutes. Biotin-labeled THZ1 was added to 1 ⁇ to lysates and rotated at 4 °C overnight. Streptavidin-agarose beads were washed and 30 ⁇ slurry was added to each lysate and rotated for 1 hour at 4 °C.
  • lysis buffer 50 mM Hepes pH 7.4, 150 mM NaCl, 1% NP-40, 5 mM EDTA, protease and phosphatase inhibitors
  • Jurkat cells were plated at 30,000 cells/well and treated with a titration of compounds indicated. Cells were allowed to grow for 72 hours. Cells were assayed using CELLTITER GLO (Promega) to determine cell viability by measuring the amount of ATP present, which is an indicator of cell metabolic activity. Results are graphed as luminescent values. Curves were generated using PRISM and an IC 50 value was determined.
  • TLC thin layer chromatography

Landscapes

  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Health & Medical Sciences (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • General Health & Medical Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Epidemiology (AREA)
  • Neurology (AREA)
  • Biomedical Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Neurosurgery (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Plural Heterocyclic Compounds (AREA)
  • Enzymes And Modification Thereof (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)

Abstract

The present invention provides novel compounds of Formulae (I'), (I), (II'), and (II), and pharmaceutically acceptable salts, solvates, hydrates, polymorphs, co-crystals, tautomers, stereoisomers, isotopically labeled derivatives, prodrugs, and compositions thereof. Also provided are methods and kits involving the inventive compounds or compositions for treating and/or preventing proliferative diseases (e.g., cancers (e.g., leukemia, acute lymphoblastic leukemia, lymphoma, Burkitt's lymphoma, melanoma, multiple myeloma, breast cancer, Ewing's sarcoma, osteosarcoma, brain cancer, ovarian cancer, neuroblastoma, lung cancer, colorectal cancer), benign neoplasms, diseases associated with angiogenesis, inflammatory diseases, autoinflammatory diseases, and autoimmune diseases) in a subject. Treatment of a subject with a proliferative disease using a compound or composition of the invention may inhibit the aberrant activity of a kinase, such as a cyclin-dependent kinase (CDK) (e.g., CDK7, CDK12, or CDK13), and therefore, induce cellular apoptosis and/or inhibit transcription in the subject.

Description

INHIBITORS OF CYCLIN-DEPENDE T KINASES
RELATED APPLICATIONS
[0001] This application claims priority under 35 U.S.C. § 119(e) to U.S. Provisional Application, U.S. S.N. 62/216,271, filed September 9, 2015, which is incorporated herein by reference.
GOVERNMENT SUPPORT
[0002] This invention was made with government support under grant number 1 R01 CA179483-01A1 awarded by the National Institutes of Health. The government has certain rights in the invention.
BACKGROUND OF THE INVENTION
[0003] The members of the cyclin-dependent kinase (CDK) family play critical regulatory roles in cell proliferation. There are currently twenty known mammalian CDKs. While CDK7 to CDK13 have been linked to transcription, CDK1, 2, 4, and 6 show demonstrable association with the cell cycle.
[0004] Unique among the mammalian CDKs, CDK7 has consolidated kinase activities, regulating both the ceil cycle and transcription. In the cytosol, CDK7 exists as a
heterotrimeric complex and is believed to function as a CD l/2-activating kinase (CAK), whereby phosphorylation of conserved residues in CDK 1/2 by CDK7 is required for full catalytic CDK activity and cell cycle progression (Desai et ah, "Effects of phosphorylation by CAK on cyclin binding by CDC2 and CDK2." Mol. Cell Biol. 15, 345-350 (1995); Kaldis et al, "Analysis of CAK activities from human cells." Eur. J. Biochem. 267, 4213-4221 (2000); Larochelle et ah, "Requirements for CD 7 in the assembly of CDK1 /cyclin B and activation of CDK2 revealed by chemical genetics in human cells." Mol Cell 25, 839-850 (2007)). In the nucleus, CDK7 forms the kinase core of the RNA polymerase (RNAP) II general transcription factor complex and is charged with phosphorylatmg the C-terminal domain (CTD) of RNAP II, a requisite step in gene transcriptional initiation (Serizawa. et ah, "Association of CDK-activating kinase subunits with transcription factor TFIIH." Nature 374, 280-282 (1995); Shiekhattar et ah, "CDK-activating kinase complex is a component of human transcription factor TFIIH." Nature 374, 283-287 (1995); Drapkin et ah, "Human cyclin-dependent kinase-activating kinase exists in three distinct complexes." Proc. Natl. Acad. Sci. U.S.A. 93, 6488-6493 (1996); Liu. et ah, "Two cyclin-dependent kinases promote RNA polymerase II transcription and formation of the scaffold complex." Mol. Cell Biol. 24, 1721 -1735 (2004); Akhtar et al, "TFiiH kinase places bivalent marks on the carboxy- terminal domain of RNA polymerase II." Mol. Cell 34, 387-393 (2009); Glover-Cutter et al, "TFUH-associated CDK7 kinase functions in phosphorylation of C-terminal domain Ser7 residues, promoter-proximal pausing, and termination by RNA polymerase II." Mol. Cell Biol. 29, 5455-5464 (2009)). Together, the two functions of CD 7, i.e., CAK and CTD phosphorylation, support critical facets of cellular proliferation, cell cycling, and
transcription.
[0005! CDK12 and CDK13 were identified in cDNA screens for cell cycle regulators.
Because their cyclin partners were not yet known, they were initially named CRKRS and CDC2L5 (Ko et al, J. Cell Sci,, 2001, 114, 2591-2603; Marques et al, Biochem Biophys Res Commun., 2000, 279(3):832-837), respectively. They were found to be 1490- and 1512- amino acid proteins, respectively, with a conserved central CTD kinase domain and degenerate RS domains identified in their N- and C-terminal regions (Even et al, J Cell Biochem., 2006, 99(3), 890-904).
[0006] Evidence has shown CDK12 and CDK13 play an important role in cancer development. A comprehensive genomic approach identified CDK.12 to be one of the most frequently somatically mutated genes in high-grade serous ovarian cancer, the most fatal form of the disease (Erratum, Nature, 2011, 474(7353), 609-615). Several identified point mutations in the kinase domain point to the critical importance of the kinase activity of CD 12 for the development/progression of this disease. CDK! 2 has also been found to contribute to the development of breast cancer. Notably, CDK! 2 is located on chromosome 17, within the 17q21 locus that contains several candidate genes for breast cancer susceptibility ( auraniemi et al, Cancer Res., 2001, 61(22), 8235-8240), and it is co- amplified with the tyrosine kinase receptor ERBB2, a protein amplified and overexpressed in about 20% of breast tumors. Gene fusion between CDK12 and ERBB2 was also detected in gastric cancer (Zang et al, Cancer Res., 2011, 71(1 ), 29-39). CDK12 is also implicated in the modification of tamoxifen sensitivity in estrogen-positive breast cancer via the modulation of the mitogen-activated protein kinase pathway (loms et al. Carcinogenesis, 2009,
30(10): 1696-1701).
[0007J Due to the important regulatory functions of kinases, such as CDK7, CDK12, and CDK13, in cell cycle control, cell proliferation, differentiation, and apoptosis, it is important to develop modulators of the activities of these kinases, including selective modulators, for use as research tools as well as therapeutic agents in the treatment of diseases. SUMMARY OF THE INVENTION
[0008] Cyclin dependent kinases (CDKs), e.g., CDK7, CDK12, and CDK13, are key- regulators of the cell cycle, Their successive activation and inactivation drives the cycle forward. The activity of CDKs is regulated by multiple mechanisms such as positive and negative phosphorylation, binding of regulatory proteins like cyclins, and CDK inhibitors. Most CDKs require the phosphorylation of a threonine residue located in the T-loop to achieve full kinase activity. This threonine residue is conserved in all CDKs that function in cell cycle regulation. The enzyme responsible for this phosphorylation is therefore termed CDK-activating-kinase or CAK. CAK complexes have been found to be composed of CDK7, CDK 1 2, CDK ! 3. cyclin H, and MAT1. Besides its CAK function, C DK?, CDK 12, and CDK13 also play a role in transcription and possibly in D A repair. This suggests that the CDK7, CDK12, and CDK13 enzyme complexes are involved in multiple functions in the cell, e.g., cell cycle control, apoptosis, transcription regulation, and DNA repair.
[0009] The present invention provides compounds of Formulae (Γ), (IT), (I), (II), and pharmaceutically acceptable salts, solvates, hydrates, polymorphs, co-crystals, tautomers, stereoisomers, isotopically labeled derivatives, prodrugs, and compositions thereof. The compounds of Formulae (Ι'), (Π'), (I), (II), and pharmaceutically acceptable salts, solvates, hydrates, polymorphs, co-crystals, tautomers, stereoisomers, isotopically labeled derivatives, prodrugs, and compositions thereof, may inhibit the activity of a kinase. The compounds described herein may in certain embodiments selectively inhibit specific CDK subtypes, for example, CDK7, C DK 1 2. or CDK13. In certain embodiments, the compounds of Formulae (F), (IT), (I), and (II) are selective for CDK7 compared to other kinases. In certain embodiments, the compounds of Formulae (Γ), (IV), (I), and (II) are selective for CDK12 and/or CDK13 compared to other kinases. The present invention also provides methods of using the inventive compounds, and pharmaceutically acceptable salts, solvates, hydrates, polymorphs, co-crystals, tautomers, stereoisomers, isotopically labeled derivatives, prodrugs, and compositions thereof, to study the inhibition of a kinase (e.g., CDK7, CDK12, and/or CDK i 3) and as therapeutics for the prevention and/or treatment of diseases associated with the overexpression and/or aberrant activity of a kinase {e.g., CDK7, CDK12, and/or CDK13). In certain embodiments, the inventive compounds are used for the prevention and/or treatment of proliferative diseases {e.g., cancers (e.g., leukemia, acute lymphoblastic leukemia, lymphoma, Burkitt's lymphoma, melanoma, multiple myeloma, breast cancer, Ewing's sarcoma, osteosarcoma, brain cancer, neuroblastoma, lung cancer, colorectal cancer), benign neoplasms, diseases associated with angiogenesis, inflammatory diseases, autoinflammatory diseases, and autoimmune diseases) in a subject.
[0010] Since the discovery of selective inhibitors of CDK7, CDK12, and CD 13 has been hampered by the high sequence and structural similarities of the kinase domain of CD family members, the developmen t of selective inhibitors of the transcriptional cyclin- dependent kinases (tCDKs) will allow dissection of their individual contributions to the regulation of transcription and evaluation of their therapeutic potential. Without wishing to be bound by any particular theory, the inventive compounds' selectivity for CD 7, CD 12, and'Or CD 1 3 may be due to the compounds' ability to covaientlv modify a specific cysteine residue of these kinases (e.g., Cys312 of CDK7, Cysl 039 of CDK12, Cysl Ol 7 of CDK13).
[0011] In one aspect, the present invention provides compounds of Formula ( ):
Figure imgf000006_0001
and pharmaceutically acceptable salts, solvates, hydrates, polymorphs, co-crystals, tautomers, stereoisomers, isotopically labeled derivatives, and prodrugs thereof, wherein R1, R2, RA, RB, Rc, Ring A, Ring B, Ring C, L! , 1/, X, ai, bl , and cl are as defined herein.
[0012] In one aspect, the present invention provides compounds of Formula (1):
Figure imgf000006_0002
and pharmaceutically acceptable salts, solvates, hydrates, polymorphs, co-crystals, tautomers, stereoisomers, isotopically labeled derivatives, and prodrugs thereof, wherein R1, R2, RA, RB, Rc, Ring A, Ring B, Ring C, L! , I/, X, ai, bl , and cl are as defined herein.
[0013] in one aspect, the present invention provides compounds of Formula (ΙΓ):
Figure imgf000006_0003
and pharmaceutically acceptable salts, solvates, hydrates, polymorphs, co-crystals, tautomers, stereoisomers, isotopically labeled derivatives, and prodrugs thereof, wherein R!, R2, RA, RB, Ring A, Ring B, L2, X, al, and bl are as defined herein.
[0014] in one aspect, the present invention provides compounds of Formula (II):
Figure imgf000007_0001
and pharmaceutically acceptable salts, solvates, hydrates, polymorphs, co-crystals, tautomers, stereoisomers, isotopically labeled derivatives, and prodrugs thereof, wherein R1, R2, R A, R , Ring A, Ring B, L2, X, al, and bl are as defined herein.
[0015] In another aspect, the present disclosure provides pharmaceutical compositions including a compound described herein, and optionally a pharmaceutically acceptable excipient. In certain embodiments, the pharmaceutical compositions described herein include a therapeutically or prophylactically effective amount of a compound described herein. The pharmaceutical composition may be useful for treating a proliferative disease in a subject in need thereof, preventing a proliferative disease in a subject in need thereof, inhibiting the activity of a protein kinase in a subject, biological sample, tissue, or cell, and/or inducing apoptosis in a cell. In certain embodiments, the proliferative disease is an inflammatory disease. I certain embodiments, the inflammatory disease is rheumatoid arthritis, Crohn's disease, or fibrosis,
[0016J In another aspect, the present invention provides methods for treating and/or preventing a proliferative disease. Exemplary proliferative diseases which may be treated include cancer, benign neoplasms, diseases associated with angiogenesis, inflammatory diseases, automflammatory diseases, and autoimmune diseases. In certain embodiments, the cancer is selected from the group consisting of pancreatic cancer, lung cancer (e.g., small cell lung cancer (SCLC), and non-small cell lung cancer), prostate cancer, breast cancer, ovarian cancer, kidney cancer, liver cancer, Ewing's sarcoma, osteosarcoma, brain cancer, neuroblastoma, and colorectal cancer.
[0017] Another aspect of the invention relates to methods of inhibiting the activity of a kinase (e.g., CDK (e.g., CDK7, CDK.I2, CDK13)) using a compound described herein in a
biological sample or subject. In certain embodiments, the method involves the selective inhibition of CD 7. In certain embodiments, the method involves the selective inhibition of CDK 12. In certain embodiments, the method involves the selective inhibition of CDK 1.3. [0018] Also provided by the present invention are methods of inhibiting the transcription of one or more genes in the cell of a biological sample or subject using a compound described herein. The transcription of genes affected by the activity of CDK7 may be inhibited by a compound of the invention. In certain embodiments, these genes are one or more selected from the group consisting of MYC, RUNX1 , MYB, TALI, GAT A3, LF2, HNRPDL, p21 , ASCL1, MYCN, INSM1 , EUROD1, NEUROG1, FOXG l, FOXA1, SOX2, SOX4, BCL1 1 A, OTX2, GAT2, PHOX2B, PLK2, TAF1 , CTGF, WEE1, SDIM, JUN, PIMl, IL8, and FOSL The transcription of genes affected by the activity of CD 12 may be inhibited by a compound of the invention. In certain embodiments, these genes are one or more selected from the group consisting of BRCA1, FANCI, ATR, FANCD2, APEX! , NEK9, CHEK1, CHEK2, ATM, RAD51C, RAD51D, ORC3L, MDCL TERF2, ERCC4, FANCF, PARP9, RUNX1, MYB, TALI , MCL1, MYC, BCL2, ETS1, and EWS-FLL The transcription of genes affected by the activity of CDK13 may be inhibited by a compound of the invention. In certain embodiments, the gene is SNORA38.
[0019] The present invention also provides methods of inhibiting cell growth in a biological sample or subject. In still another aspect, the present invention provides methods of inducing apoptosis of a cell in a biological sample or subject.
[0020] The present invention provides methods for administering to a subject in need thereof an effective amount of a compound, or pharmaceutical composition thereof, as described herein. Also described are methods for contacting a cell with an effective amount of a compound, or pharmaceutical composition thereof, as described herein. In certain embodiments, a method described herein further includes administering to the subject an additional pharmaceutical agent. In certain embodiments, a method described herein further includes contacting the cell with an additional pharmaceutical agent. The methods described herein may further include performing radiotherapy, immunotherapy, and/or transplantation on the subject.
[0021] In yet another aspect, the present invention provides compounds of Formulae (Γ), (ΙΓ), (I), (II), and pharmaceutically acceptable salts, solvates, hydrates, polymorphs, co- crystals, tautomers, stereoisomers, isotopically labeled derivatives, prodrugs, and
compositions thereof, for use in the treatment of a disease (e.g., a proliferative disease such as cancer) in a subject.
[0022| Another aspect of the present disclosure relates to kits comprising a container with a compound, or pharmaceutical composition thereof, as described herein. The kits described herein may include a single dose or multiple doses of the compound or pharmaceutical composition. The kits may be useful in a method of the disclosure. In certain embodiments, the kit further includes instructions for using the compound or pharmaceutical composition. A kit described herein may also include information (e.g. prescribing information) as required by a regulatory agency such as the U.S. Food and Drug Administration (FDA).
[0023] The details of one or more embodiments of the invention are set forth herein. Other features, objects, and advantages of the invention will be apparent from the Detailed
Description, Examples, Figures, and Claims.
BRIEF DESCRIPTION OF THE DRAWINGS
[0024] The accompanying drawing, which are incorporated in and constitute a part of this specification, illustrate sev eral embodiments of the invention and together with the description, serve to explain the principles of the invention.
[0025] Figure 1 shows the chemical structures of exemplary compounds described herein and the IC50 values of the exemplar compounds in inhibiting select cyclin-dependent kinases.
[0026] Figure 2 A shows that compound B12 exhibits binding of intracellular CDK 12 and CDK13 at concentrations between 62.5 nJVI to 1 μΜ treatment. Jurkat cells treated with compound B12 for 6 hours show decreased pulldown of CDK12 and CDK13 - associated cyclin K by biotin-THZl relative to DMSO-treated cells. These data indicate that B12 cellular treatment blocks biotin-THZl from binding CDK12 and CDK13 -associated cyclin K complexes by successful binding of these complexes in cells at these concentrations. Cyclin H (Cyc H) pulldown was not affected, indicating that CD 7 binding is not affected. Figure 2B shows the structure of compound B12.
[0027] Figure 3 shows the binding of compounds B12, B15, and B16 (relative to DMSO control) to CD 12 and CDK13 -associated cyclin K at concentrations of 100 nM, 50 nM, 25 nM, and 12.5 nM. Jurkat cells were treated with each compound (or DMSO) for 6 hours, followed by lysis and pulldown with biotin-THZl, and subsequent wester blotting for cyclin K (Cyc K) and cyclin H (Cyc H). Compound B12 exhibits binding to CDK12 and CDK i 3 - associated cyclin K, while compounds B15 and B16 do not. Compound B12 is able to block pulldown of CDK 12 and CDK13 -associated cyclin K down to 25 nM treatmen t, while compounds B15 and B16 show very little effect on cyclin K pulldown. These results indicate that at concentrations as low as 25 nM B12 successfully targets intracellular CD 12 and CDK13 -associated cyclin K complexes.
[0028] Figure 4 shows binding of intracellular CDK 12 and CDK13 -associated cyclin K complexes by exemplified compounds. Jurkat cells were treated with each compound at a concentration of 500 nM for 6 hours, followed by lysing and pulldown with biotin-ΤΉΖί, and subsequent western blotting for cyclin (Cyc ) and cyclin H (Cyc H). Compounds Bl, B3, B4, B5, B6, B8, B9, and B12 show a loss in CDK12 and CDK13 -associated cyclin K pulldown, indicating that these compounds successfully bind CD 12 and CDK13 - associated cyclin K complexes in cells thus blocking biotin-THZl pull down, while compounds B5, B8, and B9 show a more pronounced loss of cyclin H pulldown, indicating that these compounds successfully target CDK7 -cyclin H complexes in cells and interfere with biotin-THZl pull down.
[0029] Figure 5 shows exemplar ' results of growth assays of select compounds described herein. Jurkat cells were plated at 30,000 cells/well and treated with a titration of compounds indicated. Cells were allowed to grow for 72 hours. Cells were assayed using CELLTITER GLO (Promega) to determine cell viability by measuring the amount of ATP present, which is an indicator of cell metabolic activity. Top panel: luminescent values (y-axis);
concentration in μΜ (uM) (x-axis); the curves are generated using PRISM. Bottom panel: IC50 values in μΜ. Error bars indicate +/- standard deviation. All compounds tested showed anti-proliferative effects to varying extents.
[0030] Figure 6 shows exemplary mass spectrum labeling of CDK12 with compound B12. Compound B12 is able to label CDK12 once treated with a 5 -fold excess of compound B12 for 1 hour at 4 CC.
[0031] Figure 7 shows the binding of intracellular CDK12 and CDK1.3 -associated cyclin complexes by exemplified compounds. Jurkat cells were treated wit each compound at a concentration of 500 nM for 6 hours, followed by lysing and pull down with biotin-THZl, and subsequent western blotting for cyclin K (Cyc K) and cyclin H (Cyc H). Compounds that decrease the pull down efficiency of CDK12 and CDK13 -associated cyclin K complexes indicate those compounds successfully targeted intracellular CD 12 and CDK13 -associated cyclin K complexes and therefore were able to block biotin-THZl pull down of these complexes. In Figure 7 A, compounds MFH 2-90-1 and MFH 2-102-1, show a loss in cyclin K pulldown by biotin-THZl, indicating that these compounds were able to bind intracellular CDK12 and CDK13 -associated cyclin K complexes and block pull down by biotin-THZl. In Figure 7B, compounds MFH 2-90-1, MFH 3-103-1, and MFH 3-151-1, show a loss in cyclin K pulldown by biotin-THZl, indicating that these compounds were able to bind intracellular CDK12 and CDK13 -associated cyclin K complexes and thus block pull down by biotin-THZl . [0032| Figure 8 shows the binding of intracellular CD 12 and CD 13 -associated cyclin K complexes by exemplified compounds. Jurkat cells were treated with each compound at a concentration of 500 nM for 6 hours, followed by lysing and pull down with biotin-THZl, and subsequent western blotting for cyclin K (Cyc K) and cyclin H (Cyc H). Compounds that decrease the pull down efficiency of CD 12 and CDK13 -associated cyclin K complexes indicate those compounds successfully targeted intracellular CDK12 and CDK.13 -associated cyclin K complexes and therefore were able to block biotin-THZ l pull down of these complexes. In Figure 8A, compound THZ 5-31 and MFH 2-90-1 show a loss in cyclin K pulldown by biotin-THZl , indicating that these compounds successfully targeted CDK1.2 and CDK13 -associated complexes in cells and block biotin-THZ l binding. In Figure 8B, compounds THZ 5-31, MFH 2-90-1, THZ-CE B-15, and THZ-CE B-16, show a loss in cyclin K pull down by biotin-THZl, indicating that these compounds successfully targeted CD 12 and CDK13 -associated complexes in cells and block biotin-THZl binding.
[0033] Figure 9 shows the binding of intracellular CDK12 and CDK13 -associated cyclin K complexes by exemplified compounds. Jurkat cells were treated with each compound at a concentration of 500 nM for 4 hours, followed by lysing and pull down with biotin-THZl, and subsequent western blotting for cyclin K (Cyc K) and cyclin H (Cyc H). Compounds that decrease the pull down efficiency of CDK12 and CDK13 -associated cyclin K complexes indicate those compounds successfully targeted intracellular CDK12 and CDK13 -associated cyclin K complexes and therefore were able to block biotin-THZl pull down of these complexes. In Figure 9A, compounds THZ 5-31, MFH 2-90-1, MFH 3-75-1, and MFH 3-81-1 show a loss in cyclin K pull down by biotin-THZl, indicating that these compounds successfully targeted CDK12 and CD 13 -associated complexes in cells and block biotin-THZl binding. In Figure 9B, compounds THZ 5-31 , MFH 4-70-1, and MFH 4~ 70-1 show a loss in cyclin K pull down, by biotin-THZl, indicating that these compounds successfully targeted CDK12 and CDK13 -associated complexes in cells and block biotin- THZl binding.
DEFINITIONS
[0034] Definitions of specific functional groups and chemical terms are described in more detail below. The chemical elements are identified in accordance with the Periodic Table of the Elements, CAS version, Handbook of Chemistry and Physics, 75th Ed., inside cover, and specific functional groups are generally defined as described therein. [0035] Additionally, general principles of organic chemistry , as well as specific functional moieties and reactivity, are described in Thomas Sorrell, Organic Chemistry, University
Science Books, Sausalito, 1999; Smith and March, March 's Advanced Organic Chemistry, 5th Edition, John Wiley & Sons, Inc., New York, 2001 ; Larock, Comprehensive Organic
Transformations, VCH Publishers, Inc., New York, 1989; and Carruthers, Some Modern Methods of Organic Synthesis, 3rd Edition, Cambridge University Press, Cambridge, 1987. The disclosure is not intended to be limited in any manner by the exemplary listing of substituents described herein,
[0036] Compounds described herein can comprise one or more asymmetric centers, and thus ca exist in various isomeric forms, e.g., enantiomers and/or diastereomers. For example, the compounds described herein can be in the form of an individual enantiomer, diastereomer or geometric isomer, or can be in the form of a mixture of stereoisomers, including racemic mixtures and mixtures enriched in one or more stereoisomer. Isomers can be isolated from mixtures by methods know to those skilled in the art, including chiral high pressure liquid chromatography (HPLC) and the formation and crystallization of chiral salts; or preferred isomers can be prepared by asymmetric syntheses. See, for example, Jacques et al,
Enantiomers, Racemates and Resolutions (Wiley Interscience, New York, 1981); Wilen et al, Tetrahedron 33:2725 (1977); Eliel, Stereochemistry of Carbon Compounds (McGraw-Hill, NY, 1962); and Wilen, Tables of Resolving Agents and Optical Resolutions p. 268 (E.L. Eliel, Ed., Univ. of Notre Dame Press, Notre Dame, IN 1972). The disclosure additionally encompasses compounds described herein as individual isomers substantially free of other isomers, and alternatively, as mixtures of various isomers.
[0037J When a range of values is listed, it is intended to encompass each value and sub-range within the range. For example "Ci.g" is intended to encompass, Ci, C2, C3, C , C5, C*, Ci-g,
Ci-5, Ci-4, Cl-3, Cl-2, C2-6, C2-5, C2.-4, C2-3, C3.-6, C3-5, C3-4, C4-6, C4-5, Slid C5-6.
[0038] The term "aliphatic" includes both saturated and unsaturated, straight chain (i.e., unbranched), branched, acyclic, cyclic, or polycyclic aliphatic hydrocarbons, which are optionally substituted with one or more functional groups. As will be appreciated by one of ordinary skill in the art, "aliphatic" is intended herein to include, but is not limited to, alkyl, alkenyl, alkynyl, cyeloalkyl, cycloalkenyl, and cycloalkynyl moieties. Thus, the term "alkyl" includes straight, branched and cyclic alkyl groups. An analogous convention applies to other generic terms such as "alkenyl", "alkynyl", and the like. Furthermore, the terms "alkyl", "alkenyl", "alkynyl", and the like encompass both substituted and unsubstituted groups. In certain embodiments, "lower alkyl" is used to indicate those alkyl groups (cyclic, acyclic, substituted, unsubstituted, branched or unbranched) having 1-6 carbon atoms.
[0039] In certain embodiments, the alkyl, alkenyi, and alkynyl groups employed in the disclosure contain 1-20 aliphatic carbon atoms. In certain other embodiments, the alkyl, alkenyi, and alkynyl groups employed in the disclosure contain 1-10 aliphatic carbon atoms. In yet other embodiments, the alkyl, alkenyi, and alkynyl groups employed in the disclosure contain 1-8 aliphatic carbon atoms. In still other embodiments, the alkyl, alkenyi, and alkynyl groups employed in the disclosure contain 1-6 aliphatic carbon atoms. In yet other embodiments, the alkyl, alkenyi, and alkynyl groups employed in the disclosure contain 1 -4 carbon atoms. Illustrative aliphatic groups thus include, but are not limited to, for example, methyl, ethyl, n-propyl, isopropyl, cyclopropyl, -CH2-cyclopropyl, vinyl, allyl, n-butyl, sec- butyl, isobutyl, tert-butyl, cyclobutyl, -CH2-cyclobutyl, n-pentyl, sec-pentyl, isopentyl, tert- pentyl, cyclopentyl, -CH2-cyclopentyl, n-hexyl, sec-hexyl, cyclohexyl, -CH2-cyclohexyl moieties and the like, which again, may bear one or more substituents. Alkenyi groups include, but are not limited to, for example, ethenyl, propenvl, butenyl, l-methyl-2-buten-l-yl, and the like. Representative alkynyl groups include, but are not limited to, ethynyl, 2- propynyl (propargyl), 1-propynyl, and the like.
[0040] The term "alkyl" refers to a radical of a straight-chain or branched saturated hydrocarbon group having from 1 to 10 carbon atoms ("C<_io alkyl"). In some embodiments, an alkyl group has 1 to 9 carbon atoms ("Q-9 alkyl"). In some embodiments, an alkyl group has 1 to 8 carbon atoms ("Q-s alkyl"). In some embodiments, an alkyl group has 1 to 7 carbon atoms ("Q-7 alkyl"). In some embodiments, an alkyl group has 1 to 6 carbon atoms ("Ci-6 alkyl"). In some embodiments, an alkyl group has 1 to 5 carbon atoms ("Ci_5 alkyl"). In some embodiments, an alkyl group has 1 to 4 carbon atoms ("C^ alkyl"). In some embodiments, an alkyl group has 1 to 3 carbon atoms ("C1-3 alkyl"). In some embodiments, an alkyl group has 1 to 2 carbon atoms ("C<_2 alkyl"). In some embodiments, an alkyl group has 1 carbon atom ("Q alkyl"). In some embodiments, an alkyl group has 2 to 6 carbon atoms ("C2-6 alkyl"). Examples of Q -e alkyl groups include methyl (Q), ethyl (C2), propyl (C3) (e.g., n-propyl, isopropyl), butyl (C4) {e.g., n-butyl, tert-butyl, sec-butyl, iso-butyi), pentyl (C5) (e.g., n-pentyl, 3-pentanyl, amyl, neopentyl, 3-methyl-2-butany2, tertiary amyl), and hexyl (Ce) (e.g., n-hexyl). Additional examples of alkyl groups include n-heptyl (C7), n- octyl (C8), and the like. Unless otherwise specified, each instance of an alkyl group is independently unsubstituted (an "unsubstituted alkyl") or substituted (a "substituted alkyl") with one or more substituents (e.g., halogen, such as F). In certain embodiments, the alkyl group is an unsubstituted Cno alkyl (such as unsubstituted Ci-e alkyl, e.g., -CH3 (Me), unsubstituted ethyl (Et), unsubstituted propyl (Pr, e.g., unsubstituted n-propy] («-Pr), unsubstituted isopropyl (/-Pr)), unsubstituted butyl (Bu, e.g., unsubstituted n-butyl (ra-Bu), unsubstituted te/ -butyl (tert-B or i-Bu), unsubstituted sec-butyl (sec-Bu), unsubstituted isobutyl (/-Bu)). In certain embodiments, the alkyl group is a substituted Ci_io alkyl (such as substituted C e alkyl, e.g., -CF3, Bn).
[0041] "Alkenyl" refers to a radical of a straight-chain or branched hydrocarbon group having from 2 to 20 carbon atoms, one or more carbon-carbon double bonds, and no triple bonds ("C2-20 alkenyl"). In some embodiments, an alkenyl group has 2 to 10 carbon atoms ("C2-io alkenyl"). In some embodiments, an alkenyl group has 2 to 9 carbon atoms ("C2-9 alkenyl"). in some embodiments, an alkenyl group has 2 to 8 carbon atoms ("C2-8 alkenyl"). In some embodiments, an alkenyl group has 2 to 7 carbon atoms ("C2-7 alkenyl"). In some embodiments, an alkenyl group has 2 to 6 carbon atoms ("C2-6 alkenyl"). In some
embodiments, an alkenyl group has 2 to 5 carbon atoms ("C2-5 alkenyl"). In some
embodiments, an alkenyl group has 2 to 4 carbon atoms ("C2-4 alkenyl"). In some
embodiments, an alkenyl group has 2 to 3 carbon atoms ("C2-.3 alkenyl"). In some
embodiments, a alkenyl group has 2 carbon atoms ("C2 alkenyl"). The one or more carbon- carbon double bonds can be internal (such as in 2-butenyl) or terminal (such as in 1-butenyl). Examples of C2-4 alkenyl groups include ethenyl (C2), 1-propenyl (C3), 2-propenyl (C3), 1- butenyl (C4), 2-butenyl (C ), butadienyl (C4), and the like. Examples of C2-6 alkenyl groups include the aforementioned C2-4 alkenyl groups as well as pentenyl (C5), pentadienyl (C5), hexenyl (Ce), and the like. Additional examples of alkenyl include heptenyl (C?), octenyl (C8), octatrienyl (Cg), and the like. Unless otherwise specified, each instance of an alkenyl group is independently optionally substituted, i.e., unsubstituted (an "unsubstituted alkenyl") or substituted (a "substituted alkenyl") with one or more substituents. In certain embodiments, the alkenyl group is unsubstituted€2-10 alkenyl. In certain embodiments, the alkenyl group is substituted C2-10 alkenyl. In an alkenyl group, a C=C double bond for which the stereochemistry is not specified (e.g., ~CH=CHCH3 or ) may be an (is)- or (Z)- double bond.
[0042] "Alkynyl" refers to a radical of a straight-chain or branched hydrocarbon group having from 2 to 20 carbon atoms, one or more carbon-carbon triple bonds, and optionally one or more double bonds ("C2-20 alkynyl"). In some embodiments, an alkynyl group has 2 to 10 carbon atoms ("C2-10 alkynyl"). In some embodiments, an alkynyl group has 2 to 9 carbon atoms ("C2-9 alkynyl"). In some embodiments, an alkynyl group has 2 to 8 carbon atoms ("C2- 8 alkynyl"). In some embodiments, an alkynyl group has 2 to 7 carbon atoms ("C2-7 alkynyl"). In some embodiments, an alkynyl group has 2 to 6 carbon atoms ("C2-6 alkynyl"). In some embodiments, an alkynyl group has 2 to 5 carbon atoms ("C2-5 alkynyl"). In some
embodiments, an alkynyl group has 2 to 4 carbon atoms ("C2-4 alkynyl"). In some
embodiments, an alkynyl group has 2 to 3 carbon atoms ("C2-3 alkynyl"). In some
embodiments, an alkynyl group has 2 carbon atoms ("C2 alkynyl"). The one or more carbon- carbon triple bonds can be internal (such as in 2-butynyl) or terminal (such as in 1 -butynyl). Examples of C2- alkynyl groups include, without limitation, ethyny] (C2), 1-propynyl (C3), 2- propynyl (C3), 1-butynyl (C4), 2-butynyl (C4), and the like. Examples of€ alkenyl groups include the aforementioned C2-4 alkynyl groups as well as pentynyl (C¾), hexynyl (Ce), and the like. Additional examples of alkynyl include heptynyl (C7), octynyl (C8), and the like. Unless otherwise specified, each instance of an alkynyl group is independently optionally substituted, i.e., unsubstituted (an "unsubstituted alkynyl") or substituted (a "substituted alkynyl") with one or more substituents. In certain embodiments, the alkynyl group is unsubstituted C2-1o alkynyl. In certain embodiments, the alkynyl group is substituted C2-1o alkynyl.
[0043] "Carbocyclyl" or "carbocyclic" refers to a radical of a non-aromatic cyclic hydrocarbon group having from 3 to 10 ring carbon atoms ("C3 0 carbocyclyl") and zero heteroatoms in the non-aromattc ring system, in some embodiments, a carbocyclyl group has 3 to 8 ring carbon atoms ("C3-8 carbocyclyl"). In some embodiments, a carbocyclyl group has 3 to 6 ring carbon atoms ("C3_6 carbocyclyl"). In some embodiments, a carbocyclyl group has 3 to 6 ring carbon atoms ("C3-6 carbocyclyl"). In some embodiments, a carbocyclyl group has 5 to 10 ring carbon atoms ("€'5 0 carbocyclyl"). Exemplary C3-6 carbocyclyl groups include, without limitation, cyclopropyl (C3), cyclopropenyl (C3), cyclobutyl (C4), cvclobutenyl (C4), cyclopentyl (C5), cyclopentenyl (C5), cyclohexyl ¾, cyclohexenyl (Cg), cyclohexadienyl (Ce), and the like. Exemplary€3.8 carbocyclyl groups include, without limitation, the aforementioned C3-6 carbocyclyl groups as well as cycloheptyl (C7), cycloheptenyl (C7), cycloheptadienyl (C7), cycloheptatrienyl (C7), cyclooctyl (C8), cyclooctenyl (C8),
bicyclo[2.2.1]heptanyl (C7), bicyclo [2.2.2 joctanyl (C ), and the like. Exemplary€3.10 carbocyclyl groups include, without limitation, the aforementioned€3.8 carbocyclyl groups as well as cyclononyl (C9), cyclononenyl (C9), eyclodecyl (Cio), cyclodecenyl (Cio), octahydro- lH-indenyl (C9), decahydronaphthalenyl (Cio), spiro[4.5]decanyl (Cio), and the like. As the foregoing examples illustrate, in certain embodiments, the carbocyclyl group is either monocyclic ("monocyclic carbocyclyl") or contain a fused, bridged or spiro ring system such as a bicyclic system ("bicyclic carbocyclyl") and can be saturated or can be partially unsaturated. "Carbocyclyl" also includes ring systems wherein the carbocyclic ring, as defined above, is fused with one or more aryl or heteroaiyl groups wherein the point of attachment is on the carbocyclic ring, and in such instances, the number of carbons continue to designate the number of carbons in the carbocycitc ring system. Unless otherwise specified, each instance of a carbocyclyl group is independently optionally substituted, i.e.,
unsubstituted (an "unsubstituted carbocyclyl") or substituted (a "substituted carbocyclyl") with one or more substituents. In certain embodiments, the carbocyclyl group is unsubstituted C3.10 carbocyclyl. In certain embodiments, the carbocyclyl group is substituted C3..10 carbocyclyl.
[0044] In some embodiments, "carbocyclyl" is a monocyclic, saturated carbocyclyl group having from 3 to 10 ring carbon atoms ("C3.10 cycloalkyl"). In some embodiments, a
cycloalkyl group has 3 to 8 ring carbon atoms ("C3 cycloalkyl"). In some embodiments, a cycloalkyl group has 3 to 6 ring carbon atoms ("C3-6 cycloalkyl"). In some embodiments, a cycloalkyl group has 5 to 6 ring carbon atoms ("C5-6 cycloalkyl"). In some embodiments, a cycloalkyl group has 5 to 10 ring carbon atoms ("€5 0 cycloalkyl"). Examples of C5..6 cycloalkyl groups include cyclopentyl (C5) and cyclohexyl (C5). Examples of C3-6 cycloalkyl groups include the aforementioned C5-6 cycloalkyl groups as well as cyclopropyl (C3) and cyclobutyl (C4). Examples of C3-8 cycloalkyl groups include the aforementioned C3-6 cycloalkyl groups as well as eycloheptyl (C7) and cvclooctyl (Cs). Unless otherwise specified, each instance of a cycloalkyl group is independently unsubstituted (an "unsubstituted cycloalkyl") or substituted (a "substituted cycloalkyl") with one or more substituents. In certain embodiments, the cycloalkyl group is unsubstituted C3.10 cycloalkyl. In certain embodiments, the cycloalkyl group is substituted C3 0 cycloalkyl.
[0045] "Heterocyclyi" or "heterocyclic" refers to a radical of a 3- to 10-membered non- aromatic ring system having ring carbon atoms and 1 to 4 ring heteroatoms, wherein each heteroatom is independently selected from nitrogen, oxygen, sulfur, boron, phosphorus, and silicon ("3-10 membered heterocyclyi"). In heterocyclyi groups that contain one or more nitrogen atoms, the point of attachment can be a carbon or nitrogen atom, as valency permits. A heterocyclyi group can either be monocyclic ("monocyclic heterocyclyi") or a fused, bridged, or spiro ring system, such as a bicyclic system ("bicyclic heterocyclyi"), and can be saturated or can be partially unsaturated. Heterocyclyi bicyclic ring systems can include one or more heteroatoms in one or both rings. "Heterocyclyi" also includes ring systems wherein the heterocyclic ring, as deiined above, is fused with one or more carbocyclyl groups wherem the point of attachment is either on the carbocyclyl or heterocyclic ring, or ring systems wherem the heterocyclic ring, as defined above, is fused with one or more aryl or heteroaryl groups, wherein the point of attachment is on the heterocyclic ring, and in such instances, the number of ring members continue to designate the number of ring members in the heterocyclic ring system. Unless otherwise specified, each instance of heterocyclyl is independently optionally substituted, i.e., unsubstituted (an "unsubstituted heterocyclyl") or substituted (a "substituted heterocyclyi") with one or more substituents. In certain embodiments, the heterocyclyl group is unsubstituted 3-1.0 membered heterocyclyl. In certain embodiments, the heterocyclyl group is substituted 3-10 membered heterocyclyl.
[0046] in some embodiments, a heterocyclyl group is a 5-10 membered, non-aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms, wherem each heteroatom is independently selected from nitrogen, oxygen, sulfur, boron, phosphorus, and silicon ("5-10 membered heterocyclyl"). in some embodiments, a heterocyclyl group is a 5-8 membered non-aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur ("5-8 membered heterocyclyl"). In some embodiments, a heterocyclyl group is a 5-6 membered non-aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur ("5-6 membered heterocyclyl"). In some embodiments, the 5-6 membered heterocyclyl has 1.-3 ring heteroatoms selected from nitrogen, oxygen, and sulfur. In some embodiments, the 5-6 membered heterocyclyl has 1 -2 ring heteroatoms selected from nitrogen, oxygen, and sulfur. In some embodiments, the 5-6 membered heterocyclyl has one ring heteroatom selected from nitrogen, oxygen, and sulfur.
[0047] Exemplaiy 3-membered heterocyclyl groups containing one heteroatom include, without limitation, azirdiiiyl, oxiranyl, thiiranyl. Exemplary 4-membered heterocyclyl groups containing one heteroatom include, without limitation, azetidinyl, oxetanyl and thietanyl. Exemplary 5-membered heterocyclyl groups containing one heteroatom include, without limitation, tetrahydrofuranyl, dihydrofuranyl, tetrahydrothiophenyl, dihydrothiophenyl, pyrrolidinyl, dihydropyrrolyl, and pyrrolyl-2,5-dione. Exemplaiy 5-membered heterocyclyl groups containing two heteroatoms include, without limitation, dioxolanyl, oxasulfuranyl, disulfuranyl, and oxazolidin-2-one. Exemplary 5-membered heterocyclyl groups containing three heteroatoms include, without limitation, triazolinyl, oxadiazoimyi, and thiadiazolinyl. Exemplary 6-membered heterocyclyl groups containing one heteroatom include, without limitation, piperidinyl, tetrahydropyranyl, dihydropyridinyl, and thianyl. Exemplary 6- inembered heierocyclyl groups containing two heteroatoms include, without limitation, piperazinyl, morpholmyl, dithiany], and dioxanyl. Exemplary 6-membered heierocyclyl groups containing two heteroatoms include, without limitation, triazinanyl. Exemplary 7- membered heierocyclyl groups containing one heteroatom include, without limitation, azepanyl, oxepanyl and thiepanyl. Exemplar}' 8-membered heterocyclyl groups containing one heteroatom include, without limitation, azocanyl, oxecanyl and thiocanyl. Exemplar ' 5- membered heterocyclyl groups fused to a Cf, aryl ring (also referred to herein as a 5,6~bicyclic heterocyclic ring) include, without limitation, indolinyl, isoindolinyl, dihydrobenzofuranyl, dihydrobenzothienyl, benzoxazolmony], and the like. Exemplary 6-membered heterocyclyl groups fused to an aryl ring (also referred to herein as a 6,6-bicyclic heterocyclic ring) include, without limitation, tetrahydroquinolinyi, tetrahydroisoquinoiinyl, and the like.
[0048] "Aryl" refers to a radical of a monocyclic or poly cyclic (e.g., bicyclic or tricyclic) 4n+2 aromatic ring system (e.g., having 6, 10, or 14 pi electrons shared in a cyclic array) having 6-14 ring carbon atoms and zero heteroatoms provided in the aromatic ring system ("C6-14 aryl"). In some embodiments, an aryl group has six ring carbon atoms ("Q, ary '; e.g., phenyl). In some embodiments, an aryl group has ten ring carbon atoms ("do aryl"; e.g., naphthyl such as 1-naphthyl and 2-naphthyl). In some embodiments, an aryl group has fourteen ring carbon atoms ("C14 aryl"; e.g., anthracyl). "Aryl" also includes ring systems wherein the aryl ring, as defined above, is fused with one or more carbocyclyl or heterocyclyl groups, wherein the radical or point of attachment is on the aryl ring, and in such instances, the number of carbon atoms continue to designate the number of carbon atoms in the ary l ring system. Unless otherwise specified, each instance of an aryl group is independently optionally substituted, i.e., unsubstituted (an "unsubstituted aryl") or substituted (a
"substituted aryl") with one or more substituents. In certain embodiments, the aryl group is unsubstituted C6- - 4 aryl. In certain embodiments, the aryl group is substituted Q,-i4 aryl.
[0049] "Aralkyl" refers to an optionally substituted alkyl group substituted by an optionally substituted aryl group. In certain embodiments, the aralkyl is optionally substituted benzyl. In certain embodiments, the aralkyl is benzyl. In certain embodiments, the aralkyl is optionally substituted phenethyl. In certain embodiments, the aralkyl is phenethyl.
[0050! "Heteroaryl" refers to a radical of a 5-10 membered, monocyclic or bicyclic 4n+2 aromatic ring system (e.g., having 6 or 10 pi electrons shared in a cyclic array) having ring carbon atoms and 1-4 ring heteroatoms provided in the aromatic ring system, wherein each heteroatom is independently selected from nitrogen, oxygen and sulfur ("5-10 membered heteroaryl"). In heteroaryl groups that contain one or more nitrogen atoms, the point of attachment can be a carbon or nitrogen atom, as valency permits. Heteroaryl bicyclic ring systems can include one or more heteroatoms in one or both rings. "Heteroaryl" includes ring systems wherein the heteroaryl ring, as defined above, is fused with one or more carbocyclyl or heterocyclyl groups wherein the point of attachment is on the heteroaryl ring, and in such instances, the number of ring members continue to designate the number of ring members in the heteroaryl ring system. "Heteroaryl" also includes ring systems wherein the heteroaryl ring, as defined above, is fused with one or more aryl groups wherein the point of attachment is either on the ary l or heteroaryl ring, and in such instances, the number of ring members designates the number of ring members in the fused (aryl/heteroaryl) ring system. Bicyclic heteroaryl groups wherein one ring does not contain a heteroatom (e.g., indolyl, quinolinyl, carbazolyl, and the like) the point of attachment can be on either ring, i.e., either the ring bearing a heteroatom (e.g., 2-indolyl) or the ring that does not contain a heteroatom (e.g., 5- indolyl).
[0051] In some embodiments, a heteroaryl group is a 5-10 membered aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms provided in the aromatic ring system, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur ("5-10 membered heteroaryl"). In some embodiments, a heteroaryl group is a 5-8 membered aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms provided in the aromatic ring system, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur ("5-8 membered heteroaryl"). In some embodiments, a heteroaryl group is a 5-6 membered aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms provided in the aromatic ring system, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur ("5-6 membered heteroaryl"). In some embodiments, the 5- 6 membered heteroaryl has 1-3 ring heteroatoms selected from nitrogen, oxygen, and sulfur. In some embodiments, the 5-6 membered heteroaryl has 1-2 ring heteroatoms selected from nitrogen, oxygen, and sulfur. In some embodiments, the 5-6 membered heteroaryl has 1 ring heteroatom selected from nitrogen, oxygen, and sulfur. Unless otherwise specified, each instance of a heteroaryl group is independently optionally substituted, i.e., unsubstituted (an "unsubstituted heteroaryl") or substituted (a "substituted heteroaryl") with one or more substituents. In certain embodiments, the heteroaryl group is unsubstituted 5-14 membered heteroaryl. In certain embodiments, the heteroaryl group is substituted 5-14 membered heteroaryl.
[0052] Exemplary 5-membered heteroaryl groups containing one heteroatom include, without limitation, pyrrolyl, furanyl, and thiophenyl. Exemplary 5-membered heteroaryl groups containing two heteroatoms include, without limitation, imidazolyl, pyrazolyl, oxazolyl, isoxazolyl, thiazolyl, and isothiazolyl. Exemplary 5-membered heteroaryl groups containing three heteroatoms include, without limitation, triazolyl, oxadiazolyl, and thiadiazolyl.
Exemplar}' 5-membered heteroaiyl groups containing four heteroatoms include, without limitation, tetrazolyl. Exemplary 6-membered heteroaryl groups containing one heteroatom include, without limitation, pyridinyl. Exemplary 6-membered heteroaryl groups containing two heteroatoms include, without limitation, pyridazinyl, pyrimidinyl, and pyrazinyl.
Exemplar 6-membered heteroaryl groups containing three or four heteroatoms include, without limitation, triazinyl and tetrazinyl, respectively. Exemplary 7-membered heteroaryl groups containing one heteroatom include, without limitation, azepinyl, oxepinyl, and thiepinyl. Exemplary 5,6-bicyciic heteroaryl groups include, without limitation, indoiyl, isoindolyl, indazolyl, benzotriazolyl, benzothiophenyl, isobenzothiophenyl, benzofuranyl, benzoisofurany], benzimidazolyl, benzoxazolyl, benzisoxazolyl, benzoxadiazolyl, benzthiazolyl, benzisothiazolyl, benzthiadiazolyl, indolizinyl, and purinyl. Exemplary 6,6- bicyclic heteroaryl groups include, without limitation, naphthyridmyl, pteridinyl, quinolmyl, isoquinolinyl, cinnolinyl, quinoxalmyl, phthalazinyl, and quinazolinyl.
[0053] "Heteroaralkyl" is a subset of alkyl and heteroaryl and refers to an optionally substituted alkyl group substituted by an optionally substituted heteroaryl group.
[0054] "Unsaturated" or "partially unsaturated" refers to a group that includes at least one double or triple bond. A "partially unsaturated" ring system is further intended to encompass rings having multiple sites of unsaturation, but is not intended to include aromatic groups (e.g., aryl or heteroaryl groups). Likewise, "saturated" refers to a group that does not contain a double or triple bond, i.e., contains all single bonds.
[0055] Alkyl, alkenyl, alkyny], carbocyclyl, heterocyclyl, aryl, and heteroaryl groups, which are divalent linking groups, are further referred to using the suffix -ene, e.g., alkylene, alkenylene, alkynylene, carbocyclylene, heterocyclylene, arylene, and heteroarylene.
[0056] An atom, moiety, or group described herein may be unsubstituted or substituted, as valency permits, unless otherwise provided expressly. The term "optionally substituted" refers to substituted or unsubstituted.
[0057J A group is optionally substituted unless expressly provided otherwise. The term "optionally substituted" refers to being substituted or unsubstituted. In certain embodiments, alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl groups are optionally substituted (e.g., "substituted" or "unsubstituted" alkyl, "substituted" or "unsubstituted" alkenyl, "substituted" or "unsubstituted" alkynyl, "substituted" or "unsubstituted" carbocyclyl, "substituted" or "unsubstituted" heterocyclyl, "substituted" or "unsubstituted" aryl or "substituted" or "unsubstituted" heteroary] group). I general, the term "substituted", whether preceded by the term "optionally" or not, means that at least one hydrogen present on a group (e.g., a carbon or nitrogen atom) is replaced with a permissible substituent, e.g., a substituent which upon substitution results in a stable compound, e.g., a compound which does not spontaneously undergo transformation such as by rearrangement, cyclization, elimination, or other reaction. Unless otherwise indicated, a "substituted" group has a substituent at one or more substitutable positions of the group, and when more than one position in any given structure is substituted, the substituent is either the same or different at each position. The term "substituted" is contemplated to include substitution with all permissible substituents of organic compounds, any of the substituents described herein that results in the formation of a stable compound. The present disclosure contemplates any and all such combinations in order to arrive at a stable compound. For purposes of this disclosure, heteroatoms such as nitrogen may have hydrogen substituents and/or any suitable substituent as described herein which satisfy the valencies of the heteroatoms and results in the formation of a stable moiety. In certain embodiments, the substituent is a carbon atom substituent. In certain embodiments, the substituent is a nitrogen atom substituent. In certain embodiments, the substituent is an oxygen atom substituent. In certain embodiments, the substituent is a sulfur atom substituent.
[0058] Exemplary carbon atom substituents include, but are not limited to, halogen, -CN, -NO2, -N3, -SO2H, -SO3H, -OH, -GRaa, -ON(Rbb)2, -N(Rbb)2, N( RhV , -N(ORcc)Rbb,
-C(=G)Raa, -CO2H, -CHQ, ~C(ORcc)2, ~CO2Raa, -OC(=
-OCG2Raa, -C(=0)N(Rbb)2, -OC(===0)N(Rbb)2, -NRbbC(=0)Raa, -NRbbC02Raa 5
-NRbbC(-0)N(Rbb)2, -C(-NRbb)Raa, -C(=NR b)ORaa, -OC(= Rbb)Raa, -OC(-NRbb)ORaa, -C(=NRbb)N(Rbb)2, -GC(=NRbb)N(Rbb)2, -NRbbC(=NRbb)N(Rbb)2, -C(=0)NRbbS02Raa, -NRbbSQ2Raa, -S02 (Rbb)2, ~S02Raa, ~SQ2ORaa, ~OS02Raa, ~S(===0)Raa, -OS( ))Raa, -Si(Raa)3, -OSi(Raa)3 -C(=S)N(Rbb)2, -C(0)SRaa, -C(-S)SRaa, -SC(-S)SRaa,
-SC(=0)SRaa, -OC(=0)SRaa, -SC(=0)GRaa, -SC(=0)Raa, -P(=0)(Raa)2, -P(=G)(ORcc)2, "0Ρ(=0)(ί 2, -OP(=G){ORcc)2, ~P(=0)(N(Rbb)2)2, ~OP(=0)(N(Rbb)2)2, ~ RbbP(=0)(Raa)2, -NRbbP(===0)(ORcc)2, -NRbbP(= ))(N(Rbb)2)2, -~P(RCC)2, -P(ORcc)2, P(R :)3 ' X ,
P{ORt )3 ' X , -P(RCC)4, -P(ORcc)4, -OP(Rcc)2, ()P(RC'-)3 ' X , -OP(ORcc)2, (>P(i)R t)3 ' X , -OP(Rcc)4, -OP(ORcc)4, -B(Raa)2, -B(OR£C)2, BRa'{OR ''"")., CM0 alkyl, CL IO perhaloalkyl, C2-io alkenyl, C2-io alkynyl, heteroCi-io alkyl, heteroC2-i o alkenyl, heteroC2- 1Q alkynyl, C3-io carbocyclyl, 3-14 membered heterocyclyl, Cfr.14 aryl, and 5-14 membered heteroary], wherein each alkyl, alkenyl, alkynyl, heteroalkyl, heteroalkenyl, eteroalkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 Rdd groups; wherein X~ is a counterion;
or two geminal hydrogens on a carbon atom are replaced with the group =0, =S, =NN(R )2, =NNRbbC(=0)Raa, =NNRbbC(O)0Raa, ===NNRbbS(===0)2Raa, =NRbb, or ===NORcc; each instance of R a is, independently, selected from CMO alkyl, CMO perhaloalkyl, C2-io alkenyl,€2- 10 alkynyl, C3..10 carbocyclyl, 3-14 membered heterocyclyl, Ce-w aryl, and 5- 14 membered heteroaryl, or two Raa groups are joined to form a 3-14 membered heterocyclyl or 5-14 membered heteroaryl ring, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 Rdd groups;
each instance of Rbb is, independently, selected from hydrogen, -OH, -OR*8,
- (RCC)2, --CN, C(~0)Ri,!\ -C(-0) (Rcc)2, -C02Raa, -S02Raa, -C(-NRcc)ORaa,
-C(= RCC)N(RCC)2, -SG2N(RCC)2, -S02Rcc, -S02ORcc, SORm, -C(=S) (R)2, -C(=0)SRcc, -C(=S)SRCC, -P(=0)(Raa)2, -P(=0)(GRcc)2, -P(=Q)(N(RCC)2)2, CM0 alkyl Ci-!0 perhaloalkyl, C2-io alkenyl, C2.1o alkynyl, heteroCnoalkyl, heteroC2-ioalkenyl, heteroC2. loalkynyl, C3 0 carbocyclyl, 3-14 membered heterocyclyl, C6-14 aryl, and 5-14 membered heteroaryl, or two Rbb groups are joined to form a 3-14 membered heterocyclyl or 5-14 membered heteroaryl ring, wherein each alkyl, alkenyl, alkynyl, heteroalkyl, heteroalkenyl, heteroalkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1 , 2, 3, 4, or 5 RM groups; wherein X is a counterion;
each instance of Rcc is, independently, selected from hydrogen, Cuo alkyl, C O perhaloalkyl, C2-10 alkenyl, C2-io alkynyl, C3. 0 carbocyclyl, 3-14 membered heterocyclyl, Cg. 14 aryl, and 5-14 membered heteroaryl, or two Rcc groups are joined to form a 3-14 membered heterocyclyl or 5-14 membered heteroaryl ring, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 RM groups;
each instance of Rdd is, independently, selected from halogen, -CN, -N02, -N3, -SO2H, -SO3H, -OH, -OR* -ON(Rff)2, -N(Rfl)2, -N^X - (ORes)Rff, ~SH, -SR* -SSR", -C(===0)Ree, -C02H, -C02R8e, -OC(===0)Re8, -OCQjR" -C(===0)N(Rff)2,
-OC(-0) (RtT)2, -NRffC(-0)Ree, -NRffC02Re8, -NRffC(-0) (Rff)2, -C(- Rff)ORes,
Figure imgf000022_0001
-NRflC(===NRfljN(Rff)2, - R¾02Ree, -S02N(Rfl)2, ~S02Rse, ~S02ORee, ~OS02Ree, -S(-0)Re8, -Si(Ree)3, -OSi(Ree)3, -C(-S)N(Rfi)2, -C(-0)SR88, -C(-S)SR88, -SC(=S)SRse, -P(=0)(ORee)2> -P(=0)(Res)2, -OP( ))(Ree)2, ~OP(===0)(ORee)2,€,.6 alkyl, C 6 perhaloalkyl, C2-6 alkenyl, C2.g alkynyl, heteroCi.galkyl, heteroC2..6alkeny3, heteroC2..6a3kynyl, C3.10 earboeyclyl, 3-10 membered heterocyclyi, C(,.IQ aryl, 5-10 membered heteroaryl, wherein each alkyl, alkenyl, alkynyl, heteroalkyl, heteroalkenyl, heteroalkynyl, earboeyclyl, heterocyclyi, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 Rss groups, or two geminal substituents can be joined to form =0 or =S; wherein X is a counterion;
each instance of Ree is, independently, selected from Ci-6 alkyl, d-e perhaloalkyl, C2-6 alkenyl, C2-6 alkynyl, C3..10 earboeyclyl, Cg-io aryl, 3-10 membered heterocyclyi, and 3-10 membered heteroaryl, wherem each alkyl, alkenyl, alkynyl, earboeyclyl, heteroeyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 R88 groups;
each instance of R * is, independently, selected from hydrogen, d-e alkyl, G_e perhaloalkyl, C2.g alkenyl, C2.g alkynyl, C3 0 earboeyclyl, 3-10 membered heterocyclyi, Cg-io aryl and 5-10 membered heteroaryl, or two R1' groups are joined to form a 3-14 membered heterocyclyi or 5-14 membered heteroaryl ring, wherein each alkyl, alkenyl, alkynyl, earboeyclyl, heterocyclyi, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 Rgg groups; and
each instance of Rss is, independently, halogen, -CN, -NO2, -N3, ~SQ2H, -SO3H, -OH, -OCi-6 alkyl, ON(d ,, alkyl)2, N(C alkyl)2, N(G ;> alkyl).-, ' X , Ni l(G <, alkyl)2 +X , S2(G„ alkyl) +X , M S, X , -N(OCi-6 alky])(d-6 alkyl), N(OH)(C ,, alkyl), -NH(OH), -SH, SC. alkyl, SS(Ci <, alkyl), {"())(C; f, alkyl), iX i 1, -C02(d~6 alkyl), -OC(=0)(Ci_6 alkyl), ~OCG2(d-6 alkyl), -C(=0)NH2, -C(=0)N(Cl-6 alkyl)2,
OC(" )N H(d„ alkyl), -NHC(=0)( , ;> alkyl), K(G (, aikyl)C(= ))( Ci_6 alkyl),
-NHC02(Ci.6 alkyl), - HC(-0)N(Cs..6 alkyl)2, -NHC(-0) H(Ci..6 alkyl), -NHC(=0)NH2, -C(=NH)0(Ci-6 alkyl),
Figure imgf000023_0001
-6 alkyl)2, -C(= H)NH(Ci-6 alkyl), -C(=NH)NH2, -OC(=NH)N(Ci-6 alkyi)2, -OC( H) H(Ci. 6 alkyl), -OC(NH)NH2, -NHC(NH)N(Ci-.6 alkyl)2, -NHC(=NH)NH2, NI 1S02(G (1 alkyl), -S02N(Ci..6 alkyl)2, S02N H(G (, alkyl), -S02 H2, -SG2d-6 alkyl, -S020d -6 alkyl, -OSQsCi-e alkyl, -SOCi-6 alkyl, -Si(Cl-6 alkyl)3, ~GSi(d-6 alkyl)3
Figure imgf000023_0002
aikyl)2, C( "S)N H(d <, alkyl), C(=S) ¾, -C(===0)S(Cl.6 alkyl), -C(=S)SCi-6 alkyl, SC(-S}SG ,, alkyl,
Figure imgf000023_0003
alkyl)2, -P(0)(G-6 alkyl)2, -0P(O)(d-6 alkyl)2,
alkyl)2, Ci-6 alkyl, -6 perhaloalkyl, C2-6 alkenyl, C2-6 alkynyl, hetero -6alkyl, heteroC2. 6alkenyl, heteroC2-6alkynyl,€3-10 earboeyclyl, Ce-io aryl, 3-10 membered heterocyclyi, 5-10 membered heteroaryl; or two geminal Rs substituents can be joined to form =0 or ==S;
wherein X is a counterion.
[0059] A "counterion" or "anionic counterion" is a negatively charged group associated with a positively charged group in order to maintain electronic neutrality. An anionic counterion may be monovalent (i.e., including one formal negative charge). An anionic counterion may also be multivalent (i.e., including more than one formal negative charge), such as divalent or trivalent. Exemplary counterions include halide ions (e.g., F~, CF, Br , F), NO3 ", C V, OH", H2P04~, HC03 , HS04~, sulfonate ions (e.g., methansulfonate, trifluoromethanesulfonate, / - toluenesulfonate, benzenesulfonate, 10-camphor sulfonate, naphthalene-2-sulfonate, naphthalene-l-sulfonic acid-5-sulfonate, ethan-l-sulfonic acid-2-sulfonate, and the like), carboxylate ions (e.g., acetate, propanoate, benzoate, gly cerate, lactate, tartrate, glycoiate, gluconate, and the like), BF4 ", PF_f , PF6 ~ AsF6 ~ SbF6 ~ B[3,5-(CF3)2C6H3]4 , B(C6F5)4 ~, BPh4 "", A](OC(CF3)3)4 , and carborane anions (e.g., CBuH12 " or (HCBuMesBrg) ),
Exemplary counterions which may be multivalent include CO3 2 ~, 1 Ρ{..), , P04 3~ B407 2~, S04 2~, S203 ~, carboxylate anions (e.g., tartrate, citrate, fumarate, maleate, maiate, malonate, gluconate, succinate, glutarate, adipate, pimelate, suberate, azelate, sebacate, salicylate, phthalates, aspartate, glutamate, and the like), and carboranes.
[0060] "Halo" or "halogen" refers to fluorine (fluoro, -F), chlorine (chloro, -CI), bromine (bromo, -Br), or iodine (iodo, -I).
[0061] The term "hydroxy!" or "hydroxy" refers to the group -OH. The term "substituted hydroxy!" or "substituted hydroxyl," by extension, refers to a hydroxy! group wherein the oxygen atom directly attached to the parent molecule is substituted with a group other than hydrogen, and includes groups selected from -OR88, -ON(Rbb)2, -0C(=O)SR88,
-0C(O)Raa, -OC02Raa, -OC(-0)N(Rbb)2, -OC(- Rbb)Raa, -OC(-NRbb)OR8a,
-OC(=NRbb)N(Rbb)2, -OS(=0)Raa, -OS02Raa, -OSi(Raa)3, -QP(RCC)2, -QP(RCC)3 +X~, -OP(ORcc)2, -OP(ORcc)3 +X , -0P(==O)(Ra3)2, -OP(-0)(ORcc)2, and -OP(==0)(N(Rbb))2, wherein X , R88, Rbb, and Rcc are as defined herein.
[0062] "Acy!" refers to a moiety selected from the group consisting of -C(=0)R88,-CHO, - C02Raa, -C(=0)N(Rbb)2, -C(=NRbb)Raa, -C(=NRbb)ORae, -C(=NRbb)N(Rbb)2, - C(===0)NRbbS02Raa, -C(=S)N(Rbb)2, -C(=0)SRaa, or -C(==S)SRaa, wherein R88 and Rbb are as defined herein.
[0063| The term "amino" refers to the group -NH2. The term "substituted amino," by extension, refers to a monosubstituted amino, a disubstituted amino, or a trisubstituted amino. In certain embodiments, the "substituted amino" is a monosubstituted amino or a
disubstituted amino group,
[0064J Nitrogen atoms ca be substituted or unsubstituted as valency permits, and include primary, secondary, tertiary, and quaternary nitrogen atoms. Exemplary nitrogen atom substituents include, but are not limited to, hydrogen, -OH, -OR38, -N(RCC)2, -CN,
Figure imgf000025_0001
-C(-0)N(Rcc)2, C();:R a, -S02Raa, -C(-NRbb)Raa, -~C(-NRcc)ORaa,
-C(=NRCC)N(RCC)2, -S02N(Rcc)2, -S02Rcc, ~S02ORcc, SORm, -C(=S)N(R)2, -C(=0)SRcc, -C(===S)SRCC, -P(===0)(ORcc)2, -P(===0)(Raa)2, -P(==0)(N(Rcc)2)2, CM0 alkyi, Cno perhaloalkyl, C -io alkenyl, C2.1o alkynyl, heteroCnoalkyl, heteroC2.ioalkenyl, heteroC2. loalkynyl, C3 0 carbocyclyl, 3-14 membered heterocyclyl, C(,- i4 aryl, and 5-14 membered heteroaryl, or two R groups attached to an N atom are joined to form a 3-14 membered heterocyclyl or 5-14 membered heteroaryl ring, wherein each alkyl, alkenyl, alkynyl, heteroalkyl, heteroalkenyl, heteroalkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 Rdd groups, and wherein Raa, Rbb, Rcc and Rdd are as defined above.
[0065] In certain embodiments, the substituent present on a nitrogen atom is a nitrogen protecting group (also referred to as an amino protecting group). Nitrogen protecting groups include, but are not limited to, -OH, -QRaa, -N(RCC)2, -C(=Q)Raa, -C(=0)N(Rcc)2, -C02Raa, - S02Raa, -C(=NRcc)Raa, -C(=NRcc)ORaa, -C(=NR£C)N(RCC)2, -S02N(Rcc)2, -S02Rcc, -S02ORcc, - SORaa, -C(===S)N(RCC)2, -C(===0)SRcc, -C(===S)SRCC, CM0 alkyl (e.g., aralkyi, heteroaralkyi), C2_10 alkenyl, C2.1o alkynyl, C3.io carbocyclyl, 3-14 membered heterocyclyl, Ce-14 aryl, and 5-14 membered heteroaryl groups, wherem each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aralkyi, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 Rdd groups, and wherein Ra , Rbb, Rco and Rdd are as defined herein. Nitrogen protecting groups are well known in the art and include those described in detail in Protecting Groups in Organic Synthesis, T. W. Greene and P. G. M. Wuts, 3rd edition, John Wiley & Sons, 1999, incorporated herein by reference.
[0066] For example, nitrogen protecting groups such as amide groups (e.g., -C(=0)Raa) include, but are not limited to, formamide, acetamide, chloroacetamide, trichloroacetamide, frifluoroacetamide, phenylacetamide, 3-phenylpropanamide, picolinamide, 3- pyridylcarboxamide, N-benzoylphenylalanyl derivative, benzamide, 7-phenylbenzamide, o- nitrophenylacetamide, o-nitrophenoxyacetamide, acetoacetamide, (N - dithiobenzyloxyacylamino)acetamide, 3-(p-hydroxyphenyl)propanamide, 3-(o- nitrophenyl)propanamide, 2-methyl-2-(o-nitrophenoxy)propanaimde, 2-methyl-2-(o- phenylazophenoxy)propanamide, 4-chlorobutanamide, 3-methyl-3-nitrobutanamide, o- nitrocirmamide, N-acetylmethionine derivative, o-nitrobenzamide, and o- (benzoyloxymethyl)benzamide.
[0067] Nitrogen protectmg groups such as carbamate groups {e.g., -C(=0)ORaa) include, but are not limited to, methyl carbamate, ethyl carbamate, 9-fluorenylmethyl carbamate (Fmoc), 9-(2-sulfo)fluorenylmethyl carbamate, 9-(2,7-dibromo)fluorenylmethyl carbamate, 2,7-di-/- butyl-[9-(10,10-dioxo-l 0,10,10,10-tetrahydrothioxanthyl)]methyl carbamate (DBD-Tmoc), 4-methoxyphenacyl carbamate (Phenoc), 2,2,2 -trichloroethyl carbamate (Troc), 2- trimethylsilylethy] carbamate (Teoc), 2-phenylethyl carbamate (hZ), l-(l-adamantyl)-l- methylethyl carbamate (Adpoc), l ,l-dimethyl-2-haloethyl carbamate, l,l-dimethyl~2,2- dibromoethyl carbamate (DB-/-BOC), l,l-dimethyl-2,2,2-trichloroethyl carbamate (TCBOC), 1 -methyl- 1 -(4-biphenylyl)eth 3 carbamate (Bpoc), 1 -(3 ,5 -di-t-butylphenyl)- 1 -methylethyl carbamate (t-Bumeoc), 2-(2'- and 4'-pyridyl)ethy] carbamate (Pyoc), 2-(N,N- dicyclohexylcarboxamido)ethyl carbamate, /-butyl carbamate (BOC or Boc), 1 -adamantyl carbamate (Adoc), vinyl carbamate (Voc), allyl carbamate (Alloc), 1 -isopropylallyl carbamate (Ipaoc), cinnamyl carbamate (Coc), 4-rdtrocinnamyl carbamate (Noc), 8-quinolyl carbamate, N-hydroxypiperidinyl carbamate, alkyldithio carbamate, benzyl carbamate (Cbz), p-methoxybenzyl carbamate (Moz), ?-nitobenzyl carbamate, p-bromobenzyl carbamate, p- chlorobenzyl carbamate, 2,4-dtchlorobenzyl carbamate, 4-methylsulfinylbenzyl carbamate (Msz), 9-anthrylmethyl carbamate, diphenylmethyl carbamate, 2-methylthioethyl carbamate, 2-methylsulfonylethyl carbamate, 2-(p-toiuenesuifonyl)ethyl carbamate, [2-(l,3- dithiany])]methyl carbamate (Dmoc), 4-methylthiopheny] carbamate (Mtpc), 2,4- dimethylthiophenyl carbamate (Bmpc), 2-phosphonioethyl carbamate (Peoc), 2- triphenylphosphonioisopropyl carbamate (Ppoc), l,l-dimetliyl-2-cyanoethyl carbamate, m- chloro-p-acyioxybenzyl carbamate, jp-(dihydroxyboryl)benzyl carbamate, 5- benzisoxazolylmethyl carbamate, 2-(trifluoromethyl)-6-chromonylmethyl carbamate (Tcroc), w-nitrophenyl carbamate, 3,5-dimethoxybenzyl carbamate, o-mtrobenzyl carbamate, 3,4- dimethoxy-6-nitrobenzyl carbamate, phenyl(o-nitrophenyl)methyl carbamate, -amyl carbamate, S-benzyl thiocarbamate, >-cyanobenzyl carbamate, cyclobutyl carbamate, cyclohexyl carbamate, cyclopentyl carbamate, cyclopropylmethyl carbamate, p- decyloxybenzyi carbamate, 2,2-dimethoxyacylvinyl carbamate, o-(N,N- dimethylcarboxamido)benzyl carbamate, 1 -dimethyl-3-(N,N-dimemylcarboxamido)propyl carbamate, 1,1-dimethylpropynyl carbamate, di(2-pyridyl)methyl carbamate, 2-furanylmethyl carbamate, 2-iodoethyl carbamate, isoborynl carbamate, isobutyl carbamate, isonicotinyl carbamate, ?-( 7'-methoxyphenylazo)benzyl carbamate, 1-methylcyclobutyl carbamate, 1- methylcyclohexyl carbamate, 1 -methyl- 1-cyclopropylmethyl carbamate, l-methyl-l-(3,5- dimethoxyphenyl)ethyl carbamate, 1 -methyl- l-( 7-phenylazophenyl)ethyl carbamate, 1 - methyl-l-phenylethyl carbamate, 1 -methyl- 1 -(4-pyridyl)ethyl carbamate, phenyl carbamate, /?-(phenylazo)benzyl carbamate, 2,4,6-tri-t-butylphenyl carbamate, 4- (trimethylammonium)benzyl carbamate, and 2,4,6-trimethylbenzyl carbamate.
[0068] Nitrogen protecting groups such as sulfonamide groups (e.g., -S(=0)2Raa) include, but are not limited to, jp-toluenesulfonamide (Ts), benzenesulfonamide, 2,3,6,-trimethyl-4- methoxybenzenesulfonamide (Mtr), 2,4,6-trimethoxybenzenesulfonamide (Mtb), 2,6- dimethyl-4-methoxybenzenesulfonamide (Pme), 2,3,5,6-tetramethyl-4- methoxybenzenesulfonamide (Mte), 4-methoxybenzenesulfonamide (Mbs), 2,4,6- trimethylbenzenesulfonamide (Mts), 2,6-dimethoxy-4-methylbenzenesulfonamide (iMds), 2,2,5,7,8-pentamethylchroman-6-sulfonamide (Pmc), methanesulfonamide (Ms), β- trimethylsilylethanesulfonamide (SES), 9-anthracenesulfonamide, 4-(4',8'- dimethoxynaphthyimethyl)benzeiiesulfonamide (DNMBS), benzylsulfonamide,
trifluoromethylsulfonamide, and phenacylsulfonamide.
[0069] Other nitrogen protecting groups include, but are not limited to, phenothiazinyl-(lO)- acyl derivative, N'-p~toluenesulfonylammoacyl derivative, iV-phenylaminothioacyl derivative, N-benzoylphenylalanyl derivative, N-acetylmethionine derivative, 4,5-diphenyl-3-oxazolin-2- one, N-phthalimide, N-dithiasuccinimide (Dts), N-2,3-diphenylmaleimide, N-2,5- dimethylpyrroie, N-l,l,4,4-tetramethyldisilylazacyclopentane adduct (STABASE), 5- substituted l,3-dimethyl-l,3,5-triazacyc3ohexan-2-one, 5-substituted l,3-dibenzyl-l,3,5- triazacyclohexan-2-one, 1 -substituted 3,5-dinitro-4-pyridone, N-methylamine, N-allylamine, N-[2-(trimetliylsily2)ethoxy]methylamine (SEM), N-3-acetoxypropylamine, N-(l -isopropyl-4- nitro-2-oxo-3-pyroolin-3-yl)amine, quaternary ammonium salts, N-benzylamine, N-di(4- methoxyphenyl)methylamine, N-5-dibenzosuberylamine, N-triphenylmethylamine (Tr), N- [(4-methoxyphenyl)diphenylmethyl]amine (MMTr), N-9-phenylfluorenylamine (PhF), N-2,7 - dichioiO-9-fluorenylmethyleneamine, N-ferrocenylmethylamino (Fcm), N-2-picolylamino JV- oxide, Λ-Ι,Ι -dimethylthiomethyleneamine, N-benzylideneamine, N-p- methoxybenzylideneamine, N-diphenylmemyleneamine, N- [(2- pyridyl)mesityl]methyleneamine, N-(Ar,N-dimethylamiiiomethylene)ainine, NN- isopropylidenediamine, N- ?-mtiObenzylideneamrne, N-salicylideneamine, N-5- chlorosalicylidenearriine, N-(5-chloro-2-hydroxyphenyl)phenylmethyleneamine, N- cyclohexylideneamine, N-(5,5-dimethyl-3-oxo-l-cyclohexenyl)amine, N-borane derivative, N-diphenylborinic acid derivative, N-| henyl(pentaacylchromium- or tungsten)acyl] amine, N-copper chelate, N-zinc chelate, N-nitroamine, N-nitrosoamine, amine N-oxide,
diphenylphosphinamide (Dpp), dimethylthiophosphinamide (Mpt),
diphenylthiophosphinamide (Ppt), dialkyl phosphoramidates, dibenzyl phosphoramidate, diphenyl phosphoramidate, benzenesulfenamide, o-nitrobenzenesulfenamide (Nps), 2,4- dinitrobenzenesulfenamide, pentachlorobenzenesulfenamide, 2-nitro-4- methoxybenzenesulfenamide, triphenylmethylsulfenamide, and 3-nttTopyrtdinesulfenamide
[0070] Exemplary oxygen atom substit ents include, but are not limited to, -Raa, -N(R")2, -C(=0)SRaa, -C(===0)Raa, -C02Raa, -C(===0)N(Rbb)2, -C(===NRbb)Raa, -C(===NRbb)ORa3, -C(- Rbb)N(Rbb)2, -S(-0)Raa, S();.Raa, -~Si(Raa)3, -P(RCC)2, P(R );; X , -P(ORcc)2,
P(ORt V X , -P(=0)(Raa)2, "P(=0)(OR£C)2, and -P(=0)(N(Rbb) 2)2, wherein X , Raa, Rbb, and Rcc are as defined herein, in certain embodiments, the oxygen atom substituent present on an oxygen atom is an oxygen protecting group (also referred to as a hydroxy] protecting group). Oxygen protecting groups are well known in the art and include those described in detail in Protecting Groups in Organic Synthesis, T. W. Greene and P. G. M. Wuts, 3ld edition, John Wiley & Sons, 1999, incorporated herein by reference. Exemplary oxygen protecting groups include, but are not limited to, methyl, t-butyloxycarbonyl (BOC or Boc), methoxylmethyl (MOM), methylthiomethyl (MTM), t-butylthiomethyl,
(phenyldimethylsilyl)methoxymethyl (SMOM), benzyloxymethyl (BOM), p- methoxybenzyloxymethyl (PMBM), (4-methoxyphenoxy)methyl (p-AOM), guaiacolmethyl (GUM), t-butoxymethyl, 4-pentenyloxymethyl (POM), siloxymethyl, 2- methoxyethoxymethyl (MEM), 2,2,2-trichloroethoxymethyl, bis(2~chloroethoxy)methyl, 2- (trimethylsilyl)ethoxymethyl (SEMOR), tetrahydropvranyl (THP), 3-bromotetrahydropyranyl, tetrahydrothiopyranyl, 1 -methoxycyclohexyl, 4-methoxytetrahydropyranyl (MTHP), 4- methoxytetrahydrothiopyranyl, 4-methoxytetrahydrothiopyranyl S,S-dioxide, l-[(2-chloro-4- methyi)phenyi]-4-methoxypiperidin-4-yl (CTMP), 1 ,4-dioxan-2-yl, tetrahydrofuranyl, tetrahydrothiofuranyl, 2,3,3a,4,5,6,7,7a-octahydro-7,8,8-tTimethyl-4,7-methanobenzofi:iran-2- yl, 1-ethoxy ethyl, l-(2-chloroet oxy)ethyl, 1 -methyl- 1 -methoxy ethyl, 1 -methyl- 1 - benzyloxy ethyl, 1 -methyl- l-benzyloxy-2-fluoroethyl, 2,2,2-trichloroethyl, 2- trimethylsilylethyl, 2-(phenylselenyl)ethyl, /-butyl, allyl, p-chlorophenyl, >-methoxyphenyl, 2,4-dinitrophenyl, benzyl (Bn), ?-methoxybenzy], 3,4-dimethoxybenzyl, o-nitrobenzyl, 7- nitrobenzyl, jp-halobenzyl, 2,6-dichlorobenzyl, >-cyanobenzyl, p-phenylbenzyl, 2-picolyl, 4- picolyl, 3-methyl-2-picolyl N-oxido, (Uphenylmethyl, jp,p'-dinitrobenzhydryl, 5- dibenzosuberyl, triphenylmethyl, a-naphthyldiphenylmethyl, p- methoxyphenyldip enylmethyl, di(p-methoxyphenyl)phenylmethyl, tri(p- methoxyphenyl)methyl, 4-(4'-bromophenacyloxyphenyl)diphenylmethyl, 4,4',4"-tris(4,5- dichlorOphthalimidophenyl)methyl, 4,4',4"-tris(levulinoyloxyphenyl)methyl, 4,4',4"- tris(benzoyloxyphenyl)methyl, 3-(imidazol-l-yl)bis(4',4"-dimethoxyphenyl)methyl, 1,1- bis(4-methoxyphenyl)-l '-pyrenylmethyl, 9-anthryl, 9-(9-phenyl)xanthenyl, 9-(9-phenyl-10- oxo)anthryl, l ,3-benzodisulfuran-2-yl, benzisothiazolyl S,S-dioxido, trimethylsilyl (TMS), triethylsilyl (TES), triisopropylsilyl (TIPS), dimet ylisopropylsilyl (IPDMS),
diethylisopropylsilyl (DEIPS), dimethyl thexylsilyl, /-butyldimethylsilyl (TBDMS), t- butyldiphenylsilyl (TBDPS), tribenzylsily], tri- j-xylylsilyl, triphenylsilyl,
diphenylmethylsilyl (DPMS), t-butylmethoxyphenylsilyl (TBMPS), formate, benzoyl formate, acetate, chloroacetate, dichloroacetate, trichloroacetate, trifl oroacetate, methoxyacetate, triphenylmethoxyacetate, phenoxyaeetate, 7-chlorophenoxyacetate, 3-phenylpropionate, 4- oxopentanoate (levulinate), 4,4-(ethylenedithio)pentanoate (levulmoyldithioacetal), pivaloate, adamantoate, crotonate, 4-methoxycrotonate, benzoate, p-phenylbenzoate, 2,4,6- trimethylbenzoate (mesitoate), alkyl methyl carbonate, 9-fluorenylmethyl carbonate (Fmoc), alkyl ethyl carbonate, alkyl 2,2,2-trichloroethyl carbonate (Troc), 2-(trimethy]silyl)ethyl carbonate (TMSEC), 2-(phenylsulfonyl) ethyl carbonate (Psec), 2-(triphenylphosphonio) ethyl carbonate (Peoc), alkyl isobutyl carbonate, alkyl vinyl carbonate alkyl allyl carbonate, alkyl 7-nitrophenyl carbonate, alkyl benzyl carbonate, alkyl -methoxybenzyl carbonate, alkyl 3,4-dimethoxybenzyl carbonate, alkyl o-nitrobenzyl carbonate, alkyl ^-nitrobenzyl carbonate, alkyl 5-benzyl thiocarbonate, 4-ethoxy-l-napththyl carbonate, methyl
dithiocarbonate, 2-iodobenzoate, 4-azidob tyrate, 4-nitro-4-methylpentanoate, o- (dibromomethyl)benzoate, 2-formylbenzenesulfonate, 2-(methylthiomethoxy)ethyl, 4- (methylthiomethoxy)butyrate, 2~(methylthiomethoxymethyl)benzoate, 2,6-dichloro~4~ methylphenoxyacetate, 2,6-dichloro-4-( 1 , 1 ,3 ,3-tetramethylbutyl)phenoxyacetate, 2,4-bis( 1,1- dimethylpropyl)phenoxyacetate, chlorodiphenylacetate, isobutyrate, monosuccinoate, (E -2- methyl-2-butenoate, o-(methoxyacyl)benzoate, a-naphthoate, nitrate, alkyl N. V,N',N!- tetramethylphosphorodiamidate, alkyl N-phenylcarbamate, borate, dimethylphosphinothioyl, alkyl 2,4-dmitrophenylsulfenate, sulfate, methanesulfonate (mesylate), benzylsulfonate, and tosylate (Ts). [0071j Exemplar}' sulfur- atom substituents include, but are not limited to, -Raa, ~ (R11)2, -C(-0)SRaa, -C(-0)Raa, -C02Raa, -C(=0)N(Rbb)2, -C(-NRbb)Raa, -C(=NRbb)ORaa,
-C(=NRbb)N(Rbb)2, "S(=0)Raa, -S02Raa, ~Si(Raa)3, -P(RCC)2, -P(RCC)3 + -P(ORcc)2, -P(QRCC)3 +X~, -P(=0)(Raa)2, -P(=G)(ORcc)¾ and ~P(=0)( (Rbb) 2)2, wherein Raa, Rbb, and
Rco are as defined herein. In certain embodiments, the sulfur atom substituent present on a sulfur atom is a sulfur protecting group (also referred to as a thiol protecting group). Sulfur protecting groups are well known in the art and include those described in detail in Protecting
Groups in Organic Synthesis, T. W. Greene and P. G. M. Wuts, 3 " edition, John Wiley &
Sons, 1999, incorporated herein by reference.
[0072] A "hydrocarbon chain" refers to a substituted or unsubstituted divalent alkyl, alkenyl, or alkynyl group. A hydrocarbon chain includes (1) one or more chains of carbon atoms immediately between the two radicals of the hydrocarbon chain; (2) optionally one or more hydrogen atoms on the chain(s) of carbon atoms; and (3) optionally one or more substituents ("non-chain substituents," which are not hydrogen) on the chain(s) of carbon atoms. A chain of carbon atoms consists of consecutively comiected carbon atoms ("chain atoms" or "carbon units") and does not include hydrogen atoms or heteroatoms. However, a non-chain substituent of a hydrocarbon chain may include any atoms, including hydrogen atoms, carbon atoms, and heteroatoms. For example, hydrocarbon chain -CAH(CBH2CCH3)- includes one chain atom CA, one hydrogen atom on CA, and non-chain substituent -(CBH2CCH3). The term "Cx hydrocarbon chain," wherein x is a positive integer, refers to a hydrocarbon chain that includes x number of ch ain atom(s) between the two radicals of the hydrocarbon chain. If there is more than one possible value of x, the smallest possible value of x is used for the the hydrocarbon chain. For example, -CH(C2H5)- is a Q hydrocarbon chain, and
Figure imgf000030_0001
is a C3 hydrocarbon chain. When a range of values is used, the meaning of the range is as described herein. For example, a C3-10 hydrocarbon chain refers to a hydrocarbon chain where the number of chain atoms of the shortest chain of carbon atoms immediately between the two radicals of the hydrocarbon chain is 3, 4, 5, 6, 7, 8, 9, or 10. A hydrocarbon chain may be saturated (e.g., -(CH2)4-). A hydrocarbon chain may also be unsaturated and include one or more C~C and/or C≡C bonds anywhere in the hydrocarbon chain. For instance, -CH=CH-(CH2)2-, -CH2-C≡C-CH2-5 and -C C-Ci !-O i- are all examples of a unsubstituted and unsaturated hydrocarbon chain. In certain embodiments, the hydrocarbon chain is unsubstituted (e.g., -C≡C- or -(CH2)4-). In certain embodiments, the hydrocarbon chain is substituted (e.g., -CH(C2H5)- and -CF2-). Any two substituents on the hydrocarbon chain may be joined to form an optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, or optionally substituted heteroaryl ring. For
Figure imgf000031_0001
are all examples of a hydrocarbon chain. In contrast, in certain embodiments,
Figure imgf000031_0002
and are not within the scope of th e h ydrocarbon chains described herein. When a chain atom of a Cx hydrocarbon chain is replaced with a heteroatom, the resulting group is referred to as a Cx hydrocarbon chain wherein a chain atom is replaced with a heteroatom, as opposed to a Cx-i hydrocarbon chain. For example, ¾ ^ ^ is a C hydrocarbon chain wherein one chain atom is replaced with an oxygen atom,
[0073] The term "leaving group" is given its ordinary meaning in the art of synthetic organic chemistry and refers to an atom or a group capable of being displaced by a nucleophile.
Examples of suitable leaving groups include, but are not limited to, halogen (such as F, CI, Br, or I (iodine)), alkoxycarbonyloxy, aryloxycarbonyloxy, alkanesulfonyloxy, arenesulfonyloxy, alkyl-carbonyloxy (e.g., acetoxy), arylcarbonyloxy, aryloxy, methoxy, N,0- dirnethylhydroxylamino, pixyl, and haloformates. In some cases, the leaving group is a sulfonic acid ester, such as toluenesulfonate (tosylate, -OTs), methanesulfonate (mesylate, - OMs), 7-bromobenzenesulfonyloxy (brosylate, -OBs), -OS(=0)2(CF2)3CF3 (nonaflate, -ONf), or trtfluoromethanesulfonate (trif!ate, -OTf). In some cases, the leaving group is a brosylate, such as jp-bromobenzenesulfonyloxy. In some cases, the leaving group is a nosylate, such as 2-nitrobenzenesulfonyloxy.The leaving group may also be a phosphineoxide (e.g., formed during a Mitsunobu reaction) or an internal leaving group such as an epoxide or cyclic sulfate. Other non-limiting examples of leaving groups are water, ammonia, alcohols, ether moieties, thioether moieties, zinc haiides, magnesium moieties, diazonium salts, and copper moieties. Exemplary leaving groups include, but are not limited to, halo (e.g., chloro, bromo, iodo) and activated substituted hydroxy] groups (e.g., -OC(-0)SRaa, -OC(=0)Raa, -OC02R a, - OC(=0)N(Rbb)2, -GC(=NRbb)Raa, ~OC(=NRbb)ORaa, ~OC(=NRbb)N(Rbb)2, ~-OS(=0)Raa, - OSG2Raa, -OP(Rcc)2, -OP(Rcc)3, -OP(==0)2Raa, -OP(=0)(Raa)2, -OP(===G)(ORcc)2, - OP(-0)2 (Rbb)2, and -OP(-0)( Rbb)2, wherein Raa, Rbb, and Rcc are as defined herein).
[0074J The term "pharmaceutically acceptable salt" refers to those salts which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of humans and lower animals without undue toxicity, irritation, allergic response, and the like, and are commensurate with a reasonable benefit/risk ratio. Pharmaceutically acceptable salts are well known in the art. For example, Berge et al. describe pharmaceutically acceptable salts in detail in J. Pharmaceutical Sciences, 1977, 66, 1 -19, incorporated herein by reference.
Pharmaceutically acceptable salts of the compounds described herein include those derived from suitable inorganic and organic acids and bases. Examples of pharmaceutically acceptable, non-toxic acid addition salts are salts of an amino group formed with inorganic acids such as hydrochloric acid, hydrobromic acid, phosphoric acid, sulfuric acid, and perchloric acid or with organic acids such as acetic acid, oxalic acid, maieic acid, tartaric acid, citric acid, succinic acid, or malonic acid or by using other methods know in the art such as ion exchange. Other pharmaceutically acceptable salts include adipate, alginate, ascorbate, aspartate, benzenesulfonate, benzoate, bisulfate, borate, but rate, camphorate,
camphorsulfonate, citrate, cyclopentanepropionate, digluconate, dodecylsulfate,
ethanesulfonate, formate, fumarate, glucoheptonate, glycerophosphate, gluconate,
hemisulfate, heptanoate, hexanoate, hydroiodide, 2-hydroxy-ethanesulfonate, lactobionate, lactate, laurate, lauryl sulfate, malate, maleate, malonate, methanesulfonate, 2- naphthalenesulfonate, nicotinate, nitrate, oleate, oxalate, palmitate, pamoate, pectinate, persulfate, 3-phenylpropionate, phosphate, picrate, pivalate, propionate, stearate, succinate, sulfate, tartrate, thiocyanate, p-toluenesulfonate, undecanoate, valerate salts, and the like. Salts derived from appropriate bases include alkali metal, alkaline earth metal, ammonium and ÷(Ci-4 alkyl)4 " salts. Representative alkali or alkaline earth metal salts include sodium, lithium, potassium, calcium, magnesium, and the like. Further pharmaceutically acceptable salts include, when appropriate, nontoxic ammonium, quaternary ammonium, and amine cations formed using counterfoils such as halide, hydroxide, carboxylate, sulfate, phosphate, nitrate, lower alkyl sulfonate, and aryl sulfonate.
[00751 The tertn "solvate" refers to forms of the compound that are associated with a sol vent, usually by a solvolysis reaction. This physical association may include hydrogen bonding. Conventional solvents include water, methanol, ethanol, acetic acid, DMSO, THF, diethyl ether, and the like. The compounds described herein may be prepared, e.g., in crystalline form, and may be solvated. Suitable solvates include pharmaceutically acceptable solvates and further include both stoichiometric solvates and non-stoichiometric solvates. In certain instances, the solvate will be capable of isolation, for example, when one or more solvent molecules are incorporated in the crystal lattice of a crystalline solid. "Solvate" encompasses both solution-phase and isolatable solvates. Representative solvates include hydrates, ethanolates, and methanolates.
[0076] The term "hydrate" refers to a compound that is associated with water. Typically, the number of the water molecules contained in a hydrate of a compound is in a definite ratio to the number of the compound molecules in the hydrate. Therefore, a hydrate of a compound may be represented, for example, by the general formula R x H20, wherein R is the compound, and x is a number greater than 0. A given compound may form more than one type of hydrate, including, e.g., monohydrates (x is 1 ), lower hydrates (x is a number greater than 0 and smaller than 1 , e.g., hemihydrates (R-0.5 H2O ), and polyhydrates (x is a number greater than 1, e.g., dihydrates (R-2 H20) and hexahydrates (R-6 H20)).
[0077] The term "tautomers" or "tautomeric" refers to two or more interconvertible compounds resulting from at least one formal migration of a hydrogen atom and at least one change in valency (e.g., a single bond to a double bond, a triple bond to a single bond, or vice versa). The exact ratio of the tautomers depends on several factors, including temperature, solvent, and pH. Tautomerizations (i.e., the reaction providing a tautomeric pair) may catalyzed by acid or base. Exemplary tautomerizations include keto-to-enol, amide-to-imide, lactam-to-lactim, enamine-to-imine, and enamine-to-(a different enamine) tautomerizations.
[0078] It is also to be understood that compounds that have the same molecular formula but differ in the nature or sequence of bonding of their atoms or the arrangement of their atoms in space are termed "isomers". Isomers that differ in the arrangement of their atoms in space are termed "stereoisomers."
[0079] Stereoisomers that are not mirror images of one another are termed "diastereomers" and those that are non-superimposable mirror images of each other are termed "enantiomers." When a compound has an asymmetric center, for example, it is bonded to four different groups, a pair of enantiomers is possible. An enantiomer can be characterized by the absolute configuration of its asymmetric center and is described by the R- and S-sequencing rules of Cahn and Prelog, or by the manner in which the molecule rotates the plane of polarized light and designated as dextrorotatory or levorotatory (i.e., as (+) or (-)-isomers respectively). A chiral compound can exist as either individual enantiomer or as a mixture thereof. A mixture containing equal proportions of the enantiomers is called a "racemic mixture." [0080! The term "polymorphs" refers to a crystalline form of a compound (or a salt, hydrate, or solvate thereof) in a particular crystal packing arrangement. All polymorphs have the same elemental composition, Different crystalline forms usually have different X-ray diffraction patterns, infrared spectra, melting points, density, hardness, crystal shape, optical and electrical properties, stability, and solubility, Reciysiallization solvent, rate of crystallization, storage temperature, and other factors may cause one crystal form to dominate. Various polymorphs of a compound can be prepared by crystallization under different conditions.
[00811 The tertn "co-crystal" refers to a crystalline structure composed of at least two components, in certain embodiments, a co-crystal may contain a compound of the present invention and one or more other component, including but not limited to, atoms, ions, molecules, or solvent molecules. In certain embodiments, a co-crystal may contain a compound of the present invention and one or more componen ts related to said compound, including not limited to, an isomer, tautomer, salt, solvate, hydrate, synthetic precursor, synthetic derivative, fragment or impurity of said compound.
[0082] The term "isotopically labeled derivative" or "isotopically labeled" refers to a compound wherein one or more atoms in the compound (or in an associated ion or molecule of a salt, hydrate, or solvate) has been replaced with an isotope of the same element. For the given element or position in the molecule the isotope will be enriched, or present in a higher percentage of all atoms of the element or of all atoms at the position in the molecule in a sample, relative to an unlabeled variant. In certain embodiments, the enriched isotope will be a stable isotope. In certain embodiments, the enriched isotope will be an unstable or radioactive isotope (e.g., a radionuclide). In certain embodiments, the enriched isotope may be detected by a measurement technique, including but not limited to nuclear magnetic resonance, mass spectrometry, infrared spectroscopy, or a technique that measures radioactive decay.
[0083] The term "prodrugs" refers to compounds that have cleavable groups and become by solvolysis or under physiological conditions the compounds described herein, which are pharmaceutically active in vivo. Such examples include, but are not limited to, choline ester derivatives and the like, N-alkylmorpholine esters and the like. Other derivatives of the compounds described herein have activity in both their acid and acid derivative forms, but in the acid sensitive form often offer advantages of solubility, tissue compatibility, or delayed release in the mammalian organism (see, Bundgard, H., Design of Prodrugs, pp. 7-9, 21-24, Elsevier, Amsterdam 1985). Prodrugs include acid derivatives well known to practitioners of the art, such as, for example, esters prepared by reaction of the parent acid with a suitable alcohol, or amides prepared by reaction of the parent acid compound with a substituted or unsubstituted amine, or acid anhydrides, or mixed anhydrides. Simple aliphatic or aromatic esters, amides, and anhydrides derived from acidic groups pendant on the compounds described herein are particular prodrugs. In some cases it is desirable to prepare double ester type prodrugs such as (acyloxy)alkyl esters or ((alkoxycarbonyl)oxy)alkylesters. Cj -Cg alkyl, C2-C8 alkenyl, C2-C8 alkynyl, aryl, C7-C12 substituted aryl, and C7-C12 aryl alkyl esters of the compounds described herein may be preferred.
[0084| The tenn "inhibition", "inhibiting", "inhibit," or "inhibitor" refer to the ability of a compound to reduce, slow, halt or prevent activity of a particular biological process (e.g., CDK kinase activity)) in a cell relative to vehicle.
[0085] When a compound, pharmaceutical composition, method, use, or kit is referred to as "selectively," "specifically," or "competitively" binding a first protein kinase, the compound, pharmaceutical composition, method, use, or kit binds the first protein kinase (e.g., CDK) with a higher binding affinity (e.g. , not less than about 2-fold, not less than about 5-fold, not less than about 10-fold, not less than about 30-fold, not less than about 100-fold, not less than about 1,000-fold, or not less than about 10,000-fold) than binding a second protein or second chromatin that is different from the first protein and the first chromatin.
[0086] When a compound, pharmaceutical composition, method, use, or kit is referred to as "selectively," "specifically," or "competitively" modulating (e.g., increasing or inhibiting) the activity of a first protein kinase, the compound, pharmaceutica] composition, method, use, or kit modulates the activity of the first protein kinase (e.g. , CDK) to a greater extent (e.g., not less than about 2-fold, not less than about 5-fold, not less than about 10-fold, not less than about 30-fold, not less than about 100-fold, not less than about 1 , 000-fold, or not less than about 10,000-fold) than the activity of a second protein kinase that is different from the first protein kinase.
[0087] The term "aberrant activity" refers to activity deviating from normal activity, that is, abnormal activity. The term "increased activity" refers to activity higher than normal activity.
[0088] The terms "composition" and "formulation" are used interchangeably.
[0089] A "subject" to which administration is contemplated refers to a human (i.e., male or female of any age group, e.g., pediatric subject (e.g., infant, child, or adolescent) or adult subject (e.g., young adult, middle-aged adult, or senior adult)) or non-human animal. In certain embodiments, the non-human animal is a mammal (e.g., primate (e.g., cynomolgus monkey or rhesus monkey), commercially relevant mammal (e.g., cattle, pig, horse, sheep, goat, cat, or dog), or bird (e.g., commercially relevant bird, such as chicken, duck, goose, or turkey)). In certain embodiments, the non-human animal is a fish, reptile, or amphibian. The non-human animal may be a male or female at any stage of development. The non-human animal may be a transgenic animal or genetically engineered animal. A "patient" refers to a human subject in need of treatment of a disease.
[0090] The term "biological sample" refers to any sample including tissue samples (such as tissue sections and needle biopsies of a tissue); cell samples (e.g., cytological smears (such as Pap or blood smears) or samples of cells obtained by microdissection); samples of whole organisms (such as samples of yeasts or bacteria); or cell fractions, fragments or organelles (such as obtained by lysing cells and separating the components thereof by centrifugation or otherwise). Other examples of biological samples include blood, serum, urine, semen, fecal matter, cerebrospinal fluid, interstitial fluid, mucous, tears, sweat, pus, biopsied tissue (e.g., obtained by a surgical biopsy or needle biopsy), nipple aspirates, milk, vaginal fluid, saliva, swabs (such as buccal swabs), or any material containing biomolecules that is derived from another biological sample.
[0091] The terms "administer," "administering," or "administration" refers to implanting, absorbing, ingesting, injecting, inhaling, or otherwise introducing a compound described herein, or a composition thereof, into, in, or on a subject.
[0092] The terms "treatment," "treat," and "treating" refer to reversing, alleviating, delaying the onset of, or inhibiting the progress of a disease described herein . In some embodiments, treatment may be administered after one or more signs or symptoms of the disease have developed or have been observed. In other embodiments, treatment may be administered in the absence of signs or symptoms of the disease. For example, treatment may be administered to a susceptible subject prior to the onset of symptoms (e.g., in light of a histor of symptoms and/or in light of exposure to a pathogen). Treatment may also be continued after symptoms have resolved, for example, to delay or prevent recurrence.
[0093] The terms "condition," "disease," and "disorder" are used interchangeably.
[0094] An "effective amount" of a compound described herein refers to an amount sufficient to elicit the desired biological response, i.e. , treating the condition. As will be appreciated by those of ordinaiy skill in this art, the effective amount of a compound described herein may vary depending on such factors as the desired biological endpoint, the pharmacokinetics of the compound, the condition being treated, the mode of administration, and the age and healt of the subject. In certain embodiments, an effective amount is a therapeutically effective amount. In certain embodiments, an effective amount is a prophylactic treatment. In certain embodiments, an effective amount is the amount of a compound described herein in a single dose. In certain embodiments, an effective amount is the combined amounts of a compound described herein in multiple doses.
[0095] A "therapeutically effective amount" of a compound described herein is an amount sufficient to provide a therapeutic benefit in the treatment of a condition or to delay or minimize one or more symptoms associated with the condition. A therapeutically effective amount of a compound means an amount of therapeutic agent, alone or in combination with other therapies, which provides a therapeutic benefit in the treatment of the condition. The term "therapeutically effective amount" can encompass an amount that improves overall therapy, reduces or avoids symptoms, signs, or causes of the condition, and/or enhances the therapeutic efficacy of another therapeutic agent.
[0096] A "prophyiacticaliy effective amount" of a compound described herein is an amount sufficient to prevent a condition, or one or more symptoms associated with the condition or prevent its recurrence. A prophyiacticaliy effective amount of a compound means an amount of a therapeutic agent, alone or in combination with other agents, whic provides a prophylactic benefit in the prevention of the condition. The term "prophyiacticaliy effective amount" can encompass an amount that improves overall prophylaxis or enhances the prophylactic efficacy of another prophylactic agent.
[0097] A "proliferative disease" refers to a disease that occurs due to abnormal growth or extension by the multiplication of cells (Walker, Cambridge Dictionary of Biology;
Cambridge University Press: Cambridge, UK, 1990). A proliferative disease may be associated with: 1) the pathological proliferation of normally quiescent cells; 2) the pathological migration of cells from their normal location (e.g., metastasis of neoplastic cells); 3) the pathological expression of proteolytic enzymes such as the matrix
metalloproteinases (e.g., collagenases, gelatinases, and elastases); or 4) the pathological angiogenesis as in proliferative retinopathy and tumor metastasis. Exemplary proliferative diseases include cancers (i.e., "malignant neoplasms"), benign neoplasms, diseases associated with angiogenesis, inflammatory diseases, and autoimmune diseases.
[0098] The term "angiogenesis" refers to the physiological process through whic new blood vessels form from pre-existing vessels. Angiogenesis is distinct from vasculogenesis, which is the de novo fonnation of endothelial cells from mesoderm cell precursors. The first vessels in a developing embryo form through vasculogenesis, after which angiogenesis is responsible for most blood vessel growth during normal or abnormal development. Angiogenesis is a vital process in growth and development, as well as in wound healing and in the fonnation of granulation tissue. However, angiogenesis is also a fundamental step in the transition of tumors from a benign state to a malignant one, leading to the use of angiogenesis inhibitors in the treatment of cancer. Angiogenesis may be chemically stimulated by angiogenic proteins, such as growth factors (e.g., VEGF). "Pathological angiogenesis" refers to abnormal (e.g., excessive or insufficient) angiogenesis that amounts to and/or is associated with a disease.
[0099] The terms "neoplasm" and "tumor" are used herein interchangeably and refer to an abnormal mass of tissue wherein the growth of the mass surpasses and is not coordinated as in the growth of normal tissue. A neoplasm or tumor may be "benign" or "malignant," depending on the follo wing characteristics: degree of cellular differen tiation (including morphology and functionality), rate of growth, local invasion, and metastasis. A "benign neoplasm" is generally well differentiated, has characteristically slower growth than a malignant neoplasm, and remains localized to the site of origin. In addition, a benign neoplasm does not have the capacity to infiltrate, invade, or metastasize to distant sites. Exemplary benign neoplasms include, but are not limited to, lipoma, chondroma, adenomas, acrochordon, senile angiomas, seborrheic keratoses, lentigos, and sebaceous hyperplasias. In some cases, certain "benign" tumors may later give rise to malignant neoplasms, which may result from additional genetic changes in a subpopulation of the tumor's neoplastic cells, and these tumors are referred to as "pre-malignant neoplasms." An exemplary pre-malignant neoplasm is a teratoma. In contrast, a "malignant neoplasm" is generally poorly differentiated (anaplasia) and has characteristically rapid growth accompanied by progressive infiltration, invasion, and destruction of the surrounding tissue. Furthermore, a malignant neoplasm generally has the capacity to metastasize to distant sites. The term "metastasis," "metastatic," or "metastasize" refers to the spread or migration of cancerous cells from a primary or original tumor to another organ or tissue and is typically identifiable by the presence of a "secondary tumor" or "secondary cell mass" of the tissue type of the primary or original tumor and not of that of the organ or tissue in which the secondary (metastatic) tumor is located. For example, a prostate cancer that has migrated to bone is said to be metastasized prostate cancer and includes cancerous prostate cancer cells growing in bone tissue.
[00100] The term "cancer" refers to a class of diseases characterized by the development of abnormal cells that proliferate uncontrollably and have the ability to infiltrate and destroy normal body tissues. See, e.g., Stedman 's Medical Dictionary, 25th ed.; Hensyl edL; Williams & Wilkins: Philadelphia, 1990. Exemplary cancers include, but are not limited to, hematological malignancies. Additional exemplary cancers include, but are not limited to, acoustic neuroma; adenocarcinoma; adrenal gland cancer; anal cancer; angiosarcoma (e.g., lymphangiosarcoma, lymphangioendotheliosarcoma, hemangiosarcoma); appendix cancer; benign monoclonal gammopathy; biliar cancer (e.g., c olangiocarcinoma); bladder cancer; breast cancer (e.g., adenocarcinoma of the breast, papillary carcinoma of the breast, mammary cancer, medullary carcinoma of the breast, triple negative breast cancer (TNBC)); brain cancer (e.g., meningioma, glioblastomas, glioma (e.g., astrocytoma,
oligodendroglioma), meduUoblastoma); bronchus cancer; carcinoid tumor; cervical cancer (e.g., cervical adenocarcinoma); choriocarcinoma; chordoma; craniopharyngioma; colorectal cancer (e.g., colon cancer, rectal cancer, colorectal adenocarcinoma); connective tissue cancer; epithelial carcinoma; ependymoma; endotheliosarcoma (e.g., Kaposi's sarcoma, multiple idiopathic hemorrhagic sarcoma); endometrial cancer (e.g., uterine cancer, uterine sarcoma); esophageal cancer (e.g., adenocarcinoma of the esophagus, Barrett's
adenocarcinoma); Ewing's sarcoma; ocular cancer (e.g., intraocular melanoma,
retinoblastoma); familiar hypereosinophilia; gall bladder cancer; gastric cancer (e.g., stomach adenocarcinoma); gastrointestinal stromal tumor (GIST); germ cell cancer; head and neck cancer (e.g., head and neck squamous cell carcinoma, oral cancer (e.g., oral squamous cell carcinoma), throat cancer (e.g., laryngeal cancer, pharyngeal cancer, nasopharyngeal cancer, oropharyngeal cancer)); heavy chain disease (e.g., alpha chain disease, gamma chain disease, mu chain disease; hemangioblastoma; hypopharynx cancer; inflammatory myofibroblastic tumors; immunocytic amyloidosis; kidney cancer (e.g., nepliroblastoma a.k.a. Wilms' tumor, renal cell carcinoma); liver cancer (e.g., hepatocellular cancer (HCC), malignant hepatoma); lung cancer (e.g., bronchogenic carcinoma, small cell lung cancer (SCLC), non-small cell lung cancer (NSCLC), adenocarcinoma of the lung); leiomyosarcoma (LMS); mastocytosis (e.g., systemic mastocytosis); muscle cancer; myelodysplastic syndrome (MDS);
mesothelioma; myeloproliferative disorder (MPD) (e.g., polycythemia vera (PV), essential thrombocytosis (ET), agnogenic myeloid metaplasia (AMM) a.k.a. myelofibrosis (MF), chronic idiopathic myelofibrosis, chronic myelocytic leukemia (CML), chronic neutrophilic leukemia (CNL), hypereosinophilic syndrome (HES)); neuroblastoma; neurofibroma (e.g., neurofibromatosis ( F) type 1 or type 2, schwannomatosis); neuroendocrine cancer (e.g., gastroenteropancreatic neuroendocrine tumor (GEP- ET), carcinoid tumor); osteosarcoma (e.g., bone cancer); ovarian cancer (e.g., cystadenocarcmoma, ovarian embryonal carcinoma, ovarian adenocarcinoma); papillary adenocarcinoma; pancreatic cancer (e.g., pancreatic adenocarcinoma, intraductal papillary mucinous neoplasm (IPMN), Islet cell tumors); penile cancer (e.g., Paget's disease of the penis and scrotum); pinea!oma; primitive neuroectodermal tumor (PNT); plasma cell neoplasia; paraneoplastic syndromes; intraepithelial neoplasms; prostate cancer (e.g., prostate adenocarcinoma); rectal cancer; rhabdomyosarcoma; salivary gland cancer; skin cancer (e.g., squamous cell carcinoma (SCC), keratoacanthoma (KA), melanoma, basal cell carcinoma (BCC)); small bowel cancer (e.g., appendix cancer); soft tissue sarcoma (e.g., malignant fibrous histiocytoma (Wi s), liposarcoma, malignant peripheral nerve sheath tumor (MPNST), chondrosarcoma, fibrosarcoma, myxosarcoma); sebaceous gland carcinoma; small intestine cancer; sweat gland carcinoma; synovioma; testicular cancer (e.g., seminoma, testicular embryonal carcinoma); thyroid cancer (e.g., papillary carcinoma of the thyroid, papillary thyroid carcinoma (PTC), medullary thyroid cancer); urethral cancer; vaginal cancer; and vulvar cancer (e.g., Paget's disease of the vulva).
[00101] The term "hematological malignancy" refers to tumors that affect blood, bone marrow, and/or lymph nodes. Exemplary hematological malignancies include, but are not limited to, leukemia, such as acute lymphoblastic leukemia (ALL) (e.g., B-cell ALL, T-cell ALL), acute myelocytic leukemia (AML) (e.g., B-cell AML, T-cell AML), chronic
myelocytic leukemia (CML) (e.g. , B-cell CML, T-cell CML), and chronic lymphocytic leukemia (CLL) (e.g., B-cell CLL, T-cell CLL)); lymphoma, such as Hodgkin lymphoma (HL) (e.g., B-cell HL, T-cell HL) and non-Hodgkin lymphoma (NHL) (e.g., B-cell NHL, such as diffuse large cell lymphoma (DLCL) (e.g., diffuse large B-cell lymphoma (DLBCL, e.g., activated B-cell (ABC) DLBCL (ABC-DLBCL))), follicular lymphoma, chronic lymphocytic leukemia/small lymphocytic lymphoma (CLL/SLL), mantle cell lymphoma (MCL), margmal zone B-cell lymphoma (e.g., mucosa-associated lymphoid tissue (MALT) lymphoma, nodal marginal zone B-cell lymphoma, splemc marginal zone B-cell lymphoma), primary mediastinal B-cell lymphoma, Burkitfs lymphoma, Waldenstrom's
macroglobulinemia (WM, lymphoplasmacytic lymphoma), hairy cell leukemia (HCL), immunoblastic large cell lymphoma, precursor B-lymphoblastic lymphoma, central nervous system (CNS) lymphoma (e.g., primary CNS lymphoma and secondary CNS lymphoma); and T-cell NHL, such as precursor T-lymphoblastic lymphoma leukemia, peripheral T-cell lymphoma (PTCL) (e.g., cutaneous T-cell lymphoma (CTCL) (e.g., mycosis fungoides, Sezary syndrome), angioimmunoblastic T-cell lymphoma, extranodal natural killer T-cell lymphoma, enteropathy type T-cell lymphoma, subcutaneous panniculitis-like T-cell lymphoma, and anaplastic large cell lymphoma); lymphoma of an immune privileged site (e.g., cerebral lymphoma, ocular lymphoma, lymphoma of the placenta, lymphoma of the fetus, testicular lymphoma); a mixture of one or more leukemia/lymphoma as described above; myelodysplasia; and multiple myeloma (MM). [00102J The term "inflammatory disease" refers to a disease caused by, resulting from, or resulting in inflammation. The term "inflammatory disease" may also refer to a dysregulated inflammatory reaction that causes an exaggerated response by macrophages, granulocytes, and/or T-lymphocytes leading to abnormal tissue damage and/or cell death. An inflammatory disease can be either an acute or chronic inflammator condition and can result from infections or non-infectious causes. Inflammatory diseases include, without limitation, atherosclerosis, arteriosclerosis, autoimmune disorders, multiple sclerosis, systemic lupus erythematosus, polymyalgia rheumatica (PMR), gouty arthritis, degenerative arthritis, tendonitis, bursitis, psoriasis, cystic fibrosis, arthrosteitis, rheumatoid arthritis, inflammatory arthritis, Sjogren's syndrome, giant cell arteritis, progressive systemic sclerosis
(scleroderma), ankylosing spondylitis, polymyositis, dermatomyositis, pemphigus, pemphigoid, diabetes (e.g., Type I), myasthenia gravis, Hashimoto's thyroiditis, Graves' disease, Goodpasture's disease, mixed connective tissue disease, sclerosing cholangitis, inflammatory bowel disease, Crohn's disease, ulcerative colitis, pernicious anemia, inflammatory dermatoses, usual interstitial pneumonitis (UIP), asbestosis, silicosis, bronchiectasis, berylliosis, talcosis, pneumoconiosis, sarcoidosis, desquamative interstitial pneumonia, lymphoid interstitial pneumonia, giant cell interstitial pneumonia, cellular interstitial pneumonia, extrinsic allergic alveolitis, Wegener's granulomatosis and related forms of angiitis (temporal arteritis and polyarteritis nodosa), inflammatory dermatoses, hepatitis, delayed-type hypersensitivity reactions (e.g., poison ivy dermatitis), pneumonia, respiratory tract inflammation, Adult Respiratory Distress Syndrome (ARDS), encephalitis, immediate hypersensitivity reactions, asthma, hay fever, allergies, acute anaphylaxis, rheumatic fever, glomerulonephritis, pyelonephritis, cellulitis, cystitis, chronic cholecystitis, ischemia (ischemic injury), reperfusion injury, allograft rejection, host-versus-graft rejection, appendicitis, arteritis, blepharitis, bronchiolitis, bronchitis, cervicitis, cholangitis,
chorioamnionitis, conjunctivitis, dacrvoadenitis, dennatomyositis, endocarditis, endometritis, enteritis, enterocolitis, epicondylitis, epididymitis, fasciitis, fibrositis, gastritis, gastroenteritis, gingivitis, ileitis, iritis, laryngitis, myelitis, myocarditis, nephritis, omphalitis, oophoritis, orchitis, osteitis, otitis, pancreatitis, parotitis, pericarditis, pharyngitis, pleuritis, phlebitis, pneumonitis, proctitis, prostatitis, rhinitis, salpingitis, sinusitis, stomatitis, synovitis, testitis, tonsillitis, urethritis, urocystitis, uveitis, vaginitis, vasculitis, vulvitis, vulvovaginitis, angitis, chronic bronchitis, osteomyelitis, optic neuritis, temporal arteritis, transverse myelitis, necrotizing fasciitis, and necrotizing enterocolitis. [00103J An "autoimmune disease" refers to a disease arising from an inappropriate immune response of the body of a subject against substances and tissues normally present in the body. In other words, the immune system mistakes some part of the body as a pathogen and attacks its own cells. This may be restricted to certain organs (e.g., in autoimmune thyroiditis) or involve a particular tissue in different places (e.g., Goodpasture's disease which may affect the basement membrane in both the lung and kidney). The treatment of autoimmune diseases is typically with immunosuppression, e.g. , medications which decrease the immune response. Exemplar autoimmune diseases include, but are not limited to, glomerulonephritis,
Goodpasture's syndrome, necrotizing vasculitis, lymphadenitis, peri -arteritis nodosa, systemic lupus erythematosis, rheumatoid arthritis, psoriatic arthritis, systemic lupus erythematosis, psoriasis, ulcerative colitis, systemic sclerosis, dermatomyositis/polymyositis, anti -phospholipid antibody syndrome, scleroderma, pemphigus vulgaris, ANCA-associated vasculitis (e.g., Wegener's granulomatosis, microscopic polyangtitis), uveitis, Sjogren's syndrome, Crohn's disease, Reiter's syndrome, ankylosing spondylitis, Lyme disease,
Guillain-Barre syndrome, Hashimoto's thyroiditis, and cardiomyopathy.
[00104] The term "kinase" is a class of enzyme that transfers a phosphate group from a high energy donor molecules, such as ATP, to a specific substrate, referred to as phosphorylation. Kinases are part of the larger family of phosphotransferases. One of the largest groups of kinases are protein kinases, which act on and modify the activity of specific proteins. Kinases are used extensively to transmit signals and control complex processes in cells. Various other kinases act on small molecules such as lipids, carbohydrates, amino acids, and nucleotides, either for signaling or to prime them for metabolic pathways. Kinases are often named after their substrates. More than 500 different protein kinases have been identified in humans. Exemplary human protein kinases include, but are not limited to, AAK1 , ABL, ACK, ACTR2, ACTR2B, AKT1, AKT2, AKT3, ALK, ALK1, ALK2, ALK4, ALK7, AMPKal, AMPKa2, A KRD3, ANPa, ANPb, ARAF, ARAFps, ARG, AurA, AurApsl, AurAps2, AurB, AurBpsl , AurC, AXL, BARK1 , BARK2, BIKE, BLK, BMPR1 A, BMPRlApsl , BMPR1 Aps2, BMPR1B, BMPR2, BMX, BRAF, BRAFps, BRK, BRSK1, BRSK2, BTK, BUB1, BUBR1, CaMKla, CaMKlb, CaMKld, CaMKlg, CaMK2a, CaMK2b, CaMK2d, CaMK2g, CaMK4, CaMKKl , CaMKK2, ca LCK, CASK, CCK4, CCRK, CDC2, CDC7, CDKIO, CDK1 1, CDK2, CDK3, CDK4, CDK4ps, CDK5, CDKSps, CDK6, CDK7, CDK7ps, CDK8, CDKSps, CDK9, CDKLl, CDKL2, CDKL3, CDKL4, CDKL5, CGDps, CHED, CH 1 , CHK2, CHK2psl, CH 2ps2, CKla, CKla2, CKlapsl, CKlaps2, CKlaps3, CKld, CKle, CKlgl, CK lg2, CKlg2ps, CK lg3, CK2al , CK2al-rs, CK2a2, CLIK1 , CLIK1L, CL 1, CLK2, CLK2ps, CLK3, CLK3ps, CLK4, COT, CRIK, CRK7, CSK, CTK, CYGD, CYGF, DAPK.1, DAPK2, DAPK3, DCAMKLl, DCAMKL2, DCAMKL3, DDR1, DDR2, DLK, DMPK1, DMPK2, DRAKl , DRAK2, DYRK A, DYRK1B, DYRK2, DYRK3, DYRK4, EGFR, EphAl, EphAlO, EphA2, EphA3, EphA4, EphA5, EphA6, EphA7, EpliAS, EphBl , EphB2, EphB3, EphB4, Ep B6, Erkl, Erk2, Erk3, Erk3psl, Erk3ps2, Erk3ps3, Erk3ps4, Erk4, Erk5, Erk7, FAK, FER, FERps, FES, FGFR1, FGFR2, FGFR3, FGFR4, FGR, FLT1, FLTlps, FLT3, FLT4, FMS, FRK, Fused, FYN, GAK, GCK, GCN2, GC 22, GPRK4, GPRK5, GPRK6, GPRK6ps, GPRK7, GSK3A, GSK3B, Haspin, HCK,
HER2/ErbB2, HER3/ErbB3, HER4/ErbB4, HH498, ΗΪΡΚ1 , HIPK2, HIPK3, HIPK4, HPK l, HRI, HRtps, HSER, HUNK, tCK, IGF1R, IKKa, IKKb, IKKe, ILK, INSR, IRAKI, IRAK 2, IRA 3, IRAK4, IRE1, IRE2, 1RR, ITK, JAKl, JAK2, JAK3, JN 1, JNK2, JNK3, KDR, KHS1, KHS2, KIS, KIT, KSGCps, KSR1, KSR2, LATS1, LATS2, LCK, LIMK1, LIMK2, LIMK2ps, LKBl, LMR1 , LMR2, LMR3, LOK, LRRK1 , LRRK2, LTK, LY , LZK, MAK, MAP2K1, MAP2Klps, MAP2K2, MAP2K2ps, MAP2K3, MAP2K4, MAP2K5, MAP2K6, MAP2K7, MAP3K1, MAP3K2, MAP3K3, MAP3K4, MAP3K5, MAI}3K6, MAP3K7, MAP3K8, MAPKAPK2, MAPKAPK3, MAPKAPK5, MAPKAPKpsl, MARK1, MARK2, MARK3, MARK4, MARKpsOl, MARKps02, MARKps03, MARKps04, MARKps05, MARKps07, MARKpsOS, MARKps09, MARKpslO, MARKpsl l, MARKpsl2, MARKpsl3, MARKpslS, MARKpsie, M/\RKpsl7, MARKpslS, MARKpsl9, M/\RKps20, MARKps21, MARKps22, MARKps23, MARKps24, MARKps25, MARKps26, MARKps27, MARKps28, MARKps29, MARKps30, MAST1, MAST2, MAST3, MAST4, MAST'L, MELK, MER, MET, M1SR2, MLK1, MLK2, MLK3, MLK4, MLKL, MNK1, MNKlps, MNK2, MOK, MOS, MPSK1, MPSKlps, MRCKa, MRCKb, MRCKps, MSK1, MSK12, MSK2, MSK22, MSSK1 , MST1 , MST2, MST3, MST3ps, MST4, MUSK, MY03A, MY03B, MYTl, NDRl, NDR2, NEK1, NEK10, NEK11, NEK2, NEK2psl, NEK2ps2, NEK2ps3, NEK3, NEK4, E 4ps, NEK5, NEK6, NEK7, NEKS, NEK9, NIK, ΝΓΜ1, NLK, NRBPl, NRBP2, NuaKl, NuaK2, Obscn, Obscrt2, OSR1, p38a, p38b, p38d, p38g, p70S6K, p70S6Kb, p70S6Kpsl , p70S6Kps2, PAK1, PAK2, PAK2ps, PAK3, PAK4, PAK5, PAK6, PASK, PBK, PCTAIREl, PCTAIRE2, PCTAIRE3, PDGFRa, PDGFRb, PDK1, PEK, PFTAIRE1, PFTAIRE2, PHKgl, PHKglpsl, PHKglps2, PHKglps3, PHKg2, PIK3R4, PIMl, PIM2, PIM3, PINKl,
PITSLRE, PKACa, PKACb, PKACg, PKCa, PKCb, PKCd, PKCe, PKCg, PKCh, PKCi, PKCips, PKCt, PKCz, PKDl, PKD2, PKD3, PKG1, PKG2, PKN1, PKN2, PKN3, PKR, PLK1, PL lpsl, PLKlps2, PLK2, PLK3, PLK4, PRKX, PRKXps, PRKY, PRP4, PRP4ps, PRPK, PSKH1, PSKHlps, PSKH2, PYK2, QIK, QSK, RAF1, RAFlps, RET, RHOK, RIPK1, R1PK2, RIPK3, RNAseL, ROC 1, ROC 2, RON, ROR1, ROR2, ROS, RSKl, R.SK-I ,, RSI 2,, R.S .22S ELSK3? JR.SK32, R.S1* 4, K.Si 425 j SK .il 5 j .SKX-.25 R. K? RTYXC s, SA ps, SBK, SCYL1, SCYL2, SCYL2ps, SCYL3, SGK, SgKOSOps, Sg 069, SgK071 , SgK085, SgKl lQ, Sg 196, SGK2, SgK223, SgK269, SgK288, SGK3, SgK3Q7, SgK384ps, Sg 396, SgK424, Sg 493, SgK494, SgK495, Sg 496, SIK(e.g., SIKl, SIK2), skMLCK, SLK, Slob, sniMLC , SNRK, SPEC, SPEG2, SRC, SRM, SRPK1, SRP 2, SRPK2ps, SSTK, STK33, STK33ps, STLK3, STLK5, STLK6, STLK6psl, STLK6-rs, SuRT 106, SYK, TAK1 , TAOl, TA02, TA03, TBCK, TBK1 , TEC, TES l, TESK2, TGFbRl,
TGFbR2, ΤΪΕ1 , TIE2, TLK l, TLKlps, TL 2, TLK2psl , TL 2ps2, TNK1, Trad, Trbl, Trb2, Trb3, Trio, TRKA, TRKB, T'RKC, TSS Vl, TSSK2, TSSK3, TSSK4, TSS psl,
TSSKps2, TTBK1, TTBK2, TTK, TT , TXK, TYK2, ΊΎΚ22, TYR03, TYR03ps, ULK1, ULK2, UL 3, UL 4, VACAMKL, VR l, VRK2, VRK3, VRK3ps, Weel, Weel B, WeelBps, Weelpsl, Weel ps2, Wnkl, Wnk2, Wnk3, Wnk4, YANK , YAN 2, YA.N 3, YES, YESps, YSK1, ZAK, ZAP 70, ZCl/HGK, ZC2/TNIK, ZC3/MINK, and ZC4/NRK.
[00105] The term "SRC family kinase" refers to a family of non-receptor tyrosine protein kinases that includes nine members: SRCA subfamily that includes c-SRC (proto-oncogene tyrosine-protein kinase SRC), YES (proto-oncogene tyrosine-protein kinase Yes), FYN (proto-oncogene tyrosine-protein kinase FYN), and FGR (Gardner-Rasheed feline sarcoma viral (v-FGR) oncogene homolog); SRCB subfamily that includes LCK (lymphocyte-specific protein tyrosine kinase), HCK (tyrosine-protein kinase HCK, hemopoietic cell kinase), BLK (tyrosine-protein kinase BLK), and LYN (tyrosine-protein kinase LYN); and FRK (Fyn- reiated kinase).
[00106! The tenn "CDK" refers to a cyclin-dependent kinase. A CDK binds a cyclin (e.g., Cyclin H), which is a regulatory protein. CDKs phosphorylate their substrates at serines and threonines. The consensus sequence for the phosphorylation site in the amino acid sequence of a CDK substrate is [S/T*]PX[K/R], where S/T* is the phosphorylated serine or threonine, P is proline, X is any amino acid, K is lysine, and R is arginine. CDKs include CDK1, CDK2, CDK3, CDK4, CDK5, CDK6, CDK?, CDK 8, CDK 9. CDK10, CDK 1 1, CDK 1 2, CDK ! 3, CDK14, CDK15, CDK16, CDK17, CDK18, CDK19. and CDK20.
[00107J CDK7, cyclin-dependent Idnase 7, is a CDK, wherein the substrate is Cyclin H, MAT1 (e.g., MNAT1), or Cyclin H and MAT1. CDK7 is alternatively referred to as CAK1 , HCAK, M015, STK1, CDKN7, and p39M015. Non-limiting examples of the nucleotide and protein sequences for human CDK7 are described in GenBank Accession Number: NP 001790, incorporated herein by reference. The amino acid sequence of this CDK7 is as follows:
MA.LDVKSRA RYEKLDFLGEGQFATVY ARDKNTNQIVAI I LGHRSEAKDGINRTAL
REIKLLQELSHPN I IGLLDAFGH SNI SLVFDFMETDLE I IKDNSLVLTPSHIKAYML TLQGLEYLHQHWILHRDLKPNNLLLDENGVL LADFGLAKSFGSPNRAYTHQWTRWYRA PELLFGARMYGVGVD WAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDM CSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPG PTPGCQLPRPNCPVETL EQSNPALAIKRKRTEALEQGGLPKKLIF <SEQ ID NO: 1)
[00108] CDK12, cyclin-dependent kinase 12, is a CDK, wherein the substrate is Cyclin K or flavopiridol. CD 12 is alternatively referred to as Cdc2-reiated kinase, CDC2 -related protein kinase 7, Cell division cycle 2-related protein kinase 7, Cell division protein kinase 12, CRK7, CRKR, CRKRS, cyclin-dependent kinase 12, or KIAA0904. Non-limiting examples of the nucleotide and protein sequences for huma CDK 12 are described in Umprot Number: Q9NYV4, which is incorporated herein by reference. The amino acid sequence of this
CDK12 is as follows:
PNSERHGG DGSGGASGTLQPSSGGGSSNSRERHRLVS H RHKSKHSKDMGLVTPEA ASLGTVIKPLVEYDDISSDSDTFSDDMAFKLDRRENDERRGSDRSDRLHKHRHHQHRRSR DLLKAKQTEKE SQEVSSKSGSMKDRISGSS RSNEETDDYG AQVA SSSKESRSSKLH KEKTRKEREL SGHKDRSKSHRKRETP SYKTVDSP RRSRSPHRKWSDSSKQDDSPSGA SYGQDYDLSPSRSHTSSNYDSYKKSPGSTSRRQSVSPPYKEPSAYQSSTRSPSPYSRRQR SVSPYSRRRSSSYERSGSYSGRSPSPYGRRRSSSPFLSKRSLSRSPLPSRKSMKSRSRSP AYSRHSSSHS KRSSSRSRHSS ISPVRLPLNSSLGAELSRKK ERAAAAAAAKMDGKE,3 KGSPVFLPRKENSSVEAKDSGLESKKLPRSVKLE SAPDTELVNVTHLNTEV NSSDTGK VKLDENSEKHLV DL AQGTRDSKPIAL EEIVTPKETETSE E PPPLP IASPPPPLP TTTPPPQTPPLPPLPPIPALPQQPPLPPSQPAFSQVPASSTSTLPPSTHSKTSAVSSQAN SQPPVQVSVKTQVSVTAAIPHLKTS LPPLPLPPLLPGDDDMDSPKETLPS PV KEKEQ RTRHLLTDLPLPPELPGGDLSPPDSPEPKAITPPQQPYKKRPKICCPRYGERRQTESDWG KRCVDKFDI IGIIGEGTYGQVYKAKD DTGELVALKKVRLDNE EGFPITAIREIKILRQ LIHI^VVI KEIVTDKQDALDF^
KQLMEGLEYCH NFLHRDIKCSNILLNNSGQIKLADFGLARLYNSEESRPYTNKVITLW YRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANLELAQLELISRLCGSPCPAVW PDVIKLPYFNTMKPKKQYIUWL EEFSFIPSAALDLLDIMLTLDPSKRCTAEQTLQSDF^ DVELSKMAPPDLPHWQDCHELWSKKRRRQRQSGVWEEPPPSKTSRKETTSGTSTEPVK NSSPAPPQPAPGKVESGAGDAIGLADITQQLNQSELAVLLNLLQSQTDLSIPQMAQLLNI HSNPE QQQLEALNQSISALTEATSQQQDSETMAPEESLKEAPSAPVILPSAEQTTLEAS S PADMQNILAVLLSQLMKTQEPAGSLEENNSD NSGPQGPRRTPTMPQEEAAACPPHIL PPEKRPPEPPGPPPPPPPPPLVEGDLSSAPQELISIPAVTAALLQLLSQPEAEPPGHLPHEH
QALRPMEYSTRPRPNRTYGNTDGPETGFSAIDTDERNSGPALTESWQTI/V'KNRTFSGSL SHLGESSSYQGTGSVQFPGDQDLRFARVPLALHPWGQPFLKAEGSSNSWHAETKLQNY GELGPGTTGASSSGAGLHWGGPTQSSAYGKLYRGPTRVPPRGGRGRGVPY (SEQ ID NO : 2 )
[00109] CDK 1 3. cyclin-dependent kinase 3, is a CDK, wherein the relevant cyclin is cyclin K and a reference inhibitor is the pan-CDK inhibitor flavopiridol and the c-terminal domain (CTD) of RNA-polymerase II is a physiological substrate. CDK 13 is alternatively referred to as CHED; CDC2L; CDC2L5; or hCDK13. Non-limiting examples of the nucleotide and protein sequences for human CDK12 are described in GenBank Accession Number M80629, which is incorporated herein by reference. The amino acid sequence of this CDK13 is as follows:
MPSSSDTALGGGGGLSWAEKKLEERRKRRRFLSPQQPPLLLPLLQPQLLQPPPPPPPLLF
LAAPGTAAAAAAAAAJISSSCFSPGPPLEVKRLARG RRAGGRQKRRP.GPPAGQEAEKRRV
FSLPQPQQDGGGGASSGGGWPLVEYEDVSSQSEQGLLLGGASAATAATAAGGTGGSGGS
PASSSGTQRRGEGSERRPRRDRRSSSGRSKERHREHRRRDGQRGGSEASKSRSRHSHSGE
ERAEVAKSGSSSSSGGRR SASATSSSSSSRKDR.DSKAHRSRTKSSKEPPSAYKEPPKAY
REDKTEPKAYRRRRSLSPLGGRDDSPVSHRASQSLRSRKSPSPAGGGSSPYSRRLPRSPS
PYSRRRSPSYSRHSSYERGGDVSPSPYSSSSWRRSRSPYSPVLRRSGKSRSRSPYSSRHS
RSRSRHRLSRSRSRHSSISPSTLTLKSSLAAELNKNKKARAAEAARAM
EAAAKAAKASNTS PTKGNTETSASASQTNHVKDVKKIKIEHAPSPSSGGTLKNDKAKT
PPLQVTKVENNLIVDKATKKAVIVGKESKSAATKEESVSLKE TKPLTPSIGAKEKEQHV
ALVTSTLPPLPLPPMLPED EADSLRGNISVKAV EVEKKLRCLLADLPLPPELPGGDD
LSKSPEEKKTA QLHSKRRPKICGPRYGETKEKDID GKRC D FDI IGIIGEGTYGQVY
KARD DTGEMVALKKVRLDNEKEGFPITAIREIKILRQLTHQSIINMKEIVTD EDALDF
K D GAFYLVFEYMDHDL GLLESGLVHFNENHI SFMRQLMEGLDYCHK NFLHRDIKC
SNILLNNRGQI LADFGLARLYSSEESRPYTNKVI LWYRPPELLLGEERYTPAIDVWSC
GCILGELFTK PIFQANQELAQLELISRICGSPCPAVWPDVI LPYFNTMKP QYRR L
REEFVFIPAAALDLFDYMLALDPSKRCTAEQALQCEFLRDVEPSKMPPPDLPLWQDCHEL SKKRRRQKQMGMTDDVS IKAPRKDLSLGLDDSRTNTPQGVLPSSQLKSQGSSNVAPV
TGPGQHLNHSELAILLNLLQS TSVNMADFVQVLNI VNSETQQQLNKINLPAGILATGE
KQTDPSTPQQESSKPLGGIQPSSQ IQPKVETDAAQAAVQSAFAVLLTQLIKAQQSKQKD
VLLEEKENGSGHEASLQLRPPPEPSTPVSGQDDLIQHQDMRILELTPEPDRPRILPPDQR
PPEPPEPPPVTEEDLDYRTENQHVPTTSSSLTDPHAGVKAALLQLLAQHQPQDDPKREGG
IDYQAGDTYVS SDYKDNFGSSSFSSAPYVSNDGLGSSSAPPLERRSFIGNSDIQSLDNY
S ASSHSGGPPQPSAFSESFPSSVAGYGDIYLNAGP LFSGD DHRFEYSHGPIAVLANS
SDPSTGPESTHPLPA HNYNYGGNLQENPSGPSLMHGQT TSPAQGPGYSQGYRGHIST
STGRGRGRGLPY (SEQ ID NO: 3)
DETAILED DESCRIPTION OF CERTAIN EMBODIMENTS OF THE INVENTION
[001101 Cyclin dependent kinases (CDKs) are key regulators of the cell cycle. Their successive activation and inactivation drives the cycle forward. The activity of CDKs is regulated by multiple mechanisms such as positive and negative phosphorylation, binding of regulatory proteins like eyclins, and CDK inhibitors. CD 7 plays a critical role in the regulation of RNA polymerase II-mediated transcription of protei -encoding genes.
Disruption of CDK7, CDK12, and/or CDK 13 signaling causes defects in transcription.
However, a complete understanding of how these disruptions affect global transcription is lacking. Furthermore, the absence of selecti ve inhibitors of CDK7, CDK12, and CDK13 has hindered investigation of the transcriptional and functional consequences of acute and long- term inhibition of these kinases under normal and pathological conditions. The present invention provides selective CDK7, CDK12, and/or CDK! 3 inhibitors, which covalently modify a cysteine residue located outside of the canonical kinase domain (i.e., Cys312 of CDK7, Cysl039 of CDK12, and Cysl017 of CDK 13). Selective covalent inhibitors of these kinases may be useful in the treatment of various proliferative diseases including cancer.
[00111] The present in vention provides compounds, which inhibit the activity of a kinase, for the prevention and/or treatment of a subject with a proliferative disease. In certain embodiments, the inventive compounds inhibit the activity of a cyclin-dependent kinase (CDK). in certain embodiments, the inventive compounds inhibit the activity of a cyclin- dependent kinase 7 (CDK7). In certain embodiments, the inventive compounds inhibit the activity of a cyclin-dependent kinase 12 (CDK12). In certain embodiments, the inventive compounds inhibit the activity of a cyclin-dependent kinase 13 (CDK13). The present invention also provides methods of using the compounds described herein, e.g., as biological probes to study the inhibition of the activity of a kinase (e.g., CDK (e.g. CDK7, CDK12, and/or CDK13)), and as therapeutics, e.g., in the prevention and/or treatment of diseases associated with the overexpression and/or aberrant activity of a kinase (e.g., CDK (e.g.
CDK7, CDK12, and/or CDK13)). In certain embodiments, the diseases are proliferative diseases. The proliferative diseases that may be treated and/or prevented include, but are not limited to, cancers (e.g., breast cancer, leukemia, melanoma, multiple myeloma), benign neoplasms, diseases associated with angiogenesis, inflammator diseases, autoinflammatory diseases, and autoimmune diseases. Also provided by the present disclosure are
pharmaceutical compositions, kits, methods, and uses including a compound of Formulae (Γ), (IT), (I), and (11) as described herein.
Compounds
[00112] Aspects of the present disclosure relate to the compounds described herein. The compounds described herein may be useful in treating and/or preventing proliferative diseases in a subject, inhibiting the activity of a protein kinase (e.g., CDK) in a subject or biological sample, and inducing apoptosis of a cell. In certain embodiments, a compound described herein is a compound of any one of Formulae (!'), (IF), (I), (II), or a
pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, in certain embodiments, a compound described herein is a compound of Formula (Γ), or a pharmaceutically acceptable salt thereof. In certain embodiments, a compound described herein is a compound of Formula (I), or a pharmaceutically acceptable salt thereof. In certain embodiments, a compound described herein is a compound of Formula (IT), or a pharmaceutically acceptable salt thereof. In certain embodiments, a compound described herein is a compound of Formula (II), or a pharmaceutically acceptable salt thereof.
[00113] in certain embodiments, a compound described herein is of Formula (Γ):
Figure imgf000048_0001
or a pharmaceutically acceptable salt thereof, wherein:
R1 is hydrogen, halogen, or optionally substituted alkyl;
M is O, S, or NRM;
RM is hydrogen, optionally substituted alkyl, optionally substituted aikenyi, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl , optionally substituted aeyl, or a nitrogen protecting group;
Ring A is optionally substituted monocyclic carbocyclyl, optionally substituted monocyclic heterocyclyl, optionally substituted phenyl, or optionally substituted monocyclic heteroaryl;
Ring B is optionally substituted monocyclic carbocyclyl, optionally substituted monocyclic heterocyclyl, optionally substituted phenyl, or optionally substituted monocyclic heteroaryl;
Ring C is optionally substituted monocyclic carbocyclyl, optionally substituted monocyclic heterocyclyl, optionally substituted monocyclic or bicyclic aryl, or optionally substituted monocyclic or bicyclic heteroaryl;
each instance of RA, RB, and Rc is independently hydrogen, halogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl, -ORa, -N(Ra)2, -SRa, -CN, -SCN, -N02, -N3, or optionally substituted acyl;
each instance of Ra is independently hydrogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted acyl, a nitrogen protecting group when attached to a nitrogen atom, an oxygen protectmg group when attached to an oxygen atom, or a sulfur protecting group when attached to a sulfur atom, or two instances of Ra are joined to form a substituted or un substituted, heterocyclic ring, or substituted or unsubstituted, heteroaryl ring; each of al , bl, and cl is independently 0, 1 , 2, 3, 4, 5, or 6, as valency permits;
Ll is -CH2-, k S( -O), lh, -0-, -S-, -NRLi-, €( -()) , lc -NRL1C(=0)- ft, lc - C(0)NRLi- ¾, lc -0C(=O)- /6, or k -C(=0)0- lb wherein lh indicates the point of attachment is to Ring B; and ''''" indicates the point of attachment is to Ring C;
L2 is -0-, -S-, NRL2—, -NRL2C(=0>- -½, lh -C(=0)NRL2- />i; wherein ih indicates the point of attachment is to Ring B; and lm indicates the point of attachment is to the heteroaryl ring with M;
X is xm -C 2 R2-xa, C! I C! i , xm i2 K i X "', xm -CH2-0-CH2- xa, xm C! I2 RLX-CH2-- -0-, -S-, -NRLX-, xm -0-CH2- xa, xm -S-CH2- x xm -S-C(===0)CH2- m, or xm -NRLX-CH2-ia; wherein xa indicates the point of attachment is to Ring A; and xm indicates the point of attachment is to the heteroaryl ring with M;
each of RLi , RL2, and RLX is independently hydrogen, optionally substituted Ci_ alkyl, or a nitrogen protecting group;
2 is any of Formulae (i~l)~(!-41):
Figure imgf000049_0001
(i-1) (i-2) (i-3) (i-4) (i-5)
Figure imgf000050_0001
(i-7) (i-9)
Figure imgf000050_0002
(i-12) (i-13) (i-14)
Figure imgf000050_0003
(i-22) (i-25)
Figure imgf000050_0004
Figure imgf000051_0001
Figure imgf000051_0002
(i-37) (i-38) (i-39)
or
Figure imgf000051_0003
(i- 1)
wherein:
L3 is a bond or an optionally substituted C}_4 hydrocarbon chain, optionally wherein one or more carbon units of the hydrocarbon chain are independently replaced with -C=0- , -0-, -S-, ~NRL3a-, -NRL3aC(=0)~, -C(=0)NRL3a-, -SC(=0)-, -C(=0)S-, -OC(=0)-, -
Figure imgf000051_0004
OC-, -S(=0)-, -S(=0)0-, -OS(=0)-, -S(=0)NRL3a-, -NRL3aS(==0)-, -S("O)3-, - S(=0)20-, -OS(=0)2-, -S(=0)2NRUe-, or -NRUeS(=0)2-, wherein RL a is hydrogen, optionally substituted Ci.g alkyl, or a nitrogen protecting group, and wherein each occurrence of RL3b is independently hydrogen, halogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyciyl, optionally substituted aryl, or optionally substituted heteroaryl, or two RLjb groups are joined to form an optionally substituted carbocyclic or optionally substituted heterocyclic ring;
L4 is a bond or an optionally substituted, branched or unbranched Ci-6 hydrocarbon chain; each of R ' , R", and R ' is independently hydrogen, halogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclvi, optionally substituted heterocvciyl, optionally substituted aryl, optionally substituted heteroaryl, -CN, -CH2OREE, -CH2 (REE)2, -CH2SREE - OREE, -N(RE )2, -Si(R E)3, and -SREE, wherein each occurrence of REE is
independently hydrogen, optionally substituted alkyl, optionally substituted alkoxy, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, or optionally substituted heteroaryl, or two REE groups are joined to form an optionally substituted heterocyclic ring;
or REl and REj, or RE2 and RE3, or RE1 and RE2 are joined to form an optionally substituted carbocyelic or optionally substituted heterocyclic ring;
llE4 is a leaving group;
REj is halogen;
RE6 is hydrogen, optionally substituted Ci-g alkyl, or a nitrogen protecting group;
each instance of Y is independently O, S, or NRE/, wherein RE ' is hydrogen, optionally substituted Cj_6 alkyl, or a nitrogen protecting group;
a is 1 or 2; and
each instance of z is independently 0, 1, 2, 3, 4, 5, or 6, as valency permits.
[00114] in certain embodiments, a compound described herein is of Formula (I):
Figure imgf000052_0001
or a pharmaceutically acceptable salt thereof, wherein:
R1 is hydrogen, halogen, or optionally substituted alkyl;
M is O, S, or NRM;
is hydrogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl , optionally substituted aeyl, or a nitrogen protecting group;
Ring A is optionally substituted monocyclic carbocyclyl, optionally substituted monocyclic heterocyclyl, optionally substituted phenyl, or optionally substituted monocyclic heteroaryl; Ring B is optionally substituted monocyclic carbocyclyl, optionally substituted monocyclic heterocyclyl, optionally substituted phenyl, or optionally substituted monocyclic heteroaryl;
Ring C is optionally substituted monocyclic carbocyclyl, optionally substituted monocyclic heterocyclyl, optionally substituted phenyl, or optionally substituted monocyclic heteroaryl;
each instance of RA, R , and R is independently hydrogen, halogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl, -QRa, -N(Ra)2, -SR.4, -CN, -SCN, -N02, -N3, or optionally substituted acyl;
each instance of Ra is independently hydrogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted acyl, a nitrogen protecting group when attached to a nitrogen atom, an oxygen protecting group when attached to an oxygen atom, or a sulfur protecting group when attached to a sulfur atom, or two instances of Ra are joined to form a substituted or unsubstituted, heterocyclic ring, or substituted or unsubstituted, heteroaryl ring; each of al, bl, and cl is independently 0, 1, 2, 3, 4, 5, or 6, as valency permits;
L1 is -0-, -S-, -NRL1-, -C(=0)-, k KRi :C( -()) l lc -C(=0)NRL1- 1 lc -OC(-O)- h, or lc -C(=0)0- lh; wherein ώ indicates the point of attachment is to Ring B; and k indicates the point of attachment is to Ring C;
L2 is -0-, --S-, - RL2-, lh -NRL2C(===0>-fe, ib -C(-0) RL2- Bi; wherein lb indicates the point of attachment is to Ring B; and im indicates the point of attachment is to the heteroaryl ring with M:
X is -0-, -S-, -NRLX-, xm O h Xi!, xm S O I; v", or xm - RLX-CH2- xa; wherein xa indicates the point of attachment is to Ring A; and xm indicates the point of attachment is to the heteroaryl ring with M;
each of RL', R1'2, and RLX is independently hydrogen, optionally substituted Ci_e alkyl, or a nitrogen protecting group; R2 is any of Fonnulae (i-l)-(i-46):
Figure imgf000054_0001
Figure imgf000054_0002
(i-7) (i~8) (i-9)
Figure imgf000054_0003
(i-1 )
Figure imgf000054_0004
(i-17)
Figure imgf000054_0005
(i-21) (i-22) (i-24) (i-25)
Figure imgf000055_0001
Figure imgf000055_0002
(i-31) (i-32) (i-33) (i-34) 0-35)
Figure imgf000055_0003
L3 is a bond or an optionally substituted C hydrocarbon chain, optionally wherein one or more carbon units of the hydrocarbon chain are independently replaced with ~C=Q~, - 0-, -S-,
- RUS - RL3aC(=== 3)-, -C(=0)NRUA-, -SC(=0)-, -C(=0)S-, -0C(=O)-, -C(=0)0-, - NRUAC(=S)-, -C(=S)NRL3a~, fr¾¾v~CRL3b= RL3b-, e¾~CRL3b= RL3b-, -C C-. -S(=0)-, - S( -{))()··. -OS( ··<))-, -S(=0)NRUA-, -NRL3AS(=0)-, -S( -()),·% -S(=0)20-, -0S(=O)2-, -
S(-0)2NRL3a-, or
-NRLJAS(=0)2-, wherein RLJA is hydrogen, substituted or unsubstituted d-e alkyl, or a nitrogen protecting group, and wherein each occurrence of RL3D is independently hydrogen, halogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, or optionally substituted heteroaryl, or two RL3b groups are joined to form an optionally substituted carbocyclic or optionally substituted heterocyclic ring;
L4 is a bond or an optionally substituted, branched or unbranclied Cj.6 hydrocarbon chain;
each of REl, Rt2, and RB3 is independently hydrogen, halogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl, -CN, -CH2OREE, -CH2 (REE)2, -CH2SRE -OREE, -N(REE)2, -Si(REE)3, and ~SREE, wherein each occurrence of REt is independently hydrogen, optionally substituted alkyl, optionally substituted alkoxy, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, or optionally substituted heteroaryl, or two REt groups are joined to form an optionally substituted heterocyclic ring; or RE! and RE3, or RE2 and REj, or RE1 and RF'2 are joined to form an optionally substituted carbocyclic or optionally substituted heterocyclic ring;
RE4 is a leaving group;
RE' is halogen;
RE6 is hydrogen, substituted or unsubstituted C< _<5 alkyl, or a nitrogen protecting group;
each instance of Y is independently O, S, or NRE', wherein Rt? is hydrogen, substituted or unsubstituted C, _6 alkyl, or a nitrogen protecting group;
a is 1 or 2; and
each instance of z is independently 0, 1 , 2, 3, 4, 5, or 6, as valency permits,
[00115] In certain embodiments, a com ound described herein is of Formula (IT):
Figure imgf000056_0001
R1 is hydrogen, halogen, or optionally substituted alkyl;
M is O, S, or NRM;
RM is hydrogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl , optionally substituted acyl, or a nitrogen protecting group;
Ring A is optionally substituted monocyclic carbocyclyl, optionally substituted monocyclic heterocyclyi, optionally substituted phenyl, or optionally substituted monocyclic heteroaryl;
Ring B is optionally substituted monocyclic carbocyclyl, optionally substituted monocyclic heterocyclyi, optionally substituted phenyl, or optionally substituted monocyclic heteroaryl;
each instance of RA and RB is independently hydrogen, halogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyi, optionally substituted aryl, optionally substituted heteroaryl, OR", -N(Ra)2, -SRa, -CN, -SCN, -C(=NRa)Ra, -C(=NRa)ORa, - C(=NRa)N(Ra)2, -C(=0)Re, C(-())()R':. -C(0)N(Ra)2, -N02, -NRaC(-0)Ra, - NRaC(=G)ORa, ~NRaC(=0)N(Ra)2, -OC(=0)Ra, -OC(=0)ORa, or ~OC(=0)N(Ra)2;
each instance of Ra is independently hydrogen, optionally substituted acyl, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyi, optionally substituted aryl, optionally substituted heteroaryl, a nitrogen protecting group when attached to a nitrogen atom, an oxygen protecting group when attached to an oxygen atom, or a sulfur protecting group when attached to a sulfur atom, or two instances of Ra are joined to form a substituted or unsubstituted, heterocyclic ring, or substituted or unsubstituted, heteroaryl ring;
each of al and bl is independently 0, 1, 2, 3, 4, 5, or 6, as valency permits;
L2 is -0-, -S-, -NRL2-, ib - L2C( )>- Bi, lb -C(===G)NRL2- ; wherei ib indicates the point of attachment is to Ring B; and im indicates the point of attachment is to the heteroaryl ring with M;
X is a bond, -0-, -S-, -NRLX-, X,H O CI I, x::, xm S Ci i, v", or xm NRi C\ \2 xa: wherein xa indicates the point of attachment is to Ring A; and CTi indicates the point of attachment is to the heteroaryl ring with M;
each of l 1'2 and RLX is independently hydrogen, optionally substituted Ci_6 alkyl, or a nitrogen protecting group; R' is any of Formulae (i-l)-(i- 1):
Figure imgf000058_0001
i-2) (i~4)
Figure imgf000058_0002
Figure imgf000058_0003
2) (i-23) (i-24)
Figure imgf000059_0001
(i-28)
Figure imgf000059_0002
(i-32) (i-33) (i-34)
-L3— Br _L3-F -L3-CF3
Figure imgf000059_0003
(1-37) (i-38) (1-39)
Figure imgf000059_0004
wherein:
L3 is a bond or an optionally substituted C 1.4 ydrocarbon chain, optionally wherein one or more carbon units of the hydrocarbon chain are independently replaced with -C=0-
, -0-, -S-, -NRL3a-5 -NRUaC(=0)-, -C(==Q)NRL3a-5 -SC(=0)-, -C(=0)S-, -0C(=O)-, - C(=0)0-, -NRL3aC(-S)~, -C(=S)NRL3\ trans -CRL h^CRLih~, cis-CRL3b-CRu -, - OC-, -S(=0)-, -S(=0)0-, -OS(=0)-, -S(0)NRL3a-, -NRUaS(=0)-, -S(=0)2-, - S(=0)20-, -08(0)2-, -S(=0)2 RuS or -NRUaS(=0)2-, wherein RL3a is hydrogen, optionally substituted d-6 alkyl, or a nitrogen protecting group, and wherein each occurrence of RL3D is independently hydrogen, halogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocvciyl, optionally substituted aryl, or optionally substituted heteroaryl, or two RL3b groups are joined to form an optionally substituted carbocyclic or optionally substituted heterocyclic ring;
L4 is a bond or an optionally substituted, branched or unbranched C e hydrocarbon chain; each of RE1, RE2, and RE3 is independently hydrogen, halogen, optionally substituted alkyl, optionally substituted alkeny], optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocvciyl, optionally substituted aryl, optionally substituted heteroaryl, -CN, -CH2OREE, -CH2N(R,- ,':)2, -CH2SRE - OREE, - (REE)2, -St(REE)3, and -SREE, wherein each occurrence of REE is
independently hydrogen, optionally substituted alkyl, optionally substituted alkoxy, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, or optionally substituted heteroaryl, or two REE groups are joined to form an optionally substituted heterocyclic ring;
or REl and REj, or RE2 and RE3, or REi and RE2 are joined to form an optionally substituted carbocyclic or optionally substituted heterocyclic ring;
RE4 is a leaving group;
RE5 is halogen;
RE6 is hydrogen, optionally substituted Ci-g alkyl, or a nitrogen protecting group;
each instance of Y is independently O, S, or NRE?, wherein RE? is hydrogen, optionally substituted C alkyl, or a nitrogen protecting group;
a is 1 or 2; and
each instance of z is independently 0, 1, 2, 3, 4, 5, or 6, as valency permits.
[00116] In certain embodiments a compound described herein is of Formula (II):
Figure imgf000060_0001
or a pharmaceutically acceptable salt thereof, wherein:
R1 is hydrogen, halogen, or optionally substituted alkyl;
M is O, S, or NRM;
is hydrogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl , optionally substituted acyl, or a nitrogen protecting group;
Ring A is optionally substituted monocyclic carbocyclyl, optionally substituted monocyclic heterocyclyi, optionally substituted phenyl, or optionally substituted monocyclic heteroaryl;
Ring B is optionally substituted monocyclic carbocyclyl, optionally substituted monocyclic heterocyclyi, optionally substituted phenyl, or optionally substituted monocyclic heteroaryl;
each instance of RA and RB is independently hydrogen, halogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyi, optionally substituted aryl, optionally substituted heteroaryl, OR", -N(Ra)2, -SRa, -CN, -SCN, -C(=NRa)Ra, -C(===NRa)OR3, -C(= Ra)N(Re)2, -C(-0)Ra, -C(O)0Ra, -C(=0)N(R8)2, -NO2, -NRaC(0)Ra,
~-NRaC(=0)ORa, ~NRaC(=0)N(Ra)2, ~OC(=0)Ra, -GC(=0)ORa, or ~-OC(=0)N(Ra)2;
each instance of Rais independently hydrogen, optionally substituted acyl, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyi, optionally substituted aryl, optionally substituted heteroaryl, a nitrogen protecting group when attached to a nitrogen atom, an oxygen protecting group when attached to an oxygen atom, or a sulfur protecting group when attached to a sulfur atom, or two instances of Ra are joined to form a substituted or unsubstituted, heterocyclic ring, or substituted or unsubstituted, heteroaryl ring;
each of al and bl is independently 0, 1, 2, 3, 4, 5, or 6, as valency permits;
L2 is -0-, --S-, - RL2-, lh -NRL2C(===0>-fe, ib -C(-0) RL2- Bi; wherei lb indicates the point of attachment is to Ring B; and im indicates the point of attachment is to the heteroaryl ring with M;
X is -0-, -S-, NRLX— , xm O h Xi!, xm S O I; v", or xm - RLX-CH2- xa; wherein xa indicates the point of attachment is to Ring A; and xm indicates the point of attachment is to the heteroaryl ring with M;
each of RL and RLX is independently hydrogen, optionally substituted C, _6 alkyl, or a nitrogen protecting group; R2 is any of Fonnulae (i-l)-(i-4
Figure imgf000062_0001
i-2) (i~4)
Figure imgf000062_0002
(i-7) (i~8) (i-9)
Figure imgf000062_0003
(i-1 )
Figure imgf000062_0004
(i-17)
Figure imgf000062_0005
(i-21) (i-22) (i-24) (i-25)
Figure imgf000063_0001
(i-28)
Figure imgf000063_0002
(i-32) (i-33) (i-34) E6
-CI -LJ--Br Ld_F
Figure imgf000063_0003
(i-38) (l-J
Figure imgf000063_0004
wherein:
L3 is a bond or an optionally substituted C1-4 hydrocarbon chain, optionally wherein one or more carbon units of the hydrocarbon chain are independently replaced with -C=0, - 0-, -S-, -NRL3S -NRUaC(=0)-, -C(=0)NRUa-, -SC(=0)-, -C(=0)S-, -OC(=0)-, -C(=0)0-, - NRUaC(=S)-, -C(=S)NRL3a~, fr¾¾v~CRL3b= RL3b-, e¾~CRL3b= RL3b-, -C C-. -S(=0)-, - S( -{))()··. ~OS( -())-·,••S(-0)K Ri ¾'-, -NRL3aS(=<))-, -S( -()),·% -S(=0)20-, -0S(=O)2-, - S(0)2NRL3a-, or -NRL3aS(=0)2-, wherein RL3a is hydrogen, substituted or unsubstituted C-..6 alkyl, or a nitrogen protecting group, and wherein each occurrence of RLjb is independently hydrogen, halogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, or optionally substituted heteroaryl, or two R1'311 groups are joined to form an optionally substituted carbocyclic or optionally substituted heterocyclic ring;
L4 is a bond or an optionally substituted, branched or unbranched Q.6 hydrocarbon chain;
each of RE1, RE2, and RE3 is independently hydrogen, halogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl, -CN, -CH2OREE, -CH2N(REE)2, -CH2SREE, -OREE, -N(REE)2, -Si(REE)3, and -SREE, wherein each occurrence of REE is independently hydrogen, optionally substituted alkyl, optionally substituted alkoxy, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, or optionally substituted heteroaryl, or two REE groups are joined to form an optionally substituted heterocyclic ring;
or RE1 and RE3, or RE2 and RR', or REi and RE2 are joined to form an optionally substituted carbocyclic or optionally substituted heterocyclic ring;
RE4 is a leaving group;
Rt:! is halogen;
RE6 is hydrogen, substituted or unsubstituted C e alkyl, or a nitrogen protecting group;
each instance of Y is independently O, S, or NRE', wherein RE? is hydrogen, substituted or unsubstituted d ..(, alkyl, or a nitrogen protecting group;
a is 1 or 2; and
each instance of z is independently 0, 1, 2, 3, 4, 5, or 6, as valency permits.
[00117] As generally defined herein in Formulae (Γ), (IT), (1), and (II), R! is hydrogen, halogen, or optionally substituted alkyl. As generally defined herein in Formulae (I)-(II), R1 is hydrogen, halogen, or optionally substituted alkyl. In certain embodiments, R1 is hydrogen. In certain embodiments, R1 is halogen. In certain embodiments, R1 is F. In certain embodiments, R1 is CI. In certain embodiments, R1 is Br. In certain embodiments, R1 is I. In certain embodiments, R' is optionally substituted alkyl. In certain embodiments, R! is unsubstituted alkyl. In certain embodiments, Rl is unsubstituted Ci-ealkyl. In certain embodiments, R1 is methyl In certain embodiments, R1 is substituted alkyl. In certain embodiments, R' is substituted Chalky!. [001181 In certain embodiments, M is O. In certain embodiments, M is S. In certain embodiments, M is NR , wherein RM is as defined herein. In certain embodiments, M is NFL In certain embodiments, M is NRM, wherein RM is optionally substituted alkyl. In certain embodiments, M is NRM, wherein RM is unsubstituted alkyl. In certain embodiments, M is NCH3. In certain embodiments, M is NAc.
[00119] Compounds of any one of Formulae (Γ), (IF), (I), and (II) include Ring A attached to linker X. Compounds of any one of Formulae (I)-(H) include Ring A attached to linker X. Ring A may be optionally substituted monocyclic carbocyclyl, optionally substituted monocyclic heterocyclyl, optionally substituted phenyl, or optionally substituted monocyclic heteroaiyl. In certain embodiments, Ring A is optionally substituted monocyclic carbocyclyl. In certain embodiments, Ring A is optionally substituted cyclohexyl. In certain embodiments, Ring A is optionally substituted monocyclic heterocyclyl. In certain embodiments, Ring A is optionally substituted piperidinyl. In certain embodiments, Ring A is optionally substituted piperizinyl. In certain embodiments, Ring A is optionally substituted tetrahydropyranyl. In certain embodiments, Ring A is optionally substituted phenyl. In certain embodiments. Ring A is phenyl substituted with only X. In certain embodiments, Ring A is optionally substituted monocyclic heteroaiyl. In certain embodiments, Ring A is optionally substituted 5-membered heteroaiyl. In certain embodiments. Ring A is optionally substituted 6-membered heteroaryl. In certain embodiments, Ring A is optionally substituted pyridine. In certain embodiments, Ring A is optionally substituted pyrimidine.
[00120] In certain embodiments, Ring A is of Formula (x-i);
Figure imgf000065_0001
wherein:
each of Vi0, Vu, V12, V13, and V14 is independently O, S, N, RAS, C, or CR^, as valency permits;
each instance of RA l is independently selected from the group consisting of hydrogen, substituted or unsubstituted acyl, substituted or unsubstituted alkyl, substituted or
unsubstituted alkenyl, substituted or unsubstituted alkyny], substituted or unsubstituted carbocyclyl, substituted or unsubstituted heterocyclyl, substituted or unsubstituted aryl, substituted or unsubstituted heteroaryl, and a nitrogen protecting group; each instance of RA2 is independently selected from the group consisting of hydrogen, halogen, substituted or unsubstituted acyl, substituted or unsubstituted alkyl, substituted or unsubstituted alkenyl, substituted or unsubstituted alkynyl, substituted or unsubstituted carbocyclyL substituted or unsubstituted heterocyclyl, substituted or unsubstituted aryi, substituted or unsubstituted heteroaryl, -CN, -ORA2a, -N(RA2a)2, and -SR^3; and
each occurrence of RA2a is independently selected from the group consisting of hydrogen, substituted or unsubstituted acyl, substituted or unsubstituted alkyl, substituted or unsubstituted alkenyl, substituted or unsubstituted alkynyl, substituted or unsubstituted carbocycly], substituted or unsubstituted heterocyclyl, substituted or unsubstituted aryl, substituted or unsubstituted heteroaryl, a nitrogen protecting group when attached to a nitrogen atom, an oxygen protecting group when attached to an oxygen atom, and a sulfur protecting group when attached to a sulfur atom, or two RA2a groups are joined to form a substituted or unsubstituted heterocyclic ring.
[00121] In certain embodiments, only one of Vi0, Vu, V12, V13, and V14 is selected from the group consisting of O, S, N, Ring A is of the formula:
Figure imgf000066_0001
[00122] In certain embodiments, Ring A is of the formula;
Figure imgf000066_0002
00123] In certain embodiments, Ring A is of the formula:
Figure imgf000066_0003
[00124] In certain embodiments, only two of V10, V'1, V!2, V13, and V14 are each independently selected from the group consisting of O, S, N, and NRA!. In certain embodiments, Ring A is of the formula;
Figure imgf000067_0001
[00125] In certain embodiments, Ring A is of the formula:
Figure imgf000067_0002
[00126] In certain embodiments, Ring A is of Formula (x-ii):
[00127] In certain embodiments, R
[00128] In certain embodiments, Ri
Figure imgf000067_0003
ng A is of the formula:
Figure imgf000067_0004
In certain embodiments, Ring A is of the formula:
Figure imgf000068_0001
in certain embodiments, Ring A is of the formula; R . In certain embodiment is of the formula:
Figure imgf000068_0002
. In certain embodiments, Ring A is of the formula:
Figure imgf000068_0003
[00131] In certam embodiments, only three of Vi0, Vu, V'\ Vi3, and VK are each independently selected from the group consisting of O, S, N, and NRA! . In certain
Figure imgf000068_0004
[00132] In certain embodiments, Ring A is of the formula:
Figure imgf000068_0005
[00133] In certain embodiments, Ring A is of the formula:
Figure imgf000068_0006
Figure imgf000069_0001
In certain embodiments, only four of V10, V1', V12, Vli, and V14 are each independently selected from the group consisting of N and NRA1. In certain embodiments, Ring A is of the formula:
Figure imgf000069_0002
[00135] In certain embodiments, Ring A may also be a substituted or unsubstituted 6- membered heteroaryl ring. I certain embodiments, Ring A is of the formula:
Figure imgf000069_0003
, wherein each of V1", V", V12, ViJ, V14, and V1S is independently N, C, or CR^, as valency permits, wherein RA2 is as defined herein, In certain embodiments, only one i0, Vu, V12, V1 V'4, and V!5 is N. In certain embodiments, Ring A is of the formula:
Figure imgf000069_0004
, wherein k is 0, 1, 2, 3, or 4, and R* * is as defined herein. In certain
embodiments, Ring A is of the formula:
Figure imgf000069_0005
[00136] In certain embodiments, only two of V , V1 , V , V J, V , and V are N. In certain
Figure imgf000069_0006
[00137! I*1 certain embodiments, only three of V10, Vu, V
Figure imgf000070_0001
[00138] in certain embodiments, Ring A is of the formula:
Figure imgf000070_0002
wherein RA and al are as defined herein.
Figure imgf000070_0003
Figure imgf000071_0001
. In certain embodiments, a2 is 5; and Rgi is of the formula
[00140] In certain embodiments, Ring wherein RA and al are as defined here
[00141] In certain embodiments, al is
Figure imgf000071_0002
1; and Ring A is one of the fonnulae:
Figure imgf000071_0003
Figure imgf000072_0001
. In certain embodiments, a2 is 5; and Rgi is of the formula
[00142] In certain embodiments, Ring A is optionally substituted monocyclic heterocyclyl. In certain embodiments, Ring A is optionally substituted 5-membered heterocyclyl. In certain embodiments, Ring A is optionally substituted 6-membered heterocyclyl. In certain embodiments, Ring A is optionally substituted 6-membered heterocyclyl with one heteroatom selected from the group of S, O, and N.
[00143] In certain embodiments, Ring A is of the formula:
Figure imgf000072_0002
wherein HA is S, O, or NRHA; RHA is hydrogen, optionally substituted alkyl, or a nitrogen protecting group; and RA and al are as defined herein.
[00144] In certain embodiments, Ring a:
Figure imgf000072_0003
wherein HA, RA and al are as defined herein.
[00145] In certain embodiments, Ring a:
Figure imgf000072_0004
wherein HA, RA and al are as defined herein.
[00146] In certain embodiments, HA is S. In certain embodiments, HA is O. In certain embodiments, HA is RHA. In certain embodiments, Ring
Figure imgf000073_0001
[00148] In certain embodiments, Ring A is of the formula:
Figure imgf000073_0002
wherein RHA is hydrogen, optionally substituted alkyl, or a nitrogen protecting
and al are as defined her In certain embodiments, Ring A is of the formula
Figure imgf000073_0003
Figure imgf000073_0004
[00149] In certain embodiments, RA is hydrogen. In certain embodiments, RA is halogen. In certain embodiments, RA is F. In certain embodiments, RA is CI. In certain embodiments, RA is Br. In certain embodiments, RA is I. In certain embodiments, RA is optionally substituted alkyl. In certain embodiments, RA is unsubstituted alkyl. In certain embodiments, RA is methyl, ethyl, //-propyl, /'-propyl, n-butyl, s-butyl, t-butyl, n-pentyl, -pentyl, neo-pentyl, i- pentyl, s-pentyl, or 3 -pentyl. In certain embodiments, RA is /-butyl. In certain embodiments, RA is substituted alkyl. In certain embodiments, RA is haloalkyl. In certain embodiments, RA is -CF3, -CHF2, or -CH2F. In certain embodiments, RA is optionally substituted alkenyl. In certain embodiments, RA is optionally substituted alkynyl. In certain embodiments, RA is optionally carbocyclyl. In certain embodiments, RA is optionally substituted heterocyclyl. In certain embodiments, RA is optionally substituted aryl. In certain embodiments, RA is optionally substituted heteroaryl. In certain embodiments, RA is -ORa, wherein Ra is as defined herein. In certain embodiments, RA is -OH. In certain embodiments, RA is -ORa, wherein Ra is optionally substituted alkyl or an oxygen protecting group. In certain embodiments, RA is -OR3, wherein Ra is unsubstituted alkyl. In certain embodiments, RA is - OCH3. In certain embodiments, RA is -N(Ra)2, wherein Ra is as defined herein. In certain embodiments, RA is -NH2. In certain embodiments, RA is -N(R )2, wherein eacn instance of Ra is optionally substituted alkyl or a nitrogen protecting group. In certain embodiments, RA is -N(CH3)2. In certain embodiments, RA is -NHRa, wherein Ra is optionally substituted alkyl or a nitrogen protecting group. In certain embodiments, RA is -NHCH3.
[00150] In certain embodiments, at least one instance of RAl is H (hydrogen). In certain embodiments, at least one instance of RAl is halogen. In certain embodiments, at least one instance of RAi is F (fluorine). In certain embodiments, at least one instance of RAi is CI (chlorine). In certain embodiments, at least one instance of RA1 is Br (bromine). In certain embodiments, at least one instance of RAi is I (iodine). In certain embodiments, at least one instance of RAl is substituted acyl. In certain embodiments, at least one instance of RAl is unsubstituted acyl. In certain embodiments, at least one instance of RA l is acetyl. In certain embodiments, at least one instance of RAl is substituted acetyl. In certain embodiments, at least one instance of RAl is substituted alkyl. In certain embodiments, at least one instance of RAi is unsubstituted alkyl. In certain embodiments, at least one instance of RAl is Cs_6 alkyl. In certain embodiments, at least one instance of RA1 is methyl. In certain embodiments, at least one instance of RAl is ethyl. In certain embodiments, at least one instance of RAl is propyl. In certain embodiments, at least one instance of RAl is butyl. In certain embodiments, at least one instance of RAl is substituted alken l. In certain embodiments, at least one instance of RA1 is unsubstituted alkenyl. In certain embodiments, at least one instance of RA1 is vinyl. In certain embodiments, at least one instance of RA! is substituted alkynyl. In certain embodiments, at least one instance of RAl is unsubstituted alkynyl. In certain embodiments, at least one instance of RA1 is ethynyl. In certain embodiments, at least one instance of RA1 is substituted carbocyclyi. In certain embodiments, at least one instance of RAi is unsubstituted carbocyclyi. In certain embodiments, at least one instance of RAl is substituted heterocyclyl. In certain embodiments, at least one instance of RAi is unsubstituted heterocyclyl. In certain embodiments, at least one instance of R"1 is substituted aryl. In certain embodiments, at least one instance of RA1 is unsubstituted aryl. In certain embodiments, at least one instance of RA! is substituted phenyl. In certain embodiments, at least one instance of RAl is unsubstituted phenyl. In certain embodiments, at least one instance of RA1 is substituted heteroaryl. In certain embodiments, at least one instance of RAl is unsubstituted heteroaryl. In certain embodiments, at least one instance of RAi is substituted pyridyl. In certain embodiments, at least one instance of RAl is unsubstituted pyridyl. In certain embodiments, at least one instance of R is a nitrogen protecting group. In certain embodiments, at least one instance of RA1 is BOC.
[00151] In certain embodiments, at least one RAI is hydrogen, substituted or unsubstituted d- 6 alkyl, or a nitrogen protecting group. In certain embodiments, all instances of RAl are each independently hydrogen, substituted or unsubstituted C< -6 alkyl, or a nitrogen protecting group. In certain embodiments, all instances of RA! are hydrogen.
[00152] In certain embodiments, at least one RA2 is H. In certain embodiments, at least one RA2 is halogen. In certain embodiments, at least one RA2 is F. In certain embodiments, at least one RA2 is CI. In certain embodiments, at least one RA2 is Br. In certain embodiments, at least one RA2 is I (iodine). In certain embodiments, at least one RAi is substituted acyl. In certain embodiments, at least one RA2 is unsubstituted acyl. In certain embodiments, at least one RA2 is acetyl. In certain embodiments, at least one RA is substituted acetyl. In certain
embodiments, at least one R^ is substituted alkyl. In certain embodiments, at least one RA2 is unsubstituted alkyl. In certain embodiments, at least one R*2 is d-6 alkyl. In certain embodiments, at least one RA2 is methyl. In certain embodiments, at least one RA2 is ethyl. In certain embodiments, at least one RA2 is propyl. In certain embodiments, at least one R" is butyl. In certain embodiments, at least one R'42 is substituted alkenyl. In certain embodiments, at least one RA2 is unsubstituted alkenyl. In certain embodiments, at least one RA2 is vinyl. In certain embodiments, at least one RA2 is substituted alkynyl. In certain embodiments, at least one RA2 is unsubstituted alkynyl. In certain embodiments, at least one R'42 is ethynyl. In certain embodiments, at least one R:42 is substituted carbocyclyl. In certain embodiments, at least one A is unsubstituted carbocyclyl. In certain embodiments, at least one A is substituted heterocyclyl. In certain embodiments, at least one Rj 2 is unsubstituted
heterocyclyl. In certain embodiments, at least one RA2 is substituted aryl. In certain embodiments, at least one RA2 is unsubstituted aryl. In certain embodiments, at least one RA2 is substituted phenyl. In certain embodiments, at least one RA2 is unsubstituted phenyl. In certain embodiments, at least one RA2 is substituted heteroaryl. In certain embodiments, at least one RA is unsubstituted heteroaryl. In certain embodiments, at least one RA is substituted pyridyl. In certain embodiments, at least one RA is unsubstituted pyridyl. In certain embodiments, at least one RA2 is -ORA a, wherein R4215 is as defined herein. In certain embodiments, at least one R"42 is -OR^3, wherein RA2a is hydrogen. In certain embodiments, at least one RA2 is -ORA2a, wherein RA a is substituted or unsubstituted d-6 alkyl. In certain embodiments, at least one RA2 is -OR'423, wherein RA2a is unsubstituted Ci-6 alkyl. In certain embodiments, at least one is -OCH3. In certain embodiments, at least one R" is - N(RA a)2. In certain embodiments, at least one RA2 is -SR*23. In certain embodiments, all instances of ,A' 2 are hydrogen,
[00153] In certain embodiments, all RAi and A2 Al
R'" are hydrogen. In certain embodiments, R is hydrogen; and at least one RA2 is substituted or unsubstituted alkyl. In certain
embodiments, R' is hydrogen; and at least one A Ai2 i ·s unsubstituted alkyl. In certain embodiments, RA1 is hydrogen; and at least one RAi is methyl, ethyl, or n-propyl. I certain embodiments, RAi is hydrogen; and at least one R" is~OR a, wherein RA a is as defined herein. In certain embodiments, RAi is hydrogen; and at least one RA2 is-ORA2a, wherein R1 is substituted or unsubstituted C alkyl. In certain embodiments, RAl is hydrogen; and at least one R is-OR ,^A"23a, wherein R ,AA2a is unsubstituted Ci R Al is hydrogen; and at least one RA2 is-OCH3.
Figure imgf000076_0001
[00158] Compounds of any one of Formulae (Γ), (IF), (I), and (II) include Ring B between linker L1 and linker Ϊ.Λ Compounds of any one of Formulae (Ι)-(Π) include Ring B between linker Ll and linker L2. Ring B may be optionally substituted monocyclic carbocyclyl, optionally substituted monocyclic heterocyclvl, optionally substituted phenyl, or optionally substituted monocyclic heteroaryl. In certain embodiments, Ring B is optionally substituted monocyclic carbocyclyl. in certain embodiments, Ring B is optionally substituted monocyclic heterocyclvl. In certain embodiments, Ring B is optionally substituted pyrrolidinyl. In certain embodiments, Ring B is optionally substituted phenyl. In certain embodiments, Ring B is optionally substituted monocyclic heteroaryl. In certain embodiments, Ring B is phenyl substituted with only Ll and L2. In certain embodiments, Ring B is optionally substituted cyclohexyl. In certain embodiments, Ring B is optionally substituted piperidinyl. In certain embodiments, Ring B is optionally substituted piperizinyl. In certain embodiments. Ring B is optionally substituted pyridmyl. In certain embodiments. Ring B is optionally substituted pyrirnidinyl.
[00159] In certain embodiments of Formulae Ι' , ΙΙ'), (I), and (II), , Ring B is
Figure imgf000077_0001
substituted. In certain embodiments,
ring atom is optionally substituted. In
Figure imgf000077_0002
certain embodiment , wherein each ring atom is optionally
substituted. In certain embodiments, Ring B is
Figure imgf000077_0003
or V , wherein each ring atom is optionally substituted, and L1 and L may attach to Ring B at either indicated
position. In certain embodiments, Ring B is
Figure imgf000077_0004
, wherein each ring atom is optionally substituted, and L and R may attach to Ring B at either indicated
position. In certain embodiments, Ring B is
Figure imgf000077_0005
, wherein each ring atom is optionally substituted, and L and R2 isattached to Ring B at either position indicated. In certain
embodiments, Ring B is
Figure imgf000077_0006
, wherein each ring atom is optionally substituted, and L and L ' may attach to Ring B at either indicated
position. In certain embodiments, Ring B is
Figure imgf000078_0001
, wherein each ring atom is optionally substituted, and L1 and 1 may attach to Ring B at either indicated position.
[00160] Compounds of Formula (Γ) and (I) include Ring C between linker Ll and R . Ring C may be optionally substituted monocyclic carbocyclyl, optionally substituted monocyclic heterocyclvl, optionally substituted phenyl, or optionally substituted monocyclic heteroaryl. In certain embodiments. Ring C is optionally substituted monocyclic carbocyclyl. in certain embodiments, Ring C is optionally substituted monocyclic heterocyclvl. In certain embodiments, Ring C is optionally substituted monocyclic aryl. In certain embodiments, Ring C is optionally substituted phenyl. In certain embodiments, Ring C is optionally substituted bicyclic aryl. In certain embodiments, Ring C is optionally substituted 2,3- dihydro-lH-indene. In certain embodiments, Ring C is optionally substituted naphthalene. In
certain embodiments, Ring C is:
Figure imgf000078_0002
. In certain embodiments,
Ring C
Figure imgf000078_0003
. In certain embodiments, Ring C is optionally substituted monocyclic heteroaryl. In certain embodiments, Ring C is phenyl substituted with only L1 and R2. In certain embodiments, Ring C is optionally substituted cyclohexyl. In certain embodiments, Ring C is optionally substituted pyridinone. In certain
embodiments, Ring C is:
Figure imgf000078_0004
. In certain embodiments, Ring C is: . In certain embodiments, Ring C is optionally substituted piperidinyl. In certain embodiments. Ring C is optionally substituted piperizinyl. In certain embodiments, Ring C is optionally substituted pyridinyl. In certain embodiments, Ring C is optionally substituted pyrimidinyl. In certain embodiments, Ring C is optionally substituted bicyclic heteroaryl. In certain smbodiments, Ring C is optionally substituted indoiyl. In certain embodiments, Ring C is
optionally substituted indolinyl. In certain embodiments, Ring C is:
Figure imgf000079_0001
. In certain
embodiments, Ring C
Figure imgf000079_0002
[00161] In certain embodiments, for Formula (I'), L! is -CH2-. In certain embodiments, for Formula (Ι'), L1 is k -S(=0)2- ¾. In certain embodiments, Ll is -0-. In certain embodiments, L! is -S-. In certain embodiments, L1 is -NRLi-. In certain embodiments, L1 is -C(=0)-. In certain embodiments, l) is ~-NRLl-. In certain embodiments, L1 is !c ~OC(=0}~ w, In certain embodiments, L1 is k -C(=0)0- ffi. In certain embodiments, Ll is lc - RLi C(=0)- a. In certain embodiments, L1 is lc -C(=0)NRL1-'6. As used herein, lb indicates the point of attachment is to Ring B; and k indicates the point of attachment is to Ring C.
[00162] In certain embodiments, Ru is hydrogen. In certain embodiments, RL! is optionally substituted Ci-g alkyl. In certain embodiments, RLi is unsubstituted C}_6 alkyl. In certain embodiments, RLi is methyl. In certain embodiments, RL1 is substituted C alkyl. In certain embodiments, RL1 is a nitrogen protecting group.
[00163] in certain embodiments, L2 is -Ό-. In certain embodiments, L is -S-. In certain embodiments, L2 is - RL -, In certain embodiments, L2 is ib --- iL2C(= ))--- In certain embodiments, L2 is 10 -C(=0)NRL2-,m. As used herein, 10 indicates the point of attachment is to Ring B; and lm indicates the point of attachment is to the heteroaryl ring with M.
[00164] In certain embodiments, RL2 is hydrogen. In certain embodiments, R1'2 is optionally substituted Ci.g alkyl. In certain embodiments, RL is unsubstituted Ci.g alkyl. In certain embodiments, RL2 is methyl. In certain embodiments, RL2 is substituted Ci-6 alkyl. In certain embodiments, RL2 is a nitrogen protecting group.
[00165] In certain embodiments, for Formula (Π'), X is a bond. In certain embodiments, for Formula (Γ), X is """-CF^CF^--^. In certain embodiments, for Formula (Γ), X is xm~ CH -m. In certain embodiments, for Formula (Γ), X is *"* ~CH2~-NRLX~:ra. In certain embodiments, for Formula (V), X is xm -CHr-NH-'*", In certain embodiments, for Formula (Γ), X is xm -CH2-0-CH2- M. I certain embodiments, for Formula (Γ), X is xm I In M i CH2- ra. In certain embodiments, X is -0-. In certain embodiments, X is -S-, In certain embodiments, X is xm - S--C(=0)CH2-:,:fl. In certain embodiments, X is -NRL - In certain embodiments, X is -O-CH2-. In certain embodiments, X is -S-CH2-. In certain
embodiments, X is -NRLX-CH2-. In certain embodiments, X is -NH-CH2-.
[00166] In certain embodiments, al is 1. In certain embodiments, al is 2. In certain embodiments, al is 3.
[00167] In certain embodiments, bl is 1. In certain embodiments, bl is 2. In certain embodiments, bl is 3.
[00168] In certain embodiments, cl is 1. In certain embodiments, cl is 2. In certain embodiments, cl is 3.
[00169] In certain embodiments, RB is optionally substituted alkyl. In certain embodiments, RB is optionally substituted Ci-Ce alkyl. In certain embodiments, RB is unsubstituted C\-Ce alkyl. In certain embodiments, RB is methyl or ethyl. In certain embodiments, RB is substituted Q-Ce alkyl. In certain embodiments, RB is hydroxy C Cg alkyl. In certain embodiments, RB is -CH2OH. In certain embodiments, RB is -CH2CH2OH. In certain embodiments, RB is -N(Ra)2, wherein Ra is as defined herein. In certain embodiments, RB is - NHRa, wherein Ra is as defined herein. In certain embodiments, RB is -NHRa, wherein Ra is hydrogen or optionally substituted Ci-Cg alkyl. In certain embodiments, RB is -NH2. In certain embodiments, RB is -NHRa, wherem Ra is optionally substituted C\~Ce alkyl. In certain embodiments, RB is -NHRa, wherem Ra is unsubstituted CpCe alkyl. In certain embodiments, RB is -NHR8, wherein Ra is methyl or ethyl. In certain embodiments, RB is - NHCH3. In certain embodiments, RB is -NHRa, wherein Ra is a nitrogen protecting group. In certain embodiments, RB is -N(CH3)Ra, wherein Ra is optionally substituted Ci-Cg alkyl. In certain embodiments, RB is -N(CH3)Ra, wherein R3 is unsubstituted Q-C6 alkyl. In certain embodiments, RB is -N(CH3)Ra, wherein Ra is methyl or ethyl. In certain embodiments, RB is -N(CH3)2. In certain embodiments, R is - N(CH3)Ra, wherein Ra is a nitrogen protecting group.
[00170] In certain embodiments, Rc is optionally substituted alkyl. In certain embodiments, Rc is optionally substituted Ci-Cg alkyl. In certain embodiments, Rc is unsubstituted Q-Ce alkyl. In certain embodiments, R is methyl or ethyl. In certain embodiments, Rc is substituted Ci-Ce alkyl. In certain embodiments, Rc is hydroxy Ci-Cf, alkyl. In certain embodiments, Rc is -CH2OH. In certain embodiments, Rc is -CH2CH2OH. In certain embodiments, Rc is -N(Ra)2, wherein Ra is as defined herein. In certain embodiments, Rc is - NHRa, wherein Ra is as defined herein. In certain embodiments, Rc is -NHRa, wherem Ra is hydrogen or optionally substituted Ci-C alkyl. In certain embodiments, Rc is -N¾. In certain embodiments, Rc is -NHRa, wherein Ra is optionally substituted CrC alkyl. In certain embodiments, Rc is -NHRa, wherein Rais unsubstituted CpCe alkyl. in certain embodiments, Rc is -NHRa, wherein Ra is methyl or ethyl. In certain embodiments, Rc is - M ICH.:. In certain embodiments, Rc is ~NHRa, wherein Ra is a nitrogen protecting group. In certain embodiments, Rc is -N(CH3)Ra, wherein Ra is optionally substituted Q-C alkyl. In certain embodiments, Rc is -N(CH3)Ra, wherein Ra is unsubstituted C-. -C alkyl. In certain embodiments, Rc is -N(CH3)Ra, wherein Rais methyl or ethyl. In certain embodiments, Rc is -N(CH3)2. In certain embodiments, Rc is - N(CH3)Ra, wherein Ra is a nitrogen protecting group.
[00171] Compounds of Formula (I1) include R attached to Ring C. Compounds of Formula (I) include R2 attached to Ring C. Compounds of Formula (I) include R2 attached to Ring B. Compounds of Formula (Γ) include R2 attached to Ring B. In certain embodiments, R2 comprises an eiectrophilic moiety. In certain embodiments, R2 comprises a Michael acceptor moiety. The eiectrophilic moiety (e.g., Michael acceptor moiety) may react with a cysteine residue of a kinase (e.g., CDK (e.g., CDK7)) to allow for covalent attachment of the compound to the kinase. In certain embodiments, the eiectrophilic moiety (e.g., Michael acceptor moiety) may react with a cysteine residue of a kinase (e.g., CDK (e.g., CDK7)). In certain embodiments, the eiectrophilic moiety (e.g., Michael acceptor moiety) may react with the Cys312 residue of CDK7. In certain embodiments, the covalent attachment is irreversible. In certain embodiments, the covalent attachment is reversible.
[00172] As generally defined herein in Formulae (Γ), (IF), (I), and (II), , R2 may be any one
of Formulae (i-l)-(i-41). In certain embodiments, R2 is of Formula (i-1):
Figure imgf000081_0001
0-1)· In
certain embodiment is of Formula (i-2):
Figure imgf000081_0002
(I~2). In certain embodiments, R
is of Formula (i-3):
Figure imgf000081_0003
(i-3). In certain embodiments, R2 is of Formula (i- ): (1-4). In certain embodiments, R2 is of Formula (i-5): N (i-5). In certain embodiments, R2 is
Y
of Formula (i-6): Rt 1 (i-6). In certain embodiments, R2 is of Formula (i-7)
Figure imgf000082_0001
(1-7). In certain embodiments, R is of Formula (i-8): In certain embodiments, is of Formula i-9 : RL4 i-9 . In certain embodiments, R2 is of
-11):
Figure imgf000082_0002
(i-ll). In certain embodiments, R ' is of Formula (1-12): (i-12). In certain embodiments, is of Formula (i-13):
Figure imgf000082_0003
(i-13). In certain embodiments, R* is of Formula 1-14 :
Figure imgf000082_0004
i-14 . In certain embodiments Rz is of Fonnula i-15)
Figure imgf000082_0005
(i-15), In certain embodiments, R is of Formula (1-16): certain embodiments, R" is of Formula (i-17):
Figure imgf000083_0001
(i-17). In certain embodiments,
E2
J is of Formula (i-18): RE3 (i-18). In certain embodiments, R' is of Formula (1-19): (i-20). In certain
Figure imgf000083_0002
embodiments, 2 is of Formula (i-21): (i-21). In certain embodiments, R is of
Figure imgf000083_0003
(i-23). In certain embodiments, R is of Formula (1-24):
In certain embodiments, R ' is of Form (i-25). In certain embodiments, is of Formula (i-26):
Figure imgf000083_0004
(i-26). In certain embodiments, R is of
Figure imgf000084_0001
(1-28). in certain embodiments, R is of Formula (i-29):
29). In certain embodiments, (i-30). In certain
embodiments, is of Formul
Figure imgf000084_0002
a (i-31): (i-31). In certain embodiments, Rz is of
Formula (1-32):
Figure imgf000084_0003
(1-32), In certain embodiments, R2 is of Formula (1-33):
(i-34). In
Figure imgf000084_0004
certain embodiments, is of Formula (1-35): (1-35). In certain embodiments, R2
I |_ 3— Q| _
is of Formula (i-36): ? (1-36). In certain embodiments, R' is of Formula (1-37):
I !_' B (i-37). I.n certain embod a ;iments, > 2 is of· τ F?ormul ia_ ( iti-3 im8).: ? F (l.~38). In
■ [_3—Q „
certain embodiments, R is of Formula (i-39): ? (i-39). In certain embodiments, R AL '
is of Formula (i-40):
Figure imgf000085_0001
(i-40). In certain embodiments, is of Formula (i-41):
Figure imgf000085_0002
J In certain embodiments, R2 is of Fonnula (i-la): (i-la). In certain
Figure imgf000085_0003
embodiments, R is of Formula (i~lb): R 3 (i-lb). In certain embodiments, 2
Formula (i-lc):
Figure imgf000085_0004
(i-lc). In certain embodiments, R2 is of Formula (i-ld):
(i-ld). In certain embodiments, R is of Formula (i-le):
Figure imgf000085_0005
(!~1ε). In certain embodiments, ^ is of Formula (i-lf): (i-lf). In certain embodiments, R" is of
Formula (i-lg):
Figure imgf000085_0006
. In certain embodiments, is
Figure imgf000086_0001
. in certain embodiments. R2 is
Figure imgf000086_0002
embodiments, R? is of Formula i-lh : i-lh. In certain embodiments, R is
Figure imgf000086_0003
In certain embodiments, R is of Formula (i-la): (i-la). In certain mbodiments, R" is of Formula (i-l ):
Figure imgf000086_0004
(i-lb). In certain embodiments, Rz is of
Figure imgf000086_0005
Formua (i-lc :
1175] in certain embodiments, R is of Formula (i-18a):
Figure imgf000087_0001
(i-18a). In certain
embodiments, is of Formula i-18b :
Figure imgf000087_0002
i-18b . In certain embodiments, R is
of Formula (i-18c):
[00176] In certain em
Figure imgf000087_0003
bodiments, R1 is of Formula (i-15a): (i-15a). In certain
smbodiments, R" is of Formula i-15b):
Figure imgf000087_0004
(i-15b). In certain embodiments, R is
Figure imgf000087_0005
of Formula (i-iSc): (i-15c).
[00177] R2 may contain linker LJ or L4. In certain embodiments, L3 is a bond. L3 is an optionally substituted Q.4 hydrocarbon chain. In certain embodiments, L3 is an optionally substituted C 1 .4 hydrocarbon chain, wherem one or more carbon units of the hydrocarbon chain are independently replaced with -C(=0)-, -0-, -S-, -NRL3a-, -NRL3aC(=0)-, - C(-0)NRL3a-, -SC(=0)-, -C(=0)S-, -OC(=0)-, -C(=0)0-, -NRUaC(=S)-, ~C(-S)NRL3a-, ira¾s-CRL3b-CRL3b-, c¾-CRL3b==CRL3b~, -C C-, -S(=0)-, -S(=0)0-, -OS(=0)-, ~S(0)NRL3a~ , -NRUeS(=0)-, -S(=0)2-, -S(=0)20-, -0S(=O)2-, -S(===G)2NRL3a-, or -NRUaS(=€>)2-. In certain embodiments, L3 is an optionally substituted Q -4 hydrocarbon chain, wherem one carbon unit of the hydrocarbon chain is replaced with -NRL3a- (e.g., -NH-). In certain embodiments, L3 is of the formula: -(CH2)!-4- RL3a- (e.g., -(CH2)i-4-NH-) or -K R1 ¾'-C ! i2)i 4·· (e.g. , -NH-C]¾)i-4-). In certain embodiments, L3 is -NRL3a-. In certain embodiments, L3 is - NRL3a(C=0)-. In certain embodiments, L3 is -(C=0)NRL3a-. In certain embodiments, L3 is - NH-. In certain embodiments, L3 is -(C=0)-. In certain embodiments, L3 is -NH(C=0)-. In certain embodiments, L3 is -(C=0)NH-. In certain embodiments, L3 is -0-. In certain embodiments, L3 is -S-. In certain embodiments, L4 is a bond. In certain embodiments, L4 is an optionally substituted C1- hydrocarbon chain.
[00178] Linker L3 may contain groups RLja or RLjb. In certain embodiments, RL3a is hydrogen. In certain embodiments, at least one instance of RL3b is hydrogen. In certain embodiments, each instance of RL3b is hydrogen. In certain embodiments, at least one instance of RL3b is -CI, -Br, or -I. In certain embodiments, each instance of RL3b is -CI, -Br, or -I. In certain embodiments, at least one instance of RL3b is -F. In certain embodiments, each instance of RL3b is -F, In certain embodiments, at least one instance of RL3 is optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, or optionally substituted heteroaryl. In certain embodiments, two RL3° groups are joined to form an optionally substituted carbocyclic or optionally substituted heterocyclic ring.
[00179] R may contain groups REi, RE2, and/or RE3, In certain embodiments, RE1 is hydrogen. In certain embodiments, RE2 is hydrogen. In certain embodiments, RE3 is hydrogen. In certain embodiments, REl is -CI, -Br, or -L In certain embodiments, RE2 is -CI, -Br, or -L In certain embodiments, RE3 is -CI, -Br, or -I. In certain embodiments, REi is -F. In certain embodiments, RB2 is -F. In certain embodiments, REj is ~F. In certain embodiments, RE1 is optionally substituted alkyl (e.g. , substituted or unsubstituted Ci_ alkyl). in certain embodiments, RE2 is optionally substituted alkyl (e.g. , substituted or unsubstituted C e alkyl). In certain embodiments, Rt3 is optionally substituted alkyl (e.g., substituted or unsubstituted Ci-6 alkyl). In certain embodiments, REl is optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl, -CN, -CI¾OREE, -CH2N(REE)2, - CH2SREE, -OREE, -N(REE)2, -Si(REE)3, or -SR E. In certain embodiments, RE2 is optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl, -CN, -CH2OREE, -CH2N(REE)2, -CH2SREE, -OR™, -N(REE)2, -St(REE)3, or -SREE. In certain embodiments, REj is optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl, -CN, -CH2OREE, -CH2N(REE)2, -CH2SREE, -OREE, - N(REE)2, -Si(REE)3, or -SREE. In certain embodiments, REi is -N(REE)2. In certain
embodiments, R is -N(R )2. In certain embodiments, R is ~N(R )2. In certain embodiments, RE1 is -Ν(0¾)2. In certain embodiments, REi is -N(CH3)2. In certain embodiments, REj is -N(CH3)2. In certain embodiments, REl is -CH2N(REE)2. In certain embodiments, RE2 is - CH2N(REE)2. In certain embodiments, RE3 is - CH2N(REE)2. In certain embodiments, REi is - CH2N(CH3)2. In certain embodiments, RE2 is - CH2N(CH3)2. In certain embodiments, RF'3 is - 0Η2Ν(Ο¼)2. In certain embodiments, REl is -CN. In certain embodiments, RE2 is -CN. In certain embodiments, RE3 is -CN.
[00180] In certain embodiments, REi and RE3 are joined to form an optionally substituted carbocyclic ring. In certain embodiments, REl and RE3 are joined to form a optionally substituted heterocyclic ring. In certain embodiments, RE2 and RE3 are joined to form an optionally substituted carbocyclic ring. In certain embodiments, RE2 and REj are joined to form an optionally substituted heterocyclic ring. In certain embodiments, REl and RE2 are joined to form a optionally substituted carbocyclic ring. In certain embodiments, REl and RE2 are joined to form an optionally substituted heterocyclic ring.
[00181 ] R may contain group RE4, where RE4 is a leaving group. In certain embodiments, R1'4 is -CI, -Br, or -I. In certain embodiments, R1'4 is -F. In certain embodiments, RE4 is - OS(=0)RE4a or -OS(=0)2RE4a, wherein RE4a is substituted or unsubstituted alkyl, substituted or unsubstituted alkenyl, substituted or unsubstituted alkynyl, substituted or unsubstituted carbocyciyl, substituted or unsubstituted heterocyclyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. In certain embodiments, RE4 is -QRE4a. In certain embodiments, RE4 is -OMs, -OTf, -OTs, -OBs, or 2-nitrobenzenesulfonyloxy. In certain embodiments, RE4 is -ORE4a. In certain embodiments, RE4 is -OMe, -OCF3, or -OPh. In certain embodiments, RE4 is -OC(=0)RE4a. In certain embodiments, RE4 is -OC(=0)Me, - 0C(=O)CF3, -OC(=0)Ph, or -0C(=O)Cl. In certain embodiments, RE4 is -OC(=0)ORE4a. In certain embodiments, RE4 is -OC(=0)OMe or -OC(=0)0(t-Bu).
[00182] R2 may contain group RE5, where RE5 is a halogen. In certain embodiments, RE5 is - CI, -Br, or -I. In certain embodiments, RE5 is -F.
[00183] R may contain group REt>. In certain embodiments, RE6 is hydrogen. In certain embodiments, REo is substituted or unsubstituted CpCg alkyl. In certain embodiments, RE6 is a nitrogen protecting group.
[00184] In certain embodiments, a is 1. In certain embodiments, a is 2.
[00185] In certain embodiments, z is 0. In certain embodiments, z is 1. In certain embodiments, z is 2. In certain embodiments, z is 3, 4, 5, or 6. [00186! R ma " contain group Y. In certain embodiments, Y is O. In certain embodiments, Y is S. In certain embodiments, Y is NRE'. In certain embodiments, Y is NH.In certain embodiments, a compound of Formula (Γ) is of Formula (I).
[00187] In certain embodiments, the compound of Formula (I) is the formula :
Figure imgf000090_0001
or a pharmaceutically acceptable salt, solvate, hydrate, poiymoiph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof.
[00188] In certain embodiments, the compound of Formula (I) is the formula:
Figure imgf000090_0002
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof.
[00189] In certain embodiments, the compound of Formula (I) is the formula:
Figure imgf000090_0003
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof.
[00190] In certain embodiments, a compound of Formula (I) is of Formula (I-i):
Figure imgf000090_0004
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein L1, L2, X, Ring A, Ring C, R!, R2, RA, RB, R , al, bl, and el are as defined herein.
[00191] in certain embodiments, a compound of Formula (1) is of Formula (I-ii):
Figure imgf000091_0001
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein L , L , X, Ring A.
Ring C, R!, R2, RA, R , Rc, al, bl, and cl are as defined herein.
[00192] In certain embodiments, a compound of Formula (1) is of Formula (I-ii-a):
Figure imgf000091_0002
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodmg thereof, wherein L,1, L2, X, Ring A, Rl, R2, RA, RB, Rc, al, bl, and cl are as defined herein,
[00193] in certain embodiments, a compound of Formula (I) is of the formula:
Figure imgf000091_0003
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein L1, L2, X, R!, R^, RA, RB, Rc, al , bl, and cl are as defined herein. [00194J In certain embodiments, a compound of Formula (I) is of the formula:
Figure imgf000092_0001
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopicallv labeled derivative, or prodrug thereof, wherein L1, L,2, X, Rl, R\ RA, RB, RC, al, bl, and cl are as defined herein.
[00195! I*1 certain embodiments, a compound of Formula (I) is of the formula:
Figure imgf000092_0002
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopicallv labeled derivative, or prodrug thereof, wherein L1, L,2, X, Rl, R\ RA, RB, RC, al, bl, and cl are as defined herein.
[001961 1*1 certain embodiments a compound of Formula (I) is of the form ula:
Figure imgf000092_0003
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopicallv labeled derivative, or prodrug thereof, wherein L!, L,2, X, R1, Rz, RA, RB, RC, al, bl, and cl are as defined herein. [00197! I*1 certain embodiments, a compound of Formula (I) is of the form ula:
Figure imgf000093_0001
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopicallv labeled derivative, or prodrug thereof, wherein L1, L,2, X, Rl, R\ RA, RB, RC, al, bl, and cl are as defined herein.
[001981 1*1 certain embodiments, a compound of Formula (I) is of the form ula:
Figure imgf000093_0002
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopicallv labeled derivative, or prodrug thereof, wherein L! , L2, X, R1, R , RA, RB, Rc, al, bl, and cl are as defined herein. [00199! I*1 certain embodiments, a compound of Formula (I) is of Formula (I-
Figure imgf000094_0001
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein L! , L2, X, Ring A, R1, R2, RA, RB, Rc, al , bl , and cl are as defined herein,
[00200] In certain embodiments a compound of Formula (I) is of the form ula:
Figure imgf000094_0002
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein L1, L2, X, R1, R RA, RB, Rc, al, bl , and cl are as defined herein.
[00201] In certain embodiments, a compound of Formula (1) is of Formula (I-ii-c):
Figure imgf000094_0003
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein L1, L2, X, Ring A, Rl, R2, RA, RB, L, al, bl, and cl are as defined herein. [00202 J In certain embodiments, a compound of Formula (I) is of the formula:
Figure imgf000095_0001
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopicallv labeled derivative, or prodrug thereof, wherein L1, L2, X, Rl, R\ RA, RB, RC, al, bl, and cl are as defined herein.
[00203! I*1 certain embodiments a compound of Formula (I) is of Formula (I-il~A):
Figure imgf000095_0002
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopicallv labeled derivative, or prodrug thereof, wherein L! , L2, X, R1, R , RA, RB, Rc, bl, and cl are as defined herein.
[00204] In certain embodiments, a compound of Formula (I) is of Formula (I-iii):
Figure imgf000095_0003
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein L1, L2, X, Ring A, Ring C, R1, R , RA, RB, Rc, al, bl, and cl are as defined herein. [00205! I*1 certain embodiments, a compound of Formula (I) is of Formula (I-
Figure imgf000096_0001
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein Ll, L2, X, Ring A, Ring C, R!, R , RA, R , Rc, al, bl , and cl are as defined herein.
[00206] In certain embodiments, a compound of Formula (I) is of Formula (I~iv-a):
Figure imgf000096_0002
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein L! , L,2, X, Ring A, R1, R2, RA, RB, Rc, al, bl, and cl are as defined herein.
[00207] In certain embodiments, a compound of Formula (I) is of the formula:
Figure imgf000096_0003
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein L! , L2, X, R1, R , RA, RB, Rc, al, bl, and cl are as defined herein. [00208! I*1 certain embodiments, a compound of Formula (I) is of Formula (I-iv-b):
Figure imgf000097_0001
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein L! , L2, X, Ring A. R1, R2, RA, RB, Rc, al , bl, and cl are as defined herein,
[00209] In certain embodiments, a compound of Formula (I) is of the form ula:
Figure imgf000097_0002
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein L1, L2, X, R1, R , RA, RB, Rc, al, bl , and cl are as defined herein.
[00210] In certain embodiments, a compound of Formula (I) is of Formula (I-v):
Figure imgf000097_0003
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein L!, L2, X, Ring A, Ring C, R!, R2, RA, RB, Rc, al, bl, and cl are as defined herein. [00211] In certain embodiments, a compound of Formula (I) is of Formula (I-v-a):
Figure imgf000098_0001
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein L! , L2, X, Ring A. R1, R2, RA, RB, Rc, al , b l , and cl are as defined herein,
[00212] In certain embodiments a compound of Formula (1) is of the form ula:
Figure imgf000098_0002
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein L1, L2, X, R1, R RA, RB, Rc, al, bl , and cl are as defined herein.
[00213] In certain embodiments, a compound of Formula (1) is of Formula (I-v-b):
Figure imgf000098_0003
(I-v-b),
or a pharmaceutically acceptable salt, solvate, hydrate, polymoiph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein L1, L2, X, Ring A, Rl, R2, RA, RB, L, al , bl, and cl are as defined herein. [00214J In certain embodiments, a compound of Formula (I) is of the formula:
Figure imgf000099_0001
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopicallv labeled derivative, or prodrug thereof, wherein L1, L,2, X, Rl, R RA, RB, RC, al, bl, and cl are as defined herein.
[00215! I*1 certain embodiments, a compound of Formula (Ι') is of of Formula (I'-A):
Figure imgf000099_0002
or a phannaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein Ll, L2, X, Ring A, R1, R2, RA, RB, Rc, al, bl, and cl are as defined herein,
[00216] n certain embodiments a com ound of Formula (Γ) is of the formula:
Figure imgf000099_0003
or a phannaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein L1, L2, X, R1, R , RA, RB, Rc, bl, and cl are as defined herein.
[00217] in certain embodiments, a compound of Formula (1?) is of of Formula (l'-i):
Figure imgf000100_0001
or a phannaceuticaily acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein L1, L2, X, Ring A, Rl, R2, RA, RB, Rc, al , bl, and cl are as defined herein,
[00218] In certain embodiments, a compound of Formula (Γ) is of of Formula (I'-ii):
Figure imgf000100_0002
or a pharmaceutically acceptable salt, solvate, hydrate, polymoiph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein L1, L2, X, Ring A, ll, R2, RA, RB, Rc, al , bl, and cl are as defined herein.
[00219] In certain embodiments, a compound of Formula (Γ) is of of Formula (I'-ili)
Figure imgf000100_0003
or a pharmaceutically acceptable salt, solvate, hydrate, polymoiph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein L1, L2, X, Ring A, ll, R2, RA, RB, al , bl, and cl are as defined herein. [00220] In certain embodiments, a compound of Formula (Ι') is of the formula
Figure imgf000101_0001
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein Ll, L2, X, R! , R2, RA, RB, Rc, bi , and cl are as defined herein.
[00221] In certain embodiments, a compound of Formula (II') is of Formula (II),
[00222] In certain embodiments, the compound of Formula (II) is the formula:
Figure imgf000101_0002
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof.
[00223] In certain embodiments, the compound of Formula (II) is the formula:
Figure imgf000101_0003
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof. [00224] In certain embodiments, the compound of Formula (II) is the formula:
Figure imgf000102_0001
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, tsotopicaily labeled derivative, or prodrug thereof.
[00225] In certain embodiments, a compound of Formula (II) is of Formula (Il-i):
Figure imgf000102_0002
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, tsotopicaily labeled derivative, or prodrug thereof, wherein L2, X, Ring A, R1, R2, RA, RB, al, and bl are as defined herein.
[00226] In certain embodiments, a compound of Formula (II) is of the formula:
Figure imgf000102_0003
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof.
[00227] In certain embodiments, a compound of Formula (II) is of the formula:
Figure imgf000102_0004
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof.
[00228] In certain embodiments, a compound of Formula (ΙΓ) is of Formula (II'~i):
Figure imgf000102_0005
or a phannaceuticaily acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopicaliy labeled derivative, or prodrug thereof, wherein L2, X, Ring A, R1, R2, RA, RB, and bl are as defined herein.
[00229 in certain embodiments, the compound of Formula (ΙΓ) is of the formula:
Figure imgf000103_0001
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopicaliy labeled derivative, or prodrug thereof.
[00230] in certain embodiments, a compound of Formula (II) is of Formula (Il-i!):
Figure imgf000103_0002
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopicaliy labeled derivative, or prodrug thereof, wherein L2, X, Ring A, Rl, R2, RA, RB, al , and blare as defined herein.
[00231] In certain embodiments, a compound of Formula (II) is of the formula:
Figure imgf000103_0003
or a phannaceuticaily acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopicaliy labeled derivative, or prodrug thereof. [00232 J In certain embodiments, a compound of Formula (II) is of the formula:
Figure imgf000104_0001
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof.
[00233 J In certain embodiments, a compound of Formula (II) is of Formula (II-iii):
Figure imgf000104_0002
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein L2, X, Ring A, R2, RA, RB, al, and blare as defined herein.
[00234] In certain embodiments, a compound of Formula (II) is of the formula:
Figure imgf000104_0003
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof. [00235 J In certain embodiments, a compound of Formula (II) is of the formula:
Figure imgf000105_0001
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof.
[00236] In certain embodiments, a compound of Formula (Γ) is of the formula:
Figure imgf000105_0002
YLIU-01-007-1
Figure imgf000106_0001
104
Figure imgf000107_0001
105 [00237 J In certain embodiments, a compound of Formula (I) is of the formula:
Figure imgf000108_0001
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof. 38 J In certain embodiments, a compound of Formula (Ϊ) is of the formula:
Figure imgf000109_0002
Figure imgf000109_0001
Figure imgf000110_0001
108
Figure imgf000111_0001
109
Figure imgf000112_0001
110
Figure imgf000113_0001
111
Figure imgf000114_0001
112
Figure imgf000115_0001
113
Figure imgf000116_0001
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof.
[00239] In certain embodiments, a compound of Formula (II1) is of the formula:
Figure imgf000116_0002
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof. [00240 J In certain embodiments, a compound of Formula (II) is of the formula:
Figure imgf000117_0001
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof.
Pharmaceutical Compositions and Administration
[00241] The pharmaceutical compositions described herein may be useful in treating and/or preventing proliferative diseases (e.g., cancers (e.g., leukemia, acute lymphoblastic leukemia, lymphoma, Burkitt's lymphoma, melanoma, multiple myeloma, breast cancer, Ewing's sarcoma, osteosarcoma, brain cancer, neuroblastoma, lung cancer, colorectal cancer), benign neoplasms, diseases associated with angiogenesis, inflammatory diseases, autoinflammatory diseases, and autoimmune diseases) in a subject. The compositions described herein mayalso be useful for inhibiting the activity of a protein kinase (e.g., CDK (e.g., CD 7, CDK12, and/or CDK13)) in a subject, biological sample, tissue, or cell. The compositions described herein may also be useful for inducing apoptosis in a cell.
[00242] The present disclosure provides pharmaceutical compositions comprising a compound described herein (e.g., a compound of any one of Formulae (V), (IT), (I), (II), , or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, and optionally a pharmaceutically acceptable excipient. In certain embodiments, the pharmaceutical composition of the invention comprises a compound described herein, or a pharmaceutically acceptable salt thereof, and optionally a pharmaceutically acceptable excipient. In certain embodiments, a pharmaceutical composition described herein comprises a compound described herein, or a pharmaceutically acceptable salt thereof, and a pharmaceutically acceptable excipient. In certain embodiments, the compound described herein, or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer,
stereoisomer, isotopically labeled derivative, or prodrug thereof, is provided in an effective amount in the pharmaceutical composition.
[00243] In certain embodiments, the effective amount is a therapeutically effective amount (e.g., amount effective for treating a proliferative disease in a subject in need thereof). In certain embodiments, the effective amount is an amount effective for inhibiting the activity of a protein kinase (e.g., CDK (e.g., CDK.7, CDK12, and/or CDK 13)) in a subject in need thereof. In certain embodiments, the effective amount is an amount effective for inhibiting the activity of a protem kinase (e.g., CDK (e.g., CDK7, CDK12, and/or CDK13)) in a cell. In certain embodiments, the effective amount is an amount effective for inducing apoptosis in a cell. In certain embodiments, the effective amount is a prophylactically effective amount (e.g., amount effective for preventing a proliferative disease in a subject in need thereof and/or for keeping a subject in need thereof in remission of a proliferative disease).
[00244] In certain embodiments, the protein kinase being inhibited is a CDK. In certain embodiments, the protem kinase being inhibited is CDK1, CD 2, CDK3, CDK4, CDK5, CDK6, CDK7, CDK8, CDK9, CDK10, CDK1 1, CDK12, CDK13, CDK14, CDK15, CDK16, CDK17, CDK18, CDK19, or CDK20. In certain embodiments, the protein kinase being inhibited is CDK7. In certain embodiments, the protem kinase being mhibited is CDK12. In certain embodiments, the protein kinase being inhibited is CDK13. In certain embodiments, the protein kinase being inhibited is a Src family kinase. In certain embodiments, the protein kinase being inhibited is SRC. In certain embodiments, the protein kinase being inhibited is FGR. In certain embodiments, the protein kinase being inhibited is BUB IB. In certain embodiments, the protein kinase being inhibited is CHEK2. In certain embodiments, the protein kinase being inhibited is HIPK4. In certain embodiments, the protein kinase being inhibited is PRKCQ. in certain embodiments, the protein kinase being inhibited is RET. In certain embodiments, the protein kinase being inhibited is MELK. In certain embodiments, the protein kinase being inhibited is IRAKI, IRAK4, BMX, or PI3K. In certain embodiments, the protem kinase being inhibited is ABL, ARG, BLK, CSK, EphB l, EphB2, FGR, FRK, FYN, SRC, YES, LCK, LYN, MAP2K5, NLK, p38a, SNRK, or TEC. In certain
embodiments, the protein kinase being inhibited is ABL1 (H396P)-phosphorylated, ABL1 - phosphorylated, BLK, EPHA4, EPHB2, EPHB3, EPHB4, PGR, JAK3(JH1 domain-catalytic), KIT, K1T(L576P), KIT(V559D), PDGFRB, SRC, YES, ABLl(H396P)-nonphosphorylated, ABLl(Y253F)-phosphorylated, ABL1 -nonphosphorylated, FRK, LYN, ABL1(Q252H)- nanphosphor lated, DDR1 , EPHB1 , ERBB4, p38-alpha, ABL2, ABL1 (Q252H)- phosphorylated, SIK, EPHA8, MEK5, ABLl(E255K)-phosphorylated, ABL1(F317L)~ nonphosphor lated, FYN, LCK, EPHA2, ABLl(M351T)-phosphorylated, TXK,
EGFR(L858R), EGFR(L861Q), ERBB2, ERBB3, EPHA5, ABL1(F317T)~
nonphosphorylated, EGFR(L747-E749del, A750P), CSK, EPHAl , ABL1(F317L)~ phosphorylated, BRAF(V600E), EGFR, ΚΓΓ-autoinhibited, or EGFR(E746-A750dei). In certain embodiments, the protein Idnase being inhibited is ABLl (F317L)-nonphosphorylated, ABL1 (H396P)-nonphosphorylated, ABL1 (H396P)-phosphorylated, ABL1 -phosphorylated, BLK, EPHA4, EPHB2, EPHB3, EPHB4, K3(j i ! i domain-catalytic), KIT, KIT(L576P), K1T(V559D), LYN, PDGFRB, SRC, YES, ABL 1 -nonphosphorylated, ABL1(Y253F)- phosphorylated, ERBB3, FGR, FRK, p38-alpha, ABL'l(F317I)-nonphosphorylated, DDRl , EPHA2, ABLl(Q252H)~phosphorylated, MEK5, ABLl(Q252H)-nonphosphoiylated, ABL2, FYN, EPHB1, ABLl(E255K phosphoryiated, ABLl(F317L)-phosphoiyiated, EPHAl, ABLl(M351T)-phosphoiylated, ERBB4, TXK, LCK, EPHA8, SIK, EPHA5, EGFR(L861Q), CSFl R-autoinhibited, BRAF(V600E), BRK, CSK, KIT(D816V), KIT-autoinhibited,
EGFR(L747-T751 del.Sins), EGFR(L858R), EGFR(L,747-E749del, A750P), or CSFIR.
[00245] In certain embodiments, the effective amount is an amount effective for inhibiting the activity of a protein Idnase (e.g., CDK (e.g., CDK7, CDK12, and/or CDK13)) by at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, or at least about 98%. In certain embodiments, the effective amount is an amount effective for inhibiting the activity of a protein kinase (e.g., CDK (e.g., CDK7, CDK12, and/or CDK13)) by not more than 10%, not more than 20%, not more than 30%, not more than 40%, not more than 50%, not more than 60%, not more than 70%, not more than 80%, not more than 90%, not more than 95%, or not more than 98%. In certain embodiments, the effective amount is an amount effective for inhibiting the activity of a protein kinase (e.g., CDK (e.g., CDK7, CDK12, and/or CDK13)) by a range between a percentage described in this paragraph and another percentage described in this paragraph, inclusive. [00246J Phannaceuiical compositions described herein can be prepared by any method known in the art of pharmacology. In general, such preparatory methods include bringing the compound described herein (i.e. , the "active ingredient") into association with a carrier or excipient, and/or one or more other accessory ingredients, and then, if necessary and/or desirable, shaping, and'or packaging the product into a desired single- or multi-dose unit.
[00247] Pharmaceutical compositions can be prepared, packaged, and/or sold in bulk, as a single unit dose, and/or as a plurality of single unit doses. A "unit dose" is a discrete amount of the pharmaceutical composition comprising a predetermined amount of the active ingredient. The amount of the active ingredient is generally equal to the dosage of the active ingredient which would be administered to a subject and/or a convenient fraction of such a dosage, such as one-half or one -third of such a dosage,
[00248] Relative amounts of the active ingredient, the pharmaceutically acceptable excipient, and'or any additional ingredients in a pharmaceutical composition described herein will vary, depending upon the identity, size, and'or condition of the subject treated and further depending upon the route by which the composition is to be administered. The composition may comprise between about 0.1% and about 100% (w/w) of the active ingredient.
[00249] Pharmaceutically acceptable excipients used in the manufacture of provided pharmaceutical compositions include inert diluents, dispersing and/or granulating agents, surface active agents and'or emulsiiiers, disintegrating agents, binding agents, preservatives, buffering agents, lubricating agents, and/or oils. Excipients such as cocoa butter and suppository waxes, coloring agents, coating agents, sweetening, flavoring, and perfuming agents may also be present in the composition.
[0025OJ Exemplar}' diluents include calcium carbonate, sodium carbonate, calcium phosphate, dicalcium phosphate, calcium sulfate, calcium hydrogen phosphate, sodium phosphate lactose, sucrose, cellulose, microcrystalline cellulose, kaolin, mannitol, sorbitol, inositol, sodium chloride, dry starch, cornstarch, powdered sugar, and mixtures thereof.
[00251] Exemplary granulating and/or dispersing agents include potato starch, com starch, tapioca starch, sodium starch glycolate, clays, alginic acid, guar gum, citrus pulp, agar, bentonite, cellulose, and wood products, natural sponge, cation-exchange resins, calcium carbonate, silicates, sodium carbonate, cross-linked poly(vinyl-pyrrolidone) (crospovidone), sodium carboxymethyl starch (sodium starch glycolate), carboxymethyl cellulose, cross- linked sodium carboxymethyl cellulose (croscarmellose), methylcellulose, pregelatinized starch (starch 1500), microcrystalline starch, water insoluble starch, calcium carboxymethyl cellulose, magnesium aluminum silicate (Veegum), sodium lauryl sulfate, quaternary ammonium compounds, and mixtures thereof.
[00252] Exemplary surface active agents and/or emulsifiers include natural emulsifiers (e.g., acacia, agar, alginic acid, sodium alginate, tragacantli, chondrux, cholesterol, xanthan, pectin, gelatin, egg yolk, casein, wool fat, cholesterol, wax, and lecithin), colloidal clays (e.g., bentonite (aluminum silicate) and Veegum (magnesium aluminum silicate)), long chain amino acid derivatives, high molecular weight alcohols (e.g. , stearyl alcohol, cetyl alcohol, oleyl alcohol, triacetin monostearate, ethylene glycol distearate, glyceryl monostearate, and propylene glycol monostearate, polyvinyl alcohol), carbomers (e.g., carboxy polymethylene, polyacrylic acid, acrylic acid polymer, and carboxyvrnyl polymer), carrageenan, cellulosic derivatives (e.g., carboxymethylcellulose sodium, powdered cellulose, hydroxymethyl cellulose, hydroxypropyl cellulose, hydroxypropyl methylcellulose, methylcellulose), sorbitan fatty acid esters (e.g., polyoxyethylene sorbitan monolaurate (Tween® 20), polyoxyethylene sorbitan (Tween® 60), polyoxyethylene sorbitan monooleate (Tween® 80), sorbitan monopalmitate (Span® 40), sorbitan monostearate (Span® 60), sorbitan tristearate (Span® 65), glyceryl monooleate, sorbitan monooleate (Span* 80), polyoxyethylene esters (e.g., polyoxyethylene monostearate (Myrj® 45), polyoxyethylene hydrogenated castor oil, polyethoxylated castor oil, polyoxymethylene stearate, and Solutol®), sucrose fatty acid esters, polyethylene glycol fatty acid esters (e.g., Cremophor®), polyoxyethylene ethers, (e.g., polyoxyethylene lauryl ether (Brij® 30)), po]y(viny]-pyrrolidone), diethylene glycol monolaurate, triethanolamine oleate, sodium oleate, potassium oleate, ethyl oleate, oleic acid, ethyl laurate, sodium lauryl sulfate, Pluronic® F-68, poloxamer P-188, cetrimonium bromide, cetylpyridinium chloride, benzalkonium chloride, docusate sodium, and/or mixtures thereof.
[00253] Exemplar ' binding agents include starch (e.g., cornstarch and starch paste), gelatin, sugars (e.g., sucrose, glucose, dextrose, dextrin, molasses, lactose, lactitol, mannitol, etc.), natural and synthetic gums (e.g., acacia, sodium alginate, extract of Irish moss, panwar gum, ghatti gum, mucilage of isapol husks, carboxymethylcellulose, methylcellulose,
ethylcellulose, hydroxyethylcellulose, hydroxypropyl cellulose, hydroxypropyl
methylcellulose, microcrystalline cellulose, cellulose acetate, poly(vinyl-pyrrolidone), magnesium aluminum silicate (Veegum®), and larch arabogalactan), alginates, polyethylene oxide, polyethylene glycol, inorganic calcium salts, silicic acid, polymethacrylates, waxes, water, alcohol, and/or mixtures thereof.
[00254] Exemplary preservatives include antioxidants, chelating agents, antimicrobial preservatives, antifungal preservatives, antiprotozoan preservatives, alcohol preservati es, acidic preservatives, and other preservatives. In certain embodiments, the preservative is an antioxidant. In other embodiments, the preservative is a chelating agent.
[00255] Exemplary antioxidants include alpha tocopherol, ascorbic acid, ascorbyl palmitate, butylated hydroxyanisole, butylated hydroxytoluene, monot iogiycerol, potassium
metabisulfite, propionic acid, propyl gallate, sodium ascorbate, sodium bisulfite, sodium metabisulfite, and sodium sulfite.
[00256] Exemplary chelating agents include emylenediamrnetetraacetic acid (EDTA) and salts and hydrates thereof (e.g., sodium edetate, disodium edetate, trisodium edetate, calcium disodium edetate, dipotassium edetate, and the like), citric acid and salts and hydrates thereof (e.g., citric acid monohydrate), fumaric acid and salts and hydrates thereof, malic acid and salts and hydrates thereof, phosphoric acid and salts and hydrates thereof, and tartaric acid and salts and hydrates thereof. Exemplary antimicrobial preservatives include benzalkonium chloride, benzethomum chloride, benzyl alcohol, bronopol, cetrimide, cetylpyridinium chloride, chlorhexidine, chlorobutanol, chlorocresol, chloroxylenol, cresol, ethyl alcohol, glycerin, liexetidiiie, imidurea, phenol, phenoxyethanol, phenyletliyl alcohol, phenylmercuric nitrate, propylene glycol, and thimerosal.
[00257] Exemplary antifungal preservatives include butyl paraben, methyl paraben, ethyl paraben, propyl paraben, benzoic acid, hydroxybenzoic acid, potassium benzoate, potassium sorbate, sodium benzoate, sodium propionate, and sorbic acid.
[00258] Exemplary alcohol preservatives include ethanol, polyethylene glycol, phenol, phenolic compounds, bisphenol, chlorobutanol, hydroxybenzoate, and phenylethyl alcohol.
[00259] Exemplary acidic preservatives include vitamin A, vitamin C, vitamin E, beta- carotene, citric acid, acetic acid, dehydroacetic acid, ascorbic acid, sorbic acid, and phytic acid.
[00260] Other preservatives include tocopherol, tocopherol acetate, deteroxime mesylate, cetrimide, butylated hydroxyanisol (BHA), butylated hydroxytoluened (BHT),
ethylenediamine, sodium lauryl sulfate (SLS), sodium lauryl ether sulfate (SLES), sodium bisulfite, sodium metabisulfite, potassium sulfite, potassium metabisulfite, Glydant® Plus, Plienonip®, methylparaben, Germali® 115, Germaben® II, Neolone®, Kathon^, and Euxyi1*.
[00261] Exemplaiy buffering agents include citrate buffer solutions, acetate buffer solutions, phosphate buffer solutions, ammonium chloride, calcium carbonate, calcium chloride, calcium citrate, calcium glubionate, calcium gluceptate, calcium gluconate, D-gluconic acid, calcium glycerophosphate, calcium lactate, propanoic acid, calcium levulinate, pentanoic acid, dibasic calcium phosphate, phosphoric acid, tribasic calcium phosphate, calcium hydroxide phosphate, potassium acetate, potassium chloride, potassium gluconate, potassium mixtures, dibasic potassium phosphate, monobasic potassium phosphate, potassium phosphate mixtures, sodium acetate, sodium bicarbonate, sodium chloride, sodium citrate, sodium lactate, dibasic sodium phosphate, monobasic sodium phosphate, sodium phosphate mixtures, tromethamine, magnesium hydroxide, aluminum hydroxide, alginic acid, pyrogen- free water, isotonic saline, Ringer's solution, ethyl alcohol, and mixtures thereof,
[00262] Exemplary lubricating agents include magnesium stearate, calcium stearate, stearic acid, silica, talc, malt, glyceryl behanate, hydrogenated vegetable oils, polyethylene glycol, sodium benzoate, sodium acetate, sodium chloride, leucine, magnesium lauryl sulfate, sodium lauryl sulfate, and mixtures thereof.
[00263] Exemplary natural oils include almond, apricot kernel, avocado, babassu, bergamot, black current seed, borage, cade, camomile, canola, caraway, carnauha, castor, cinnamon, cocoa butter, coconut, cod liver, coffee, corn, cotton seed, emu, eucalyptus, evening primrose, fish, flaxseed, geraniol, gourd, grape seed, hazel nut, hyssop, isopropyl myristate, jojoba, kukui nut, lavandin, lavender, lemon, litsea cubeba, macademia nut, mallow, mango seed, meadowfoam seed, mink, nutmeg, olive, orange, orange roughy, palm, palm kernel, peach kernel, peanut, poppy seed, pumpkin seed, rapeseed, rice bran, rosemary, safflower, sandalwood, sasquana, savoury, sea buckthorn, sesame, shea butter, silicone, soybean, sunflower, tea tree, thistle, tsubaki, vetiver, walnut, and wheat germ oils. Exemplary synthetic oils include, but are not limited to, butyl stearate, caprylic triglyceride, capric triglyceride, cyclomethicone, diethyl sebacate, dimethicone 360, isopropyl myristate, mineral oil, octyldodecanol, oleyl alcohol, silicone oil, and mixtures thereof,
[00264J Liquid dosage forms for oral and parenteral administration include pharmaceutically acceptable emulsions, microemulsions, solutions, suspensions, syrups and elixirs. In addition to the active ingredients, the liquid dosage forms may comprise inert diluents commonly used in the art such as, for example, water or other solvents, solubilizing agents and emulsifiers such as ethyl alcohol, isopropyl alcohol, ethyl carbonate, ethyl acetate, benzyl alcohol, benzyl benzoate, propylene glycol, 1,3-butylene glycol, dimethylformamide, oils (e.g., cottonseed, groundnut, corn, germ, olive, castor, and sesame oils), glycerol, tetrahydrofurfuryl alcohol, polyethylene glycols and fatty acid esters of sorbitan, and mixtures thereof. Besides inert diluents, the oral compositions can include adjuvants such as wetting agents, emulsifying and suspending agents, sweetening, flavoring, and perfuming agents. In certain embodiments for parenteral administration, the conjugates described herein are mixed with solubilizing agents such as Creinophor , alcohols, oils, modified oils, glycols, polysorbates, cyclodextrins, polymers, and mixtures thereof,
[00265] Injectable preparations, for example, sterile injectable aqueous or oleaginous suspensions can be formulated according to the known art using suitable dispersing or wetting agents and suspending agents. The sterile injectable preparation can be a sterile injectable solution, suspension, or emulsion in a nontoxic parenterally acceptable diluent or solvent, for example, as a solution in 1,3-butanediol. Among the acceptable vehicles and solvents that can be employed are water, Ringer's solution, U.S.P., and isotonic sodium chloride solution. In addition, sterile, fixed oils are conventionally employed as a solvent or suspending medium. For this purpose any bland fixed oil can be employed including synthetic mono- or di-glycerides. In addition, fatty acids such as oleic acid are used in the preparation of injectables.
[00266] The injectable formulations can be sterilized, for example, by filtration through a bacterial-retaining filter, or by incorporating sterilizing agents in the form of sterile solid compositions which can be dissolved or dispersed in sterile water or other sterile injectable medium prior to use.
[00267] In order to prolong the effect of a drug, it is often desirable to slow the absorption of the drug from subcutaneous or intramuscular injection. This can be accomplished by the use of a liquid suspension of crystalline or amorphous material with poor water solubility. The rate of absorption of the drug then depends upon its rate of dissolution, which, in turn, may depend upon crystal size and crystalline form. Alternatively, delayed absorption of a parenterally administered drug form may be accomplished by dissolving or suspending the drug in an oil vehicle.
[00268] Compositions for rectal or vaginal administration are typically suppositories which can be prepared by mixing the conjugates described herein with suitable non-irritating excipients or carriers such as cocoa butter, polyethylene glycol, or a suppository wax which are solid at ambient temperature but liquid at body temperature and therefore melt in the rectum or vaginal cavity and release the active ingredient.
[00269] Solid dosage forms for oral administration include capsules, tablets, pills, powders, and granules. In such solid dosage forms, the active ingredient is mixed with at least one inert, pharmaceutically acceptable excipient or carrier such as sodium citrate or dicalcium phosphate and/or (a) fillers or extenders such as starches, lactose, sucrose, glucose, mannitol, and silicic acid, (b) binders such as, for example, carboxymethylcellulose, alginates, gelatin, polyvinylpyrroHdinone, sucrose, and acacia, (c) humectants such as glycerol, (d) disintegrating agents such as agar, calcium carbonate, potato or tapioca starch, alginic acid, certain silicates, and sodium carbonate, (e) solution retarding agents such as paraffin, (f) absorption accelerators such as quaternary ammonium compounds, (g) wetting agents such as, for example, cetyl alcohol and glycerol monostearate, (h) absorbents such as kaolin and bentonite clay, and (i) lubricants such as talc, calcium stearate, magnesium stearate, solid polyethylene glycols, sodium lauryl sulfate, and mixtures thereof. In the case of capsules, tablets, and pills, the dosage form may include a buffering agent.
[00270] Solid compositions of a similar type can be employed as fillers in soft and hard-filled gelatin capsules using such excipients as lactose or milk sugar as well as high molecular weight polyethylene glycols and the like. The solid dosage forms of tablets, dragees, capsules, pills, and granules can be prepared with coatings and shells such as enteric coatings and other coatings well known in the art of pharmacology. They may optionally comprise opacifying agents and can be of a composition that they release the active ingredient(s) only, or preferentially, in a certain part of the intestinal tract, optionally, in a delayed manner. Examples of encapsulating compositions which can be used include polymeric substances and waxes. Solid compositions of a similar type can be employed as fillers in soft and hard- filled gelatin capsules using such excipients as lactose or milk sugar as well as high molecular weight polyethylene glycols and the like.
[00271] The active ingredient can be in a micro-encapsulated form with one or more excipients as noted above. The solid dosage forms of tablets, dragees, capsules, pills, and granules can be prepared with coatings and shells such as enteric coatings, release controlling coatings, and other coatings well known in the pharmaceutical formulating art. in such solid dosage forms the active ingredient can be admixed with at least one inert diluent such as sucrose, lactose, or starch. Such dosage forms may comprise, as is normal practice, additional substances other than inert diluents, e.g., tabieting lubricants and other tableting aids such a magnesium stearate and microcrystalline cellulose. In the case of capsules, tablets and pills, the dosage forms may comprise buffering agents. They may optionally comprise opacifying agents and can be of a composition that they release the active ingredient(s) only, or preferentially, in a certain part of the intestinal tract, optionally, in a delayed manner.
Examples of encapsulating agents which can be used include polymeric substances and waxes.
[00272] Dosage forms for topical and/or transdermal administration of a compound described herein may include ointments, pastes, creams, lotions, gels, powders, solutions, sprays, inhalants, and/or patches. Generally, the active ingredient is admixed under sterile conditions with a pharmaceutically acceptable carrier or excipient and'Or any needed preservatives and'or buffers as can be required. Additionally, the present disclosure contemplates the use of transdermal patches, which often have the added advantage of providing controlled delivery of an active ingredient to the body. Such dosage forms can be prepared, for example, by dissolving and/or dispensing the active ingredient in the proper medium. Alternatively or additionally, the rate can be controlled by either providing a rate controlling membrane and/or by dispersing the active ingredient in a polymer matrix and/or gel.
[00273J Suitable devices for use in delivering intradermal pharmaceutical compositions described herein include short needle devices. Intradermal compositions can be administered by devices which limit the effective penetration length of a needle into the skin. Alternatively or additionally, conventional syringes can be used in the classical mantoux method of intradermal administration. Jet injection devices which deliver liquid formulations to the dermis via a liquid jet injector and'or via a needle which pierces the stratum corneum and produces a jet which reaches the dermis are suitable. Ballistic powder/particle delivery devices which use compressed gas to accelerate the compound in powder form through the outer layers of the skin to the dermis are suitable.
[00274] Formulations suitable for topical administration include, but are not limited to, liquid and/or semi-liquid preparations such as liniments, lotions, oil-in-water and'Or water-in-oil emulsions such as creams, ointments, and/or pastes, and'or solutions and/or suspensions. Topically administrable formulations may, for example, comprise from about 1 % to about 10% (w/w) active ingredient, although the concentration of the active ingredient can be as high as the solubility limit of the active ingredient in the solvent. Formulations for topical administration may further comprise one or more of the additional ingredients described herein.
[00275] A pharmaceutical composition described herein can be prepared, packaged, and'or sold in a formulation suitable for pulmonary administration via the buccal cavity. Such a formulation may comprise dry particles which comprise the active ingredient and which have a diameter in the range from about 0.5 to about 7 nanometers, or from about 1 to about 6 nanometers. Such compositions are conveniently in the form of dry powders for
administration using a device comprising a dry powder reservoir to which a stream of propellant can be directed to disperse the powder and'or using a self-propelling
solvent/powder dispensing container such as a device comprising the active ingredient dissolved and/or suspended in a low-boiling propellant in a sealed container. Such powders comprise particles wherein at least 98% of the particles by weight have a diameter greater than 0.5 nanometers and at least 95% of the particles by number have a diameter less than 7 nanometers. Alternatively, at least 95% of the particles by weight have a diameter greater tha 1 nanometer and at least 90% of the particles by number have a diameter less than 6 nanometers. Dry powder compositions may include a solid fine powder diluent such as sugar and are conveniently provided in a unit dose form,
[00276] Low boiling propellants generally include liquid propellants having a boiling point of below 65 °F at atmospheric pressure. Generally the propellant may constitute 50 to 99.9% (w/w) of the composition, and the active ingredient may constitute 0.1 to 20% (w/w) of the composition. The propellant may further comprise additional ingredients such as a liquid non-ionic and/or solid anionic surfactant and/or a solid diluent (which may have a particle size of the same order as particles comprising the active ingredient).
[00277] Pharmaceutical compositions described herein formulated for pulmonary delivery may provide the active ingredient in the form of droplets of a solution and/or suspension. Such formulations can be prepared, packaged, and/or sold as aqueous and/or dilute alcoholic solutions and/or suspensions, optionally sterile, comprising the active ingredient, and may conveniently be administered using any nebulization and/or atomization device. Such formulations may further comprise one or more additional ingredients including, but not limited to, a flavoring agent such as saccharin sodium, a volatile oil, a buffering agent, a surface active agent, and/or a preservative such as methylhydroxybenzoate. The droplets provided by this route of administration may have an average diameter in the range from about 0.1 to about 200 nanometers.
[00278] Formulations described herein as being useful for pulmonary deliver}' are useful for intranasal delivery of a pharmaceutical composition described herein. Another formulation suitable for intranasal administration is a coarse powder comprising the active ingredient and having an average particle from about 0.2 to 500 micrometers. Such a formulation is administered by rapid inhalation through the nasal passage from a container of the po wder held close to the nares.
[00279] Formulations for nasal administration may, for example, comprise from about as little as 0.1% (w/w) to as much as 100% (w/w) of the active ingredient, and may comprise one or more of the additional ingredients described herein. A pharmaceutical composition described herein can be prepared, packaged, and/or sold in a formulation for buccal administration. Such formulations may, for example, be in the form of tablets and/or lozenges made using conventional methods, and may contain, for example, 0.1 to 20% (w/w) active ingredient, the balance comprising an orally dissolvable and/or degradable composition and, optionally, one or more of the additional ingredients described herein. Alternately,
formulations for buccal administration may comprise a powder and/or an aerosolized and/or atomized solution and/or suspension comprising the active ingredient. Such powdered, aerosolized, and/or aerosolized formulations, when dispersed, may have an average particle and/or droplet size in the range from about 0.1 to about 200 nanometers, and may further comprise one or more of the additional ingredients described herein.
[00280] A pharmaceutical composition described herein can be prepared, packaged, and/or sold in a formulation for ophthalmic administration. Such formulations may, for example, be in the form of eye drops including, for example, a 0.1 -1.0% (w/w) solution and/or suspension of the active ingredient in an aqueous or oily liquid earner or excipient. Such drops may further comprise buffering agents, salts, and/or one or more other of the additional ingredients described herein. Other opthalmieally-administrable formulations which are useful include those which comprise the active ingredient in microcrystaiime fonn and/or in a liposomal preparation. Ear drops and/or eye drops are also contemplated as being within the scope of this disclosure.
[00281] Although the descriptions of pharmaceutical compositions provided herein are principally directed to pharmaceutical compositions which are suitable for administration to humans, such compositions are generally suitable for administration to animals of all sorts. Modification of pharmaceutical compositions suitable for administration to humans in order to render the compositions suitable for administration to various animals is well understood, and the ordinarily skilled veterinary pharmacologist can design and/or perform such modification with ordinary experimentation.
[00282] The compounds provided herein are typically formulated in dosage unit fonn for ease of administration and uniformity of dosage. It will be understood, however, that the total daily usage of the compositions described herein will be decided by a physician within the scope of sound medical judgment. The specific therapeutically effective dose level for any particular subject or organism will depend upon a variety of factors including the disease being treated and the severity of the disorder; the activity of the specific active ingredient employed; the specific composition employed; the age, body weight, general health, sex, and diet of the subject; the time of administration, route of administration, and rate of excretion of the speci fic active ingredient employed; the duration of the treatment; drugs used in combination or coincidental with the specific active ingredient employed; and like factors well known in the medical arts. [00283J The compounds and compositions provided herein can be administered by any route, including enteral (e.g., oral), parenteral, intravenous, intramuscular, intra-arterial,
intramedullary, intrathecal, subcutaneous, intraventricular, transdermal, interdermal, rectal, intravaginal, intraperitoneal, topical (as by powders, ointments, creams, and/or drops), mucosal, nasal, bucal, sublingual; by intratracheal instillation, bronchial instillation, and/or inhalation; and/or as an oral spray, nasal spray, and/or aerosol. Specifically contemplated routes are oral administration, intravenous administration (e.g., systemic intravenous injection), regional administration via blood and/or lymph supply, and/or direct
administration to an affected site. In general, the most appropriate route of administration will depend upon a variety of factors including the nature of the agent (e.g., its stability in the environment of the gastrointestinal tract), and/or the condition of the subject (e.g., whether the subject is able to tolerate oral administration). In certain embodiments, the compound or pharmaceutical composition described herein is suitable for topical administration to the eye of a subject.
[00284] The exact amount of a compound required to achieve an effective amount will vary from subject to subject, depending, for example, on species, age, and general condition of a subject, severity of the side effects or disorder, identity of the particular compound, mode of administration, and the like. An effective amount may be included in a single dose (e.g., single oral dose) or multiple doses (e.g., multiple oral doses). In certain embodiments, when multiple doses are administered to a subject or applied to a biological sample, tissue, or cell, any two doses of the multiple doses include different or substantially the same amounts of a compound described herein. In certain embodiments, when multiple doses are administered to a subject or applied to a biological sample, tissue, or cell, the frequency of administering the multiple doses to the subject or applying the multiple doses to the tissue or cell is three doses a day, two doses a day, one dose a day, one dose every other day, one dose every third day, one dose every week, one dose every two weeks, one dose every three weeks, or one dose every four weeks. In certain embodiments, the frequency of administering the multiple doses to the subject or applying the multiple doses to the tissue or cell is one dose per day. In certain embodiments, the frequency of administering the multiple doses to the subject or applying the multiple doses to the tissue or cell is two doses per day . In certain embodiments, the frequency of administering the multiple doses to the subject or applying the multiple doses to the tissue or cell is three doses per day. In certain embodiments, when multiple doses are administered to a subject or applied to a biological sample, tissue, or cell, the duration between the first dose and last dose of the multiple doses is one day, two days, four days, one week, two weeks, three weeks, one month, two months, three months, four months, six months, nine months, one year, two years, three years, four years, five years, seven years, ten years, fifteen years, twenty years, or the lifetime of the subject, biological sample, tissue, or cell. In certain embodiments, the duration between the first dose and last dose of the multiple doses is three months, six months, or one year. In certain embodiments, the duration between the first dose and last dose of the multiple doses is the lifetime of the subject, biological sample, tissue, or cell. In certain embodiments, a dose (e.g. , a single dose, or any dose of multiple doses) described herein includes independently between 0.1 ig and 1 g, between 0.001 mg and 0.01 mg, between 0.01 mg and 0.1 mg, between 0.1 mg and 1 mg, between 1 mg and 3 mg, between 3 mg and 10 mg, between 10 mg and 30 mg, between 30 mg and 100 mg, between 100 mg and 300 mg, between 300 mg and 1,000 mg, or between 1 g and 10 g, inclusive, of a compound described herein. In certain embodiments, a dose described herein includes independently between 1 mg and 3 mg, inclusive, of a compound described herein. In certain embodiments, a dose described herein includes independently between 3 mg and 10 mg, inclusive, of a compound described herein. In certain embodiments, a dose described herein includes independently between 10 mg and 30 mg, inclusive, of a compound described herein. In certain embodiments, a dose described herein includes independently between 30 mg and 100 mg, inclusive, of a compound described herein.
[00285] Dose ranges as described herein provide guidance for the administration of provided pharmaceutical compositions to an adult. The amount to be administered to, for example, a child or an adolescent can be determined by a medical practitioner or person skilled in the art and can be lower or the same as that administered to an adult. In certain embodiments, a dose described herein is a dose for an adult human whose body weight is approximately 70 kg.
[00286] A compound or composition, as described herein, may be administered in combination with one or more additional pharmaceutical agents (e.g. , therapeutically and/or prophylactically active agents) useful in treating and/or preventing a proliferative disease. The compounds or compositions can be administered in combination with additional pharmaceutical agents that improve their activity (e.g., activity (e.g., potency and/or efficacy) in treating a proliferative disease in a subject in need thereof, in preventing a proliferative disease in a subject in need thereof, and/or in inhibiting the activity of a protein kinase (e.g., CDK (e.g. , CDK7, CD 12, and/or CDK13)) in a subject, biological sample, tissue, or cell), improve bioavailability, improve safety, reduce drug resistance, reduce and/or modify metabolism, inhibit excretion, and/or modify distribution in a subject, biological sample, tissue, or cell. It will also be appreciated that the therapy employed may achieve a desired effect for the same disorder, and/'or it may achieve different effects. In certain embodiments, a pharmaceutical composition described herein including a compound described herein and an additional pharmaceutical agent shows a synergistic effect that is absent in a
pharmaceutical composition including one of the compound and the additional
phannaceutical agent, but not both.
[00287] The compound or composition can be administered concurrently with, prior to, or subsequent to one or more additional pharmaceutical agents, which are different from the compound or composition and may be useful as, e.g., combination therapies in treating and/'or preventing a proliferative disease. Pharmaceutical agents include therapeutically active agents. Pharmaceutical agents also include prophylactically active agents. Pharmaceutical agents include small organic molecules such as drug compounds (e.g., compounds approved for human or veterinary use by the U.S. Food and Drug Administration as provided in the Code of Federal Regulations (CFR)), peptides, proteins, carbohydrates, monosaccharides, oligosaccharides, polysaccharides, nucleoproteins, mueoprotems, lipoproteins, synthetic polypeptides or proteins, small molecules linked to proteins, glycoproteins, steroids, nucleic acids, DNAs, RNAs, nucleotides, nucleosides, oligonucleotides, an d sense oligonucleotides, lipids, hormones, vitamins, and cells. In certain embodiments, the additional pharmaceutical agent is a pharmaceutical agent useful in treating a proliferative disease. In certain embodiments, the additional pharmaceutical agent is a pharmaceutical agent useful in preventing a proliferative disease. In certain embodiments, the additional pharmaceutical agent is a pharmaceutical agent useful in inhibiting the activity of a protein kinase {e.g., CDK (e.g., CDK7, CDK12, and/or CDK 13)) in a subject, biological sample, tissue, or cell. In certain embodiments, the additional pharmaceutical agent is a pharmaceutical agent useful in inducing apoptosis in a cell. In certain embodiments, the additional phannaceutical agent is a pharmaceutical agent approved by a regulator}' agency (e.g., the US FDA) for treating and/or preventing a proliferative disease. Each additional pharmaceutical agent may be administered at a dose and/or on a time schedule determined for that pharmaceutical agent. The additional pharmaceutical agent(s) may also be administered together with each other and/or with the compound or composition described herein in a single dose or administered separately in different doses. The particular combination to employ in a regimen will take into account compatibility of the compound described herein with the additional pharmaceutical agent(s) and/or the desired therapeutic and/or prophylactic effect to be achieved. In general, it is expected that the additional pharmaceutical agent(s) in combination be utilized at levels that do not exceed the levels at which they are utilized individually. In some embodiments, the levels utilized in combination will be lower than those utilized individually.
[00288] In certain embodiments, the additional pharmaceutical agent is a cytotoxic agent, in certain embodiments, the additional pharmaceutical agent is an anti-proliferative agent (e.g., anti-cancer agent). In certain embodiments, the additional pharmaceutical agent is an anti- leukemia agent. In certain embodiments, the additional pharmaceutical agent is
ABITREXATE (methotrexate), ADE, Adriamycin RDF (doxorubicin hydrochloride),
Ambochlorin (chlorambucil), ARRANON (nelarabine), ARZERRA (ofatumumab),
BOSIJLIF (bosutimb), BUSULFEX (busulfan), CAMPATH (alemtiizumab), CERUBIDINE (daunorubicin hydrochloride), CLAFEN (cyclophosphamide), CLOFAREX (clofarabine), CLOLAR (clofarabine), CVP, CYTOSAR-U (cytarabine), CYTOXAIM (cyclophosphamide), ERWINAZE (Asparaginase Erwinia Chrysanthemi), FLUDARA (fiudarabine phosphate), FOLEX (methotrexate), FOLEX PFS (methotrexate), GAZYVA (obinutuzumab), GLEEVEC (imatinib mesylate), Hyper-CVAD, ICLUSIG (ponatinib hydrochloride), IMBRUVICA (ibrutinib), LEUKERAN (chlorambucil), LINFOLIZIN (chlorambucil), MARQIBO
(vincristine sulfate liposome), METHOTREXATE LPF (methorexate), MEXATE
(methotrexate), MEXATE- AQ (methotrexate), mitoxantrone hydrochloride, MUSTARGEN (mechlorethamine hydrochloride), MYLERAN (busulfan), NEOSAR (cyclophosphamide), ONCASPAR (Pegaspargase), PURJNETHOL (mercapto rine), PURJXAN
(mercaptopurine), Rubidomycin (daunorubicin hydrochloride), SPRYCEL (dasatinib),
SYNRIBO (omacetaxine mepesuccinate), TARABINE PFS (cytarabine), TASIGNA
(nilotinib), TREA DA (bendamustine hydrochloride), TRISENOX (arsenic trioxide), VINCASAR PFS (vincristine sulfate), ZYDELIG (idelalisib), or a combination thereof. In certain embodiments, the additional pharmaceutical agent is an anti-lymphoma agent. In certain embodiments, the additional pharmaceutical agent is ABITREXATE (methotrexate), ABVD, ABVE, ABVE-PC, ADCETRIS (brentuximab vedotin), ADRIAMYCIN PFS (doxorubicin hydrochloride), ADRIAMYCIN RDF (doxorubicin hydrochloride),
AMBOCHLORIN (chlorambucil), AMBOCLORIN (chlorambucil), ARRANON
(nelarabine), BEACOPP, BECENUM (carmustine), BELEODAQ (beiinostat), BEXXAR (tositumomab and iodine 1 131 tositumomab), BICNU (carmustine), BLENOXANE
(bleomycin), CARMUBRIS (carmustine), CHOP, CLAFEN (cyclophosphamide), COPP, COPP-ABV, CVP, CYTOXAN (cyclophosphamide), DEPOCYT (liposomal cytarabine), DTIC-DOME (dacarbazine), EPOCH, FOLEX (methotrexate), FOLEX PFS (methotrexate), FOLOTYN (pralatrexate), HYPER-CVAD, ICE, IMBRUVICA (ibrutinib), INTRON A (recombinant interferon alfa-2b), ISTODAX (romidepsin), LEUKERAN (chlorambucil), LINFOLIZIN (chlorambucil), Lomustine, MATULANE (procarbazine hydrochloride), METHOTREXATE LPF (methotrexate), MEXATE (methotrexate), MEXATE-AQ
(methotrexate), MOPP, MOZOBiL (plerixafor), MUSTARGEN (mechlorethamine
hydrochloride), NEOSAR (cyclophosphamide), OEPA, ONTAK (denileukin diftitox), OPPA, R-CHOP, REVLIMID (lenalidomide), RITUXAN (rituximab), STANFORD V, TREANDA (bendamustine hydrochloride), VAMP, VELBAN (vinblastine sulfate), VELCADE
(bortezomib), VELSAR (vinblastine sulfate), VINCASAR PFS (vincristine sulfate),
ZEVALIN (ibritumomab tiuxetan), ZOLINZA (vorinostat), ZYDELIG (idelalisib), or a combination thereof. In certain embodiments, the additional pharmaceutical agent is
AB3TREXATE (methotrexate), ABRAXANE (paciitaxel albumin-stabilized nanoparticle formulation), AC, AC-T, ADE, ADRIAMYCIN PFS (doxorabicin hydrochloride),
ADRUCIL (fluorouracil), AFINITOR (everolimus), AFINITOR DISPERZ (everoltmus), ALDARA (imiquimod), ALIMTA (pemetrexed disodium), AREDIA (pamidronate
disodium), ARIMIDEX (anastrozole), AROMASIN (exemestane), AVASTIN
(bevacizumab), BECENUM (carmustine), BEP, BICNIJ (carmustine), BLENOXANE
(bleomycin), CAF, CAMPTOSAR (irinotecan hydrochloride), CAPOX, CAPRELSA
(vandetanib), C ARBOPL ATTN -TAXOL, CARMUBRIS (carmustine), CASODEX
(bicalutamide), CEENU (lomustine), CERUBIDLNE (daunort bicin hydrochloride),
CERVARTX (recombinant HPV bivalent vaccine), CLAFEN (cyclophosphamide), CMF, COMETRIQ (cabozantinib-s-malate), COSMEGEN (dactinomycin), CYFOS (ifosfamide), CYRAMZA (ramucirumab), CYTOSAR-U (cytarabine), CYTOXAN (cyclophosphamide), DACOGEN (decitabine), DEGARELIX, DOXIL (doxorubicin hydrochloride liposome), DOXORUBICIN HYDROCHLORIDE, DOX-SL (doxorubicin hydrochloride liposome), DTIC-DOME (dacarbazine), EFUDEX (fluorouracil), ELLENCE (epirubicin hydrochloride), ELOXATIN (oxaliplatin), ERBITUX (cetuximab), ERIVEDGE (vismodegib), ETOPOPHOS (etoposide phosphate), EVACET (doxorabicin hydrochloride liposome), FARESTON (toremifene), FASLODEX (fiilvestrant), FEC, FEMARA (letrozole), FLUOROPLEX
(fluorouracil), FOLEX (methotrexate), FOLEX PFS (methotrexate), FOLFIRI, FOLFIRI- BE V ACIZUMAB , FOLFIRI -CETUXIMAB, FOLFIRINOX, FOLFOX, FU-LV,
GARDASIL (recombinant human papillomavirus (HPV) quadrivalent vaccine),
GEMCrrABINE-CISPLATIN, GEMCITABINE-OXALIPLATIN, GEMZAR (gemcitabine hydrochloride), GILOTRIF (afatinib dimaleate), GLEEVEC (imatinib mesylate), GLIADEL (carmustme implant), GLIADEL WAFER (carmustme implant), HERCEPTIN (trastuzumab), HYCAMTIN (topotecan hydrochloride), IFEX (ifosfamide), IFOSFAMIDUM (ifosfamide), INLYTA (axitinib), I TRON A (recombinant interferon alfa-2b), IRESSA (gefitinib), IXEMPRA (ixabepilone), JAKAFI (ruxolitinib phosphate), JEVTANA (cabazitaxel), KADCYLA (ado-trastuzumab emtansine), KEYTRUDA (pembrolizumab), KYPROLIS (carfilzomib), LIPODOX (doxorubicin hydrochloride liposome), LUPRON (leuprolide acetate), LUPRON DEPOT (leuprolide acetate), LUPRON DEPOT-3 MONTH (leuprolide acetate), LUPRON DEPOT-4 MONTH (leuprolide acetate), LUPRON DEPOT-PED
(leuprolide acetate), MEGACE (megestrol acetate), MEKINIST (trametinib),
METHAZOLASTONE (temozolomide), METHOTREXATE LPF (methotrexate), MEXATE (methotrexate), MEXATE-AQ (methotrexate), MITOXANTRONE HYDROCHLORIDE, MITOZYTREX (mitomycin c), MOZOBIL (plerixafor), MUSTARGEN (mechiorethamine hydrochloride), MUTAMYCIN (mitomycin c), MYLOSAR (azacitidine), NAVELBINE (vinorelbine tartrate), NEOSAR (cyclophosphamide), NEXAVAR (sorafenib tosylate), NOLVADEX (tamoxifen citrate), NOVALDEX (tamoxifen citrate), OFF, PAD, PARAPLAT (carboplatin), PARAPLATIN (carboplatin), PEG-INTRON (peginterferon alfa-2b),
PEMETREXED DISODIUM, PERJETA (perruzumab), PLATINOL (cisplatin), PLATINOL- AQ (cisplatin), POMALYST (pomalidomide), prednisone, PROLEUKIN (aldesleukin), PROLIA (denosumab), PROVENGE (sipuleucel-t), REVL1MID (lenalidomide),
RUB IDOM YCIN (daunorubicin hydrochloride), SPRYCEL (dasatinib), STIVARGA
(regorafenib), SUTENT (sunitinib malate), SYLATRON (peginterferon alfa-2b), SYLVANT (siltuximab), SYNOVIR (thalidomide), TAG, TAFINLAR (dabrafenib), TARABINE PFS (cytarabine), TARCEVA (erlotinib hydrochloride), TASIGNA (nilotinib), TAXOL
(paclitaxel), TAXOTERE (docetaxel), TEMODAR (temozolomide), THALOMID
(thalidomide), TOPOSAR (etoposide), TORTSEL (temsiroHmus), TPF, TRISENOX (arsenic trioxide), TYKERB (iapatinib ditosylate), VECTIBIX (panitumumab), VEIP, VELBAN (vinblastine sulfate), VELCADE (bortezomib), VELSAR (vinblastine sulfate), VEPESID (etoposide), VIADUR (leuprolide acetate), VIDAZA (azacitidine), VINCASAR PFS (vincristine sulfate), VOTRIENT (pazopanib hydrochloride), WELLCOVORIN (leucovorin calcium), XALKORI (crizotinib), XELODA (capecitabine), XELOX, XGEVA (denosumab), XOFIGO (radium 223 dichloride), XTANDI (enzalutamide), YERVOY (ipilimumab),
ZALTRAP (ztv-af!ibercept), ZELBORAF (vemurafenib), ZOLADEX (goserelin acetate), ZOMETA (zoledronic acid), ZYKADI A (ceritinib), ZYT'IGA (abiraterone acetate), or a combination thereof. In certain embodiments, the additional pharmaceutical agent is a kinase inhibitor. In certain embodiments, the additional pharmaceutical agent is a protein kinase inhibitor (e.g., tyrosine protein kinase inhibitor). In certain embodiments, the additional pharmaceutical agent is an inhibitor of a Src family kinase. In certain embodiments, the additional pharmaceutical agent is a CD inhibitor. In certain embodiments, the additional pharmaceutical agent is a CDK7 inhibitor, in certain embodiments, the additional pharmaceutical agent is a CDK 12 inhibitor. In certain embodiments, the additional pharmaceutical agent is a CDK 13 inhibitor. In certain embodiments, the additional pharmaceutical agent is an inhibitor of one or more protein kinases selected from the group consisting of IRAKI, IRAK4, BMX, and PI3 , In certain embodiments, the additional pharmaceutical agent is an inhibitor of one or more protein kinases selected from the group consisting of BUB I B, CDK2, CDK9, CHEK2, PGR, HIPK4, PRKCQ, RET, SRC, and MELK. In certain embodiments, the additional pharmaceutical agent is an inhibitor of one or more protein kinases selected from the group consisting of ABL, ARG, BLK, CSK, EphBl, EphB2, FOR, FRK, FYN, SRC, YES, LCK, LYN, MAP2K5, NLK, p38a, S RK, and TEC, In certain embodiments, the additional pharmaceutical agent is an inhibitor of one or more protein kinases selected from the group consisting of ABLl(H396P)-phosphorylated, ABL1- phosphorylated, BLK, EPHA4, EPHB2, EPHB3, EPHB4, FGR, JAK3(JH1 domain-catalytic), KIT, KIT(L576P), KIT(V559D), PDGFRB, SRC, YES, ABLl(H396P)-nonphosphorylated, ABLl(Y253F)-phosphorylated, ABLl-nonphosphorylated, FRK, LYN, ABL1(Q252H)- nonphosphorylated, DDR1 , EPHB1 , ERBB4, p38-alpha, ABL2, ABL1 (Q252H)- phosphorylated, SIK, EPHA8, MEK5, ABLl (E255K)-phosphorylated, ABL1(F317L)~ nonphosphorylated, FYN, LCK, EPHA2, ABLl (M351 T)-phosphorylated, TXK,
EGFR(L858R), EGFR(L861Q), ERBB2, ERBB3, EPHA5, ABL1(F317I)- nonphosphorylated, EGFR(L747-E749del, A750P), CSK, EPHA1 , ABL1(F317L)- phosphorylated, BRAF(V600E), EGFR, KIT-autoinhibited, and EGFR(E746-A750de1). In certain embodiments, the additional pharmaceutical agent is an inhibitor of one or more protein kinases selected from the group consisting of ABLl(F317L)-nonphosphorylated, ABL 1 (H396P)-nonphosphorylated, ABL1 (H396P)-phosphorylated, ABL1 -phosphoryiated, BLK, EPHA4, EPHB2, EPHB3, EPHB4, K3(j i ! i domain-catalytic), KIT, KIT(L576P), K1T(V559D), LYN, PDGFRB, SRC, YES, ABLl-nonphosphorylated, ABL1(Y253F)- phosphorylated, ERBB3, FGR, FRK, p38-alpha, ABLl(F317T)-nonphosphorylated, DDR1, EPHA2, ABLl (Q252H)-phosphorylated, MEK5, ABLl (Q252H)-nonphosphorylated, ABL2, FYN, EPHB1 , ABLl(E255K)-phosphorylated, ABL,l (F317L)-phosphorylated, EPHAl , ABLl(M351T)-phosphorylated, ERBB4, TXK, LCK, EPHA8, SIK, EPHA5, EGFR(L861Q), CSFl R-autoinhibited, BRAF(V600E), BRK, CSK, KIT(D816V), KIT-autoinhibited, EGFR(L747-T751del,Sins), EGFR(L858R), EGFR(L747-E749del, A750P), and CSF1R. In certain embodiments, the additional pharmaceutical agent is an a ti-angiogenesis agent, antiinflammatory agent, immunosuppressant, anti-bacterial agent, anti-viral agent, cardiovascular agent, cholesterol-lowering agent, anti-diabetic agent, anti-allergic agent, pain-relieving agent, or a combination thereof. In certain embodiments, the compounds described herein or pharmaceutical compositions can be administered or used in combination with an ant -cancer therapy including, but not limited to, transplantation (e.g., bone marrow transplantation, stem cell transplantation), surgery, radiation therapy, immunotherapy, and chemotherapy.
[00289] Also encompassed by the disclosure are kits (e.g., pharmaceutical packs). The kits provided may comprise a pharmaceutical composition or compound described herein and a container (e.g., a vial, ampule, bottle, syringe, and/or dispenser package, or other suitable container). In some embodiments, provided kits may optionally further include a second container comprising a pharmaceutical excipient for dilution or suspension of a
pharmaceutical composition or compound described herein. In some embodiments, the pharmaceutical composition or compound described herein provided in the first container and the second container are combined to form one unit dosage form.
Methods of Treatment and Uses
[00290] The present invention also provides methods for the treatment or prevention of a proliferative disease (e.g., cancers (e.g., leukemia, acute lymphoblastic leukemia, lymphoma, Burkitt's lymphoma, melanoma, multiple myeloma, breast cancer, Ewing's sarcoma, osteosarcoma, brain cancer, neuroblastoma, lung cancer, colorectal cancer), benign neoplasms, diseases associated with angiogenesis, inflammatory diseases, autoinflammatory diseases, and autoimmune diseases).
[00291] The compounds described herein may exhibit kinase inhibitory activity; the ability to inhibit cyclin-dependent kinase (CDK); the ability to inhibit cyclin-dependent kinase 7 (CDK7); the ability to inhibit cyclin-dependent kinase 7 (CDK7), without inhibiting another cyclin-dependent kinase (CDK); the ability to inhibit cyclin-dependent kinase 12 (CDK12); the ability to inhibit cyclin-dependent kinase 12 (CDK12), without inhibiting another cyclin- dependent kinase (CDK); the ability to inhibit cyclin-dependent kinase 13 (CDK13); the ability to inhibit cyclin-dependent kinase 13 (CDK13), without inliibiting another cyclin- dependent kinase (CDK); the ability to inhibit cyclin-dependent kinases 12 and 13 (CDK12 and CDK13); the ability to inhibit cyclin-dependent kinases 12 and 13 (CDK12 and CDK! 3), without inhibiting another cyclin-dependent kinase (CDK); a therapeutic effect and/or preventative effect in the treatment of cancers; a therapeutic effect and/or preventative effect in the treatment of Myc-dependent cancers; and/or a therapeutic profile (e.g., optimum safety and curative effect) that is superior to existing chemotherapeutic agents.
[00292] Without wishing to be bound by any particular theory, the compounds described herein are able to bind (e.g., covalently modify) the protein kinase being inhibited. In certain embodiments, the R2 group of a compound described herein is able to bind (e.g., covalently modify) to the protein kinase. In certain embodiments, the R2 group of a compound described herein is able to covalently bind a cysteine residue of the protein kinase. In certain embodiments, the compound is capable of covalently modifying CD 7 (e.g., Cys312 of CDK7). In certain embodiments, the R2 group of a compound described herein is able to covalently modify residue Cys312 of CD 7. In certain embodiments, the compound is capable of covalently modifying CD 12 (e.g., Cysl039 of CDK12). In certain embodiments, the R2 group of a compound described herein is able to covalently modify residue Cysl039 of CDK12. In certain embodiments, the compound is capable of covalently modifying CDK13 (e.g., CyslOl? of CD 13). In certain embodiments, the R2 group of a compound described herein is able to covalently modify residue Cysl Ol 7 of CDK13.
[00293] In another aspect, the present disclosure provides methods of inhibiting the activity of a protein kinase in a subject, the methods comprising administering to the subject an effective amount (e.g., therapeutically effective amount) of a compound, or pharmaceutical composition thereof, as described herein.
[00294] In another aspect, the present disclosure provides methods of inhibiting the activity of a protein kinase in a biological sample, the methods comprising contacting the biological sample with an effective amount of a compound, or pharmaceutical composition thereof, as described herein.
[00295] In another aspect, the present disclosure provides methods of inhibiting the activity of a protein kinase in a tissue, the methods comprising contacting the tissue with an effective amount of a compound, or pharmaceutical composition thereof, as described herein.
[00296] In another aspect, the present disclosure provides methods of inhibiting the activity of a protein kinase in a cell, the methods comprising contacting the cell with an effective amount of a compound, or pharmaceutical composition thereof, as described herein.
[00297] In certain embodiments, the subject being treated is a mammal. In certain embodiments, the subject is a human. In certain embodiments, the subject is a domesticated animal, such as a dog, cat, cow, pig, horse, sheep, or goat. In certain embodiments, the subject is a companion animal such as a dog or cat. In certain embodiments, the subject is a livestock animal such as a cow, pig, horse, sheep, or goat. In certain embodiments, the subject is a zoo animal. In another embodiment, the subject is a research animal such as a rodent, dog, or non-human primate. In certain embodiments, the subject is a non-human transgenic animal such as a transgenic mouse or transgenic pig.
[00298] In certain embodiments, the biological sample being contacted with the compound or composition is breast tissue, bone marrow, lymph node, lymph tissue, spleen, or blood.
[00299] In certain embodiments, the cell being contacted with the compound or composition is in vitro. In certain embodiments, the cell being contacted with the compound or composition is in vivo. In certain embodiments, the cell being contacted with the compound or composition is ex vivo. In certain embodiments, the cell being contacted with the compound or composition is a malignant cell (e.g., malignant blood cell). In certain embodiments, the cell being contacted with the compound or composition is a malignant hematopoietic stem cell (e.g., malignant myeloid cell or malignant lymphoid cell). In certain embodiments, the cell being contacted with the compound or composition is a malignant lymphocyte (e.g., malignant T-cell or malignant B-cell). In certain embodiments, the cell being contacted with the compound or composition is a malignant red blood cell, malignant white blood cell, or malignant platelet. In certain embodiments, the cell being contacted with the compound or composition is a malignant neutrophil, malignant macrophage, or malignant plasma cell. In certain embodiments, the cell being contacted with the compound or composition is a carcinoma cell. In certain embodiments, the cell being contacted with the compound or composition is a carcinoma breast cell. In certain embodiments, the cell being contacted with the compound or composition is a sarcoma cell. In certain embodiments, the cell being contacted with the compound or composition is a sarcoma cell from breast tissue.
[00300] The proliferative disease to be treated or prevented using the compounds described herein may be associated with overexpression of a kinase, such as cyclin-dependent kinase (CD ), The process of eukaryotic cell division may be broadly divided into a series of sequential phases termed Gl , S, G2, and M. Correct progression through the various phases of the cell cycle has been shown to be critically dependent upon the spatial and temporal regulation of a family of proteins known as cyclin dependent kinases (CDKs) and a diverse set of their cognate protein partners termed cyclins. CDKs are CDC2 (also known as CDK1 ) homologous serine-threonine kinase proteins that are able to utilize ATP as a substrate in the phosphorylation of diverse polypeptides in a sequence-dependent context. Cyclins are a family of proteins characterized by a homology region, containing approximately 100 amino acids, termed the "cyclin box" which is used in binding to, and defining selectivity for, specific CD partner proteins.
[00301] Modulation of the expression levels, degradation rates, protein levels, and activity levels of various CDKs and cyclins throughout the cell cycle leads to the cyclical formation of a series of CDK/cyclin complexes, in which the CDKs are enzymatically active. The formation of these complexes controls passage through discrete cell cycle checkpoints and thereby enables the process of cell division to continue. Failure to satisfy the prerequisite biochemical criteria at a given cell cycle checkpoint, i.e., failure to form a required
CDK/cyclin complex, can lead to cell cycle arrest and/or cellular apoptosis. Aberrant cellular proliferation can often be attributed to loss of correct cell cycle control. Inhibition of CDK enzymatic activity therefore provides a means by which abnormally dividing cells can have their division arrested and/or be killed. The diversity of CDKs, and CDK complexes, and their critical roles in mediating the cell cycle, provides a broad spectrum of potential therapeutic targets selected on the basis of a defined biochemical rationale.
[00302] CDK7, a member of the CDK family, was originally isolated as the catalytic subunit of the trimeric CDK-activating kinase (CAK) complex. This complex, consisting of CDK7, cyclin H, and MAT1, is responsible for activation of the mitotic promoting factor in vitro. The discovery that CDK7 was also a component of the basal transcription repair factor IIH (TFIIH) implicated a dual role for CDK7 in transcription as part of TFIIH and in the control of the cell cycle as the trimeric CAK complex. TFIIH is a multi-subunit protein complex identifi ed as a factor required for RN A polymerase II (RN AP ID-catalyzed transcription, and subsequently this complex was found to play a key role in nucleotide excision repair. CDK7 is a component of at least three complexes, i.e., the trimeric CAK complex, the quaternary complex with the XPD (or ERCC2, a protein involved in transcription-coupled nucleotide excision repair), and the nine-subunit TFIIH complex. The two functions of CDK7 in CAK and CTD phosphorylation support critical facets of cellular proliferation, cell cycling, and transcription. Overexpression of CDK7 may inhibit apoptosis, promote transcription and cell proliferation, and/or disrupt DNA repair, and therefore, cause proliferative diseases. In certain embodiments, the proliferative disease to be treated or prevented using the compounds described herein may be associated with overexpression of a CDK {e.g., CDK7).
[00303] Cdkl 2 and Cdkl 3 are Cdc2-related proteins that share 92% identity in their kinase domains (Chen et al., Exp. Neurol, , 2014, 261, 10-21). CDK 12 plays a critical role in cell processes, for example, regulating transcription and splicing machinery by stabilizing the RNAPII and DNA interaction, and regulating DNA damage response (DDR) and maintenance of genomic stability by modulating the expression of DDR genes.
Overexpression of CDKl 2 has been found to correlate, both at the transcriptional and protein level, with pathological parameters of breast cancer disease.
[00304] A proliferative disease may be associated with aberrant activity of a CDK (e.g., CDK7, CDK12, and/or CDKl 3). Aberrant activity of a CDK (e.g., CDK7, CDK12, and/or CDKl 3) may be an elevated and/or an inappropriate activity of the CDK. Deregulation of cell cycle progression is a characteristic of a proliferative disease, and a majority of proliferative diseases have abnormalities in some component of CDK (e.g., CDK7, CDK 12, and/or CDKl 3) activity, frequently through elevated and/or inappropriate CDK activation. Inhibition of the catalytic activity of CDK7, CDK12, and/or CDKl 3 would be expected to inhibit ceil cycle progression by blocking the phosphorylation of cell cycle CDKs, and would additionally inhibit transcription of effectors of cell division, in certain embodiments, CDK7 is not overexpressed, and the activity of CDK7 is elevated and/or inappropriate. In certain other embodiments, CDK7 is overexpressed, and the activity of CDK7 is elevated and/or inappropriate, in certain embodiments, CDKl 2 is not overexpressed, and the activity of CDKl 2 is elevated and/or inappropriate. In certain embodiments, CDKl 2 is overexpressed, and the activity of CDKl 2 is elevated and or inappropriate. In certain other embodiments, CDKl 3 is not overexpressed, and the activity of CDKl 3 is elevated and/or inappropriate, in certain other embodiments, CDKl 3 is overexpressed, and the activity of CDKl 3 is elevated and/or inappropriate. The compounds described herein, and pharmaceutically acceptable salts, solvates, hydrates, polymorphs, co-crystals, tautomers, stereoisomers, isotopically labeled derivatives, prodrugs, and compositions thereof, may inhibit the activity of CDK7 and be useful in treating and/or preventing proliferative diseases. The compounds described herein, and pharmaceutically acceptable salts, solvates, hydrates, polymorphs, co-crystals, tautomers, stereoisomers, isotopically labeled derivatives, prodrugs, and compositions thereof, may inhibit the activit of CDK12 and/or CDK13 and be useful in treating and/or preventing proliferative diseases.
[00305] A proliferative disease may also be associated with inhibition of apoptosis of a cell in a biological sample or subject. All types of biological samples described herein or known in the art are contemplated as being within the scope of the invention. Apoptosis is the process of programmed cell death. Inhibition of apoptosis may result in uncontrolled cell proliferation and, therefore, may cause proliferative diseases. The cell cycle CDKs (CDKl, 2, 4, and 6) are activated by phosphorylation by CDK7/cyclin H (also called CAK). Inhibition of CDK.7 would therefore result in cell-cycle arrest at multiple points in the cell cycle due to failure to activate the cell cycle CDKs. CDK 7 activates transcription by phosphorylating the CTD of RNAP II. Inhibition of CTD phosphorylation has been shown to inhibit transcription and reduce expression of short lived proteins, including those involved in apoptosis regulation, it is appreciated in the art that stalling of RMA polymerase may activate p53 (also known as protein 53 or tumor protein 53, a tumor suppressor protein that is encoded in humans by the TP53 gene), leading to apoptosis. Thus, inhibition of the activity of CDK7 are expected to cause cytotoxicity by inducing apoptosis. The compounds described herein, and pharmaceutically acceptable salts, solvates, hydrates, polymorphs, co-crystals, tautomers, stereoisomers, isotopically labeled derivatives, prodrugs, and compositions thereof, may induce apoptosis, and therefore, be useful in treating and/or preventing proliferative diseases.
[00306] The CycK/Cdkl2 complex regulates phosphorylation of Ser2 in the C-terminal domain of RNA polymerase II and expression of a small subset of human genes, as revealed in expression microarrays. Through regulation of expression of DNA damage response genes (i.e. oncogenes), CycK/Cdkl2 protects cells from genomic instability. In certain
embodiments, the DNA damage response genes are BRCAl, BRCA2, HER1, HER2, ATR, FANCI, or FANCD2. In certain embodiments, the DNA damage response genes are BRCAl, HER2, ATR, FANCI, and FANCD2. In certain embodiments, the DNA damage response genes are BRCAl . In certain embodiments, the DNA damage response genes are HER2.
[00307] In certain embodiments, the proliferative disease to be treated or prevented using the compounds described herein is cancer. All types of cancers disclosed herein or known in the art are contemplated as being within the scope of the invention. In certain embodiments, the proliferative disease is a cancer associated with BCL-2 anti-apoptotic proteins (e.g., MCL-1 and/or XIAP) (e.g., cancer associated with dependence on BCL-2 anti-apoptotic proteins). In certain embodiments, the proliferative disease is a cancer associated with overexpression of MYC (a gene that codes for a transcription factor), in certain embodiments, the cancer is a MYC-dependent cancer. In certain embodiments, the proliferative disease is a cancer associated with amplification of BRCAl. In certain embodiments, the proliferative disease is a cancer associated with amplification of HER2. In certain embodiments, the proliferative disease is a hematological malignancy. In certain embodiments, the proliferative disease is a blood cancer. In certain embodiments, the proliferative disease is a hematological malignancy. In certain embodiments, the proliferative disease is leukemia. In certain embodiments, the proliferative disease is chronic lymphocytic leukemia (CLL). In certain embodiments, the proliferative disease is acute lymphoblastic leukemia (ALL). In certain embodiments, the proliferative disease is T-cell acute lymphoblastic leukemia (T-ALL). In certain embodiments, the proliferative disease is chronic myelogenous leukemia (CML). in certain embodiments, the proliferative disease is acute myelogenous leukemia (AML). In certain embodiments, the proliferative disease is acute monocytic leukemia (AMoL). In certain embodiments, the proliferative disease is lymphoma. In some embodiments, the proliferative disease is Burkitt's lymphoma. In certain embodiments, the proliferative disease is a Hodgkm's lymphoma. In certain embodiments, the proliferative disease is a non- Hodgkin's lymphoma. In certain embodiments, the proliferative disease is multiple myeloma. In certain embodiments, the proliferative disease is melanoma. In certain embodiments, the proliferative disease is colorectal cancer. In certain embodiments, the proliferative disease is breast cancer. In certain embodiments, the proliferative disease is recurring breast cancer. In certain embodiments, the proliferative disease is mutant breast cancer. In certain
embodiments, the proliferative disease is HER2+ breast cancer. In certain embodiments, the proliferative disease is HER2- breast cancer. In certain embodiments, the proliferative disease is triple-negative breast cancer (TNBC). In certain embodiments, the proliferative disease is a bone cancer. In certain embodiments, the proliferative disease is osteosarcoma. In certain embodiments, the proliferative disease is E wing's sarcoma. In some embodiments, the proliferative disease is a brain cancer. In some embodiments, the proliferative disease is neuroblastoma. In some embodiments, the proliferative disease is a lung cancer. In some embodiments, the proliferative disease is small cell lung cancer (SCLC). In some
embodiments, the proliferative disease is non-small cell lung cancer. In some embodiments, the proliferative disease is a benign neoplasm. All types of benign neoplasms disclosed herein or known in the art are contemplated as being within the scope of the invention. In some embodiments, the proliferative disease is associated with angiogenesis. All types of
angtogenests disclosed herein or known in the art are contemplated as being within the scope of the invention. In certain embodiments, the proliferative disease is an inflammatory disease. All types of inflammatory diseases disclosed herein or known in the art are contemplated as being within the scope of the invention. In certain embodiments, the inflammatory disease is rheumatoid arthritis.
In certain embodiments, the proliferative disease is an acute inflammatory disease. In certain embodiments, the acute inflammatory disease is rheumatoid arthritis, chron's disease, or fibrosis. In some embodiments, the proliferative disease is an autoinflammatory disease. All types of automflamrnatory diseases disclosed herein or known in the art are contemplated as being within the scope of the invention. In some embodiments, the proliferative disease is an autoimmune disease. All types of autoimmune diseases disclosed herein or known in the art are contemplated as being within the scope of the invention.
[00308] Another aspect of the invention relates to meth od s of inhibiting the activity of a kinase in a biological sample, tissue, cell, or subject. In certain embodiments, the kinase is a CD , In certain embodiments, the kinase is CDK7. In certain embodiments, the kinase is CD 12. In certain embodiments, the kinase is CDK13. In certain embodiments, the activity of the kinase is aberrant activity of the kinase. In certain embodiments, the activity of th e kinase is increased activity of the kinase. In certain embodiments, the inhibition of the activity of the kinase is irreversible. In other embodiments, the inhibition of the activity of the kinase is reversible. In certain embodiments, the methods of inhibiting the activity of the kinase include attaching a compound described herein to the kinase.
[00309] Also pro vided in the present invention are methods of inhibiting transcription of genes in a biological sample or subject. In certain embodiments, the transcription of genes affected by the activity of CDK7 may be inhibited by a compound of the invention. In certain embodiments, the genes which may have their transcription inhibited by the activity of CDK7 are one or more selected from the group consisting of MY C, RlJNXl , MYB, TALI , GATA3, KLF2, HNRPDL, p21, ASCL1, MYCN, INSM1, NEUROD1 , NEUROG1, FOXGl , FOXA1 , SOX2, SOX4, BCL11A, OTX2, GAT2, PHOX2B, PLK2, TAF1, CTGF, WEE1, SDIM, JUN, PIM1, IL8, and FOS1. In certain embodiments, the genes which may have their transcription inhibited by the activity of CD 7 include MYC, KLF2, E2F2, CD 6, CCND3, E2F3, HNRPDL, TET1, IL7R, BRCA1 , BRCA2, HER1, and HER2. In certain embodiments, the transcription of genes affected by the activity of CDK12 may be inhibited by a compound of the invention. In certain embodiments, the genes which may have their transcription inhibited by the activity of CDK 12 are one or more selected from the group consisting of BRCA1, FANCI, ATR, FANCD2, APEX1, NEK9, CHEKl, CHEK2, ATM, RAD51C, RAD51 D, ORC3L, MDC1 , TERF2, ERCC4, FANCF, PARP9, RUNX1, MYB, TAL L MCL1, MYC, BCL2, ETS 1, and EWS-FLI. In certain embodiments, the transcription of genes affected by the activity of CDK13 may be inhibited by a compound of the invention. In certain embodiments, the gene is SNORA38.
[00310] The present inven tion also provides methods of inhibiting cell growth in a biological sample, tissue, cell, or subject.
[00311] In still another aspect, the present invention provides methods of inducing apoptosis of a cell in a biological sample, tissue, cell, or subject. [00312 J In certain embodiments, the methods described herein include administering to a subject or contacting a biological sample with an effective amount of a compound described herein, or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, or a
pharmaceutical composition thereof. In certain embodiments, the methods described herein include administering to a subject or contacting a biological sample with an effective amount of a compound described herein, or a pharmaceutically acceptable salt thereof, or a pharmaceutical composition thereof. In certain embodiments, the compound is contacted with a biological sample. In certain embodiments, the compound is administered to a subject. In certain embodiments, the compound is administered in combination with one or more additional pharmaceutical agents described herein. The additional pharmaceutical agent may be an anti-proliferative agent. In certain embodiments, the additional pharmaceutical agent is an and -cancer agent. The additional pharmaceutical agent may also be a kinase inhibitor. In certain embodiments, the additional pharmaceutical agent is an inhibitor of a CDK. In certain embodiments, the additional pharmaceutical agent is an inhibitor of CDK7. In certain embodiments, the additional pharmaceutical agent is a selective inhibitor of CDK7. In certain embodiments, the additional pharmaceutical agent is a nonselective inhibitor of CDK7. In certain embodiments, the additional pharmaceutical agent is an inhibitor of CDK12. In certain embodiments, the additional pharmaceutical agent is a selective inhibitor of CDK12. In certain embodiments, the additional pharmaceutical agent is a nonselective inhibitor of CDK! 2. In certain embodiments, the additional pharmaceutical agent is an inhibitor of CDK13. In certain embodiments, the additional pharmaceutical agent is a selective inhibitor of CDK13. In certain embodiments, the additional pharmaceutical agent is a nonselective inhibitor of CDK13. In certain embodiments, the additional pharmaceutical agent is an inhibitor of another CDK. In certain embodiments, the additional pharmaceutical agent is a selective inhibitor of another CDK. In certain embodiments, the additional pharmaceutical agent is a nonselective inhibitor of another CDK. In certain embodiments, the additional pharmaceutical agent is flavopiridol, triptolide, SNS-032 (BMS-387032), PHA-767491, PHA-793887, BS-181, (5)-CR8, (R)-CR8, or NU6140. In certain embodiments, the additional pharmaceutical agent is an inhibitor of a mitogen-activated protein kinase (MAPK). In certain embodiments, the additional pharmaceutical agent is an inhibitor of a glycogen synthase kinase 3 (GSK3). I certain embodiments, the additional pharmaceutical agent is an inhibitor of an AGC kinase. In certain embodiments, the additional pharmaceutical agent is an inhibitor of a calmodultn-dependent kinase (CaM Kinase). In certain embodiments, the additional pharmaceutical agent is an inhibitor of a casein Idnase 1. In certain embodiments, the additional pharmaceutical agent is an inhibitor of a STE kinase. In certain embodiments, the additional pharmaceutical agent is a inhibitor of a tyrosine kinase.
[00313] In some embodiments, the additional pharmaceutical agent is a topoisomerase inhibitor, a MCL1 inhibitor, a BCL-2 inhibitor, a BCL-xL inhibitor, a BRD4 inhibitor, a BRCA1 inhibitor, BRCA2 inhibitor, HER1 inhibitor, HER2 inhibitor, a CD 9 inhibitor, a Jumonji histone demethylase inhibitor, or a DNA damage inducer. In some embodiments, the additional pharmaceutical agent is etoposide, obatoclax, navitoclax, JQ1, 4-(((5'-chloro-2'- (((1 R,4R)~4~(((K)- 1 -metiioxypropan-2-yl)amino)cyclohexyl)amino)-[2,4'-bipyridin]-6- yl)amino)memyl)tetrahydro-2H-pyran-4-carbonitrile, JIB04, or cisplatin. In some embodiments, the additional pharmaceutical agent is etoposide, obatoclax, or navitoclax, and the disease to be treated is breast cancer, e.g., triple-negative breast cancer, HER2 positive breast cancer, HER2 negative breast cancer, ER -positive breast cancer, ER-negative breast cancer, or ER/PR-positive breast cancer. In some embodiments, the additional
pharmaceutical agent is etoposide, JIB04, or cisplatin, and the disease to be treated is Ewing's sarcoma. In some embodiments, the additional pharmaceutical agent is JQ1 or NVP2, and the disease to be treated is leukemia, e.g. , acute myelogenous leukemia, myeioblastic leukemia, promyelocytic leukemia, myelomonocytic leukemia, monocytic leukemia, monoblastic leukemia, or megakaryoblastic leukemia. In certain embodiments, a pharmaceutical composition described herein further comprises a combination of the additional pharmaceutical agents described herein.
[00314] The inventive compounds or compositions may synergistically augment inhibition of CD 7 induced by the additional pharmaceutical agent(s) in the biological sample or subject. The inventive compounds or compositions may synergistically augment inhibition of CD 12 induced by the additional pharmaceutical agent(s) in the biological sample or subject. The inventive compounds or compositions may synergistically augment inhibition of CD 12 and/or CDK13 induced by the additional pharmaceutical agent(s) in the biological sample or subject. Thus, the combination of the inventive compounds or compositions and the additional pharmaceutical agent(s) may be useful in treating proliferative diseases resistant to a treatment using the additional pharmaceutical agent(s) without the inventive compounds or compositions.
[00315| In some embodiments, the activity of a protein kinase is non-selectively inhibited by the compounds or pharmaceutical compositions described herein. In some embodiments, the activity of the protein kinase being inhibited is selectively inhibited by the compounds or pharmaceutical compositions described herein, compared to the activit of a different protein (e.g., a different protein kinase). In certain embodiments, the activity of CDK (e.g., CDK7, CDKT2, or CDK 13) is selectively inhibited by a compound or pharmaceutical composition described herein, compared to the activity of a different protein, in certain embodiments, the activity of CDK7 is selectively inhibited by a compound or pharmaceutical composition described herein, compared to the activity of a different CDK protein. In certain
embodiments, the activity of CDK7 is selectively inhibited by a compound or pharmaceutical composition described herein, compared to the activity of CDK12. In certain embodiments, the activity of CDK7 is selectively inhibited by a compound or pharmaceutical composition described herein, compared to the activity of CDK13. In certain embodiments, the activity of CDK7 is selectively inhibited by a compound or pharmaceutical composition described herein, compared to the activity of CDK12 and the activity of CDK13. In certain
embodiments, the activity of CDK 12 is selectively inhibited by a compound or
pharmaceutical composition described herein, compared to the activity of CDK 7, In certain embodiments, the activity of CDK13 is selectively inhibited by a compound or
pharmaceutical composition described herein, compared to the activity of CDK7. In certain embodiments, the activity of CDK 12 and the activity of CDK 13 are selectively inhibited by a compound or pharmaceutical composition described herein, compared to the activity of CDK7,
[00316] The selectivity of a compound or pharmaceutical composition described herein in inhibiting the activity of a protein kinase over a different protein (e.g., a different protein kinase) may be measured by the quotient of the IC50 value of the compound or
pharmaceutical composition in inhibiting the activity of the different protein over the IC50 value of the compound or pharmaceutical composition in inhibiting the activity of the protein kinase. The selectivity of a compound or pharmaceutical composition described herein for a protein kinase over a different protein may also be measured by the quotient of the K& value of an adduct of the compound or pharmaceutical composition and the different protein over the Kd value of an adduct of the compound or pharmaceutical composition and the protein kinase. In certain embodiments, the selectivity is at least 2-fold, at least 3-fold, at least 5-fold, at least 10-fold, at least 30-fold, at least 100-fold, at least 300-fold, at least 1,000-fold, at least 3,000-fold, at least 10,000-fold, at least 30,000-fold, or at least 100,000-fold. In certain embodiments, the selectivity is not more than 100,000-fold, not more than 10,000-fold, not more than 1,000-fold, not more than 100-fold, not more than 10-fold, or not more than 2-fold. Combinations of the above-referenced ranges (e.g., at least 2-fold and not more than 10,000- fold) are also within the scope of the disclosure,
[00317] In certain embodiments, a kit described herein includes a first container comprising a compound or pharmaceutical composition described herein. In certain embodiments, a kit described herein is useful in treating a proliferative disease (e.g., cancers (e.g., leukemia, acute lymphoblastic leukemia, lymphoma, Burkitt's lymphoma, melanoma, multiple myeloma, breast cancer, Ewing's sarcoma, osteosarcoma, brain cancer, neuroblastoma, lung cancer, colorectal cancer), benign neoplasms, diseases associated with angiogenesis, inflammatory diseases, automfiammatory diseases, and autoimmune diseases) in a subject in need thereof, preventing a proliferative disease in a subject in need thereof, inhibiting the activity of a protein kinase (e.g., CDK (e.g., CDK7, CDK12, or CDK13)) in a subject, biological sample, tissue, or cell, and/or inducing apoptosis in a cell.
[00318] In certain embodiments, a kit described herein further includes instructions for using the compound or pharmaceutical composition included in the kit. A kit described herein may also include information as required by a regulatory agency such as the U.S. Food and Drug Administration (FDA). In certain embodiments, the information included in the kits is prescribing information. In certain embodiments, the kits and instructions provide for treating a proliferative disease in a subject in need thereof, preventing a proliferative disease in a subject in need thereof, inhibiting the activity of a protein kinase (e.g., CDK (e.g., CDK7, CDK12, or CDK13)) in a subject, biological sample, tissue, or cell, and'or inducing apoptosis in a cell. A kit described herein may include one or more additional pharmaceutical agents described herein as a separate composition.
EXAMPLES
[00319] In order that the invention described herein may be more fully understood, the following examples are set forth. The synthetic and biological examples described in this application are offered to illustrate the compounds, pharmaceutical compositions, and methods provided herein and are not to be construed in any way as limiting their scope.
Pulldown Assay (Figures 2-4 and 7-9)
[00320] Jurkat cells were treated with DMSO or concentration of compound indicated, 6 hours after treatment, cells were washed and harvested by resuspending in lysis buffer (50 mM Hepes pH 7.4, 150 mM NaCl, 1% NP-40, 5 mM EDTA, protease and phosphatase inhibitors) and lysing on ice 30 minutes. Lysates were cleared by centrifugation at 15,000 rpm 30 minutes. Biotin-labeled THZ1 was added to 1 μΜ to lysates and rotated at 4 °C overnight. Streptavidin-agarose beads were washed and 30 μΕ slurry was added to each lysate and rotated for 1 hour at 4 °C. Beads were washed 5 times with lysis buffer and 50 μΕ 2X LDS buffer was added to each sample. Samples were boiled and equal volume of protein was loaded onto gel. Gel was transferred to nitrocellulose and blotted for Cyclin K and Cyclin H.
Interpretation of Results
[00321| We conclude that pre-treatment of cells with several of the compounds, but not DMSO, blocks biotin-THZl from being able to bind to CDK12, which blocks the pulldown of CDK12 and CD 13 -associated Cyclin K. This indicates that active compounds are able to engage CDK12 and CDK13 -associated cyclin K complexes in cells and block binding of these complexes by bio-THZl. We do not see a similar loss of pulldown of Cyclin H, indicating that these compounds are not able to bind to CDK.7 -associated cyclin H
complexes and block its association with biotin-THZl .
Growth Assay (Figure 5)
[00322] Jurkat cells were plated at 30,000 cells/well and treated with a titration of compounds indicated. Cells were allowed to grow for 72 hours. Cells were assayed using CELLTITER GLO (Promega) to determine cell viability by measuring the amount of ATP present, which is an indicator of cell metabolic activity. Results are graphed as luminescent values. Curves were generated using PRISM and an IC50 value was determined.
Interpretation of Results
[00323] We can conclude that several of the compounds generated and tested are more potent against cell growth than the parent SNS-032 compound in Jurkat cells.
Synthesis of the Compounds
[00324] The compounds provided herein can be prepared from readily available starting materials using the following general methods and procedures. Reactions were monitored by thin layer chromatography (TLC) with 0.25 mm E. Merck pre-coated silica gel plates (60 F254) and Waters LCMS system (Waters 2489 UV sible Detector, Waters 3100 Mass, Waters 515 HPLC pump, Waters 2545 Binary Gradient Module, Waters Reagent Manager, Waters 2767 Sample Manager) using SunFire™ CI 8 column (4.6 x 50 mm, 5 μτη particle size): solvent gradient = 95% A at 0 min, 0% A at 5 min; solvent A = 0.5% TFA in Water; solvent B = Methanol; flow rate: 1.5 mL/min. Purification of reaction products was carried out by flash chromatography using CombiFksh^Rf with Teledyne Isco RedLStep^Rf High Performance Gold or Silicycle Sili&5'ep1M High Performance columns (4 g, 12 g, 24 g, 40 g, 80 g or 120 g) or by Waters preparative HPLC system with a CI 8 column: solvent gradient = 100% A at 0 min, 0% A at 15 min; solvent A === 0.5% TFA in Water; solvent B === Methanol; flow rate: 20 mL/min. The purity of all compounds was over 95% and was analyzed with Waters LCMS system. Ή NMR and i C NMR spectra were obtained using a Varian Inova- 600 or 400 MHz spectrometer. Chemical shifts are reported relative to chloroform (<5 = 7.24) for -l NMR or dimethyl sulfoxide (δ = 2.50) for Ή NMR and dimethyl sulfoxide (δ = 39.51) for i3C NMR. Data are reported as (br = broad, s = singlet, d = doublet, t = triplet, q = quartet, m = multipiet).
H-2-
Figure imgf000149_0001
Figure imgf000149_0002
5-Thiocyasiai thia l-2-amine (M FH-2-76-I)
[00325] A mixture of 2-amino-5-bromothiazo]e hydrobromide (6.0 g, 23.08 mmol) and potassium thiocyanate (9.0 g, 92.32 mmol) in methanol (150 mL) was stirred at room temperature for 20 h. Methanol was evaporated and water (20 ml) was added. The pH of the aqueous solution was adjusted to pH==12 with 10% NaOH and then a precipitate was formed. The solid was collected by filtration to yield compound MFH-2-76-1 (1.5 g, 41%) as a solid. LCMS (m/z): 158 [M + H]+.
5-((5-tert-Bi5tyloxazol-2~yI)methylthi0)tMazoI-2-araiMe (MFH-2-80-1)
[00326] To a solution of compound MFH-2-76-1 (315 mg, 2 mmol) in EtOH (5 ml) was added aBH4 (151 mg, 4 mmol) at room temperature. The mixture was stirred for lh, and then acetone (3 ml) was slowly added. After lh, a solution of 5~tert~Butyl~2~
chloromethyloxazole (348 mg, 2 mmol) in EtOH (3 ml) was added. The resulting dark reaction mixture was heated to reflux for lh, and was then cooled and concentrated in reduced pressure. The residue was then dissolved in ethyl acetate and washed with water. The organic phase was separated, dried (MgS04) and concentrated in reduced pressure to give a crude product MFH-2-80-1 (310 mg, 57%) LCMS (m/z): 270 [M + 13]·· .
5-[[(5-t-buty2-oxazolyl)methyl]thioJ-2-bromo MFH-2-83-1)
[00327] To a solution of CuBr? (1.8 g, 8 mmol) in acetonitrile (48 mL) at 0°C was added t- BuONO (827 mg, 8 mmol) followed by compound MFH-2-80-1 (1.8 g,6.68 mmol). The mixture was stirred at 0°C for lh and then was warmed up to room temperature. Ethyl acetate was added and the organic mixture washed with hydrochloric acid (50 mL), dried over magnesium sulfate, filtered through a pad of silica gel, and concentrated in reduced pressure. The residue was purified by chromatographed on silica gel to give product. MFH- 2-83-1 (1.5g, 67%). LCMS (m z): 334 [M + H]+.
(¾)~teri~bisty!3~(5~ii5~iert~buty!oxa
carboxylate (MFH-2-84-1)
[00328] The mixture of MFH-2-83-1 (1.5g, 4.5 mmol), (R)-tert-butyl 3-aminopiperidine-l- carboxylate (1.6 g, 8.1 mmol) and DIEA (1.5 g, 11.25 mmol) in NMP (5 mL) was stirred at 140 °C for overnight. The residue was extracted with chloroform and iso-propanol (4:1). The organic phase was washed with brine (50 mL) and dried over Na2S04. After removal of the solvent, the residue was purified by silica gel (MeOH/DCM = 0-20%) to obtain MFH-2-84-1 (1.36 g, yield 66.8%). LCMS (m z): 453 [M + H]+.
(R)-5-((5-tert-biityloxazol-2-y!)met!iyltMo)-N-(piperidi!i-3-yl)t azol-2-aiiiiHe MFH-2- 85-1)
[00329] To a solution of MFH-2-85-1 (1.36 g, 3 mmol) in methanol (18 mL) was added 4N HCl dioxane (18 mL). The solution was then stirred for 3h at room temperature and the solvent was removed under reduced pressure to provide a crude which was directly used in the next step. LCMS (m/z): 353 [M + H]+.
(R)-(3-(5-((5-tert-but loxazol-2-yl)methylthio)thiazol-2-ylamino)p^^
idtrophenyl)methanone (MFH-2-86-l)
[00330] The mixture of MFH-2-85-1 (250 mg, 0.643 mmol), 4-nitrobenzoyl chloride (132 mg, 0.71 mmol) in pyridine (3 mL) was stirred for overnight at room temperature. Then the reaction mixture was concentrated under reduced pressure and the residue was directly used in the next step. LCMS (m/z): 502 [M + H]+.
(R)-(4-aminophenyl)(3-(5-((5 ert-butyloxazol-2-yl)methylthio)thiazol-2- ylamino)piperidin-l-yl)methanone (MFH-2-89-1)
[00331] To a solution of MFH-2-86-1 (270 mg, 0.54 mmol) in ethyl acetate and methanol (1:1) were added Tin (11) chloride dehydrate (1.2 g, 5,4 mmol) and cone, HC1 (0.2 mL). After stirring for 3 h at 80 °C, the reaction mixture was diluted with chloroform and iso-propanol (4:1), neutralized with saturated Nai ICO.; and filtered. The filtrate was extracted with chloroform and iso-propanol (4:1), concentrated under reduced pressure and the resulting residue was purified by silica gel column chromatography (MeOH/DCM === 0-20%) to give MFH-2-89-1 (140 mg, yield 55%). LCMS (m/z): 472 [M + H]+.
( )~ -(4-(3~(5~((5-tert- HiyIoxazoI-2-yI)raethyltMo)tMazol-2-ylamiMo)piperidiiie-l-" carbonyl)phenyl)acrylamide (MFH-2-90-1)
[00332] To a solution of MFH-2-89-1 (140 mg, 0.30 mmol) and DIPEA (0.2 mL) in CH3CN (2 mL) was added acryioyl chloride (35 mg, 0.39mmol) in DCM (0.8 mL) dropwise. The mixture was then stirred at 0°C for lh. The solution was then concentrated under reduced pressure and the residue was purified by prep-HPLC (MeOH H20, 0.05%TFA) to provide MFH-2-90-1 (24.7 mg, yield 16%). LCMS (m/z): 526 [M + H i--. i l l NMR (500 MHz, DMSO) δ 10.27 (s, 1H), 7.97 (s, 1H), 7.67 (s, 2H), 7.35 (d, J= 6.7 Hz, 2H), 6.87 (d, J= 26.3 Hz, III), 6.70 (s, III), 6.43 (dd, J= 17.0, 10.1 Hz, 1H), 6.27 (dd, J= 17.0, 1.8 Hz, 1H), 5.77 (dd, J- 10.1 , 1.8 Hz, III), 3.94 (s, 2H), 3.79 (s, 1H), 3.63 (d, J= 23.9 Hz, 2H), 3.14 (d, J = 65.1 Hz, 2H), 1.95 (s, 1H), 1.76 (s, 1H), 1.52 (d, J = 7.8 Hz, 2H), 1.17 (s, 9H).
Figure imgf000152_0001
(S)-tert-but B-(5-((5-tert-buty]oxazo]-2-yl)methylthio)thiazol-2-yla-^^
carboxylate (MFH-2-82-1)
[00333] The mixture of MFH-2-83-1 (150 mg, 0.45 mmoi), (S)-tert-butyi 3-aminopiperidine- 1-carboxylate (160 mg, 0.81 mmol) and DIEA (150 mg, 1.13 mmol) in NMP (1 mL) was stirred at 140 °C for overnight. The residue was extracted with chlorofonn and iso-propanol (4:1). The organic phase was washed with brine (20 mL) and dried over Na2S04. After removal of the solvent, the residue was purified by silica gel (MeOH/DCM = 0-20%) to obtain MFH-2-82-1 (136 mg, yield 67%). LCMS (m/z): 453 [M + H]+.
(S)-5-((5-tert-butyloxazol-2-yl)methyltbio)-N-(piperidin -yl)thiazol-2-amine MFH-2-
87-1)
[00334] To a solution of MFH-2-82-1 (136 mg, 0.3 mmol) in methanol (3 mL) was added 4N HCI/dioxane (3 mL). The solution was then stirred for 3h at room temperature and the solvent was removed under reduced pressure to provide a crude which was directly used in the next step. LCMS (m/z): 353 [M + ! ij .
(S)-(3-(5-((5-teit-bHtyloxazol-2-yl)methyltMo)t azoI-2-ylamiiio)piperidiii-l-yI)(4- MitropheoyI)methaiiosie (MFH-2-88-1)
[00335] The mixture of MFH-2-87-1 (250 mg, 0.643 mmol), 4-nitrobenzoyl chloride (132 mg, 0.71 mmol) in pyridine (3 mL) was stirred for overnight at room temperature. Then the reaction mixture was concentrated under reduced pressure and the residue was directly used in the next step. LCMS (m/z): 502 [M + H]+. (S)-(4-aminophenyl)(3-(5-((5-tert-butyloxazol-2-yl)methylthio)thiazol-2- ylamino)piperidin-l-yl)methanone (MFH-2-91-1)
[00336] To a solution of MFH-2-88-1 (270 mg, 0.54 mmol) in ethyl acetate and methanol (1:1) were added Tin(ll) chloride dehydrate (1.2 g, 5.4 mmol) and cone. HC2 (0.2 mL). After stirring for 3 h at 80 °C, the reaction mixture was diluted with chlorofonn and iso-propanol (4:1 ), neutralized with saturated NaHC(¾ and filtered. The filtrate was extracted with chloroform and iso~propanol(4: 1), concentrated under reduced pressure and the resulting residue was purified by silica gel column chromatography (MeOH DCM = 0-20%) to give MFH-2-91-1 (140 mg, yield 55%). LCMS (tn/z): 472 [M + H]+.
(S)-N-(4-(3-(5-((5-tert-bHtyloxazol-2-yI)methylthio)tMazol-2-ylamiiio)piperidiiie-l- carbonyl)phenyl)acrylamide (MFH-2-92-1 )
[00337] To a solution of MFH-2-91-1 (30 mg, 0.06 mmol) and DIPEA (0.2 mL) in CH3CN (2 mL) was added acryloyl chloride (8 mg, 0.08 mmol) in DC .VI (0.5 mL) dropwise. The mixture was then stirred at 0°C for Ih. The solution was then concentrated under reduced pressure and the residue was purified by prep-HPLC (MeOH/H20, 0.05%TFA) to provide MFH-2-92-1 (11 mg, yield 33%). LCMS (m/z): 526 [M + H]+. IH NMR (500 MHz, DMSO) δ 10.30 (s, IH), 8.07 (s, IH), 7.65 (s, 2H), 7.35 (d, J= 6.7 Hz, 2H), 6.88 (d, J= 37.7 Hz, IH), 6.70 (s, IH), 6.43 (dd, J = 16.9, 10.1 Hz, IH), 6.27 (dd, J=== 17.0, 1.6 Hz, IH), 5.77 (dd, ,/== 10.2, 1.7 Hz, IH), 3.95 (s, 2H), 3.79 (s, IH), 3.63 (d, ,/ - 23.9 Hz, 2H), 3.14 (d, J= 65.1 Hz, 2H), 1.92 (s, J= 18.7 Hz, IH), 1.76 (s, IH), 1.52 (d, J= 6.6 Hz, 2H), 1.17 (s, 9H). -2-95-
Figure imgf000153_0001
( )-tert-b ityI4-(3-(5~((5-tert~ Htjioxazol~2-yI)MiethyltMo)tMazoI-2-yIamiii0)piperidiiie- l-earboiiyl)cydo exykarbaraate (MFH-2-93-1).
[00338] The mixture of MFH-2-85-1 (116 mg, 0.33 mmol), 4-(tert- butoxycarbonylamino)cyc2ohexanecarboxylic acid (120 mg, 0.5 mmol), HOBT (68 mg , 0.5 mmol) and EDCI (96 mg, 0.5 mmol) in DCM (10ml) was stirred for overnight. The reaction mixture was diluted with DCM (25 ml). The organic phase was washed with saturated
Na2C03 and brine (20 ml.) and dried over Na2S04. After removal of the solvent, the residue was purified by silica gel (MeOH/DCM === 0-20%) to obtain MFH-2-93-1 (80 mg, yield
42%). LCMS (m/z): 578 [M + H]+.
(R)-(4-aminocyclohesyl)(3-(5-((5-teii:-butyloxazol-2-yl)methylthio)tIiiazol-2^
ylamino)piperidin-l-yl)methanone (MFH-2-94-1)
[00339] To a solution of MFH-2-93-1 (80 mg, 0.14 mmol) in methanol (3 mL) was added 4N HCI/dioxane (3 mL). The solution was then stirred for 3h at room temperature and the solvent was removed under reduced pressure to provide a crude which was directly used in the next step. LCMS (m/z): 478 [M + H]+.
(R)-N-(4-(3-(5-((5-tert-bHtyloxazol-2-yI)methyltMo)t azol-2-ylamiiio)piperidme-l- carbonyl)cyclohexyl)acrylamide (MFH-2-95-1 )
[00340] To a solution of MFH-2-94-1 (30 mg, 0.06 mmol) and DIPEA (0.2 mL) in CH3CN (2 mL) was added acryloyl chloride (8 mg, 0.08 mmol) in DCM (0.5 mL) dropwise. The mixture was then stirred at 0°C for lh. The solution was then concentrated under reduced pressure and the residue was purified by prep-HPLC (MeOH/H20, 0.05%TFA) to provide MFH-2-95-1 (15.9 mg, yield 48%). LCMS (m/z): 532 [M + H]+.
4N,HCf/dioxans
Figure imgf000155_0001
(R)-ter†-biityI4-(3-(5-((5-tert-bHtyI©xaz^^
l-carbonyl)benzylcarbamate (MFH-2-96-1).
[00341] The mixture of MFH-2-85-1 (88 mg, 0.25 mmol), 4-((tert- butoxycarbonylamino)methyl)benzoic acid (94 mg, 0.38 mmol), HOB'T (51 mg , 0.38 mmol) and EDCI (72 mg, 0.38 mmol) in DCM (8 mi) was stirred for overnight. The reaction mixture was diluted with DCM (25 ml). The organic phase was washed with saturated Na2C03 and brine (20 mL) and dried over Na2S04. After removal of the solvent, the residue was purified by silica gel (MeOH/DCM = 0-20%) to obtain MFH-2-96-1 (125 mg, yield 85%). LCMS (m/z): 586 [M + H]+.
(R)-(4-(aminomethyl)phenyl)(3~(5-(^^
ylamino)piperidin-l-yl)methanone (MFH-2-97-1)
[00342] To a solution of MFH-2-96-1 (125 mg, 0.21 mmol) in methanol (3 mL) was added 4N HCl/dioxane (3 mL). The solution was then stirred for 3h at room temperature and the solvent was removed under reduced pressure to provide a crude which was directly used in the next step. LCMS (m/z): 486 [M + j jj ,
(R)-N-(4-(3~C5~((5~tert~bMiyiexa^
carbonyl)benzyl)acrylamide (MFH-2-98-1)
[00343] To a solution of MFH-2-97-1 (50 mg, 0.1 mmol) and DiPEA (0.2 mL) in CH3CN (2 mL) was added acryloyl chloride (12 mg, 0.13 mmol) in DCM (0.5 mL) dropwise. The mixture was then stirred at 0°C for 1 h. The solution was then concentrated under reduced pressure and the residue was purified by prep-HPLC (MeOH/H2Q, 0.05 %TFA) to provide MFH-2-98-1 (16.4 mg, yield 30%). LCMS (m/z): 540 [M + H]+. lH NMR (500 MHz, DMSO) δ 8.62 (s, 1H), 8.08 (d, J = 54.5 Hz, 1H), 7.28 (d, J = 31.4 Hz, 4H), 6.91 (d, J = 65.2 Hz, IH), 6.72 (s, IH), 6.28 (dd, J = 17.1, 10.2 Hz, 1H), 6.13 (dd, J= 17.1, 2.2 Hz, 1H), 5.62 (dd, J= 10.2, 1.9 Hz, IH), 4.36 (s, 2H), 3.95 (s, 2H), 3.67 - 3.62 (in, 2H), 3.33 (s, IH), 3.14 - 2.83 (m, 2H), 1.94 (s, I H), 1.74 (d, J= 65.1 Hz, I H), 1.53 (s, 2H), 1.20 (s, 9H).
Figure imgf000156_0001
IWFH-2-100-1 MFH-2-102-1
(R)-4-nitrophenyl3-(5-((5 ert-butyloxazol-2-yl)methylthio)thiazol-2-
[00344J To a solution of MFH-2-85-1 (210 mg, 0.6 mmol) and DIPEA (116 mg, 0.9 mmol) in DCM (8 mL) was added 4-nitrophenyl chloroformate (133 mg, 0.66mmol) in DCM (1 mL) dropwise. The mixture was then stirred at 0°C for lh. The solution was then concentrated under reduced pressure and the residue was purified by silica gel (MeOH/DCM = 0-20%) to obtain MFH-2-99-1 (283 mg, yield 91%). LCMS (m/z): 518 [M + H]+.
(R)-4-aminophenyB-(5-((5-tert-butyloxazol-2-yl)methyltbJo)tliiazol-2- ylamino)piperidine-l-carboxylate (MFH-2-100-1)
[00345] To a solution of MFH-2-99-1 (106 mg, 0.21 mmol) in ethyl acetate and methanol (1 : 1) were added Tin(II) chloride dehydrate (462 mg, 2.1 mmol) and cone. HC1 (0.1 mL). After stirring for 3 h at 80 °C, the reaction mixture was diluted with chloroform and iso- propanol (4: 1), neutralized with saturated NaHCOs and filtered. The filtrate was extracted with chloroform and iso-propanol (4: 1), concentrated under reduced pressure and the resulting residue was purified by silica gel column chromatography (MeOH DCM === 0-20%) to give MFH-2-100-1 (60 mg, yield 60%). LCMS (m/z): 488 [M + H]+.
(R)^-aci lamidophenyD-(5-((5-tert-butyloxazol-2-y])methylthio)thiazol-2- ylamino)piperidine~ -carboxylate (MFH-2-102-1)
[00346] To a solution of MFH-2-100-1 (60 mg, 0.12 mmol) and DIPEA (0.2 mL) in CH3CN (2 mL) was added acryloyl chloride (15 mg, 0.16 mmol) in DCM (0.5 mL) dropwise. The mixture was then stirred at 0°C for lh. The solution was then concentrated under reduced pressure and the residue was purified by prep-HPLC (MeOH/H20, 0.05%TFA) to provide MFH-2-102-1 (18.1 mg, yield 27%). LCMS (m/z); 542 [M + H]+. !H NMR (500 MHz, DMSO) δ 10.17 is, IH), 8.13 (d, J = 14.2 Hz, IH), 7.64 (s, 2H), 7.08 (s, IH), 7.01 (d, J = 9.0 Hz, IH), 6.95 (s, IH), 6.72 (dd, J - 11.3, 7.1 Hz, IH), 6.42 (dd, J - 16.9, 10.1 Hz, IH), 6.25 (dd, J = 17.0, 1.7 Hz, IH), 5.82 - 5.68 (m, IH), 3.94 (s, 2H), 3.84 (s, IH), 3.74 (s, I H), 3.26 (d, J = 44.4 Hz, 2H), 2.93 (s, IH), 1.92 (d, J= 13.1 Hz, IH), 1.79 (d, J = 6.3 Hz, IH), 1.52 (s, 2H), 1.21 (s, 9H).
Figure imgf000157_0001
(R)- tert-butyll ~(3~(5~((5-tert-b is tyloxazol-2-yl)methylthio)thi azol-2-ylami no)piperidine- l-carbony])piperidin-4-ylcarbamate (MFH-2- 101-1)
[00347] The mixture of MFH-2-99-1 (177 mg, 0.34 mmol) and tert-butyl piperidin-4~ vlcarbamate (89 mg, 0.44 mmol) in DMSO (3 mL) was stirred at 60 °C overnight. The residue was extracted with chloroform and iso-propanol (4: 1). The organic phase was washed with brine (20 mL) and dried over Na2S04. After removal of the solvent, the residue was purified by silica gel (MeOH/DCM = 0-20%) to obtain MFH-2-101-1 (150 mg, yield 76%). LCMS (in//): 579 [M + ! ij '
(R)-(4~amfflepiperMio~l~yi)(3-(5~((5~tert^
ylamino)piperidin-l-yl)methanone (MFH-2-103-1)
[00348J To a solution of MFH-2-101-1 (150 mg, 0.26 mmol) in methanol (3 mL) was added 4N HCl/dioxane (3 mL). The solution was then stirred for 3h at room temperature and the solvent was removed under reduced pressure to provide a crude which was directly used in the next step. LCMS (m z): 479 [M + H]+'
(R)-N-(l-(3-(5-((5-tert-butyloxazol-2-yQ
carbonyl)piperidin-4-yl)acrylamide (MFH-2-104-1)
[00349] To a solution of MFH-2-103-1 (30 mg, 0.06 mmol) and DIPEA (0.2 mL) in C3¾CN (2 mL) was added acryloyl chloride (8 mg, 0.08 mmol) in DCM (0.5 mL) dropwise. The mixture was then stirred at 0°C for I . The solution was then concentrated under reduced pressure and the residue was purified by prep-HPLC (MeOH/H20, 0.05%TFA) to provide MFH-2-104-1 (10.2 mg, yield 30%). LCMS (m/z): 533 [M + H]+. lH NMR (500 MHz, DMSO) δ 8.13 (s, I H), 8.07 (d, J = 7.7 Hz, I H), 6.97 (s, I H), 6.70 (d, J = 5.5 Hz, I H), 6.18 (dd, J = 17.1, 10.1 Hz, IH), 6.07 (dd, J = 17.1, 2.2 Hz, IH), 5.57 (dd, J = 10.1 , 2.2 Hz, IH), 3.94 (s, 2H), 3.81 - 3.71 (m, 2H), 3.48 (s, 2H), 3.34 - 3.24 (m, 2H), 2.79 (t, J= 11.6 Hz, 3H), 2.70 (dd, J - 13.2, 9.5 Hz, IH), 1.89 (d, J = 10.4 Hz, I II), 1.71 (d, J = 13.1 Hz, 3H), 1.43 (dd, J= 16.4, 8.5 Hz, 2H), 1.32 (m, 2H), 1.18 (s, 9H).
Figure imgf000159_0001
(-thiadiazol-2-amine (MFH-2-202-1)
[00350] A mixture of 5-bromo-l,3,4-thiadiazol-2 -amine (1.5 g, 8.3 mmol) and potassium thiocyanate (3.2 g, 33.3 mmol) in methanol (30 mL) was stirred at room temperature for 20 h. Methanol was evaporated and water (10 ml) was added. The pH of the aqueous solution was adjusted to pH=T2 with 10% NaOH and precipitate formed. The solid was collected by filtration to yield compound MFH-2-202-1 (600 mg, 46%) as solid. LCMS (m/z): 159 [M +
5-((5-tert-butyloxazol-2-yl)methyltUo)-1 ?4-thiadiazol-2-amine (MFH-2-204-1)
[003511 To a solution of compound MFH-2-202-1 (315 mg, 2 mmol) in EtOH (5 ml) was added NaBH4 ( 51 mg, 4 mmol) at room temperature. The mixture was stirred for lh, and then acetone (3 ml) was slowly added. After lh, a solution of 5-tert-Butyl-2- chlorometliyloxazole (348 mg, 2 mmol) in EtOH (3 ml) was added. The resulting reaction mixture was heated to reflux for lh and then was cooled followed by concentration in reduced pressure. The residue was dissolved in ethyl acetate. The organic phase was washed with brine (30 mL) and then the solvent was removed after drying with MgS04. The crude product was then obtained MFH-2-204-1 (310 mg, 57%) as solid LCMS (m/z): 271 [M + H]+. 2-((5-bromo-1 )4-thiadiazol-2-ylthio)methyl)-5-tert-butyloxaz-ole MFH-2-208-1)
[00352] To a solution of CuBr2 (594 mg, 2.66 mmol) in acetomtrile (8 mL) at 0°C was added t-BuONO (275 mg, 2.66 mmol) followed by compound MFH-2-204-1 (600 mg,2.22 mmol). The mixture was stirred at 0°C for Ih and then was warmed up to room temperatui'e. After stirring for I , ethyl acetate was added and the organic mixture washed with hydrochloric acid (50 mL), dried over magnesium sulfate, filtered through a pad of silica gel, and concentrated in reduced pressure. The residue was chromatographed on silica gel to give the MFH-2-208-1 (700 mg, 94%). LCMS (m/z): 335 [M + H]+.
(R)-tert-butyD-(5-((5-tert-butyloxazol-2-yl)methyltbJo)-1 54-thiadiazol-2- ylamino)piperidine-l-carboxylate (MFH-3-2-1)
[00353] The mixture of MFH-2-208-1 (250 mg, 0.75 mmol), (R)-tert-hutyl 3- aminopiperidine-l-carboxylate (225 mg, 1.12 mmol) and DIEA (242 mg, 1.87mmol) in NMP
(1 mL) was stirred at 140 °C overnight. The residue was extracted with chloroform and iso- propanol (4:1). The organic phase was washed with brine (50 mL) and dried over Na2SC¼. A fter removal of the solvent, the residue was purified by silica gel (MeOH/DCM = 0-20%) to obtain MFH-3-2-1 (180 mg, yield 53%). LCMS (m/z): 454 [M + H]+'
(R)-5-((5~iert~butyloxazi>l-2~yl)methyltWo)- ~(p!per M~3~yl)-1 ,4~iMadla¾ol~2~amiHe (MFH-3-11-1)
[00354] To a solution of MFH-3-2-1 (250 mg, 0.55 mmol) in methanol (5 mL) was added 4N HCl/dioxane (5 mL). The solution was then stirred for 3h at room temperature and the solvent was removed under reduced pressure to provide a cmde which was directly used in the next step. LCMS (m/z): 354 [M + H]+'
(R)-(3-(5-((5-tert-butyloxa:rol^
y])(4-nitrophenyl)methanone (MFH-3-14-1)
[00355] The mixture of MFH-3-11-1 (140 mg, 0.4 mmol), 4-nitrobenzoyl chloride (88 mg, 0.48 mmol) in pyridine (3 mL) was stirred overnight at room temperature. Then the reaction mixture was concentrated under reduced pressure and the residue was directly used in the next step. LCMS (m/z): 503 [M + H]+'
(R)-(4~ammopbeiiyl)(3-(5-((5-tert-butyloxazol-2-yl)metby!tMo)~l,354-t iadiazol-2- ylamino)piperidin-l-yl)methanone (MFH-3-18-1)
[00356] To a solution of MFH-3-1 -1 (200 mg, 0.4 mmol) in ethyl acetate and methanol (1 : 1) were added Tin(II) chloride dehydrate (904 mg, 4 mmol) and cone. HC1 (0.2 mL). After stirring for 3 h at 80 °C, the reaction mixture was diluted with chloroform and iso-propanol (4: 1), neutralized with saturated NaHC03 and filtered. The filtrate was extracted with chloroform and iso-propanol (4: 1), concentrated under reduced pressure and the resulting residue was purified by silica gel column chromatography (MeOH/DCM = 0-20%) to give MFH-3-18-1 (45 mg, yield 24%). LCMS (m/z): 473 [M + H]+.
(R)-N-(4-(3-(5-((5-tert-butyloxazol-2-yl)methylthio)-l,354-thiadiazol-2-
[00357] To a solution of MFH-3-18-1 (22 mg, 0.05 mmol) and DIPEA (0.2 mL) in CH3CN (2 mL) was added acryloyl chloride (6 mg, 0.06 mmol) in DCM (0.2 mL) dropwise. The mixture was then stirred at 0°C for I h. The solution was then concentrated under reduced pressure and the residue was purified by prep-HPLC (MeOH/H2Q, 0.05%TFA) to provide MFH-3-25- (8.8 mg, yield 36%). LCMS (m/z): 527 [M + H]+. lH NMR (500 MHz, DMSO) δ 10.29 (s, I H), 8.02 (d, J = 5.0 Hz, IH), 7.68 (s, 2H), 7.35 (s, 2H), 6.75 (s, IH), 6.44 (dd, J = 17.0, 10.1 Hz, IH), 6.28 (d, J = 16.9 Hz, IH), 5.86 - 5.70 (m, IH), 4.33 (s, 2H), 3.74 (s, I H), 3.60 (s, 2H), 3.21 (d, J === 32.1 Hz, 2H), 1.99 (s, IH), 1.77 (s, I H), 1.58 (dd, J = 22 A, 11.7 Hz, 2H), 1.29 (s, 9H).
Figure imgf000161_0001
[00358] The mixture of 1 -fluoro-4-nitrobenzene (200 mg, 1.42 mmol), cyclohexane-1,3- diamine (485 mg, 4.25 mmol) and K2C03 (587 mg, 4.25 mmol) in DMF (3 mL) was stirred at 90 °C for 6h. The solution was then diluted with chloroform and iso-propanol (4: 1). The organic phase was washed with brine (50 mL) and dried over Na2S04. After removal of the solvent, the residue was purified by silica gel (MeOH/DCM === 0-20%) to obtain MFH-3-26-1 (230 mg, yield 69%). LCMS (m z): 236 [M + H]+'
-(5-((5-tert-biityIoxazol-2-yl)methylthio)thiazol-2-yl)~ 3-(4-mtropheMyI)eyclohexaMe- 1 -diamine (MFH-3-29-1)
[00359] The mixture of MFH-2-83-1 (272 mg, 0.82 mmol), MFH-3-26-1 (230 mg, 0.98 mmol) and DIEA (316 mg, 2.46 mmol) in NMP (2 mL) was stirred at 140 °C overnight. The solution was diluted with chlorofonn and iso-propanol (4: 1 ). The organic phase was washed with brine (50 mL) and dried over Na2S04. After removal of the solvent, the residue was purified by silica gel (MeOH/DCM = 0-20%) to obtain MFH-3-29-1 (80 mg, yield 20%). LCMS (m/z): 458 [M + ! ij '
Nl-(3-(5-((5-tert-butyloxazol-2-yl)methyltW^
diami e (MFH-3-33-1)
[00360] To a solution of MFH-3-29-1 (80 mg, 0.16 mmol) in ethyl acetate and methanol (1 : 1) were added Tin(II) chloride dehydrate (370 mg, 1.6 mmol) and cone. HQ (0.1 mL). After stirring for 3 h at 80 °C, the reaction mixture was diluted with chloroform and iso- propanol (4: 1), neutralized with saturated NaHC(¾ and filtered. The filtrate was extracted with chloroform and iso-propanol (4:1), concentrated under reduced pressui'e and the resulting residue was purified by silica gel column chromatography (MeOH/DCM = 0-20%) to give MFH-3-33-1 (20 mg, yield 27%). LCMS (m/z): 458 [M + H]+.
N-(4-(3-(5-((5-tert-butyloxazol-2-yl)methylthio)thiazol-2- ylandno)cyclohesy]amino)phenyl)acrylainide (MFH-3-35-1)
[00361] To a solution of MFH-3-33-1 (20 mg, 0.04 mmol) and DIPEA (0.1 mL) in CH3CN (2 mL) was added acryloyl chloride (4 mg, 0.04 mmol) in DCM (0.2 mL) dropwise. The mixture was then stirred at - 40°C for Ih. The solution was then concentrated under reduced pressure and the residue was purified by prep-HPLC (MeOH/H20, 0,05%TFA) to provide MFH-3-35-1 (9.3 mg, yield 41%). LCMS (m/z): 512 [M + H]+.
Figure imgf000163_0001
(R)-(3~(5~((5~teri~b y!exazo!~2~y^
methyl-4-nitrophenyl)methanone (MFH-3-64-1).
[00362] The mixture of MFH-2-85-1 (44 mg, 0.13 mmol), 4-((tert- butoxycarbonylamino)methyl)benzoic acid (47 mg, 0.19 mmol), HOBT (25 mg , 0.19 mmol) and EDCI (36 mg, 0.19 mmol) in DCM (3 ml) was stirred for overnight. The reaction mixture was diluted with DCM (25 ml). The organic phase was washed with saturated Na2C<¾ and brine (20 mL) and dried over Na2S04. After removal of the solvent, the residue was purified by silica gel (MeOH/DCM === 0-20%) to obtain MFH-3-64-1 (63 mg, yield 94%). LCMS (m/z): 516 [M + H]+. R)-(4-amino-2-methylphenyl)(3-(5-((5-tert-butyloxazol-2-yl)methylthio)thiazol-2- ylamino)piperidin-l-yl)methanone (MFH-3-66-1)
[00363] To a solution of MFH-3-64-1 (63 mg, 0.12 mmol) in ethyl acetate and methanol (1:1) were added Tin(ll) chloride dehydrate (138 mg, 0.61 mmol) and cone. HC1 (0.1 mL). After stirring for 3 h at 80 °C, the reaction mixture was diluted with chloroform and iso- propanol (4: 1), neutralized with saturated NaHC03 and filtered. The filtrate was extracted with chloroform and iso-propanol (4:1), concentrated under reduced pressure and the resulting residue was purified by silica gel column chromatography (MeOH/DCM === 0-20%) to give MFH-3-66-1 (20 mg, yield 34%). LCMS (m/z): 486 [M + I I ] ···. ( )-N-(4-(3~(5~((5-tert- HiyloxazoI~2-yI)MiethyltMo)tMazoI-2-yIamiiio)piperidiiie-l-" carbonyl)-3-methylphenyl)acrylamide (MFH-3-75-1)
[00364] To a solution of MFH-3-66-1 (20 mg, 0.04 mmol) and DIPEA (0.1 mL) in CH3CN (2 mL) was added acryloyl chloride (4 mg, 0.04 mmol) in DCM (0,2 mL) dropwise. The mixture was then stirred at 0°C for lh. The solution was then concentrated under reduced pressure and the residue was purified by prep-HPLC (MeOH/TI20, 0.05%TFA) to provide MFH-3-75-1 (9.4 mg, yield 41%). LCMS (m/z): 540 [M + H]+. \ NMR (500 MHz, DMSO) δ 10.16 (d, J = 35.4 Hz, 1 H), 8.03 (d, ,/ - 59.1 Hz, 1 H), 7.54 (d, J = 9.3 Hz, IH), 7.24 - 7.08 (m, I H), 7.00 (d, J = 9.0 Hz, I H), 6.75 (d, J = 10.5 Hz, I H), 6.69 (s, 1H), 6.43 (dt J = 17.0, 10.5 Hz, 1 1 1). 6.32 - 6.20 (m, IH), 5.76 (t, J = 11.0 Hz, IH), 3.96 (s, J = 11.8 Hz, 2H), 3.59 (d, J = 52.3 Hz, 4H), 3.00 (s, IH), 2.19 (s, 3H), 1.92 (dd, J = 59.5, 33.2 Hz, 2H), 1.57 (d, ,/ - 57.5 Hz, 2H), 1.20 (s, 9H).
SnC!2,EAMeOH
Figure imgf000164_0001
(R)-(3-(5-((5-ter -b ityIoxazoI-2-yl)methylthio)tMazol-2-ylamiMo)piperidiii-l-yI)(2- methosy-4-nitrophenyl)methanone (MFH-3-65-1).
[00365] The mixture of MFH~2~85~1 (44 mg, 0.13 mmol), 4-((tert- butoxycarbonylamino)methyl)benzoic acid (47 mg, 0. 9 mmol), HOBT (25 mg , 0.19 mmol) and EDCI (36 mg, 0.19 mmol) in DCM (3 ml) was stirred overnight. The reaction mixture was diluted with DCM (25 ml). The organic phase was washed with saturated Na2C03 and brine (20 mL) and dried over Na2S03. After removal of the solvent, the residue was purified by silica gel (MeOH/DCM = 0-20%) to obtain MFH-3-64-1 (71 mg, yield 100%). LCMS (m/z); 532 [M + I ( )-(4~amiMO-2-methoxyp!ieMyl)(3~(5-((5-tert-botyloxazol-2-yl)raethyItMo)tWaz0l-2~ ylamino)piperidin-l-yl)methanone (MFH-3-67-1)
[00366] To a solution of MFH-3-64-1 (71 mg, 0.13 mmol) in ethyl acetate and methanol (1 : 1) were added Tin(ll) chloride dehydrate (151 mg, 0.67 mmol) and cone. HCl (0.1 mL). After stirring for 3 h at 80 °C, the reaction mixture was diluted with chloroform and iso- propanol (4: 1), neutralized with saturated NaHC03 and filtered. The filtrate was extracted with chloroform and iso-propanol (4: 1), concentrated under reduced pressure and the resulting residue was purified by silica gel column chromatography (MeOH DCM === 0-20%) to give MFH-3-67-1 (30 mg, yield 45%). LCMS (m/z): 502 [M + H]+.
(R)-N-(4-(3-(5-((5 ert-bHtyIoxazol-2-yI)methyltMo)t azol-2-ylamiHo)piperidme-l- carbonyl)-3-methoxypheny])acrylamide (MFH-3-81-1)
[00367] To a solution of MFH-3-67-1 (30 mg, 0.06 mmol) and DIPEA (0.1 mL) in CH3CN (2 mL) was added acryloyl chloride (7 mg, 0.08 mmol) in DCM (0.2 mL) dropwise. The mixture was then stirred at 0°C for lh. The solution was then concentrated under reduced pressure and the residue was purified by prep-HPLC (MeOH/H20, 0.05%TFA) to provide MFH-3-81-1 (11.8 mg, yield 35%). LCMS (m/z): 556 [M + H]+. Ί \ NMR (500 MHz, DMSO) δ 10.36 - 10.15 (m, 1H), 8.16 - 7.83 (m, 1H), 7.49 (d, J = 14.3 Hz, 1H), 7.15 (dd, J = 19.9, 7.7 Hz, I II), 7.04 - 6.94 (m, I II), 6.74 (dd, J - 28.4, 22.6 Hz, 2H), 6.43 (dt, J = 18.7, 9.3 Hz, IH), 6.27 (ddd, J = 17.0, 9.5, 1.8 Hz, 1 H), 5.83 - 5.72 (m, 1H), 3.91 (s, 2H), 3.78 (s, 3H), 3.73 (s, IH), 3.45 (d, J = 13.3 Hz, H), 3.24 (t, J= 32.2 Hz, IH), 2.88 (dd, J= 34.4, 22.2 Hz, 2H), 1.97 (d, J = 18.3 Hz, IH), 1.78 (s, IH), 1.46 (s, 2H), 1.20 (s, 9H).
Figure imgf000165_0001
(lR S)-3-(5-((5-tert-butyloxazol-2-yl)methylthio)thiazol-2- ylaraMo)eyclo exaiie£arbi>xy!k* add (MFH-3-79-1)
[00368] The mixture of MFH-2-83-1 (200 mg, 0.6 mmol), 3-aminocyclohexanecarboxylic acid (138 mg, 0.96 mmol) and DIEA (233 mg, 1.8 mmol) in NMP (1 mL) was stirred at 140 °C for overnight. The residue was extracted with chloroform and iso-propanol (4:1). The organic phase was washed with brine (50 mL) and dried over Na2S04. After removal of the solvent, the residue was purified by silica gel (MeOH/DCM = 0-20%) to obtain MFH-3-79-1 (60 mg, yield 26%). LCMS (m/z): 396 [M + H]+' tert-buty]l-((lR^S)-3-(5-((5-tert-butyloxazol-2-yl)methy]thio)thiazol-2- ylamino)cyclohexanecarbonyl)piperidin-4-ylGarbamate (MFH-3-83-1).
[00369] The mixture of MFH-3-79-1 (60 mg, 0.15 mmol), tert-butyl piperidin-4-ylcarbamate (46 mg, 0.23 mmol), HOBT (31 mg, 0.23 mmol) and EDCI (44 mg, 0.23 mmol) in DCM (6 ml) was stirred for overnight. I e reaction mixture was diluted with DCM (25 ml). The organic phase was washed with saturated Na2C(¼ and brine (20 mL) and dried over Na2S04. After removal of the solvent, the residue was purified by silica gel (MeOH/DCM = 0-20%) to obtain MFH-3-83-1 (80 mg, yield 91%). LCMS (m/z): 578 [M + H]+.
(4-aminopiperidin-l-yl)((lR,3S)-3-(5-((5-teii:-buty]oxazol-2-yl)methylthio)thiazol-2- ylamino)cyclohexyl)methanone (MFH-3-85-1 )
[00370] To a solution of MFH-3-83-1 (80 mg, 0.14 mmol) in methanol (3 mL) was added 4N HCl/dioxane (3 mL). The solution was then stirred for 3h at room temperature and the solvent was removed under reduced pressure to provide a crude which was directly used in the next step. LCMS (m/z): 478 [M + H]+-
N-(l-((lR^S)-3-(5-((5-tert-butyloxazol-2-yl)methylthio)thiazoI-2- ylamisio)£yclohexaiiei*arboiiyl)piperidiii~4~yI)a£rylam!de (MFH-3-88-1)
[00371] To a solution of MFH-3-85-1 (20 mg, 0.04 mmol) and DIPEA (0.1 mL) in CH3CN (2 mL) was added acryioyl chloride (5 mg, 0.05 mmol) in DCM (0.1 mL) dropwise. The mixture was then stirred at 0°C for lh. The solution was then concentrated under reduced pressure and the residue was purified by prep-HPLC (MeOH/H20, 0.05%TFA) to provide MFH-3-88-1 (3.7 mg, yield 17%). LCMS (m/z): 532 [M + H]+.
Figure imgf000167_0001
5-((5-tert-butyIoxazoI-2-yl)methylthio)-N-((lR,3R)-3-(4- mtFopbenoxy)eydo exyl)tMa¾el~2~am™e (MFH-3-97-1)
[00372] The mixture of MFH-2-83-1 (180 mg, 0.54 mmol), (lR,3R)-3-(4- nitiOphenoxy)cyclohexanamine (204 mg, 0.86 mmol) and DIEA (140 mg, 1.1 mmol) in NMP (1 mL) was stirred at 140 °C for overnight. The residue was extracted with chloroform and iso-propanol (4:1). The organic phase was washed with brine (50 mL) and dried over Na2S04. After removal of the solvent, the residue was purified by silica gel (MeOH/DCM = 0-20%) to obtain MFH-3-97-1 (80 mg, yield 30%). LCMS (m/z): 489 [M + H]+'
N-((lR R)-3-(4-aminophenoxy)cyclohexy])-5-((5-tert-butyloxazol-2- yl)methyltbJo)tbiazol-2-amine (MFH-3-102-1)
[00373 J To a solution of MFH-3-97-1 (80 mg, 0.16 mmol) in ethyl acetate and methanol (1 :1) were added Tin(II) chloride dehydrate (300 mg, 1.3 mmol) and cone. HQ (0.1 mL). After stirring for 3 h at 80 °C, the reaction mixture was diluted with chloroform and iso- propanol (4:1), neutralized with saturated NaHC(¾ and filtered. The filtrate was extracted with chloroform and iso-propanol(4: l), concentrated under reduced pressure and the resulting residue was purified by silica gel column chromatography (MeOH/DCM = 0-20%) to give MFH-3-102-1 (40 mg, yield 54%). LCMS (m z): 459 [M + H]+.
N-(4-((lR,3R)-3-(5-((5-tert-butyloxazol-2-yl)methylthio)thiazol-2- ylamino)cyclohexyloxy)phenyl)acrylamide (MFH-3-103-1)
[00374] To a solution of MFH-3-102-1 (40 mg, 0.09 mmol) and DIPEA (0.1 mL) in CH3CN (2 mL) was added acryloyl chloride (10 mg, 0.11 mmol) in DCM (0.2 mL) dropwise. The mixture was then stirred at 0°C for I h. The solution was then concentrated under reduced pressure and the residue was purified by prep-HPLC (MeOH/ILO, 0.05%TFA) to provide MFH-3-103-1 (9.6 mg, yield 21%). LCMS (m/z): 513 [M + H]+. Ή NMR (500 MHz, DMSO) δ 10.00 (s, 1H), 8.04 (d, J = 7.3 Hz, lH), 7.56 (d, J = 9.0 Hz, 2H), 6.94 (s, 1H), 6.93 - 6.89 (m, 2H), 6.71 (s, 1H), 6.39 (dd, J = 17.0, 10.1 Hz, 1H), 6.21 (dd, J = 17.0, 2.0 Hz, 1H), 5.71 (dd, J " 10.1, 2.0 Hz, 1H), 4.66 (s, 1 H), 3.94 (s, 2H), 3.83 (s, I II), 2.01 (d, J = 13.3 Hz, 1H), 1.85 (s, 1H), 1.74 - 1 .54 (m, 5H), 1.34 (dd, ,7 - 21.1 , 1 1.1 Hz, 1 H), 1.18 (s, 9H).
Figure imgf000168_0001
(R)-tert-bistyl3-(5-cyaMot azol-2-ylamiiio)piperidiiie-l-carboxylate(MFll-3-72-l)
[00375] 'Hie mixture of 2-bromothiazole-5-carbonitrile (800 mg, 4,23 mmol), (R)-tert-butyl 3-aminopiperidine-l -carboxylate (1.1 g, 5.5 mmol) and DIE A (820 mg, 6.35 mmol) in THF (15 mL) was stirred at 80 °C for 6h. The residue was extracted with chloroform and iso- propanol (4: 1). The organic phase was washed with brine (50 ml, x 2) and dried over Ν¾804. After removal of the solvent, the residue was purified by silica gel (MeOH/DCM = 0-20%) to obtain MFH-3-72-1 (1.3 g, yield 100%). LCMS (m/z): 309 [M + ! ! ] '
(R)-tert-butyl 3-(5-(ammomethyl)thiazo]-2-ylamino)piperidine-l-carboxylate (MFH-3- 82-1)
[003761 To a solution of MFH-3-72-1 (300 mg, 1 mmol) and CoCl2 6H20 (232 mg, 1 mmol) in ethanol (8 mL) was added NaBH (1 l0 mg, 3 mmol) at room temperature. The vial was sealed and stirred at room temperature for 3h and then was quenched with water. The obtained mixture was extracted with chloroform and iso-propanol (4: 1 ). The organic phase was washed with brine (50 mL χ 2) and dried over Na2S04. After removal of the solvent, the residue was purified by silica gel (MeOH/DCM = 0-20%) to obtain MFH-3-82-1 (89 g, yield 28%). LCMS (m/z): 313 [M + H]+"
(R)-tert-butyl3-(5-((5-chloro^-(trifluoromethyl)pyridin-2-ylamino)methyl)tU
ylamino)piperidine-l-carboxylate (MFH-3-99-1)
[00377] The mixture of MFH-2-82-1 (175 mg, 0.56 mmol), 2-bromo-5-chloro-4-
(trifluoromethyl)pyridme (146 mg, 0.56 mmol) and DIEA (108 mg, 0.84 mmol) in NMP (1 mL) was stirred at 80 °C for overnight. The residue was extracted with chloroform and iso- propanol (4:1). The organic phase was washed with brine (50 mL χ 2) and dried over Na2S04. After removal of the solvent, the residue was purified by silica gel (MeOH/DCM = 0-20%) to obtain MFH-3-99-1 (90 mg, yield 58%). LCMS (m/z): 492 [M + H]+'
(R)-5-((5-chlon trinuorom
yl)thiazol-2-amine (MFH-3-106-l)
[00378] To a solution of MFH-3-99-1 (90 mg, 0.18 mmol) in methanol (3 mL) was added 4N HCl/dioxane (3 mL). The sol tion was then stirred for 3h at room temperature and the solvent was removed under reduced pressure to provide a crude which was directly used in the next step. LCMS (m z): 392 [M + H]+'
(R)-N-(4-(3-(5~((5~e loro~4~(trillHoromet yl)pyr M~2~ylamiiio)met yl)t azi>l-2~ ylamino)piperidine-l-carbonyl)phenyl)acry]amide (MFH-3-107-1).
[00379] The mixture of MFH-3-106-1 (20 mg, 0.05 mmol), 4-acrylamidobenzoic acid (10 mg, 0.05 mmol), HOBT (8 mg , 0.06 mmol) and EDCI (11 mg, 0.06 mmol) in DMF (0.5 ml). Then the reaction mixture was stirred for overnight. The reaction mixture was purified by prep-HPLC (MeOH/H20, 0.05%TFA) to provide MFH-3-107-1 (3.8 mg, yield 13%). LCMS (m/z): 565 [M + ! I]. !H NMR (500 MHz, DMSO) δ 10.31 (s, 1H), 8.28 (s, 1H), 7.68 (s, 3H), 7.36 (d, J = 12 Hz, 2H), 7.25 - 6.81 (m, 3H), 6.45 (dd, J= 17.0, 10.2 Hz, 1 H), 6.28 (dd, J = 17.0, 1.9 Hz, 1H), 5.78 (dd, J= 10.1, 1.9 Hz, 1 11). 4.46 (s, 2H), 3.69 (s, 3H), 3.18 id. ./ " 11.7 Hz, 2H), 1.96 (s, 1H), 1.75 (s, 1H), 1.55 (m, 2H).
MFH-3-110-1
Figure imgf000170_0001
[00380] A solution of 5-tert-bu yl-2-(chloromethyl)oxazole (800 mg, 4.61 mmol) in triethyl phosphite (3.83 g, 23.04 mmol ) was heated at 120 °C for overnight. The solvent was removed under reduced pressure to provide a crude which was directly used in the next step. LCMS (m/z): 276 [M + \ l
(E) eFt~butyl5~(2-(5 ert-butySoxazoI^
[00381] To a solution of MFH-3-91-1 (500 mg, 1.82 mmol) in THF (5 ml,) was added t- BuOK (370 mg, 3.3 mmol) at room temperature. The vial was sealed and stirred at room temperature for 10 min. Then, a solution of tert-butyl 5-formylthiazol-2-ylcarbamate (345 mg, 1.5 mmol) in THF (3 mL) was added. After completion, the reaction mixture was quenched with water. The obtained mixture was extracted with chloroform and iso-propanol (4: 1). The organic phase was washed with brine (50 mL χ 2) and dried over Na2S04. After removal of the solvent, the residue was purified by silica gel (MeOH/DCM = 0-20%) to obtain MFH-3-94-1 (440 mg, yield 84%). LCMS (m/z): 350 [M + Hp (E)-5-(2-(5-tert-butyloxazol-2-yl)viiiyI)thiazoI-2-amiiie (MFH-3-98-1)
[00382] To a solution of MFH-3-94-1 (220 mg, 0,63 mmol) in methanol (5 mL) was added 4N HCI/dioxane (5 mL). The solution was then stirred for 3h at room temperature and the solvent was removed under reduced pressure to provide a crude which was directly used in the next step. LCMS (m/z): 250 [M + H p
(£)-2-(2-(2-bromothiazol-5-yl)vinyl)-5-tert-butylosazole (MFH-3-105-1)
[00383] To a solution of CuBr2 (172 mg, 0.77 mmol) in acetonitrile (15 mL) at 0°C. was added t-BuONO (79 mg, 0.77 mmol) followed by compound MFH-3-98-1 (160 mg, 0.64 mmol). The mixtixre was stirred at 0°C. for one hour, then at room temperature for one hour, ethyl acetate was added and the organic mixture washed with hydrochloric acid (20 mL), dried over magnesium sulfate, filtered through a pad of silica gel, and concentrated under reduced pressure. The residue was chromatographed on silica gel to give the MFH-3-105-1 (50 mg, 25%). LCMS (m/z): 314 [M + H]+.
(] ,E)~tert jufyL1~C5~(2~(5~teri~b
carboxylate (MFH-3-108-1)
[00384] The mixture of MFH-3-105-1 (50 mg, 0.16 mmol), (R)-tert-butyl 3- aminopiperidine-1 -carboxylate (51 mg, 0.26 mmol) and DIEA (41 mg, 0.32 mmol) in NMP (0.5 mL) was stirred at 140 °C for overnight. The residue was extracted with chloroform and iso-propanol (4:1). The organic phase was washed with brine (10 mL x 2) and dried over Na2S04. After removal of the solvent, the residue was purified by silica gel (MeOH/DCM = 0-20%) to obtain MFH-3-108-1 (40 mg, yield 58%). LCMS (m/z): 433 [M + Hf"
Figure imgf000171_0001
[00385] To a solution of MFH-3-108-1 (40 g, 0.09 mmol) in methanol (2 mL) was added 4N HCI/dioxane (2 mL). The solution was then stirred for 3h at room temperature and the solvent was removed under reduced pressure to provide a crude which was directly used in the next step. LCMS (m/z): 333 [M + Η]+·
(R,E)-N-(4-(3-(5-(2-(5-tert-biityloxazol-2-yl)¥iiiyI)t!iiazol-2-ylamiiio)piperidiiie-l- carbonyl)phenyl)acrylamide (MFH-3-110-1).
[00386] The mixture of MFH-3-109-1 (35 mg, 0.1 mmol), 4-acrylamidobenzoic acid (30 mg, 0.16 mmol), HOBT (21 mg , 0.16 mmol) and EDCI (30 ing, 0.16 mmol) in DMF (0.5 ml). Then the reaction mixture was stirred for overnight. The reaction mixture was purified by prep-HP!€' (MeOH/H20, 0.05%TFA) to provide MFH-3-110-1 (5 mg, yield 10%). LCMS (m/z): 506 [M + H]+.
Figure imgf000172_0001
5~(2~(5~tert~b5ityloxazol~2~yI)ethy!)thIazol~2~amiBe (MFH-3-104-1)
[00387] A mixture of compound MFH-3-94-1 ( 250 mg, 1 mmol ) and 10% Pd/C (20 mg) in MeOH (10 mL) was stirred for 5h at room temperature under ¾ balloon. The mixture was filtered through celite. The filtrate was added 4N HCl/dioxane (5 mL). The solution was then stirred for 3h at room temperature and the solvent was removed under reduced pressure to provide a crude which was directly used in the next step. LCMS (m/z): 252 [M + H]+'
2-(2-(2-bromothiazol-5-y])ethyl)-5-tert-butyloxazole (MFH-3-114-1)
[00388] To a solution of CuBr2 (53 mg, 0.24 mmol) in acetonitrile (2 mL) at 0°C. was added t-BuONO (25 mg, 0.24 mmol) followed by compound MFH-3-104-1 (60 mg, 0.24 mmol). The mixture was stirred at 0°C for one hour, and then was warmed up to room temperature. Ethyl acetate was added and the organic mixture was washed with hydrochloric acid (20 ml,), dried over magnesium sulfate, filtered through a pad of silica gel, and concentrated in vacuo. The residue was chromatographed on silica gel to give the MFH-3-114-1 (40 mg, 53%). LCMS (m/z): 316 [M + H]+.
( )-tert-b ity -(5-(2~(5-tert~bi5tyl(>xazol~2-yI)ethyl)thiazol-2-ylamiMo)piperMisie-l- carboxylate (MFH-3-115-1)
[00389] The mixture of MFH-3-114-1 (40 mg, 0.13 mmol), (R)-tert-butyl 3-ammopiperidine-
1 -carboxylate (41 mg, 0.2 mmol) and DIEA (33 mg, 0.25 mmol) in NMP (0.5 mL) was stirred at 140 °C for overnight. The residue was extracted with chloroform and iso-propanol (4:1). The organic phase was washed with brine (10 mL * 2) and dried over Na2S04. After removal of the solvent, the residue was purified by silica gel (MeOH/DCM = 0-20%) to obtain MFH-3-115-1 (35 mg, yield 63%). LCMS (m/z): 435 [M + j j] ·
(R)-5-(2-(5 ert-butyloxazol-2-yl)ethyl)-N-(piperidin-3-yl)thia^
[00390] To a solution of MFH-3-115-1 (35 mg, 0.08 mmol) in methanol (2 mL) was added 4N HCl/dioxane (2 mL). The solution was then stirred for 3h at room temperature and the solvent was removed under reduced pressure to provide a crude which was directly used in the next step. LCMS (m/z): 335 [M + H]+'
(R)-N-(4-(3-(5-(2-(5-tert-butyloxazol-2-yl)ethyl)thiazol-2-ylamino)piperidine-l- carbonyl)phenyl)acrylamide (MFH-3-116-1 ).
[00391] The mixture of (/?)-5-(2~(5-tert-butyloxazol-2-yl)ethyl)-N-(piperidin-3-yl)thiazol-2~ amine (23 mg, 0.07 mmol), 4-acrylamidobenzoic acid (15 mg, 0.08 mmol), HOBT (12 mg , 0.09 mmol) and EDCI (17 mg, 0.09 mmol) in DMF (0.5 ml) was stirred for overnight. The reaction mixture was purified by prep-HPLC (MeOH/¾0, 0.05%TFA) to provide MFH-3- 116-1 (5.5 mg, yield 16%). LCMS (m/z): 508 [M + U K 1H NMR (500 MHz, DMSO) δ 10.38 (s, 1H), 8.29 (d, J = 7.5 Hz, IH), 7.82 (d, J = 8.8 Hz, 2H), 7.74 (d, J = 8.8 Hz, 2H), 6.96 (s, 1H), 6.68 (s, 1H), 6.45 (dd, J = 17.0, 10.2 Hz, IH), 6.29 (dd, J = 17.0, 1.9 Hz, IH), 5.79 (dd, J = 10.1 , 1.9 Hz, IH), 3.87 (dd, J = 12.3, 4.0 Hz, I H), 3.75 - 3.63 (m, 2H), 3.13 - 2.99 (m, 4H), 2.96 (t, J= 6.8 Hz, 2H), 1.88 (m, 2H), 1.63 (m, 2H), 1.22 (s, 9H).
Figure imgf000174_0001
[00392] The mixture of (2-bromot iazol-5-yl)methanol (180 mg, 0.93 mmol), 1- (bromomethyl)-3-(trtfluoromethyl)benzene (288 mg, 1.2 mmol) and NaOH (67 mg, 1.67 mmol) in DMF (2 mL) was stirred at 120 °C for 3h. The residue was extracted with chloroform and iso-propanol (4:1). The organic phase was washed with brine (20 mL x 2) and dried over Na2S04. After removal of the solvent, the residue was purified by silica gel (PE/EA - 0-50%) to obtain MFH-3-111-1 (160 mg, yield 49%). LCMS (m z): 353 [M + H]+"
(R)-tert-butyl3-(5-((3-(trifluoromethyl)benzylox^
l~earboxylaie MFH-3-112-1)
[00393] The mixture of MFH-3-111-1 (160 mg, 0.34 mmol), (R)-tert-butyl 3- aminopiperidine-l-carboxylate (109 mg, 0.55 mmol) and D1EA (88 mg, 0.68 mmol) in NMP (1 mL) was stirred at 140 °C for overnight. The residue was extracted with chloroform and iso-propanol (4:1). The organic phase was washed with brine (20 mL χ 2) and dried over Na2S04. After removal of the solvent, the residue was purified by silica gel (MeOH/DCM = 0-20%) to obtain MFH-3-112-1 (35 mg, yield 22%). LCMS (m/z): 472 [M + H]+'
(R)- -(piperidiH~3~yI)~5~((3~(trifliioromethyI)benzy!oxy)methyl)thIaz(>!~2~amiBe (MFH- [00394J To a solution of MFH-3-112-1 (35 mg, 0.08 mmol) in methanol (2 mL) was added 4N HCl/dioxane (2 mL). The solution was then stirred for 3h at room temperature and the solvent was removed under reduced pressure to provide a crude which was directly used in the next step. LCMS (m/z): 372 [M + H]+'
(R)-N-(4-(3-(5-((3-(trifluoromethyl)benzy]o
carbonyl)phenyl)acrylamide (MFH-3-120-1).
[00395 J The mixture of MFH-3-119-1 (23 mg, 0.06 mmol), 4-acrylamidobenzoic acid (15 mg, 0.08 mmol), HOBT (12 mg , 0.09 mmol) and EDCI (17 mg, 0.09 mmol) in DMF (0.5 ml). Then the reaction mixture was stirred for overnight. The reaction mixture was purified by prep-HPLC (MeOH/H20, 0.05%TFA) to provide MFH-3-120-1 (8.7 mg, yield 26%). LCMS (m z): 545 [M + H i-. lH NMR (500 MHz, DMSO) δ 10.32 (s, 1H), 7.72 - 7.57 (m, 7H), 7.37 (d, J = 5.1 Hz, 3H), 6.47 - 6.40 (m, IH), 6.27 (dd, J = 16.6, 6.9 Hz, 1H), 5.77 (t, J = 8.3 Hz, H), 4.58 (d, J = 8.2 Hz, 2H), 4.56 (s, 2H), 3.78 (s, 3H), 3.20 (d, J = 6.7 Hz, 2H), 1.98 (s, IH), 1.76 (s, IH), 1.55 (m, 2H).
Figure imgf000175_0001
[00396] The mixture of (2-bromothiazol-5-yl)methanol (220 mg, 1.1 mmol), 5-tert-butyl-2- (chloromethyl)oxazole (256 mg, 1.5 mmol) and NaOH (82 mg, 2.04mmol) in DMF (2 mL) was stirred at 120 °C for 3h. The residue was extracted with chloroform and iso-propanol (4: 1). The organic phase was washed with brine (20 mL) and dried over Na2SC>4. After removal of the solvent, the residue was purified by silica gel (PE/EA = 0-50%) to obtain MFH-3-111-1 (170 mg, yield 45%). LCMS (m/z): 332 [M + H]+'
(R)-tert-butyl3-(5-(((5-tert-butyloxazol-2-yl)methoxy)methyl)thiazol-2- ylamino)piperidine-l-carboxylate (MFH-3-123-1)
[00397] The mixture of MFH-3-121-1 (170 mg, 0.51 mmol), (R)-tert-butyl 3- aminopiperidine-l-carboxylate (164 mg, 0.82 mmol) and DIEA (133 mg, 1 mmol) in NMP (1 mL) was stirred at 140 °C for overnight. The residue was extracted with chloroform and iso- propanol (4: 1). The organic phase was washed with brine (20 mL) and dried over Na2SC"4. After removal of the solvent, the residue was purified by silica gel (MeOH/DCM = 0-20%) to obtain MFH-3-123-1 (50 mg, yield 22%). LCMS (m/z): 451 [M + Hp
(¾)~5~(((5-teFt~butyi®xazei~2-y!)mei o
(MFH-3-126-1)
[00398] To a solution of MFH-3-123-1 (50 mg, 0.11 mmol) in methanol (2 mL) was added 4N HCi/dioxane (2 mL). The solution was then stirred for 3h at room temperature and the solvent was removed under reduced pressure to provide a crude which was directly used in the next step. LCMS (m/z): 372 [M + Hp
(¾)~N~(4~(3~(5~(((5-tert-b u i loxazol-^^
l-carbony])phenyl)acrylamide (MFH-3-128-1).
[00399] The mixture of MFH-3-126-1 (23 mg, 0.06 mmol), 4-acrylamidobenzoic acid (15 mg, 0.08 mmol), HOBT (12 mg , 0.09 mmol) and EDCI (17 mg, 0.09 mmol) in DMF (0.5 ml) was stirred for overnight. The reaction mixture was purified by prep-HPLC (MeOH/H20, 0,05%'TFA) to provide MFH-3-128-1 (7 mg, yield 22%). LCMS (m/z): 524 [M + H]+. Ή NMR (500 MHz, DMSO) δ 10.37 (s, 1H), 8.33 (d, J = 38.9 Hz, 1H), 7.84 (d, J = 8.5 Hz, 2H), 7.75 (d, J = 8.4 Hz, 2H), 7.37 (d, J === 8.3 Hz, 1H), 6.89 - 6.71 (m, 1 H), 6.46 (dd, ,/ === 16.9, 10.1 Hz, 1 H), 6.29 (d, J = 17.0 Hz, 1H), 5.80 (d, J = 10.0 Hz, lH), 4.59 - 4.40 (m, 2H), 4.05 (s, 1 1 1). 3.99 - 3.85 (m, 2H), 3.33 (dd, J = 31.2, 10.4 Hz, 2H), 3.00 (m, 2H), 1.93 (d, J = 15.1 Hz, 1H), 1.84 (s, 1H), 1.62 (s, 2H), 1.23 (s, 9H).
Figure imgf000177_0001
Figure imgf000177_0002
[00400] The mixture of MFH~2~82~1 (160 mg, 0.51 mmol), 5-tert-butyl-2- (chloromethyl)oxazole (89 mg, 0.51 mmol) and DIEA (132 mg, 1 mmol) in NMP (1 mL) was stirred at 80 °C for overnight. The solution was extracted with chloroform and iso-propanol (4:1 ). The organic phase was washed with brine (50 mL χ 2) and dried over Na2S04. After removal of the solvent, the residue was purified by silica gel (MeOH/DCM = 0-20%) to obtain MFH-3-90-1 (133 mg, yield 58%). LCMS (m z): 450 [M + Hf-
(R)-5-(((5-tert-butyloxa:2wl-2-yl)methy
(MFH-3-136-1)
[00401] To a solution of MFH-3-90-1 (60 mg, 0,13 mmol) in methanol (3 mL) was added 4N HCl/dioxane (3 mL). The solution was then stirred for 3h at room temperature and the solvent was removed under reduced pressure to provide a crude which was directly used in the next step. LCMS (m z): 350 [M + H]+'
(R)-N-(4-(3-(5-(((5-tert-b is tyloxazol-2-y l)m ethylamin o)methyl)thiazol-2- ylanuno)piperidine-l-carbonyl)phenyl)acrylamide (MFH-3-137-1).
[00402] The mixture of MFH-3-136-1 (30 mg, 0.09 mmol), 4-acrylamidobenzoic acid (17 mg, 0.09 mmol) and TEA (9 mg , 0.09 mmol) in DMF (1 ml). The reaction mixture was cooled to -60 °C, and HATU(33 mg, 0.09 mmol) was added in the reaction mixture. The reaction mixture was purified by prep-HPLC (MeOH/H20, 0.05%TFA) to provide MFH-3- 137-1 (18 nig, yield 38%), LCMS (m z): 523 [M + H]+. lH NMR (500 MHz, DMSO) δ 10.31 (s, IH), 8.79 - 8.59 (m, 2H), 8.10 - 7.97 (m, 1H), 7.69 (s, IH), 7.37 (s, I H), 7.13 (d, J = 6.5 Hz, IH), 6.96 (dd, J = 9.8, 4.5 Hz, IH), 6.78 (s, IH), 6.43 (d, J = 6.7 Hz, IH), 6.28 (s, IH), 5.79 (dd, J = 12.2, 4.2 Hz, IH), 4.31 is, 2H), 3.86 (s, 2H), 3.72 (s, 2H), 3.43 (d, J = 10.6 Hz, IH), 2.93 - 2.75 (m, 2H), 2.00 (d, J = 8.6 Hz, I H), 1.89 (d, J = 22.0 Hz, I H), 1.59 (m, 2H), 1.23 (s, 9H).
4N,HC:/dioxane
Figure imgf000178_0001
(R)-tert-butyl4-(3-(5-((5-tert-butyloxazoW
ylsulfonyl)phenylcarbamate (MFH-3-147-1).
[00403J The mixture of MFH-2-85-1 (60 mg, 0.17 mmol) and TEA (26 mg , 0.26 mmol) in DCM (1 ml) was cooled to 0 °C and then a solution of tert-butyl 4- (chlorosulfonyl)phenylcarbamate (50 mg, 0.17 mmol) in DCM (1 mL) was added. The reaction mixture was extracted with chloroform and iso-propanol (4: 1). The organic phase was washed with brine (50 mL) and dried over Na2S04. After removal of the solvent, the residue was purified by silica gel (MeOH/DCM = 0-20%) to obtain MFH-3-147-1 (80 mg, yield 78%). LCMS (m/z): 608 [M + H]+'
(R)-N-(l-(4-aminophenylsulfonyl)piperidin-3-yl)-5-((5-tert-butyloxazol-2- yl)methylthio)thiazol-2-amine (MFH-3-148-1)
[00404] To a solution of MFH-3-147-1 (80 mg, 0,13 mmol) in methanol (3 mL) was added 4N HCl/dioxane (3 mL). The solution was then stirred for 3h at room temperature and the solvent was removed under reduced pressure to provide a crude which was directly used in the next step. LCMS (m/z): 507 [M + H]+'
(R)-N-(4-(3-(5-((5-tert-butyloxazol-2-yl)methylthio)thiazol-2-ylamm
ylsulfonyl)phenyl)acrylamide (MFH-3-151-1)
[00405] To a solution of MFH-3-148-1 (30 mg, 0.06 iirxnol) and DIPEA (0.2 mL) in CH3CN (2 mL) was added acryloyl chloride (7 mg, 0.08 mmol) in DCM (0.2 mL) dropwise. The mixture was then stirred at 0°C for I h. The solution was then concentrated under reduced pressure and the residue was purified by prep-HPLC (MeOH/H20, 0,05%TFA) to provide MFH-3-151-1 (8.5 mg, yield 25%). LCMS (m z): 561 [M + H]+. :iH NMR (500 MHz, DMSO) δ 10.56 (d, J= 22.3 Hz, IH), 8.00 (d, J = 7.3 Hz, IH), 7.93 - 7.89 (m, IH), 7.87 (dd, J= 11.3, 4.4 Hz, IH), 7.83 - 7.75 (m, IH), 7.72 - 7.68 (m, IH), 6.98 (d, J = 2.7 Hz, H), 6.75 - 6.70 (m, IH), 6.51 - 6.42 (m, IH), 6.32 (ddd, = 17.0, 3.9, 1.9 Hz, IH), 5.83 (ddd, 10.1, 6.1, 1.9 Hz, IH), 3.96 (d, J = 3.8 Hz, 2H), 3.43 - 3.34 (m, IH), 3.25 (d, J = 11.8 Hz, IH), 3.07 - 2.93 (m, IH), 2.86 (dd, J = 12,6, 9.7 Hz, I H), 2.32 - 2.22 (m, I H), 1.77 (d, J = 6.7 Hz, IH), 1.67 (d, J = 3.5 Hz, IH), 1.52 (d, J = 10.2 Hz, IH), 1.34 (dd, J = 18.1, 10.1 Hz, IH), 1.24 - 1.16 (m, 9H).
Figure imgf000179_0001
tert-butyl 5~(benz lihio)mdoi™e~l~earboxylate
[00406] A mixture of tert-butyl 5-bromoindoline-l-carboxylate (600 mg, 2.02 mmo2),phenylmethanethio2 (276 mg, 2.22 mmol), Pd2(dba)3 (185 mg, 0,2 mmol), Xantphos (117 mg, 0.2 mmmol), and DIEA (783 mg, 6.06 mmol) in toluene (25 mL) was refluxed under N2 atmosphere for 5h. After cooling to room temperature, ethyl acetate (50 mL) and H20 (50 mL) were added to the mixture, and insoluble materials were removed by filtration. The filtrate was diluted with ethyl acetate (50 mL) and was washed with water, 0.2 M hydrochloric acid, aqueous NaHCi¾ solution, and brine. The organic layer was dried over Na2S04 and concentrated under reduced pressure. The residue was crystallized from AcOEt-i-Pr20 to give the title compound as a yellow solid (660 mg, 96%). LCMS (m/z): 342 [M + ! ί ]···. tert-but l 5-(cbJorosulfonyl)indoline-l-carboxylate (MFH-3-159-1).
[00407] To a mixture of compound MFH-3-158-1 (660 g, 1.94 mmol), acetic acid (6 mL) in water (3 mL) was added N-chlorosuccinimide (1.1 g, 7.74 mol) at 0 °C. The mixture was stirred at room temperature for 4 h. Precipitated solid was collected by filtration, washed with water and dried to give the title compound as a pale yellow solid (400 mg, 65%). This compound was used for the next step without further purification.
(R)-tert-butyl5-(3-(5-((5-tert-butyloxazo.^^
ylsulfonyl)indoline-l-carboxylate (MFH-3-162-1).
[00408] The mixture of MFH-2-85-1 (60 mg, 0.17 mmol) and TEA (26 mg, 0.26 mmol) in DCM (1 ml) was cooled to 0 °C and a solution of MFH-3-159-1 (54 mg, 0.17 mmol) in DCM (1 mL) was added. And reaction completed, the reaction mixture was extracted with chloroform and iso-propanol (4:1). The organic phase was washed with brine (50 mL) and dried over Na2S04. After removal of the solvent, the residue was purified by silica gel (MeOH/DCM - 0-20%) to obtain MFH-3-162-1 (82 mg, yield 76%). LCMS (m/z): 634 [M + Η]+·
( )-5~((5-tert~bi5tyloxazol~2~yI)methylthio)-N-(l-(!!id0liM~5~ylsiilfoMyI)piperidiii-3- yl)thiazol-2-amine (MFH-3-164- )
[00409] To a solution of MFH-3-162-1 (82 mg, 0.13 mmol) in methanol (3 mL) was added 4N HCl/dioxane (3 mL). The solution was then stirred for 3h at room temperature and the solvent was removed under reduced pressure to provide a crude which was directly used in the next step. LCMS (m/z): 534 [M + H]+'
(R)-l~(5~(3~(5~((5~tert~biityloxazol~2~yl)methyitbio)tMazoI~2~ylamtao)plpes"idisi-l- ylsulfonyl)indolin-l-yl)prop-2-en-l-one (MFH-3-168-1)
[00410] To a solution of MFH-3-164-1 (20 mg, 0.04 mmol) and DIPEA (0.1 mL) in CH3CN (2 mL) was added acryloyl chloride (5 mg, 0.05 mmol) in DCM (0.1 mL) dropwise. The mixture was then stirred at 0°C for Ih. The solution was then concentrated under reduced pressure and the residue was purified by prep-HPLC (MeOH/H20, 0.05%TFA) to provide MFH-3-168-1 (5 mg, yield 23%). LCMS (m z): 588 [M + H]+. lH NMR (500 MHz, DMSO) δ 8.29 (s, 1 H), 7.94 (d, J - 7.4 Hz, III), 7.57 (dd, J = 12.2, 3.8 Hz, 2H), 6.96 (s, IH), 6.81 - 6.74 (m, I H), 6.74 (s, I H), 6.35 (dd, J = 16.7, 2.0 Hz, IH), 5.89 (dd, J = 10.3, 2.0 Hz, IH), 4.29 (t, J = 8.7 Hz, 2H), 3.96 (s. 2H), 3.69 (s. IH), 3.55 (d, J = 8.0 Hz, IH), 3.25 (t, J = 8.4 Hz, 3H), 2.31 - 2.24 (m, IH), 2.18 (t, J = 7.4 Hz, IH), 1.77 (d, J = 6.6 Hz, 2H), 1.49 (dd, J = 17.4, 10.0 Hz, 2H), 1.24 (s, 913).
[-3-179-1
Figure imgf000181_0001
Figure imgf000181_0002
5~(pyridisi~4-yImethyItMo)tliiaz0l~2-afflMe (¾
[00 11] To a solution of compound MFH-2-76-1 (300 nig, 1.91 mrnol) in EtOH (5 ml) was added NaBH4 (144 mg, 3.82 mrnol) room temperature. The mixture was stirred for lh, and then acetone (3 ml) was slowly introduced. After lh, a solution of 4-(bromomethyl)pyridine hydrobromide (483 mg, 1.91 mrnol) in EtOH (3 ml) was added. The resulting dark reaction mixture was heated to reflux for lh, and was then cooled and concentrated in vacuo. The residue was partitioned between EtOAc and brine. The organic phase was separated, dried (MgSQ4), and concentrated in vacuo to give a crude solid which was triturated with diethyl ether/hexane to provide compound MFH-3-146-1 (240 mg, 56%) as solid LCMS (m/z): 224 [M - H] -.
2-bromo-5-(pyridin-4-ylmethyltliio)thiazole (MFH-3-153-1)
[00412] To a solution of CuBr2 (288 mg, 1,29 mrnol) in acetonitrile (8 mL) at 0°C was added t-BuONO (133 mg, 1.29 mrnol) followed by compound MFH-3-146-1 (240 g,1.08 mrnol). The mixture was stirred at 0°C for one hour, then at room temperature for one hour. Ethyl acetate was added and the organic mixture washed with hydrochloric acid (20 mL), dried over magnesium sulfate, iiltered through a pad of silica gel, and concentrated in vacuo. The residue was chromatographed on silica gel to give the MFH-3-153-1 (130 mg, 42%). LCMS (m/z): 288 [M + H]
(R)-tert-butyl3-(5-(p!^
(MFH-3-1S6-1)
[00413] The mixture of MFH-3-153-1 (130 mg, 0.45 mmol), (R)-tert-butyl 3- aminopiperidine-l -carboxylate (145 mg, 0.72 mmol) and DIEA (117 mg, 0.91 mmol) in NMP (1 mL) was stirred at 140 °C for overnight. The residue was extracted with chloroform and iso-propanol (4: 1). The organic phase was washed with brine (20 mL) and dried over Na2S04. After removal of the solvent, the residue was purified by silica gel (MeOH/DCM = 0-20%) to obtain MFH-3-156-1 (90 mg, yield 49%). LCMS (m/z): 407 [M + H]+'
(R)-N-(piperidMi-3-y!)~5~(pyridiH-4-ylmethylt o)i!iiazol~2~amisie (MFH-3-157-1)
[00414] To a solution of MFH-3-156-1 (90 mg, 0.22 mmol) in methanol (2 mL) was added 4N HCl/dioxane (2 mL). The solution was then stirred for 3h at room temperature and the solvent was removed under reduced pressure to provide a crude which was directly used in the next step. LCMS (m z): 307 [M + Η]+·
(R)-tert-b ityI4-(3-(5-(pyridiH-4-ylMiet!iylt o)tMazoI-2-yIamiiio)plperidlMe-l- carbonyl)phenylcarbamate (MFH-3-177-1).
[00415] The mixture of MFH-3-157-1 (60 mg, 0.2 mmol), 4-(tert- butoxycarbonylamino)benzoic acid (15 mg, 0.08 mmol), HOBT (12 mg , 0.09 mmol) and EDCI (60 mg, 0,26 mmol) in DMF (1 ml) was stirred for overnight. The reaction mixture was diluted with chloroform and iso-propanol (4: 1). The saturated Na2C03 was added and the reaction mixture was extracted with chloroform and iso-propanol (4:1), concentrated under reduced pressure and the resulting residue was purified by silica gel column chromatography (MeOH/DCM === 0-20%) to give MFH-3-177-1 (90 mg, yield 86%). LCMS (m/z): 526 [M + H]+.
( )-(4~amiMopheMyl)(3-(5-(pyridisi~4-yImethylthi0)tMazoI-2-yIamiiio)pipeddiM-l- yl)methanone (MFH-3-178-1)
[00416] To a solution of MFH-3-177-1 (90 mg, 0.17 mmol) in methanol (2 mL) was added 4N HCl/dioxane (2 mL). The solution was then stirred for 3h at room temperature and the solvent was removed under reduced pressure to provide a crude which was directly used in the next step. LCMS (m/z): 426 [M + Hp (R)-N-(4-(3-(5-^yridin-4-ylmethy]thio)thiazol-2-ylamino)piperidine-l- carbooyl)pheiiyl)acryIaiiiide (MFH-3-179-1)
[00417] To a solution of MFH-3-178-1 (40 mg, 0.09 mmol) and DiPEA (0.2 mL) in CH3CN (2 mL) was added acryloyl chloride (1 1 mg, 0.12mmol) in DCM (0.1 mL) dropwise. The mixture was then stirred at 0°C for Ih. The solution was then concentrated under reduced pressure and the residue was purified by prep-HPLC (MeOH/ILO, 0.05 %TFA) to provide MFH-3-179-1 (4.4 mg, yield 10%). LCMS (m/z): 480 [M + H]+. lH NMR (500 MHz, DMSO) δ 10.30 (s, IH), 8.06 (s, 1H), 7.85 (s, 2H), 7.68 (s, 2H), 7.36 (s, 2H), 7.25 - 7.02 (m, 2H), 6.80 (s, IH), 6.49 - 6.37 (m, IH), 6.27 (d, J= 16.9 Hz, IH), 5.77 (d, J = 10.1 Hz, IH), 4.12 (s, IH), 3.99 (s, 2H), 3.43 - 3.31 (m, 2H), 3.14 (d, J= 28.5 Hz, 2H), 1.95 (s, IH), 1.76 (s, IH), 1.55 (s, 2H).
Figure imgf000183_0001
Figure imgf000183_0002
5-(pyridin-3-ylmethylthio)thiazol-2-amine (MFH-3-171-1)
[00418J To a solution of compound MFH-2-76-1 (300 mg, 1.91 mmol) in EtOH (5 ml) was added aBH4 (144 mg, 3.82 mmol) portionwise at room temperature. The mixture was stirred for ih, and then acetone (3 ml) was slowly introduced. After Ih, a solution of 3- (bromomethyl)pyridine hydrobromide (483 mg, 1.91 mmol) in EtOH (3 mL) was added. The resulting dark reaction mixture was heated to reflux for ih, and was then cooled and concentrated in vacuo. The residue was partitioned between EtOAc and brine. The organic phase was separated, dried (MgS04), and concentrated in vacuo to give a crude solid which was triturated with diethyl ether/hexane to provide compound MFH-3-171-1 (310 mg, 73%) LCMS (m/z): 224 [M + H]+. 2~bromo~5~(pyrMm~3-ylmei ylt e)tMazole (MFH-3-180-1)
[00419] To a solution of CuBr2 (370 mg, 1.66 mmol) in acetonitrile (20 mL) at 0°C was added t-BuONO (172 mg, 1,66 mmol) followed by compound MFH-3-171-1 (310 mg, 1.39 mmol). The mixtui'e was stirred at 0°C for one hour, then at room temperature for one hour, ethyl acetate was added and the organic mixture washed with hydrochloric acid (2x50 mL), dried over magnesium sulfate, filtered through a pad of silica gel, and concentrated in vacuo. The residue was chromatographed on silica gel to give the MFH-3-180-1 (288 mg, 72%). LCMS (m/z): 288 [M + H]+.
(R)-tert-bHtyI3-(5-(pyridiH-3-ylmetIiyIt!iio)tfiiazol-2-ylamiMo)piperMiHe-l-carboxylate (MFH-3-182-1)
[00420] The mixture of MFH-3-180-1 (288 mg, 1 mmol), (R)-tert-butyl 3-aminopiperidine- 1-carboxylate (320 mg, 1.6 mmol) and DIEA (194 mg, 1.5 mmol) in NMP (1 mL) was stirred at 140 °C for overnight. The residue was extracted with chloroform and iso-propanol (4: 1). The organic phase was washed with brine (20 mL) and dried over Na2S04. After removal of the solvent, the residue was purified by silica gel (MeOH DCM = 0-20%) to obtain MFH-3- 182-1 (180 mg, yield 44%). LCMS (m/z): 407 [M + H]+'
(R)-N-(piperidMi-3-y!)~5~(pyridiH-3-ylmethylt o)i!iiazol~2~amisie (MFH-3- 85-1)
[00421] To a solution of MFH-3-182-1 (1 80 mg, 0.44 mmol) in methanol (3 mL) was added 4N HCl/dioxane (3 mL). The solution was then stirred for 3h at room temperature and the solvent was removed under reduced pressure to provide a crude which was directly used in the next step. LCMS (m z): 307 [M + H]+'
(R)-(4-MitropheoyI)(3-(5-(pyrldiM-"3~yImethyIthio)t!iiaz(>I-2-ylamiMo)piperidiM-l- yl)methanone (MFH-3-186-1)
[00422] The mixture of MFH-3-185-1 (120 mg, 0.39 mmol), 4-nitrobenzoyl chloride (72 mg, 0.39 mmol) in pyridine (2 mL) was stirred for overnight at room temperature. Then the reaction mixture was concentrated under reduced pressure and the residue was directly used in the next step. LCMS (m/z): 456 [M + H]"K ( )-(4~amiMopheMyl)(3-(5-(pyridisi~3-yImethylthi0)tMazoI-2-yIamiiio)pipeddiM-l- yl)methanone (MFH-3-187-1)
[00423] To a solution of MFH-3-186-1 (178 mg, 0.39 mmol) in ethyl acetate and methanol (1:1) were added Tin(II) chloride dehydrate (881 mg, 3.9 mmol) and cone. HC1 (0.2 mL). After stirring for 3 h at 80 °C, the reaction mixture was diluted with chloroform and iso- propanol (4: 1), neutralized with saturated NaHCOs and filtered. The filtrate was extracted with chloroform and iso-propanol (4:1), concentrated under reduced pressure and the resulting residue was purified by silica gel column chromatography (MeOH DCM === 0-20%) to give MTH-3-187-1 (20 mg, yield 12%). LCMS (m/z): 426 [M + H]+.
(R)-N-(4-(3-(5-(pyridiii-3-ylMiet!iylt o)tMazol-2-yIamiiio)piperidlMe-l- carbonyl)phenyl)acrylamide (MFH-3-1 1-1)
[00424] To a solution of MFH-3-187-1 (20 mg, 0.05 mmol) and DIPEA (0.1 mL) in CH3CN (2 mL) was added acryloyl chloride (6 mg, 0.06mmol) in DCM (0.5 mL) dropwise. The mixture was then stirred at 0°C for lh. The solution was then concentrated under reduced pressure and the residue was purified by prep-HPLC (MeOH/H20, 0.05%TFA) to provide MFH-3-1 1-1 (6 mg, yield 26%). LCMS (m/z): 480 [M + H]+. lH NMR (500 MHz, DMSO) δ 10.30 (s, 1H), 8.58 (d, J = 53.1 Hz, 2H), 8.00 (d, J = 44.0 Hz, 2H), 7.78 - 7.62 (m, 2H), 7.40 (d, J === 29.7 Hz, 2H), 7.14 (dd, J === 67.0, 35.1 Hz, 1H), 6.82 (s, 1H), 6.43 (dd, ,/ 17.4, 10.0 Hz, 1H), 6.28 (t, J = 12.8 Hz, 1H), 5.84 - 5.74 (m, IH), 4.04 (s, 1H), 3.98 (s, 2H), 3.31 (s, 2H), 3.17 (s, 2H), 1.96 (s, H), 1.75 (s, H), 1.54 (s, 2H).
Figure imgf000185_0001
(lR^R)-3-(4-nitro-2-(trifluoromethyl)phenoxy)cyclohesanamine (MFH-3-166-1)
[00425] To a solution of compound (l R,3R)-3-aminocyclohexanol hydrochloride (120 mg, 0.8 mmol) in absolute DMF (1 ml) was added NaH (130 mg, 3.3 mmol) portionwise at 0 °C. The mixture was stirred for Ih, and then l-fluoro-4-nitro-2-(trifluoromethyl)benzene (170 mg, 0,8 mmol) was slowly introduced. After 3h, the water was added slowly. The residue was extracted with chloroform and iso-propanol (4:1). The organic phase was washed with brine (20 mL x 2) and dried over Na2S04. After removal of the solvent, the residue was purified by silica gel (MeOH/DCM === 0-20%) to obtain MFH-3-166-1 (50 ing, yield 20%). LCMS (m/z): 305 [M + ! IJ ·
5-((5-tert-butyloxazol-2-yI)methylthio)-N-((lR,3R)-3-(4-iiitro-2- (trifluoromethyl)phenoxy)cyclohexyl)thiazol-2-amine (MTH-3-183-1)
[00426] The mixture of MFH-2-83-1 (55 mg, 0.16 mmol), MFH-3-166-1 (50 mg, 0.16 mmol) and D1EA (32 mg, 0.25 mmol) in NMP (0.5 mL) was stirred at 140 °C for overnight. The residue was extracted with chloroform and iso-propanol (4:1). The organic phase was washed with brine (20 mL χ 2) and dried over Na2S04. After removal of the solvent, the residue was purified by silica gel (MeOH/DCM = 0-20%) to obtain MFH-3-183-1 (28 mg, yield 31%). LCMS (m z): 557 [M + H]+ ~((lM. R)~3-(4-amiHO~2~(triOooromethyl)pheHoxy)eyci©!iexyl)~5~((5-tert~butyloxaz(>l~2- yl)methyltblo)tbJazol-2-amine (MFH-3-188-1)
[00427] To a solution of MFH-3-183-1 (28 mg, 0.05 mmol) in ethyl acetate and methanol (1:1 ) were added Tin(II) chloride dehydrate (113 mg, 0.5 mmol) and cone. HC1 (0,1 mL). After stirring for 3 h at 80 °C, the reaction mixture was diluted with chloroform and iso- propanol (4: 1), neutralized with saturated NaHC03 and filtered. The filtrate was extracted with chloroform and iso-propanol (4:1), concentrated under reduced pressure and the resulting residue was purified by silica gel column chromatography (MeOH/DCM = 0-20%) to give MFH-3-188-1 (20 mg, yield 75%). LCMS (m/z): 527 [M + H]+.
N-(4-((lRy3R)-3-(5-((5-tert-butyloxazol-2-yl)methylthio)thiazol-2- y]amino)cyclohexyloxy)-3-(trifluoromethy])pheny])acrylamide (MFH-3-192-1)
[00428] To a solution of MFH-3-188-1 (20 mg, 0.04 mmol) and D1PEA (0.1 mL) in CH3CN (2 mL) was added acryloyl chloride (5 mg, 0.05 mmol) in DCM (0.1 mL) dropwise. The mixture was then stirred at 0°C for lh. The solution was then concentrated under reduced pressure and the residue was purified by prep-HPLC (MeOH/H20, 0.05%TFA) to provide MFH-3-192-1 (5.4 mg, yield 24%). LCMS (m/z): 581 [M + H]+. !H NMR (500 MHz, DMSO) δ 10.27 (s, I H), 8.04 (t, J = 5.4 Hz, 2H), 7,82 (dd, J = 9.0, 2.5 Hz, IH), 7.25 (t, J = 8.1 Hz, IH), 6.95 (d, J === 5.6 Hz, I II), 6.70 (d, J 7.3 Hz, 1H), 6.39 (dd, J === 17.0, 10.1 Hz, I H), 6.26 (dd, J= 17.0, 2.0 Hz, IH), 5.77 (dd, J= 10.1 , 2.0 Hz, I H), 4.92 (s, I H), 3.93 (d, J = 0.8 Hz, 2H), 2.10 (d, J = 14.5 Hz, I H), 1.93 (d, J = 14.3 Hz, IH), 1.79 (s, IH), 1.65 (dd, J = 22.7, 11.5 Hz, 2H), 1.59 (s, 2H), 1.32 (m, IH), 1.23 (dd, J = 11.2, 6.2 Hz, IH), 1.17 (s, 9H).
Figure imgf000187_0001
5~((2-(triOHoromethy!)pyrimidi¾~5~yl)methylthio)thiazol~2-amlBe (MFH-3-184-1)
[00429] To a solution of compound MFH-2-76-1 (300 mg, 1.91 mmol) in absolute EtOH (5 ml) was added NaBH4 (144 mg, 3.82 mmol) at room temperature. The mixture was stirred for lh, and then acetone (3 ml) was slowly introduced. After I h, a solution of 5-(chloromethyl)- 2-(trifluoromethyl)pyrimidine (375 mg, 1.91 mmol) in EtOH (3 ml) was added. The resulting dark reaction mixture was heated to reflux for lh, and was then cooled and concentrated in vacuo. The residue was partitioned between EtOAc and brine. The organic phase was separated, dried (MgS04), and concentrated in vacuo to give a crude solid which was triturated with diethyl ether/hexane to provide compound MFH-3-184-1 (500 mg, 90%) LCMS (m/z): 293 [M + Ϊ Π-.
2-bromo-5-((2-(trifluoromethyl)pyrimidin-5-yl)methyltliio)tIiiazole (MFH-3-189-1)
[00430] To a solution of CuBr2 (458 mg, 2,05 mmol) in acetonitrile (15 mL) at 0°C. was added t-BuONO (211 mg, 2.05 mmol) followed by compound MFH~3~184~1 (500 mg,1 .71 mmol). The mixture was stirred at 0°C for one hour, then at room temperature for one hour. Ethyl acetate was added and the organic mixture was washed with hydrochloric acid (50 mL), dried over magnesium sulfate, filtered through a pad of silica gel, and concentrated in vacuo. The residue was chromatographed on silica gel to give the MFH~3~189-1 (430 mg, 70%). LCMS (m/z): 357 [M + H]+. (R)-tert-butyB-(5-((2-(trifluoromethyl)pyrimidin-5-yl)methylthio)th
ylamino)piperidine-l-carboxylate (MFH-3-190-1)
[00431] The mixture of MFH-3-189-1 (430 mg, 1.21 mmol), (R)-tert-butyl 3- aminopiperidine-l-carboxylate (362 mg, 1.81 mmol) and DIEA (312 mg, 2.4 mmol) in NMP (1 mL) was stirred at 140 °C for overnight. The residue was extracted with chloroform and iso-propanol (4:1). The organic phase was washed with brine (20 mL) and dried over Na2S04. After removal of the solvent, the residue was purified by silica gel (MeOH/DCM = 0-20%) to obtain MFH-3-190-1 (380 mg, yield 66%). LCMS (m/z): 476 [M + H]+-
(R)-N-(piperidin-3-yl)-5-((2-(trifluoromethyl)pyrimidin-5-yl)methyltU^
(MFH-3-19 -1)
[00432] To a solution of MFH-3-190-1 (380 mg, 0.8 mmol) in methanol (5 mL) was added 4N HCl/dioxane (5 mL). The solution was then stirred for 3h at room temperature and the solvent was removed under reduced pressure to provide a crude which was directly used in the next step. LCMS (m/z): 376 [M + Η]+·
(R)-(4-MitropIieHyI)(3-(5-((2-(triitaorometIiyI)pyrimidiH-5-yI)met!iylt o)tMazoI-2- ylamino)piperidiii-l-yl)iiiethanone (MFH-3-195-1).
[00433] The mixture of MFH-3-194-1 (230 mg, 0.61 mmol), 4-nitrobenzoy] chloride (113 mg, 0.61 mmol) in pyridine (2 mL) was stirred for overnight at room temperature. Then the reaction mixture was concentrated under reduced pressure and the residue was directly used in the next step. LCMS (m/z): 525 [M + H]+'
(R)-(4-aMiiHopheiiyl)(3-(5-((2-(trifl«oromethyl)pyrimidiM-5-yI)met!iyltIiio)tMazoI-2- y]amino)piperidin-l-yl)methaiioiie (MFH-3-198-1)
[00434] To a solution of MFH-3-195-1 (280 mg, 0.53 mmol) in ethyl acetate and methanol (1 :1) were added Tin(II) chloride dehydrate (965 mg, 4.27 mmol) and cone. HC1 (0.2 mL). After stirring for 3 h at 80 "C, the reaction mixture was diluted with chloroform and iso- propanol (4: 1), neutralized with saturated NaHC(¾ and filtered. The filtrate was extracted with chloroform and iso-propanol (4:1 ), concentrated under reduced pressure and the resulting residue was purified by silica gel column chromatography (MeOH/DCM = 0-20%) to give MFH-3-198-1 (200 mg, yield 76%). LCMS (m/z): 495 [M + H]+. ylamino)piperidine-l-carbonyl)phenyl)acrylamide ( ΓΗ-3-201-1)
[00435] To a solution of MFH-3-1 8-1 (40 mg, 0.08 mmol) and DIPEA (0.1 mL) in CH3CN (2 mL) was added acryloyi chloride (10 mg, 0.1 mmol) in DCM (0,2 mL) dropwise. The mixture was then stirred at 0°C for lh. The solution was then concentrated under reduced pressure and the residue was purified by prep-HPLC (MeOH H20, 0.05%TFA) to provide MFH-3-201-1 (9.8 mg, yield 22%). LCMS (m/z): 549 [M + H]+. ¾ NMR (500 MHz, DMSO) δ 10.26 (s, IH), 8.81 (s, 2H), 8.11 (s, IH), 7.79 - 7.59 (in, 2H), 7.38 (t, J = 13.1 Hz, 2H), 6.99 - 6.73 (m, I H), 6.50 - 6.35 (m, I H), 6.34 - 6.17 (m, 1 H), 5.80 (m, IH), 4.01 (s, 2H), 3.81 - 3.73 (m, 3H), 3.45 - 3.20 (m, 2H), 1.94 (d, J = 18.7 Hz, IH), 1.78 (m, IH), 1.54 (s, 2H).
Figure imgf000189_0001
[00436] To a solution of compound MFH-2-76-1 (300 mg, 1.91 mmol) in absolute EtOH (5 ml) was added NaBI !.¾ ( 144 mg, 3.82 mmol) portionwise at room temperature. The mixture was stirred for lh, and then acetone (3 ml) was slowly introduced. After lh, a solution of 2- (chloromethyl)pyridine hydrochloride (313 mg, 1.91 mmol) in EtOH (3 ml) was added. The resulting dark reaction mixture was heated to reflux for lh, and was then cooled and concentrated in vacuo. The residue was partitioned between EtOAc and brine. The organic phase was separated, dried (MgS04), and concentrated in vacuo to give a crude solid which was triturated with diethyl ether/hexane to provide compound MFH-3-170-1 (260 mg, 61%) LCMS (m/z); 224 [M + U K 2-bromo-5-(pyridiii-2-ylmethylthio)thiazole (MFH-3-176-1)
[00437] To a solution of CuBr2 (313 mg, 1.4 mmol) in acetonitrile (20 mL) at 0°C was added t-BuONO (144 mg, 1.4 mmol) followed by compound MFH-3-170-1 (260 mg, 1.16 mmol). The mixture was stirred at 0°C for one hour, then at room temperature for one hour. Ethyl acetate was added and the organic mixture washed with hydrochloric acid (2x50 mL), dried over magnesium sulfate, filtered through a pad of silica gel, and concentrated in vacuo. The residue was chromatographed on silica gel to give the MFH-3-176-1 (90 mg, 27%). LCMS (m/z): 288 [M + H i-.
(R)-tert-butyB-(5-(pyridin-2-ylmethylthio)thiazo]-2-ylainino)piperi
(MFH-3-196-1)
[00438] The mixture of MFH-3-176-1 (180 mg, 0.63 mmol), (R)-tert-hutyl 3- aminopiperidine-l -carboxylate (200 mg, 1 mmol) and DIEA (162 mg, 1.3 mmol) in NMP (1 mL) was stirred at 140 °C for overnight. The residue was extracted with chloroform and iso- propanol (4:1). The organic phase was washed with brine (20 mL) and dried over Na2S04. After removal of the solvent, the residue was purified by silica gel (MeOH/DCM = 0-20%) to obtain MFH-3-196-1 (120 mg, yield 47%). LCMS (m/z): 407 [M + H]+'
(R)-N-(piperidin-3-yl)-5-(pyridin-2-ylmethyltUo)tblazol-2-amiiie (MFH-3-197-1)
[00439] To a solution of MFH-3-196-1 (120 mg, 0.3 mmol) in methanol (3 mL) was added 4N HCl/dioxane (3 mL). The solution was then stirred for 3h at room temperature and the solvent was removed under reduced pressure to provide a crude which was directly used in the next step. LCMS (m/z): 307 [M + H]+ '
(RH4-nitrophenyl)(3-(5 pyrid^^
yl)methanone (MFH-3-199-1)
[00440] The mixture of MFH-3-197-1 (80 mg, 0.26 mmol), 4-nitrobenzoyl chloride (48 mg, 0.26 mmol) in pyridine (2 mL) was stirred for overnight at room temperature. Then the reaction mixture was concentrated under reduced pressure and the residue was directly used in the next step. LCMS (m/z): 456 [M + H]+'
(R)-(4-aminophenyl)(3-(5-(pyridin-2-ylmeth^
yl)methanone (MFH-3-200-1)
[00441] To a solution of MFH-3-199-1 (118 mg, 0.261 mmol) in ethyl acetate and methanol (1:1 ) were added Tin (II) chloride dehydrate (472 mg, 2.1 mmol) and cone. HC1 (0.2 mL). After stirring for 3 h at 80 °C, the reaction mixture was diluted with chloroform and iso- propanol (4: 1 ), neutralized with saturated NaHCCh and filtered. The filtrate was extracted with chloroform and iso~propanol (4: 1), concentrated under reduced pressure and the resulting residue was purified by silica gel column chromatography (MeOH/DCM = 0-20%) to give MFH-3-200-1 (60 mg, yield 54%). LCMS (m/z): 426 [M + Ϊ Π-.
(R)-T -(4-(3-(5-(pyridiM-3-yImet!iyltMo)tMazoI-2-ylamiiio)piperidiHe-l- carbonyl)pheny])acrylamide (MFH-3-191-1)
[00442] To a solution of MFH-3-187-1 (40 mg, 0.1 mmol) and DIPEA (0.1 mL) in CH3CN
(2 mL) was added acryloyl chloride (12 mg, 0.12 mmol) in DCM (0.2 mL) dropwise. The mixture was then stirred at 0°C for Ih. The solution was then concentrated under reduced pressure and the residue was purified by prep-HPLC (MeOH/H20, 0.05%TFA) to provide MFH-3-203-1 (8.4 mg, yield 19%). LCMS (m/z): 480 [M + H]+. 1H NMR (500 MHz, DMSO) δ 10.30 (s. IH), 8.62 (s, I H), 8.06 (d, J = 50.5 Hz, 2H).. 7.72 (d, J = 21.6 Hz, 2H).. 7.51 (s, 2H), 7.37 (s, 2H), 6.86 is, IH), 6.44 (dd, J = 17.1, 10.2 Hz, IH), 6.27 (d, J = 16.9 Hz, I H), 5.85 - 5.74 (m, I H). 4.04 (s, I H), 3.98 (s, 2H), 3.31 (s, 2H), 3.17 (s, 2H), 1.96 (s, IH), 1.75 (s, I H), 1.54 (s, 2H).
Figure imgf000191_0001
Figure imgf000191_0002
5-((tetrahydro-2H^yran^-yl)methyltbJo)thiazol-2-amiiie (MFH-3-202-1)
[00443 J To a solution of compound MFH-2-76-1 (194 mg, 1.23 mmol) in absolute EtOH (4ml) was added NaBH4 (93 mg, 2.47 mmol) at room temperature. The mixture was stirred for lh, and then acetone (2 ml) was slowly introduced. After Ih, a solution of 4- (bromomethyl)-tetrahydro-2H-pyran (221 mg, 1,23 mmol) in EtOH (2 mi) was added. The resulting dark reaction mixture was heated to reflux for lh, and was then cooled and concentrated in vacuo. The residue was partitioned between EtOAc and brine. The organic phase was separated, dried (MgS04), and concentrated in vacuo to give a crude solid which was triturated with diethyl ether/hexane to provide compound MFH-3-202-1 (250 mg, 88%) LCMS (m/z): 231 [M ÷ H]÷.
2- bromo-5-((tetrahydro-2H-pyran-4-yl)raethylthio)thiazole (MFH-3-204-1)
[00444] To a solution of CuBr2 (290 mg, 1.3 mmol) in acetonitrile (15 mL) at 0°C was added t-BuONO (175 mg, 1.3 mmol) followed by compound MFH-3-202-1 (250 mg, 1.1 mmol). The mixture was stirred at 0°C for one hour, then at room temperature for one hour, ethyl acetate was added and the organic mixture washed with hydrochloric acid (2x30 mL), dried over magnesium sulfate, filtered through a pad of silica gel, and concentrated in vacuo. The residue was chromatographed on silica gel to give the MFH-3-204-1 (160 mg, 50%). LCMS (m/z): 295 [M + H]+.
(R)-tert-bistyl3-(5-((tetrahydro-2H-pyra!i-4-yI)methyltMo)t azoI-2-ylamiiio)piperidiiie- l-carboxylate (MFH-3-205-1)
[00445] The mixture of MFH-3-204-1 (160 mg, 0.54 mmol), (R)-tert-butyl 3- aminopiperidine-l-carboxylate (174 mg, 0.87 mmol) and DIEA (112 mg, 0.87 mmol) in NMP (0.5 mL) was stirred at 140 °C for overnight. The residue was extracted with chloroform and iso-propanol (4:1). The organic phase was washed with brine (20 mL * 2) and dried over Na2S04. After removal of the solvent, the residue was purified by silica gel (MeOH/DCM = 0-20%) to obtain MFH-3-205-1 (120 mg, yield 53%). LCMS (m/z): 414 [M
(M)~N~(plperidlo~3~yl)~5-((tetrabydro-2H~pyraii~4~yl)methyitbio)tMaz0l~2~afflioe (MFH-
3- 206-1)
[00446] To a solution of MFH-3-205-1 (120 mg, 0.3 mmol) in methanol (3 mL) was added 4N HCl/dioxane (3 mL). The solution was then stirred for 3h at room temperature and the solvent was removed under reduced pressure to provide a crude which was directly used in the next step. LCMS (m/z): 314 [M + H]+'
(R)-(4-nitrophenyl)(3-(5-((tetrahydro-2H-pyran-4-yl)methylthio)thiazol-2- ylamino)piperidin-l-yl)methanone (MFH-3-207-1)
[00447] The mixture of MFH-3-206-1 (80 mg, 0.26 mmol), 4-nitrobenzoyl chloride (48 mg, 0.26 mmol) in pyridine (2 mL) was stirred for overnight at room temperature. Then the reaction mixture was concentrated under reduced pressure and the residue was directly used in the next step. LCMS (m/z): 463 [M + H]"K
(R)-(4-amloopheiiyl)(3~(5~((tetrahydro-2H-pyrao-4~yl)methj thio)thiazol-2- ylamino)piperidin-l-yl)methanone (MFH-4-2-1)
[00448] To a solution of MFH-3-207-1 (120 mg, 0.26 mmol) in ethyl acetate and methanol (1:1) were added Tin(II) chloride dehydrate (472 mg, 2.1 mmol) and cone. HC1 (0.2 mL). After stirring for 3 h at 80 °C, the reaction mixture was diluted with chloroform and iso- propanol (4: 1), neutralized with saturated NaHC03 and filtered. The filtrate was extracted with chloroform and iso-propanol (4:1), concentrated under reduced pressure and the resulting residue was purified by silica gel column chromatography (MeOH/DCM = 0-20%) to give MFH-4-2-1 (60 mg, yield 54%). LCMS (m/z): 433 [M + H]+.
(R)-N-(4-(3-(5-((tetrahydro-2H-pyran-4-yl)methy^
carboiiyl)p!ieiiyl)acryIamide (MFH-4-4-1)
[00449] To a solution of MFH-4-2-1 (30 mg, 0.07 mmol) and DIPEA (0.1 mL) in CH3CN (2 mL) was added acryloyl chloride (8 mg, 0.09 mmol) in DCM (0.1 mL) dropwise. The mixture was then stirred at 0°C for Ih. The solution was then concentrated under reduced pressure and the residue was purified by prep-HPLC (MeOH/H20, 0.05%TFA) to provide MFH-4-4-1 (4.6 mg, yield 13%). LCMS (m/z): 487 [M + H]+. !H NMR (500 MHz, DMSO) δ 10.32 (d, J = 28.3 Hz, H), 8.07 (s, IH), 7.77 - 7.62 (m, 2H), 7.40 (dd, J = 32.0, 7.9 Hz, 2H), 7.15 - 6.93 (m, IH), 6.45 (dd, J = 17.0, 10.1 Hz, IH), 6.28 (dd, J = 17.0, 1.9 Hz, IH), 5.79 (dd, J - 10.1, 1.9 Hz, IH), 3.83 (d, J = 9.4 Hz, 2H), 3.62 (s, 4H), 3.24 (t, J 11.1 Hz, 2H), 3.11 (s, IH), 2.58 (d, J - 6.4 Hz, IH), 1.98 (d, J = 12.6 Hz, IH), 1.77 (s, IH), 1.70 (d, J = 11.6 Hz, 2H), 1.57 (m, 3H), 1.21 (m, 3H).
Figure imgf000194_0001
5-(pyrimidiii-5-yIniet!iyIthio)tMazol-2-amiiie (MFH-3-208-1)
[0045OJ To a solution of compound MFH-2-76-1 (230 mg, 1.46 mmol) in absolute EtOH (5 ml) was added NaBH4(166 mg, 4.38 mmol) at room temperature. The mixture was stirred for Ih, and then acetone (3 ml) was slowly introduced. After lh, a solution of 5~ (chloromethyl)pyrimidine (241 mg, 1.46 mmol) in EtOH (3 ml) was added. The resulting dark reaction mixture was heated to reflux for lh, and was then cooled and concentrated in vacuo. The residue was partitioned between EtOAc and brine. The organic phase was separated, dried (MgS04), and concentrated in vacuo to give a crude solid which was triturated with diethyl ether/hexane to provide compound MFH-3-208-1 (180 mg, 55%) LCMS (m/z): 225 [M + H]+.
2-bromo~5-(pyriraidisi~5-yIiii ethylthio)thiazole (MFH-4- 1-1)
[00451] To a solution of CuBr2 (215 mg, 0.96 mmol) in acetonitrile (15 mL) at 0°C was added t-BuONO (99 mg, 0.96 mmol) followed by compound MFH-3-208-1 (180 mg, 0.8 mmol). The mixture was stirred at 0°C for one hour, then at room temperature for one hour, ethyl acetate was added and the organic mixture washed with hydrochloric acid (2x50 mL), dried over magnesium sulfate, filtered through a pad of silica gel, and concentrated in vacuo. The residue was chromatographed on silica gel to give the MFH-4-1-1 (90 mg, 39%). LCMS (m/z): 289 [M + H]+.
(R)-tert-bistyi3-(5~(pyrImidta-5~ylmethy!tWo)tMazol~2~ylamlHo)plperMlo.e~l~ carboxy e (MFH-4-3-1)
[00452| The mixture of MFH-4-1-1 (90 mg, 0.31 mmol), (RVtert-butyl 3-aminopiperidine-l- carboxylate (100 nig, 0.5 inmol) and DIEA (65 mg, 0.5 mmol) in MP (1 mL) was stirred at 140 °C for overnight. The residue was extracted with chloroform and iso-propanol (4:1 ). The organic phase was washed with brine (20 mL χ 2) and dried over Na2S04. After removal of the solvent, the residue was purified by silica gel (MeOH/DCM = 0-20%) to obtain MFH-4- 3-1 (66 mg, yield 52%). LCMS (m/z): 408 [M + Hp
(R)-T -(piperidiM-3-yI)-5-(pyrimMiM-5-ylmet!iyltMo)tMazol-2-amiiie (MFH-4-5-1)
[00453] To a solution of MFH-4-3-1 (66 mg, 0.16 mmol) in methanol (3 mL) was added 4N HCl/dioxane (3 mL). The solution was then stirred for 3h at room temperature and the solvent was removed under reduced pressure to provide a crude which was directly used in the next step. LCMS (m/z): 308 [M + Hp
(R)-(4~mtraphenyl)(3~(5~(pyrim
yl)methanone (MFH-4-6-1).
[00454] The mixture of MFH-4-5-1 (50 mg, 0.16 mmol), 4-nitrobenzoyl chloride (30 mg, 0.16 mmol) in pyridine (2 mL) was stirred for overnight at room temperature. Then the reaction mixture was concentrated under reduced pressure and the residue was directly used in the next step. LCMS (m/z): 457 [M + H]+'
(R)-(4~ammopheiiyl)(3-(5-(pyrimMiii-5-ylmet ylt o)tMazol~2~yIamiiio)piper iii-l- yl)methanone (MFH-4-7-1)
[00455] To a solution of MFH-4-6-1 (74 mg, 0.16 mmol) in ethyl acetate and methanol (1 :1) were added Tin(ii) chloride dehydrate (292 mg, 1.3 mmol) and cone. HC1 (0.1 mL). After stirring for 3 h at 80 °C, the reaction mixture was diluted with chloroform and iso-propanol (4:1), neutralized with saturated NaHC(¾ and filtered. The filtrate was extracted with chloroform and iso-propanol (4:1), concentrated under reduced pressure and the resulting residue was purified by silica gel column chromatography (MeOH/DCM = 0-20%) to give MFH-4-7-1 (15 mg, yield 22%). LCMS (m/z): 427 [M + Hp,
(R)~N~(4~(3~(5-(pyrimidMi-5-y!met ylthio)tMazi>!~2~yIamiiio)piperid™e~l~
carbony])phenyl)acrylamide (MFH-4-10-1)
[00456] To a solution of MFH-4-7-1 (15 mg, 0.04 mmol) and DIPEA (0.1 mL) in CH3CN (2 mL) was added acryloyl chloride (4 mg, 0.05 mmol) in DCM (0.1 mL) dropwise. The mixture was then stirred at 0°C for Ih. The solution was then concentrated under reduced pressure and the residue was purified by prep-HPLC (MeOH/ILO, 0.05%TFA) to provide MFH-4-1G-1 (2.2 mg, yield 13%). LCMS (m/z): 481 [M + H]+. Ή NMR (500 MHz, DMSO) δ 10.26 (s, I H), 9.07 (s, H I) 8.81 (s, 2H), 8.11 (s, IH), 7.79 - 7.59 (m, 2U), 7.38 (t, J = 13.1 Hz, 2H), 6.99 - 6.73 (m, 1H), 6.50 - 6.35 (m, 1H), 6.34 - 6.17 (m, IH), 5.80 (ddd, J = 23.3, 10.0, 2.6 Hz, 1 H), 4.01 (s, 2H), 3.81 - 3.73 (m, 3H), 3.45 - 3.20 (m, 2H), 1.94 (d, J === 18.7 Hz, IH), 1.78 (m, IH), 1.54 (s, 2H).
MFH-4-13-1
Figure imgf000196_0001
SV1FH-2-8S-1 MFH-4-13-1
(R,E)~ -(4~(3~(5-((5-tert-botyloxazoI-2-yl)raethyItMo)tWazol-2~ylam!Mo)piperidiMe-"l~ £arbos¾yl)p eiiyl)-4-(dimet ylaraMo)b !t-2-eiiam!de (MFH-4-13-1)
[00457] To a solution of (E)-4-bromobut-2-enoic acid (17 mg, 0.1 mmol) in SOCl2 (0.2 mL). The mixture was stirred at 70 °C for Hi under N2 atmosphere. The mixture was cooled to room temperature and then was concentrated under reduced pressure. The residue was diluted with dichloromethane and the resulted solution was added dropwise to a solution of ΜΓΗ-2- 20-1 (37 mg, 0.08 mmol) and DIPEA (0.2 mL) in CH3CN (2 mL) at 0°C. After stirring for 1 h at 0 °C, a solution of dimethylamine in THF (2 mol/L, 0.1 ml, 0,2 mmol) was added and the reaction mixture was stirred at room temperature for lh. The removal of the solvent under reduced pressure provided the residue which was purified by HPLC (MeOH/H20, 0,05%'TFA) to obtain MFH-4-13-1 (18 mg, yield 39%). LCMS (m/z); 583 [M + Hj ; ' \ l NMR (500 MHz, DMSO) δ 10.18 (s, I H), 7.96 (s, IH), 7.66 (s, 2H), 7.34 (d, J == 6.9 Hz, 2H), 6.84 (s, IH), 6.80 - 6.65 (m, 2H), 6.27 (d, J = 15.4 Hz, IH), 3.94 (s, 2H), 3.79 (s, IH), 3.65 (s, 2H), 3.14 (m, 2H), 3.06 (d, J = 5.8, 2H), 2.18 (s, 6H), 1.95 (s, IH), 1.75 (s, IH), 1.51 (d, J = 9.0 Hz, 2H), 1,17 (s, 9H). MFH-4-40-1
Figure imgf000197_0001
(!FH-4-40-1
(K,E)~ -(4~(3~(5~((5~tert~bHtylera
ylsulfonyl)phenyl)-4-(dimethylamino)but-2-enamide (MFH-4-40-1)
[00458] To a solution of (E)-4-broinobut-2-enoic acid ( 12 mg, 0.07 mmol) in SOCl2 (0.2 mL). The mixture was stirred at 70 °C for Ih under 2 atmosphere. The mixture was cooled to room temperature and then was concentrated under reduced pressure. The residue was diluted with dichlorometliane and the resulted solution was added dropwise to a solution of MFH-4-40-1 (25 mg, 0.05 mmol) and DIPEA (0.2 mL) in CH3CN (2 mL) at 0°C. After stirring for 1 h at 0 °C, a solution of dimethylamine in THF (2 mol/L, 0.05 ml, 0.1 mmol) was added and the reaction mixture was stirred at room temperature for Ih. The removal of the solvent under reduced pressure provided the residue which was purified by HPLC (MeOH H20, 0.05%TFA) to obtain MFH-4-40-1 (20 mg, yield 66%). LCMS (m/z): 619 [M + 11 j : Ή NMR (500 MHz, DMSO) δ 10.76 (s, IH), 7.98 (d, J = 7.2 Hz, IH), 7.90 (dd, 6.5, 4.7 Hz, 2H), 7.70 (dd, J = 6.6, 4.8 Hz, 2H), 6.97 (d, J = 2.7 Hz, IH), 6.83 - 6.75 (m, IH), 6.72 (d, J :== 8.8 Hz, IH), 6.48 (d, J = 15.3 Hz, IH), 3.96 (s, 2H), 3.71 (s, 2H), 3.53 (d, J :== 9.9 Hz, 2H), 3.24 (d, J = 11.2 Hz, I H), 3.17 (s, 2H), 2.81 (s, 6H), 2.34 - 2.22 (m, IH), 1 .84 - 1.70 (m, 2H), 1.52 (dd, J= 10.1, 4.0 Hz, IH), 1.22 (s, 9H).
Figure imgf000198_0001
(R)-tert-butyl3-(5-((5-tert-butyloxazol-2-yl)methy^
carbexy!aie (MFH- -30-1)
[00459] The mixture of MFH-2-83-1 (150 mg, 0.45 mmol), (R)~tert~butyl 3- aniinopyrrolidine-l-carboxylate (134 mg, 0.72 mmol) and DIEA (116 mg, 0.9 mmol) in NMP (1 mL) was stirred at 140 °C for overnight. The residue was extracted with chloroform and iso-propanol (4:1). The organic phase was washed with brine (30 mL 2) and dried over Na2S04. After removal of the solvent, the residue was purified by silica gel (MeOH DCM = 0-20%) to obtain MFH-4-30-1 (110 mg, yield 56%). LCMS (m/z): 439 [M + H]"h
(R)-5~((5~tert~bi8tyloxazol~2~yl)methyltMo)~N~(pyrro din-3-yl)tMazol~2~amliie (MFH-4- 39-1)
[00460] To a solution of MFH-4-30-1 (110 mg, 0.25 mmol) in methanol (3 mL) was added 4N HCl/dioxane (3 mL). The solution was then stirred for 3h at room temperature and the solvent was removed under reduced pressure to provide a crude which was directly used in the next step. LCMS (m/z): 339 [M + H]+'
(R)-(3-(5-((5-tert-butyloxazol-2-yl)methylthio^
nitrophenyl)methanone (MFH-4- 1-1)
[00461] The mixture of MFH-4-39-1 (80 mg, 0.24 mmol), 4-nitrobenzoyl chloride (53 mg, 0.28 mmol) in pyridine (2 mL) was stirred for overnight at room temperature. Then the reaction mixture was concentrated under reduced pressure and the residue was directly used in the next step. LCMS (m/z): 488 [M + H]+'
(R)-(4-aminopheny])(3-(5-((5-tert-butyloxazol-2-y])methylthio)thiazo]-2- ylamino)pyrrolidiii- l-yl)methanone (MFH-4-44- 1 )
[00462] To a solution of MFH-4-41-1 (117 mg, 0.24 mmol) in ethyl acetate and methanol (1:1) were added Tin(II) chloride dehydrate (427 mg, 1.9 mmol) and cone. HC3 (0.1 mL). After stirring for 3 h at 80 °C, the reaction mixture was diluted with chloroform and iso- propanol (4:1), neutralized with saturated Kal ICO.; and filtered. The filtrate was extracted with chloroform and iso-propanol (4:1), concentrated under reduced pressure and the resulting residue was purified by silica gel column chromatography (MeOH/DCM = 0-20%) to give MFH-4- 4-1 (90 mg, yield 83%). LCMS (m/z): 458 [M + H]+.
( )-N-(4-(3~(5~((5-tert- HiyloxazoI~2-yI)MiethyltMo)tMazoI-2-yIamiiio)pyrrolidiMe-l- carbonyl)phenyl)acrylamide (MTH- -70-1)
[00463] To a solution of MFH-4-44-1 (22 mg, 0.05 mmol) and DIPEA (0.2 mL) in CH3CN
(2 mL) was added acryloyi chloride (5 mg, 0.06 mmol) in DCM (0,1 mL) dropwise. The mixture was then stirred at 0°C for lh. The solution was then concentrated under reduced pressure and the residue was purified by prep-HPLC (MeOH H20, 0.05%TFA) to provide MFH-4-70-1 (13.4 mg, yield 54%). LCMS (m/z): 512 [M + H]+. ¾ NMR (500 MHz, DMSO) δ 10.33 (s, IH), 8.38 - 8.21 (m, IH), 7.73 (d, J = 8.3 Hz, 2H), 7.52 (t, J = 8.6 Hz, 2H), 7.04 - 6.85 (m, IH), 6.77 - 6.65 (m, IH), 6.45 (dd, J = 17.0, 10.1 Hz, 1H), 6.29 (d, J = 16.9 Hz, H), 5.84 - 5.75 (m, H), 3.96 (d, J = 24.0 Hz, 2H), 3.82 - 3.72 (m, H), 3.57 (ddd, J = 25.0, 12.1, 7.0 Hz, 3H), 3.33 (d, J = 7.5 Hz, IH), 2.15 (dt J = 30.0, 14.1 Hz, IH), 1.92 (m, IH), 1.23 - 1.12 (m, 9H). -4-73-1
Figure imgf000199_0001
fSFH-4- 4- MFH-4-73-1
(R,E)-N-(4-(3-(5-((5-tert-bHtyloxazoI-2-yl)metfiyItMo)tMazol-2-ylami!io)pyrrolidiiie-l- carbooyl)pheMyl)-4-(diniethylam!!io)b it-2-eiiamlde (MFH-4-73-1)
[00464] To a solution of (E)-4-bromobut-2-enoic acid (15 mg, 0.09 mmol) in SOCl2 (0.2 mL). The mixture was stirred at 70 °C for lh under N2 atmosphere. The mixture was cooled to room temperature and then was concentrated under reduced pressure. The residue was diluted with dichloromethane and the resulted solution was added dropwise to a solution of MFH- -40-1 (30 mg, 0.07 mmol) and DIPEA (0.2 mL) in CH3CN (2 mL) at 0°C. After stirring for 1 h at 0 "C, a solution of dimethylamine in THF (2 mol/L, 0.1 ml, 0.2 mmol) was added and the reaction mixture was stirred at room temperature for Ih. The removal of the solvent under reduced pressure provided the residue which was purified by HPLC
(MeOH/H20, 0.05%TFA) to obtain MFH-4-73-1 (23 mg, yield 61%). LCMS (m/z): 569 [M + H]+ ; lH NMR (500 MHz, DMSO) δ 10.52 (s, I II), 8.30 - 8.19 (m, 1H), 7.73 (d, J = 8.3 Hz, 2H), 7.53 (t, J = 8.4 Hz, 1 1), 7.03 - 6.85 (m, IH), 6.78 (dd, J - 15.1 , 7.4 Hz, 1 H), 6.75 - 6.65 (m, l i s). 6.48 (d, J = 15.3 Hz, IH), 3.97 (s, 2H), 3.93 (s, 2H), 3.81 - 3.71 (m, i l l), 3.65 - 3.42 (m, 3H), 3.32 (dd, J = 10.0, 2.5 Hz, IH), 2.81 (d, J = 2.5 Hz, 6H), 2.21 - 2.10 (m, IH), 1.99 - 1.85 (m, I H), 1.23 - 1.12 (m, 9H).
Figure imgf000200_0001
(4-aminophenyl)((3R) -((5-(((5-(teii:-buty])oxazo]-2-yl)methyl)sulfinyl)thiazol-2- yl)amino)piperidin-l-yl)methanone (YLIU-01-006-1)
[00465] To a solution of MFH-2-89-1 (30 mg, 0.064 mmol) in DCM (2 mL) was added m- CPBA (12 mg, 0.07 mmol), the reaction mixture was stirred at rt overnight. Then diluted with DCM, washed with NaHC03 aq.(sat), concentrated and purified with silica gel column (eluted with MeOH in DCM 0% to 15%) to give the title compound (20 mg, 64%) as a brown oil. LCMS (m/z): 488 [M + H]+.
N-(4-((3R)-3-((5-(((5-(tert-butyl)oxazol-2-yl)methyl)sulfinyl)thiazol-2- yl)aiidno)piperidine-l-carbony])phenyl)acrylainide (YLIU-01-007-1)
[00466] To a solution of YLIU-01-006-1 (20 mg, 0.04 mmol) in MeCN (2 mL) was added DIPEA (25 mg, 0.2 mmol). At 0 °C, acryloyl chloride (4 mg, 0.044 mmol) was added dropwise. Monitored with LCMS, when the reaction was completed, Na2C03 aq.(sat) was added, the resulting mixture was extracted with DCM/i-PrOH (4/1 ) (20 mL). The combined organic layer was concentrated and purified with Prep-HPLC (MeOH/H20, 0.05%TFA) to give the title compound (8 mg, 36.9%) as white solid. LCMS (m/z): 542 [M + H]+.
[00467] IH NMR (500 MHz, DMSO) δ 10.18 (s, I H), 8.45 (s, IH), 7.71 - 7.48 (m, 2H), 7.39 - 7.10 (m, 3H), 6.68 (s, IH), 6.42 - 6.24 (m, IH), 6.23 - 6.06 (m, IH), 5.77 - 5.57 (m, IH), 4.62 - 4.44 (m, 2H), 4.42 - 4.20 (m, 2H), 3.56 (m, 3H), 2.02 -1.68 (m, 2H), 1.57 - 1.32 (m, 2H), 0.99 (s, 9H).
YLIU-01-067-1
KSCN
-Br SSeOH, rt, o/n
HBr
Figure imgf000201_0001
2) , ei ano!, 65 °C, 1
YLIU -0 -805-1
YLIU-0 -084-1
Br i-BuONO, CuBr2 V
CHjCN, i! °C to rt, 2 h ,f"'s
Figure imgf000201_0002
YLiu-e -eir-i YL!lf -01 -038-1
Figure imgf000201_0003
5-Thiocyanatothiazol-2-amine (YLIU-01-004-1)
[00468] A mixture of 2-amino-5-bromothiazo]e hydrobromide (7.8 g, 30 mmol) and potassium thiocyanate (20.46 g, 210.93 mmol) in methanol (230 mL) was stirred at room temperature for 48 h. Methanol was evaporated and water (30 ml) was added. The pH of the aqueous solution was adjusted to pH==12 with 10% NaOH aq and precipitate formed. The solid was collected by filtration to yield compound YLIU-01-004-1 (3.3 g, 70 %) as a brownish solid. LCMS (m/z): 158 [M + H]+. 5~((5-tert-BistyloxazoI-2-yl)met!iylth!o)tliiazol--2-amiiie (YLIU-01-005-1)
[00469] To a solution of compound YLIU-01-004-1 (156 mg, 1 mmol) in absolute EtOH (3 ml) was added NaBH4 (76 mg, 2 mmol) portionwise at 0 °C. The mixture was stirred at rt for 1 h, and then acetone (2 ml) was slowly introduced. After i h, a solution of 2-(bromomethyl)- 5-(tert-butyl)oxazole (240 mg, 1.1 mmol) in EtOH (2 ml) was added. The resulting dark reaction mixture was heated to 65 ,JC for 1 h, and was then cooled and concentrated in vacuo. The residue was partitioned between EtOAc and brine. The organic phase was separated, dried (MgS04), concentrated and purified with silica gel column (eluted with MeOH in DCM 0% to 10%) to provide the title compound (120 mg, 44%) as a brown solid. LCMS (m/z): 270 [M + H]+.
2~(((2~bremothiazol-5-yl)ti¾!i>)met!iyl)~5-(tert~biityl)oxa2;ok> (YLIU-01-017-1)
[00470] To a solution of CuBr2 (2.32 g, 10 mmol) in acetonitrile (50 mL) at 0°C was added t- BuONO (1.1 g, 10 mmol) followed by compound YLIU-01-004-1 (1.66 g, 6.13 mmol). The mixture was stirred at 0 °C. for 1 h, then at room temperature for 1 h. Ethyl acetate was added and the organic layer was washed with hydrochloric acid (2 x 50 mL), dried over magnesium sulfate, filtered through a pad of silica gel, and concentrated in vacuo. The residue was purified on silica gel column to give the YLIU-01-017-1 (690 mg, 33%) as orange oil. LCMS (m/z): 333 [M + ! ί }-. tert-butyl (R)-3-((5-(((5-(tert-bHtyI)oxazol-2-yI)methyl)tMo)thiazol-2-yl)amiiio) pfperidfoe-l-car oxylate (YLIU-01-038-1)
[00471] A mixture of YLIU-01-017-1 (150 mg, 0.45 mmol), tert-butyl (R)-3-aminopiperidine
-1 -carboxylate (180 mg, 0.9 mmol), DIPEA (0.24 mL, 1.35 mmol) in NMP (3 mL) was heated to 140 °C overnight. The solution was diluted with water (20 mL) and extracted with chloroform and iso-propanol (4:1). The organic phase was washed with brine (50 mL. * 2) and dried over Na2S04, filtered and concentrated. The residue was purified by silica gel column (MeOH/DCM, 0-20%) to give YLIU-01-038-1 (150 mg, 73%). LCMS (m/z): 453 [M ~t~ H]~
(M)~5~(((5-(tert~bistyl)oxazoi-2-yl)metliyl)tWo)~N~(piperMi¾~3~yl)thiazol~2-ami¾e (YLIU- 01-047-1)
[00472] To a mixture of compound YLIU-01-038-1 ( 150 mg, 0.33 mmol) in methanol (2 mL) was added 4N HCl/dioxane (2 mL) and the resulted solution was stirred at rt for 3 h. The mixture was concentrated under reduced pressure to give the title compound as HQ salt, which was directly used in the next step. LCMS (m/z): 353 [M + H]"1"'
(R)-(3-((5-(((5-(tert-butyl)oxazol-2-yl)methyl)thio)thiazol-2-yl)amino)piperidm^ nitropyridin-2-yl)methanone (YLIU-01 -048-1)
[00473] To a mixture of YLIU-01 -047-1 (50 mg, 0.12 mmol), 5-nitropicolintc acid (23 mg, 0.14 mmol) and DIPEA ( 78 mg, 0.6 mmol) in DCM (2 mL) was added T3P (50% solution in EA, 230 mg, 0.36 mmol) dropwise at rt. The reaction mixture was stirred at rt overnight. The solution was diluted with DCM (20 mL) and washed with brine (50 mL x 2) and dried over Na2S04, filtered and concentrated. The residue was purified by silica gel column
(MeOH/DCM, 0-20%) to give the title compound (46 mg, 76%) as yellow solid. LCMS (m/z): 503 [M + H]"h
(R)-(5-amiMopyridi!i-2-yl)(3-((5-(((5-(tert-bistyl)oxazol-2-yl)metIiyI)t o)tfiiazol-2- yl)amino)piperidin-l-yl)methanone (YLIU-01-064-1)
[00474] To a solution of YLIU-01-048-1 (46 mg, 0.091 mmol) in ethyl acetate and methanol (2 mL, 1 :1) was added T'in(II) chloride (138 mg, 0.73 mmol) at rt. After stirring for 2 h at 80 °C, the reaction mixture was diluted with chloroform and iso-propanol (4: 1), neutralized with saturated NaHC03 aq. and filtered. The filtrate was extracted with chloroform and iso- propanol (4:1). The combined organic layer was concentrated under reduced pressure and the resulting residue was purified by silica gel column chromatography (MeOH/DCM = 0-20%) to give YLIU-01-064-1 (16 mg, 37%) as yellow solid. LCMS (m/z): 473 [M + H]+.
(R)-N-(6-(3-((5-(((5-(tert-butyl)oxazol-2-yl)meto
carbonyl)pyridin-3-yl)acrylamide (YLIU-01-067-1)
[00475] To a solution of YLIU-01-064-1 (16 mg, 0.034 mmol) and DIPEA (13 mg, 0.1 mmol) in MeCN (2 mL) was added acryloyl chloride (4 mg, 0.044 mmol) dropwise at 0 °C. Monitored with LCMS, when the reaction was completed, Na2C03 aq.(sa ) was added, the resulting mixture was extracted with DCM/i-PrOH (4/1) (20 mL x 2). The combined organic layer was concentrated and purified with Prep-HPLC (MeOH/H20, 0.05% TFA) to give the title compound (1.3 mg, 7.27 %) as white solid. LCMS (m/z): 527 [M + H]+.
Figure imgf000204_0001
tert-butyl 4-((5-(((5-(tert-butyl)oxazol-2-y])methyl)tbJo)thia.w]-2-yl)aiiiino) pfperidtae-l~ carboxylate (YLlU-01-062-1)
[00476J A mixture of YLIU-01-017-1 (150 nig, 0.45 mmol), tert-butyl 4-aminopiperidine-l- carboxylate (180 mg, 0.9 mmol), DIPEA (0.24 mL, 1.35 mmol) in NMP (3 mL) was heated to 140 °C overnight. The solution was diluted with water (20 mL) and extracted with chloroform and iso-propanol (4:1). The organic phase was washed with brine (50 mL χ 2) and dried over Na2S04, filtered and concen trated. The residue was purified by silica gel column (MeOH/DCM, 0-20%) to give YLIU-01-062-1 (150 mg, 73%). LCMS (m/z): 453 [M ~t~ H]~
5-(((5-(tert-butyl)oxazol-2-yl)methyl)thio)-N-(piperidm-4-yl)tbJazol-2-am (YLIU-01- 062A-1)
[00477J To a mixture of compound YLIU-01-062-1 (150 mg, 0.33 mmol) in methanol (2 mL) was added 4N HCl/dioxane (2 mL) and the resulted solution was stirred at rt for 3 h. The mixture was concentrated under reduced pressure to give the title compound as HC1 salt, which was directly used in the next step. LCMS (m z): 353 [M 4- H]+'
(4-((5-(((5-(tert-b«tyl)oxazol-2-yI)iiiet!iyl)t o)tMazoI-2-yI)amiiio)piperidiM-l-yl)(3- MitropheoyI)methaiiosie (YLIU-01-068-1)
[00478] The mixture of YLIU-01 -062 A-l (330 mg, 0.89 mmol), 3-mtrobenzoyl chloride (330 mg, 1.78 mmol) in pyridine (2 mL) was stirred at rt overnight. Then the reaction mixture was concentrated under reduced pressure and the residue was purified by silica gel column (MeOH/DCM:, 0-20%) to give YLIU-01-068-1 (320 mg, 72%) as yellow solid. LCMS (m z): 502 [M + H]+. (3-aminophenyl)(4-((5-(((5-(teii:-buty])oxazol-2-yl)methyl)t-iio)thiazol-2- yl)amino)piperidin-l-yl)methanone (YLIU-01 -076-1)
[00479] To a solution of YLIU-01-068-1 (100 mg, 0.2 mmol) in MeOH (3 mL) was added Pd/C (10%, 20 mg) and N2H4-H2O (0,1 mL), The reaction mixture was stirred at 80°C overnight, then filtered through Celite, The filtrate was concentrated and purified by Prep- HPLC (MeOH/H20, 0.05%TFA) to give the title compound (27 mg, 29 %) as yellow oil. LCMS (m/z): 472 [M + H]+.
N~(3~(4~((5-(((5~{tert jufyS)oxazol~2^^
carbony])phenyl)acrylamide (YLIU-01-078-1)
[00480] To a solution of YLIU-01-076-1 (20 mg, 0.042 mmol) and DIPEA (17 mg, 0.13 mmol) in MeCN (2 mL) was added acrvloyl chloride (4.2 mg, 0.046 mmol) dropwise at 0 °C. Monitored with LCMS, when the reaction was completed, Na2C03 aq.(sa ) was added, the resulting mixture was extracted with DCM/i-PrOH (4/1) (20 mL x 2). The combined organic layer was concentrated and purified with Prep-HPLC (MeOH/H20, 0.05% TFA) to give the title compound (1.4 mg, 6.3 %) as white solid. LCMS (m/z): 526 [M + H]+.
Figure imgf000205_0001
4-methyl-5-thiocyanatothiazol-2-amine (YLIU-01-056-1)
[00481] A mixture of 2-amino-5-bromothiazole hydrobromide (580 mg, 3 mmol) and potassium thiocyanate (2.9 g, 30 mmol) in methanol (20 mL) was stirred at room temperature for 48 h. Methanol was evaporated and water (3 ml) was added. The pH of the aq ueous solution was adjusted to pH=12 with 10% NaOH aq and precipitate formed. The solid was collected by filtration to yield compound YLIU-01-056-1 (480 mg, 93 %) as a brownish solid. LCMS (m/z): 172 [M + H]+.
5-(((5-(tert-butyl)oxazol-2-yl)methyl)thio)-4-methylthiazol-2-amine (YLIU-01-073-1)
[00482] To a solution of compound YLIU-01-056-1 (171 mg, 1 mmol) in absolute EtOH (3 ml) was added NaBH (76 mg, 2 mmol) portionwise at 0 °C. The mixture was stirred at rt for 1 h, and then acetone (2 ml) was slowly introduced. After 1 h, a solution of 2-(bromomethyl)- 5-(tert-butyl)oxazole (240 mg, 1.1 mmol) in EtOH (2 ml) was added. The resulting dark reaction mixture was heated to 65 °C for 1 h, and was then cooled and concentrated in vacuo. The residue was partitioned between EtOAc and brine. The organic phase was separated, dried (MgS04), concentrated and purified with silica gel column (eluted with MeOH in DCM 0% to 10%) to provide the title compound (314 mg, >100%) as a brown oil. LCMS (m/z): 284 [M +
2~(((2-bromo~4~methy!tWazol~5~yi)tliio)methyi)-5-(tert-b styi)-4-methyl0xazoie (YLIU- 01-089-1)
[00483] To a solution of CuBr2 (423 mg, 1.9 mmol) in acetonitrile (10 mL) at 0°C was added t-BuONO (200 mg, 1.9 mmol) followed by compound YLIU-01-073-1 (314 mg, 1.1 mmol). The mixture was stirred at 0 °C for 1 h, then at room temperature for 1 h. Ethyl acetate was added and the organic layer was washed with hydrochloric acid (2 x 50 mL), dried over magnesium sulfate, filtered through a pad of silica gel, and concentrated in vacuo. The residue was purified on silica gel column to give the YLIU-01-089-1 (140 mg, 37%) as orange oil. LCMS (m/z): 347 [M + H]+. tert-butyl (R)-3-((5-(((5-(tert-butyl)oxazol-2-yl)methyl)thio)-4-methylthiazol-2-yl) arnino)piperidine-l-carboxylate (YLIU-01-092-1)
[00484] A mixture of YLIU-01-089-1 (140 mg, 0,4 mmol), tert-butyl (R)-3-aminopiperidine -1-carboxylate (160 mg, 0.8 mmol), DIPEA (0.22 mL, 1.2 mmol) in NMP (3 mL) was heated to 140 °C overnight. The solution was diluted with water (20 mL) and extracted with chloroform and iso-propanol (4:1). The organic phase was washed with brine (50 mL x 2) and dried over Na2S04, filtered and concen trated. The residue was purified by silica gel column (MeOH/DCM, 0-20%) to give YLIU-01-092-1 (220 mg, >100%). LCMS (m/z): 467 [M - H] -.
(R)-5-(((5-(tert-butyl)oxazol-2-yl)methy^^
amine (YLIU-01-096-1)
[00485] To a mixture of compound YLIU-01-092-1 (220 mg, 0.47 mmol) in methanol (2 mL) was added 4N HCl/dioxane (2 mL) and the resulted solution was stirred at rt for 3 h. The mixture was concentrated and the residue was purified by Prep-HPLC (MeOH/H20, 0.05% TFA) to give the title compound (88 mg, 51 %) as yellow solid. LCMS (m/z): 367 [M + H]+.
(M)~N~(4~(3~((5~(((5-(tert-botyi)oxa¾oI-2~y!)methy!)tMo)~4~methyltMazol~2~
[00486] To a mixture of YLIU-01-096-1 (22 mg, 0.06 mmol), 4-acrylamidobenzoic acid (14 mg, 0.072 mmol) and DIPEA (39 mg, 0.3 mmol) in DCM (2 mL) was added T3P (50% solution in EA, 57 mg, 0.18 mmol) dropwise at rt. The reaction mixture was stirred at rt overnight. The solution was diluted with DCM (20 mL) and washed with brine (50 mL x 2) and dried over Na2S04, filtered and concentrated. The residue was purified by Prep-HPLC (MeOH/H20, 0.05% TFA) to give the title compound (17.1 mg, 53 %) as yellow solid.
LCMS (m/z): 540 [M + ! ij '
[00487] 1H NMR (500 MHz, DMSO) δ 10.28 (s, 1H), 8.44 - 7.89 (m, 1H), 7.81 - 7.57 (m, 2H), 7.36 (m, 2H), 6.81 - 6.60 (m, 1H), 6.51 - 6.36 (m, 1H), 6.32 - 6.20 (m, 1H), 5.88 - 5.67 (m, IH), 3.87 (m, 3H), 3.63 (s, 2H), 3.12 (m, 2H), 1.90 (m, 2H), 1.63 - 1.39 (m, 5H), 1.19 (s, 9H).
Figure imgf000207_0001
tert-butyl 5-((5-(((5-(tert-butyI)oxazol-2-yl)methyl)thio)thiazol-2-yl)amino)-3,3- difluoropiperidine-l-carboxylate (YLIU-01-101-1)
[00488] A mixture of YLIU-01-017-1 (130 mg, 0.4 mmol), tert-butyl 5-amino-3,3- difluoropiperidine-l-carboxylate ( 350 mg, 1.5 mmol), DIPEA (0.36 mL, 1,8 mmol) in MP (3 mL) was heated to 140 °C overnight. The solution was diluted with water (20 mL) and extracted with chloroform and iso-propanol (4:1 ). The organic phase was washed with brine (50 mL x 2) and dried over Na2S04, filtered and concentrated. The residue was purified by silica gel column (MeOH/DCM, 0-20%) to give YLIU-01-101-1 (12 mg, 6%). LCMS (m/z): 489 [M + ! IJ -.
5-(((5-(tert-butyl)oxazol-2-yl)methyl)thio)-^
(YLIU-01-111-1)
[00489] To a mixture of compound YLIU-01-101-1 (12 mg, 0.024 mmol) in methanol (2 mL) was added 4N HCl/dioxane (2 mL) and the resulted solution was stirred at rt for 3 h. The mixture was concentrated and the crude product was used into next step directly as HCl salt. LCMS (m/z): 389 [M + H]+. -(4-(5-((5-(((5-(tert-b«tyl)oxazol-2-yl)iiiet!iyI)t o)thiazoI-2-y!)amiiio)-3,3- difluoropiperidine-l-carbonyl)phenyl)acrylamide (YLIU-01-114-1)
[00490] To a mixture of YLIU-01-111-1 (10 mg, crude HCl salt), 4-acrylamidobenzoic acid (6 mg, 0.03 mmol) and DIPEA (16 mg, 0.12 mmol) in DCM (2 mL) was added T3P (50% solution in EA, 46 mg, 0.07 mmol) dropwise at rt. The reaction mixture was stirred at rt overnight. The solution was diluted with DCM (20 mL) and washed with brine (50 mL x 2) and dried over Na2S04, filtered and concentrated. The residue was purified by Prep-HPLC (MeOH/H20, 0.05% TFA) to give the title compound (2.5 mg, 19 %) as yellow solid, LCMS (m/z): 562 [M + ! I]-.
[00491] 1H NMR (500 MHz, DMSO) δ 10.35 (s, 1 H), 8.10 (s, 1 H), 7.74 (d, J = 8.3 Hz, 2H), 7.42 (d, J = 8.6 Hz, 2H), 7.08 - 6.83 (m, i l l), 6.72 (m, 1H), 6.45 (m, 1H), 6.29 (m, 1H), 5.80 (m, 1H), 3.97 (s, 2H), 3.65 - 3.44 (m, 3H), 3.22 - 2.90 (m, 2H), 2.08 (m, 2H), 1.21 (s, 9H). 01■1211
Figure imgf000209_0001
Methyl 4-(N-acryloylacrylamido)-3-(trifluoromethyl)beiizoate (YLlU-01-100-1)
[00492] To a solution of methyl 4-amino-3-(trifluoromethyl)benzoate (220 mg, 1 mmol) and DIPEA (390 mg, 3 mmol) in MeCN (5 mL) was added acryloyl chloride (108 mg, 1 ,2 mmol) dropwtse at 0 °C, The reaction was stirred at rt for 1 h, then Na2C03 aq.(sat.) was added, the resulting mixture was extracted with DCM (20 mL x 2). The combined organic layer was concentrated and purified with SGC (Hexane/EA=4/1 ) to give YLIU-01-100-1 (114 mg, 35 %) as white solid. LCMS (m/z): 328 [M + H]+.
4-acrylamido-3-(trifluoromethyl)benzoic acid (YLIU-01-115-1)
[00493] To a solution of YLIU-01-100-1 (114 mg, 0.35 mmol) in THF (4 mL) was added IN LiOH aq. (4 mL). The reaction mixture was stirred at rt for lh, then adjusted PH < 7 with 4N HC1 aq. The resulting mixture was extracted with EA (20 mL x 3), washed with brine (50 mL x 2) and dried over Na2S04, filtered and concentrated to give the desire product (1 10 mg, >100%) as a white solid. LCMS (m/z): 260 [M + H]+.
( )-N-(4-(3-((4~(((5-(tert-botyl)oxazol-2-yl)methyI)tMo)tMazol-2~yl)amloo)p!per!d!!ie~l- carboiiyl)~2~(triSHoromet yI)pi¾es¾yl)a£ry!amide (YLIU-01 -121-1)
[00494] To a mixture of YLIU-01 -047-1 (20 mg, 0.057 mmol), YLIU-01-115-1 (18 mg,
0.068 mmol) and DIPEA (37 mg, 0.285 mmol) in DCM (2 mL) was added T3P (50% solution in EA, 108 mg, 0.17 mmol) dropwise at rt. The reaction mixture was stirred at rt overnight. The solution was diluted with DCM (20 mL) and washed with brine (50 mL χ 2) and dried over Na2S04, filtered and concentrated. The residue was purified by Prep-HPLC
(MeOH/iLQ, 0.05% TFA) to give the title compound (17.8 mg, 53 %) as yellow solid. LCMS (m/z): 594 [M + H]"h 1H MR (500 MHz, DMSO) δ 9.87 (m, IH), 8.15 (m, 1 H), 7.72 (m, 3H), 7.08 - 6.66 (m, 2H), 6.64 - 6.50 (m, IH), 6.29 (m, IH), 5.93 - 5.70 (m, l i s), 3.94 (m, 2H), 3.72 (m, 2H), 3.40 (m, IH), 3.15 (m, 2H), 2.07 - 1.66 (m, 2H), 1.64 - 1.35 (m, 2H), 1.14 (s, 9H).
Figure imgf000210_0001
methyl 4-aeryIamldo-3-fl iorobe!izoate (YLIU-01-116-1)
[00495] To a solution of methyl 4-amino-3-fluorobenzoate (500 mg, 3 mmoi) and DIPEA (1.65 ml,, 9 mmoi) in MeCN (5 mL) was added acryloyl chloride (320 mg, 3.6 mmoi) dropwise at 0 °C. The reaction was stirred at rt for 1 h, then a2C03 aq.(sat) was added, the resulting mixture was extracted with DCM (20 mL x 2). The combined organic layer was concentrated and recrystalized from EA to give YLIU-01 -116-1 (190 mg, 28 %) as white solid. LCMS (m/z): 224 [M + H]+.
4~aery!amMe~3~ftaorebeiizoie add (YLIU-01-119-1)
[00496] To a solution of YLIU-01-116-1 (190 mg, 0.85 mmoi) in THF/water (4 mL/ 4 ml.) was added LiOH (204 mg, 8.5 mmoi). The reaction mixture was stirred at rt for lh, then adjusted PH < 7 with 4N HC1 aq. The resulting mixture was extracted with EA (20 mL x 3), washed with brine (50 mL x 2) and dried over Na2S04, filtered and concentrated to give the desire product (110 mg, 61%) as a white solid. LCMS (m/z): 210 [M + H]+.
(R)-N-(4-(3-((4-(((5-(tert-buty])oxazo]-^
carbonyl)-2-fluorophenyl)acrylamide (YLlU-01-123-1)
[00497] To a mixture of YLIU-01-047-1 (20 mg, 0.057 mmoi), YLIU-01-115-1 (15 mg,
0.068 mmoi) and DIPEA (37 mg, 0.285 mmoi) in DCM (2 mL) was added T3P (50% solution in EA, 108 mg, 0.17 mmoi) dropwise at rt. The reaction mixture was stirred at rt overnight. The solution was diluted with DCM (20 mL) and washed with brine (50 mL x 2) and dried over Na2S04, filtered and concentrated. The residue was purified by Prep-HPLC
(MeOH/H20, 0.05% TFA) to give the title compound (23.8 mg, 77 %) as yellow solid.
LCMS (m/z): 544 [M + Hp Ή NMR (500 MHz, DMSO) δ 10.06 (s, IH), 8.05 (m, 2H), 7.44 - 6.97 (m, 2H), 6.74 - 6.53 (m, 3H), 6.36 - 6.21 (m, 1H), 5.80 (m, IH), 3.69 (s, 2H), 3.53 (m, 311), 3.31 - 3.01 (m, 2H), 1.86 (m, 2H), 1.51 (m, 211), 1.16 (s, 911).
Figure imgf000211_0001
benzyl (2R M)-3~((5~(((5~(tert~b¾tyl)oxa¾ol~2-yl)met yI)thio)tMazi>!~2~yl)amiiio)- 2- methylpiperidine-l-carboxylate (YLIU-01- 142-1)
[00498] A mixture of YLIU-01-017-1 (80 nag, 0.24 mmol), benzyl (2R,3R)-3-amino-2- methyl piperidine-l-carboxylate (300 mg, 1.2 mmol), DIPEA (0.42 mL, 2.4 mmol) in NMP (3 mL) was heated to 140 °C overnight. The solution was diluted with water (20 mL) and extracted with chloroform and iso-propanol (4:1). The organic phase was washed with brine (50 mL x 2) and dried over Na2S04, filtered and concentrated. The residue was purified by silica gel column (MeOH/DCM, 0-20%) to give YLIU-01-142-1 (70 mg, 58%) as yellow solid. i .C. VIS (m/z): 501 [M + H]+.
5-(((5-(tert-but l)oxazol-2-yl)methy^
amine (YLIU-01-150-1)
[00499] To a mixture of compound YLIU-01-142-1 (70 mg, 0.14 mmol) in MeCN (4 mL) was added TMSI (280 mg, 1.4 mmol) and the resulted solution was stirred at 0 °C for 30 mill. The reaction was quenched with water and the resulting solution was purified by Prep-HPLC (MeOH/H20, 0.05% TFA) to give the title compound (34 mg, 66%) as yellow solid. i .C. VIS (m/z): 367 [M + H]+. -(4~((2R S)~3~((5~(((5-(tert-bistyi)oxazoi-2-yS)metliyl)tWo)thiazol~2~yI)amifio)~2~ methylpiperidine-l-carbonyl)phenyl)acrylamide (YLIU-01-155-1)
[00500] To a mixture of YLIU-01-150-1 (17 mg, 0.046 mmol), 4-acryiamidobenzoic acid (10 mg, 0.055 mmol) and DIPEA (0.04 mL, 0.23 mmol) in DMF (2 mL) was added HATU (35 mg, 0.093 mmol) at rt. The reaction mixture was stirred at rt overnight. The solution was diluted with DCM (20 mL) and washed with brine (50 mL χ 2) and dried over Na2SC¼, filtered and concentrated. The residue was purified by Prep-HPLC (MeOH/I O, 0.05% TFA) to give the title compound (8.2 mg, 33%) as yellow solid. LCMS (m/z): 540 [M + H]+' [005011 1H NMR (500 MHz, DMSO) δ 10.30 (s, 1H), 8.02 (s, 1H), 7.72 (d, J = 8.6 Hz, 2H), 7.38 (d, J = 8.3 Hz, 2H), 6.79 (m, 2H), 6.45 (dd, J - 17.0, 10.2 Hz, III), 6.28 (dd, J - 17.0, 1.9 Hz, 1H), 5.79 (dd, J = 10.1 , 1.9 Hz, 1H), 3.79 (m, 4H), 3.08 (m, 2H), 1.84 - 1.38 (m, 4H), 1.19 (s, 9H), 1.04 (s, 3H).
Figure imgf000212_0001
benzyl (2S,5R)-5-((5-(((5-(tert-butyl)oxazol-2-y])methyl)thio)thiazol-2-yl)ammo)- 2~ methylpiperidine-l-carboxylate (YLIU-01-143-1)
[00502J A mixture of YLIU-01-017-1 (80 mg, 0.24 mmol), benzyl (2S,5R)-5-amino-2- methyl piperidine- 1 -carboxylate (300 mg, 1 .2 mmol), DIPEA (0.42 mL, 2.4 mmol) in NMP (3 mL) was heated to 140 °C overnight. The solution was diluted with water (20 mL) and extracted with chloroform and iso-propanol (4: 1). The organic phase was washed with brine (50 mL. x 2) and dried over Na2S()4, filtered and concentrated. The residue was purified by silica gel column (MeOH/DCM, 0-20%) to give YLIU-01-143-1 (50 mg, 42%) as yellow solid. LCMS (m/z): 501 [M + H]+.
5-(((5-(tert-butyl)oxazol-2-yl)methyl)tM
amine (YLIU-01-151-1)
[00503] To a mixture of compound YLIU-01-143-1 (50 mg, 0.1 mmol) in MeCN (4 mL) was added TMSI (200 mg, 1 mmol) and the resulted solution was stirred at 0 °C for 30 min. The reaction was quenched with water and the resulting solution was purified by Prep-HPLC (MeOH/H20, 0.05% TEA) to give the title compound (20 mg, 54%) as yellow solid. LCMS (m/z): 367 [M + H]+. -(4-((2S,5R)-5-((5-(((5-(tert-b ityI)oxazol-2-yI)methy!)tlHo)tlnazo!-2-y!)amiM(>)-2- methylpiperidiii ~l~earboiiyl)pheiiyl)acryIamide (YLIU-01-156-1)
[00504] To a mixture of YLIU-01-151-1 (20 mg, 0,054 mmol), 4-acrylamidobenzoic acid (12.5 mg, 0.065 mmol) and DIPEA (0.05 niL, 0.27 mmol) in DMF (2 mL) was added HAITI (41 mg, 0.108 mmol) at rt. The reaction mixture was stirred at rt overnight. The solution was diluted with DCM (20 mL) and washed with brine (50 mL χ 2) and dried over Na2S04, filtered and concentrated. The residue was purified by Prep-HPLC (MeOH/H20, 0.05% TFA) to give the title compound (11 mg, 38%) as yellow solid. LCMS (m/z): 540 [M + H]+. 1 H MR (500 MHz, DMSO) δ 10.30 (s, IH), 8.03 (s, IH), 7.73 (d, J - 8.6 Hz, 2H), 7.39 (d, J = 8.6 Hz, 2H), 6.97 (m, IH), 6.71 (s, IH), 6.45 (dd, J = 17.0, 10.1 Hz, IH), 6.28 (dd, J = 17.0, 1.9 Hz, IH), 5.79 (dd, J = 10.1, 1.9 Hz, IH), 3.95 (m, 2H), 3.57 (m, 2H), 3.34 - 3.02 (m, I H), 2.68 (m, IH), 1.71 (m, 4H), 1.35 - 0.88 (m, 12H).
Synthesis of Bl
Figure imgf000213_0001
[005O5J To a solution of 5-bromothiazol-2-amine hydrobromide (5.2 g, 20 mmol) in methanol (100 mL) was added KSCN (19.5 g, 200 mmol) at room temperature. The resulting mixture was stirred for 20 hours and then concentrated under vacuum. The residue was diluted with H20 (150 mL). The pH of the solution was adjusted to 10 with 10% Na2C03. The precipitate was filtered and washed with water to obtain (1.8 g, 58%) of the title compound (1) as a brown solid. MS m/z 158.95 [M+H]~\ 5-(((5-(tert-butyl)oxazol-2-yl)methyl)thio)thiazol-2-amine (2)
[00506] To a solution of 5-thiocyanatothiazol-2-amine (1.8 g,l 1.46 mmol) in absolute EtOH (50 mL) was added NaBH4 (0.87 g, 2,3 mmol) portionwise at room temperature. The resulting mixture was stirred for 1 hour, and then acetone (20 mi) was slowly introduced. After 1 hours, a solution of 5-(tert-butyl)-2-(chloromethyl)oxazole (2.19 g, 12.6 mmol) in EtOH (10 ml) was added, and the resulting mixture was cooled, concentrated in vacuo, and then partitioned between EtOAc and brine, dried (Na2S04), and concentrated. The residue was purified by an silica gel column to afford (2.1 g, 68%) of the title compound (2) as a pale red-brown solid. MS m/z 270.06 [M+H]+. tert-butyl 4-((5-(((5-(tert-butyl)oxazol-2-yl)methyl)thio)tbJazol-2- y])carbamoyl)piperidine-l -carboxylate (3)
[00507] To a solution of 5-(((5-(tert-butyl)oxazol-2-yl)methy])thio)thiazo]-2-amine (186 mg, 0.69 mmol), l-(tert-butoxycarbonyl)piperidine-4-carboxylic acid (229 mg, 0.94 mmol) , DMAP (42.8 mg, 0.35 mmol) , and triethylamine(0.2 ml, 1.4 mmol) in DMF (1 mL) and DCM (2 ml) was added ED AC (267 mg, 1.4 mmol) at room temperature. The reaction mixture was stirred for 1.5 hours, diluted with EtOAc, washed with water and brine, dried (Na2S04), and concentrated. The residue was purified by an silica gel column to afford (226 mg, 83%) of the title compound (3) as a white solid. MS m/z 481.18[M+H]+.
N-(5-(((5-(tert-b!ityI)oxazoI-2-yl)met!iyl)tMo)tMazol-2-yl)piperMiMe-4-carboxamide hydrochloride (4)
[00508] To a solution of tert-butyl 4-((5-(((5-(teri-butyl)oxazol-2-yl)methyl)thio)thiazol-2- yl)carbamoy])piperidine-l -carboxylate (1 17 mg, 0.24 mmol) in 4 M HCl EtOAc (5 mL). The resulting mixture was stirred at room temperature for 30 min. Then it was concentrated under vacuum to afford (100 mg, 100%) of the title compound (4) as a white solid, which was used without further purification. MS m/z 381.14 [M+H].
(E)-N-(5~(((5-(tert-botyl)oxazol-2-yl)methyI)tMo)th!azol-2-yl)-l-(4-(d!methyIaMHOo)biit- 2-esioyl)piperidiiie~4-earboxamide (Bl)
[00509] To a solution of -(5-(((5-(tert-butyl)oxazol-2-yl)methyl)thto)thiazol-2- yl)piperidine-4-carboxamide hydrochloride (100 mg, 0.24 mmol) in DMF (1 ml.) was added HATU (110 mg, 0.29 mmol), (E)-4-(dimethylamino)but-2-enoic acid hydrochloride (45 mg, 0.27 mmol) and DIPEA (125 mg, 0.96 mmol). The resulting mixture was stirred at room temperature for 1 hour. Then it was diluted with EtOAc (100 mL), washed with water and brine, dried (Na2S04), and concentrated. The residue was purified by an silica gel column to afford (6 mg, 5.1%) of the title compound as a yellow solid. MS m/z 492.21 [.VI -I ij '. Ή NMR (400 MHz, DMSOifc) δ 12.42 (s, 1H), 10.66 (s, 2H), 7.77 (s, 2H), 7.40 (s, 3H), 6.83 (s, IH), 6.72 (s, IH), 6.51 (d, ,/ - 15.1 Hz, 1H), 4.52 - 4.17 (m, 1H), 4.07 (s, 2H), 3.63 (s, 1H), 3.08 (s, 2H), 2.77 (s, 6H), 2.02 (s, 2H), 1.72 (s, 3H), 1.46 (s, 2H), 1.19 (s, 9H).
Synthesis ofB2
Figure imgf000215_0001
5-ttiiocyaiiatot azoI-2-ami!ie (1)
[00510] To a solution of 5-bromothiazol-2-amine hydrobromide (5.2 g, 20 mmol) in
Methanol (100 mL) was added KSCN (19.5 g, 200 mmol) at room temperature. The resulting mixture was stirred for 20 hours and then concentrated under vacuum. The residue was diluted with H20 (150 mL). The pH of the solution was adjusted to 10 with 10% Na2C03. The precipitate was filtered and washed with water to obtain (1.8 g, 58%) of the title compound (1) as a brown solid. MS m/z 158.95 [M+H]+.
5-(((5-(tert-butyI)oxazoI-2-yl)methyl)thio)thiazol-2-amine (2)
[00511] To a solution of 5-thiocyanatothiazol-2-amme (1.8 g, 1.46 mmol) in absolute EtOH (50 mL) was added NaBHU (0.87 g, 2.3 mmol) portionwise at room temperature. The resulting mixture was stirred for 1 hour, and then acetone (20 ml) was slowly introduced. After 1 hour, a solution of 5-(tert-butyl)-2-(chloromethyl)oxazole (2.19 g,12.6 mmol) in EtOH (10 ml) was added, and the resulting mixture was cooled, concentrated in vacuo, and then partitioned between EtOAc and brine, dried (Na2S04), and concentrated. The residue was purified by an silica gel column to afford (2.1 g, 68%) of the title compound (2) as a pale red-brown solid. MS m/z 270.06 [M+H]+. tert-butyl 4-((5-(((5-(tert-butyl)osazol-2-yl)methyl)thio)thiazol-2- y])carbamoyl)piperidine-l -carboxylate (3)
[00512] To a solution of 5-(((5-(tert-butyl)oxazol-2-yl)methyl)thio)thiazol-2-amine (186 mg, 0.69 mmol), l-(tert-butoxycarbonyl)piperidine-4-carboxylic acid (229 mg,0.94 mmol) , DMAP (42.8 mg, 0.35 mmol) , and triethylamine (0.2 ml, 1.4 mmol) in DMF (1 mL) and DCM (2 ml) was added ED AC (267 mg, 1.4 mmol) at room temperature. The reaction mixture was stirred for 1.5 hours, diluted with EtOAc, washed with water and brine, dried (Na2S04), and concentrated. The residue was purified by an silica gel column to afford (226 mg, 83%) of the title compound (3) as a white solid. MS m/z 481.18[M+H]+.
N-(5-(((5-(tert-b!ityI)oxazoI-2-yl)met!iyl)tMo)tMazol-2-yl)piperMiMe-4-carboxamide hydrochloride (4)
[00513] To a solution of tert-butyl 4-((5-(((5-(tert-butyl)oxazol-2-yl)methyl)thio)thiazol-2- yl)carbamoyl)piperidine-l -carboxylate (20 mg, 0.047 mmol) in 4 M HC1 EtOAc (3 mL). The resulting mixture was stirred at room temperature for 30 min. Then it was concentrated under vacuum to afford (100 mg, 100%) of the title compo und (4) as a white solid, which was used without further purification. MS m/z 381.14 [M+H]. l~acryloyl- -(5-(((5~(tert~biityl)oxazol~2~yI)methyl)thio)thiazoI-2-yI)piperidisie-4- carboxamide (B2)
I**si4] jo a solution of N-(5-(((5-(tert-bu1yl)oxazol-2-yl)methyl)thio)miazo]-2-yl)piperidine-4- carboxamide hydrochloride (20 mg, 0.05 mmol ) in THF (5 mL) was added DIPEA (17 mg, 0.15 mmol) and acryloyl chloride (43 mg, 0.05 mmol) at 0 °C for 1 hour. The resulting mixture was stirred at room temperature for 2 hours. Then it was concentrated and purified by an silica gel column to afford (11 mg, 50.7%) of the title compound as a slightly white solid. MS m z 435.15 [M+H]+. Ή NMR (400 MHz, CDC13) δ 11.64 (s, 1H), 7.29 (s, 1H), 6.58 (q, J - 1 1.0 Hz, 2H), 6.28 (d, ,/ - 16.7 Hz, IH), 5.71 (d, J = 10.6 Hz, 1H), 4.58 (d, J = 12.1 Hz, 1 H), 4.09 (dd, J= 17.6, 10.2 Hz, 1H), 3.96 (s, 2H), 3.21 (s, 1H), 2.90 (s, 1H), 2.68 (t, J= 10.4 Hz, 1H), 1.95 (d, J = 12.0 Hz, 2H), 1.82 (s, 2H), 1.24 (s, 9H). Synthesis of S3
Figure imgf000217_0001
5-t ©cyaiiato† azoI-2-amiiie (1)
[00515] To a solution of 5-broinothiazol-2-arnine hydrobromide (5.2 g, 20 mmol) in methanol (100 mL) was added KSCN (19.5 g, 200 mmol) at room temperature. The resulting mixture was stirred for 20 hours and then concentrated under vacuum. The residue was diluted with ¾0 (150 mL). The pH of the solution was adjusted to 10 with 10% Na2C03. The precipitate was filtered and washed with water to obtain (1.8 g, 58%) of the title compound (1) as a brown solid. MS m/z 158.95 [M+H]+.
5-(((5-(tert-butyI)oxazoI-2-yl)methyl)thio)thiazol-2-amine (2)
[00516] To a solution of 5-thiocyanatothiazol-2-amme (1.8 g,l 1,46 mmol) in absolute EtOH (50 mL) was added NaBH4 (0.87 g, 2.3 mmol) portionwise at room temperature. The resulting mixture was stirred for 1 hour, and then acetone (20 ml) was slowly introduced. After 1 hour, a solution of 5-(tert-butyl)-2-(chloromethyl)oxazo]e (2.19 g,12.6 mmol) in EtOH (10 ml) was added, and the resulting mixture was cooled, concentrated in vacuo, and then partitioned between EtOAc and brine, dried (Na2S04), and concentrated. The residue was purified by an silica gel column to afford (2.1 g, 68%) of the title compound (2) as a pale red-brown solid. MS m/z 270.06 [M+H]+. tert-butyl (3-((5-(((5-(tert-butyl)oxazol-2-yl)methyl)thio)thiazol-2- yl)carbamoyl)cyclohexyl)carbamate (3)
[00517] To a solution of 5-(((5-(tert-butyl)oxazol~2~yl)methyl)thio)thiazol-2-amme (160 mg, 0.6 mmol) in DMF (2 mL) was added HATU (456 mg, 1.2 mmol), 3-((tert- butoxycarbonyl)amino)cyclohexane-l-carboxylic acid (292 mg, 1.2 mmol), and DIPEA (143 mg, 2.4 mmol). The resulting mixture was stirred at room temperature for 1 hour. Then it was diluted with EtOAc (150 mL), washed with water and brine, dried (Na2SO-i), and
concentrated. The residue was purified by an silica gel column to afford (210 mg, 70%) of the title compound (3) as a white solid. MS m z 495.20[M+H]+.
3-amino-N-(5-(((5-(tert-butyl)oxazol-2-yl)meth^
carboxamide hydrochloride (4)
[00518] To a solution of tert-butyl (3-((5-(((5-(tert-bu1yl)oxazol-2-yl)memyl)thio)thiazol-2- yl)carbamoy])cyclohexyl)carbamate (210 mg, 0.424 mmol) in 4 M HC1 EtOAc (5 mL). The resulting mixture was stirred at room temperature for 30 min. Then it was concentrated under vacuum to afford (182 mg, 99%) of the title compound (4) as a white solid, which was used without further purification, MS m/z 395.15 [M+H]" .
(E)-N-(5-(((5-(tert-bHtyl)oxazol-2-yl)methyl)tMo)tMazol-2-yl)-3-(4-(dimethylamiHo)b«t- 2~eMamid0)cyclohexaoe-l-earboxamide (B3)
[00519] To a solution of 3-amino- -(5-(((5-(tert-butyl)oxazol-2-yl)methyl)thio)thiazol-2- yl)cyclohexane-l -carboxamide hydrochloride (130 mg, 0.3 mmol) in DMF (1 mL) was added HATU (228 mg, 0.6 mmol), (E)-4-(dimethylamino)but-2~enoic acid hydrochloride (100 mg, 0.6 mmol), and DIPEA (0.214 ml, 1.2 mmol). The resulting mixture was stirred at room temperature for 1 hour. Then it was diluted with EtOAc (100 mL), washed with water and brine, dried Na2S04), and concentrated. The residue was purified by an silica gel column to afford (48 mg, 33%) of the title compound as a white solid. MS m/z 506.26[M+H]+. lH MR (400 MHz, DMSO- ) δ 12.27 (s, III), 8.00 (d, J= 8.0 Hz, 1H), 7.39 (s, 1H), 6.73 (s, 1H), 6.54 (d, J= 16.2 Hz, 1 H), 6.01 (d, J= 15.7 Hz, I H), 4.06 (s, 2H), 3.63 (d, J= 26.0 Hz, 2H), 3.03 (s, 2H), 2.60 (s, 1H), 2.17 (s, 6H), 1.91 (d, J= 11.2 Hz, IH), 1.79 (s, 3H), 1.30 (s, 4H), 1.18 (s, 9H).
Synthesis ofB4
Figure imgf000219_0001
5~tM©eyaoatotMaz0l~2~asHisie (1)
[00520] To a solution of 5-broinothiazol-2-arnine hydrobromide (5.2 g, 20 mmol) in methanol (100 mL) was added SCN (19.5 g, 200 mmol) at room temperature. The resulting mixture was stirred for 20 hours and then concentrated under vacuum. The residue was diluted with H20 (150 mL). The pH of the solution was adjusted to 10 with 10% Na.2C03. The precipitate was filtered and washed with water to obtain (1.8 g,58%) of the title compound (1) as a brown solid. MS m/z 158.95 [M+H]+.
5-(((5-(tert-butyl)oxazol-2-yl)methyl)thio)thiazol-2-amine (2)
[00521] To a solution of 5-thiocyanatothiazoi-2-amine (1.8 g, 11.46 mmol) in absolute EtOH (50mL) was added NaBH4 (0.87 g, 2.3 mmol) portionwise at room temperature. The resulting mixture was stirred for 1 hour, and then acetone (20 ml) was slowly introduced. After 1 hour, a solution of 5-(tert-butyl)-2-(chloromethyl)oxazole (2.19 g,12.6 mmol) in EtOH (10 ml) was added, and the resulting mixture was cooled, concentrated in vacuo, and then partitioned between EtOAc and brine, dried (Na2S04), and concentrated. The residue was purified by an silica gel column to afford (2.1 g, 68%) of the title compound (2) as a pale red-brown solid. MS m/z 270.06 [M+H]+. tert-butyl 3-((5-(((5-(tert-butyI)oxazol-2-yl)methyl)thio)thiazol-2- yl)carbamoyl)piperidine-l-carboxylate (3)
[00522] To a solution of 5-(((5-(tert-butyl)oxazol-2-yl)methyl)mio)miazol-2-amirie (200 mg, 0.74 mmol) in DMF (2 mL) was added HATU (562 mg, 1.5 mmol), l-(tert- butoxycarbonyl)piperidine-3-carboxyiic acid (343 mg, 1.5 mmol), and DIPEA (0.54 ml, 3 mmol). The resulting mixture was stirred at room temperature for 1 hour. Then it was diluted with EtOAc (150 mL), washed with water and brine, dried (Na2S04), and concentrated. The residue was purified by an silica gel column to afford (260 mg, 73%) of the title compound (3) as a white solid. MS m/z 481.19[M+H]+.
N-(5-(((5-(tert-biityI)oxazoI-2-yI)met!iyl)tMo)t azoI-2-yl)piperidi!ie-3-carboxaiMide hydrochloride (4)
[00523] To a solution of tert-butyl 3-((5-(((5-(tert-butyl)oxazol-2-yl)methyl)thio)thiazol-2- yl)carbamoyl)piperidine-l-carboxylate (260 mg, 0.54 mmol) in 4 M HC1 EtOAc (5 ml,). The resulting mixture was stirred at room temperature for 30 min. Then it was concentrated under vacuum to afford (180 mg, 80%) of the title compound (4) as a white solid, which was used without further purification. MS m/z 381.14 [M+FFp. tert-butyl (4-(3-((5-(((5-(tert-butyl)oxazol-2-yl)methyl)thio)thiazol-2- yl)carbamoyl)piperidine-l-carbonyl)phenyl)carbamate (5)
[00524] To a solution of N-(5-(((5-(tert~butyl)oxazol-2-yl)methyl)thio)thiazol-2- yl)piperidine-3-carboxamide hydrochloride (180 mg, 0.43 mmol) in DMF (2 mL) was added FIATU (329 mg, 0.86 mmol), 4-((tert-butoxycarbonyl)amino)benzoic acid (205 mg, 0.86 mmol), and DIPEA (0.38 ml, 2.15 mmol). The resulting mixture was stirred at room temperature for 1 hour. Then it was diluted with EtOAc (100 mL), washed with water and brine, dried (Na2S04), and concentrated. The residue was purified by an silica gel column to afford (80 mg, 31 %) of the title compound (5) as a white solid. MS m/z 600.23[M+H]~\ l-(4-anrinobenzoyl)-N-(5-(((5-(tert-butyl)oxazo^
3-carboxamide hydrochloride (6)
[00525] To a solution of tert-butyl (4-(3-((5-(((5-(tert-buty])oxazol-2-yl)methyl)thio)thiazo3- 2~yl)carbamoyl)piperidme~l~carbonyl)phenyl)carbamate (80 mg, 0.133 mmol) in 4 M HC1 EtOAc (3 mL), The resulting mixture was stirred at room temperature for 30 min. Then it was concentrated under vacuum to afford (65 mg, 91%) of the title compound (6) as a white solid, which was used without further purification. MS m z 38 .14 [M+H]+.
(E)-N-(5-(((5-(tert-butyI)oxazol-2-yl)methyl)thio)thiazol-2-yl)-l-(4-(4-
(dimet ylaraliio)b !t-2-eiiam!do)besiZi>y!)piper iiie~3~i*arboxamide (B4)
[00526] To a solution of l-(4-aminobenzoyl)-N-(5-(((5-(tert-butyl)oxazol-2- yl)methyl)thio)thiazol-2-yl)piperidine-3-carboxamide hydrochloride (0.60 g, 0.1 12 mmol) in DCM (5 mL) was added DIPEA (0.2 ml, 1.34 mmol) and (E)-4-bromobut-2-enoyl chloride (22.5 mg, 0.134 mmol) at 0 °C for 3 min. Then it was added 4.0 M dimethylamine in THF (2 mL). The resulting mixture was stirred at room temperature for 2 hours. Then it was concentrated and purified by an silica gel column to afford (8 mg, 1 1.7%) of the title compound as a slightly white solid. MS m z 611.24 i M-i ij . Ή NMR (400 MHz, DMSO- d6) δ 12.42 (s, I H), 10.66 (s, 2H), 7.77 (s, 2H), 7.40 (s, 3H), 6.83 (s, 1 H), 6.72 (s, I H), 6.51 id. ./ " 15, ! Hz, H), 4.52 4. i 7 (m, IH), 4.07 (s, 2H), 3.63 (s. 1 1 1). 3.08 (s. 2H), 2.77 (s, 6H), 2.02 (s, 2H), 1.72 (s, 3H), 1.46 (s, 2H), 1.19 (s, 9H).
Synthesis ofB5
Figure imgf000221_0001
[00527J To a solution of 5-bromothiazol-2-amine hydrobromide (5.2 g, 20 mmol) in methanol (100 mL) was added KSCN (19.5 g, 200 mmol) at room temperature. The resulting mixture was stirred for 20 hours and then concentrated under vacuum. The residue was diluted with H20 (150 mL). The pH of the solution was adjusted to 10 with 10% Na2C03. The precipitate was filtered and washed with water to obtain (1.8 g, 58%) of the title compound (1) as a brown solid. MS m/z 158.95 [M+H]+.
5-(((5-(tert-butyI)oxazoI-2-yl)methyl)thio)thiazol-2-amine (2)
[00528] To a solution of 5-thioeyanatothiazo3-2-amine (1.8 g, 11.46 mmol) in absolute EtOH (50 mL) was added aBH4 (0.87 g, 2.3 mmol) portionwise at room temperature. The resulting mixture was stirred for 1 hour, and then acetone (20 ml) was slowly introduced. After 1 hour, a solution of 5-(tert-butyl)-2-(chloromethyl)oxazole (2.19 g,12.6 mmol) in EtOH ( 0 ml) was added, and the resulting mixture was cooled, concentrated in vacuo, and then partitioned between EtOAc and brine, dried (Na2SO-i), and concentrated. The residue was purified by an silica gel column to afford (2.1 g, 68%) of the title compound (2) as a pale red-brown solid. MS m/z 270.06 [M+H]+. tert-butyl 3-((5-(((5-(tert-butyl)oxazol-2-yl)methyl)thio)thiazol-2- yl)carbamoyl)piperidine-l-carboxylate (3)
[00529] To a solution of 5-(((5-(tert-butyl)oxazol-2-yl)methyl)thio)thtazo3-2-amine (65 mg, 0.24 mmol) in DMF (2 mL) was added HATU (183 mg, 0.48mmoi), l-(tert- butoxycarbonyl)piperidine-3-carboxylic acid (83 mg, 0.36 mmol) and D1PEA (126 mg, 0.96 mmol). The resulting mixture was stirred at room temperature for 1 hour. Then it was diluted with EtOAc (100 mL), washed with water and brine, dried (Na2S04), and concentrated. The residue was purified by an silica gel column to afford (23 mg, 20%) of the title compound (3) as a white solid. MS m/z 481.19[M+H]+.
N-(5~(((5~(tert~butyi)0xazoi~2-y^
hydrochloride (4)
[00530] To a solution of tert-butyl 3-((5-(((5-(tert-butyl)oxazol-2-yl)methyl)thio)thiazol-2- yl)carbamoyl)piperidine-l-carboxylate (23 mg, 0.048 mmol) in 4 M HC1 EtOAc (2 mL). The resulting mixture was stirred at room temperatixre for 30 min. Then it was concentrated under vacuum to afford (16 mg, 80%) of the title compound (4) as a white solid, which was used without further purification. MS m z 381.14 [M+H]+. l-(4-aci laiiudobeiizoyl)-N-(5-(((5-(tert-butyl)oxazol-2-yl)methyl)thio)thiazol-2- yl)piperidine-3-carboxamide (B5) [00531] To a solution of N-(5-(((5-(tert-butyl)oxazol-2-yl)methyl)thio)thiazol-2- yl)piperidine-3-carboxamide hydrochloride (50 mg, 0.12 mmol) in DMF (1 mL) was added HATU (92 mg, 0.24 mmol), 4-acrylamidobenzoic acid (46 mg, 0.24 mmol), and DIPEA (0.22 ml, 1.2 mmol). The resulting mixture was stirred at room temperature for 1 hour. Then it was diluted with EtOAc (100 mL), washed with water and brine, dried (Na2S04), and concentrated. The residue was purified by an silica gel column to afford (8 mg, 12%) of the title compound as a white solid. MS m/z 554.21 [M+H]+. Ή NMR (400 MHz, DMSO-ifc) δ 12.37 (s, I I I), 7.73 (d, J - 7.8 Hz, 2H), 7.55 - 7.22 (in, 3H), 6.71 (s, IH), 6.44 (dd, ,/ - 16.9, 10.3 Hz, 1H), 6.28 (d, J= 1 6.8 Hz, 1H), 5.78 (d, J= 9.9 Hz, I H), 4.05 (s, 2H), 3.67 (s, I H), 3.05 (s, 2H), 2.69 (s, IH), 1.97 (s, IH), 1.70 (d, J= 12.1 Hz, 2H), 1.44 (s, IH), 1.23 (s, 2H), 1.12 (s, 9H).
Figure imgf000223_0001
[00532] To a solution of 5-bromothiazol-2-amine hydrobromide (5.2 g, 20 mmol) in methanol (100 mL) was added KSCN (19.5 g, 200 mmol) at room temperature. The resulting mixture was stirred for 20 hours and then concentrated under vacuum. The residue was diluted with H20 (150 mL). The pH of the solution was adjusted to 10 with 10% Na2C03. The precipitate was filtered and washed with water to obtain (1.8 g, 58%) of the title compound (1) as a brown solid. MS m/z 158.95 [M+H]~\
5-(((5-(tert-butyl)oxazol-2-yl)methyl)thio)thiazol-2-amine (2)
[00533J To a solution of 5-thiocyanatothiazol-2-amine (1.8 g, 11.46 mmol) in absolute EtOH (50 mL) was added NaBH4 (0.87 g, 2.3 mmol) portionwise at room temperature. The resulting mixture was stirred for 1 hour, and then acetone (20 mi) was slowly introduced. After 1 hour, a solution of 5-(tert-butyl)-2-(chloromethyl)oxazo2e (2,19 g,12.6 mmol) in EtOH (10 ml) was added, and the resulting mixture was cooled, concentrated in vacuo, and then partitioned between EtOAc and brine, dried (Na2S04), and concentrated. The residue was purified by an silica gel column to afford (2.1 g, 68%) of the title compound (2) as a pale red-brown solid. MS m/z 270.06 [M+H]+.
3-aerylamido-N~(5~(((5-(tert-botyl)oxazol-2-yl)met!iyI)t!iio)th!az0l-"2~yl)beMzaraMe (B6) [00534] To a solution of 5-(((5-(tert-butyl)oxazol-2-yl)methyl)thio)tlnazo3-2-amine (54 mg, 0.2 mmol) in DMF (1 mL) was added HATU (160 mg, 0.42 mmol), 3-acrylamidobenzoic acid (60 mg, 0.31 mmol), and DIPEA (52 mg, 0.4 mmol). The resulting mixture was stirred at room temperature for 1 hour. Then it was diluted with EtOAc (100 mL), washed with water and brine, dried (Na2S04), and concentrated. The residue was purified by an silica gel column to afford (7mg, 8%) of the title compound as a white solid. MS m/z 443.12[M+H]+. Ή NMR (400 MHz, CDCI3) δ 12.36 (s, 1H), 9.08 (s, 1H), 8.24 - 7.99 (m, 2H), 7.90 (s, 1H), 7.63 (d, J = 7.6 Hz, 1 H), 7.41 (t, J= 7.9 Hz, I II), 6.95 (s, 1 H), 6.55 (s, \ H), 6.44 (d, J= 16.8 Hz, 1 H), 6.32 (dd, J= 16.8, 10.0 Hz, 1H), 5.76 (d, J = 10.0 Hz, 1 H), 3.95 (s, 2H), 1.23 (s, 9H).
Synthesis ofB7
Figure imgf000224_0001
5~t!ii©cyaoatotMazol~2~a8«isie (1)
[00535] To a solution of 5-bromothiazol-2-amine hydrobromide (5.2 g, 20 mmol) in methanol (100 mL) was added KSCN (19.5 g, 200 mmol) at room temperature. The resulting mixture was stirred for 20 hours and then concentrated under vacuum. The residue was diluted with H20 (150 mL). The pH of the solution was adjusted to 10 with 10% Na.2C03. The precipitate was filtered and washed with water to obtain (1.8 g, 58%) of the title
compound (1) as a brown solid. MS m z 158.95 1 I· - 11 j - 5-(((5-(tert-butyl)oxazol-2-yl)methyl)thio)thiazol-2-amine (2)
[00536] To a solution of 5-thiocyanatothiazol-2-amine (1.8 g,l .1.46 mmol) in absolute EtOH (50 mL) was added NaBH4 (0.87 g, 2.3 mmol) portionwise at room temperature. The resulting mixture was stirred for 1 hour, and then acetone (20 mi) was slowly introduced. After 1 hour, a solution of 5-(tert-butyl)-2-(chloromethyl)oxazole (2,19 g,12.6 mmol) in EtOH (10 ml) was added, and the resulting mixture was cooled, concentrated in vacuo, and then partitioned between EtOAc and brine, dried (Na2S04), and concentrated. The residue was purified by an silica gel column to afford (2.1 g, 68%) of the title compound (2) as a pale red-brown solid. MS m/z 270.06 [M+H]+.
tert-buty] (3-((5-(((5-(tert-buty])oxazol-2-yl)methyl)thio)thiazol-2- yl)carbamoyl)phenyl)carbamate (3)
[00537] To a solution of 5-(((5-(tert-butyl)oxazol-2-yl)methyl)thio)thiazo3-2-arnine (404 mg, 1.5 mmol) in DMF (2 mL) was added HATU (1.14 g, 3 mmol), 3-((tert- butoxycarbonyl)amino)benzoic acid (573 mg, 3 mmol), and DIPEA (1.05 ml, 6 mmol). The resulting mixture was stirred at room temperature for 1 hour. Then it was diluted with EtOAc (200 mL), washed with water and brine, dried (Na2S04), and concentrated. The residue was purified by an silica gel column to afford (490 mg, 67%) of the title compound (3) as a white solid. MS m/z 489.15[M+H]+.
3~amino~N~(5~(((5-(tert-b tyl)i>xa¾ol-2-y!)met yl)thio)thiazol~2~yI)beii¾am!de hydrochloride (4)
[00538] To a solution of tert-butyl (3-((5-(((5-(tert~butyl)oxazol-2-yl)methyl)thio)thiazol-2- yl)carbamoyl)phenyl)carbamate (245 mg, 0.5 mmol) in 4 M HC1 EtOAc (5 mL). The resulting mixture was stirred at room temperature for 30 min. Then it was concentrated under vacuum to afford (212 mg, 100%) of the title compound (4) as a white solid, which was used without further purification, MS m/z 389.11 [M+FI]" .
(E)-N-(5-(((5-(tert-buty])oxazo]-2-yl)methy^
2~eMamido)beiizamMe B7)
[00539] To a solution of 3-armno-N-(5-(((5-(tert-butyl)oxazol-2-yl)memyl)thio)thiazol-2- yl)benzamide hydrochloride (83 mg, 0.195 mmol) in MeCN(5 mL) was added DIPEA (77.6 mg, 0.6 mmol), and (E)-4-bromobut-2-enoyl chloride (40.26 mg, 0.22 mmol) at 0 °C for 3min. Then it was added 4,0 M dimethylamine in THF (1 mL). The resulting mixture was stirred at room temperature for 2 hours. Then it was concentrated and purified by an silica gel column to afford (7 mg, 7.2%) of the title compound as a slightly yellow solid. MS m/z 500.18 [M-HJ " . ¾ NMR (400 MHz, CDC13) δ 8.82 (s, 1H), 8.01 (d, J= 16.7 Hz, 2H), 7.64 (s, ! i !). 7.42 (s, l i s). 7.10 (s, l i s). 7.00 (s, l i s). 6.58 (s, l i s). 6.24 (d, J = 13.7 Hz, M i). 3.96 (s, 2H), 3.16 (s, 2H), 2.31 (s, 6H), 1.26 (s, 9H).
?SIS o.
Figure imgf000226_0001
5~thiocyanatothiazol-2-amine (1 )
[00540] To a solution of 5-bromothiazol-2-amine hydrobromide (5.2 g, 20 mmol) in methanol (100 mL) was added KSCN (19.5 g, 200 mmol) at room temperature. The resulting mixture was stirred for 20 h and then concen trated under vacuum. The residue was diluted with H20 (150 mL). The pH of the solution was adjusted to 10 with 10% Na2C03. The precipitate was filtered and washed with water to obtain (1.8 g, 58%) of the title compound (1) as a brown solid. MS m/z 158.95 [M+H]+.
5-(((5-(tert-butyl)oxazol-2-yl)methyl)thio)thiazol-2-arnine (2)
[00541] To a solution of 5-thiocyanatothiazoi-2-amine (1.8 g, 11.46 mmol) in absolute EtOH (50 mL) was added NaBH4 (0.87 g, 2.3 mmol) portionwise at room temperature. The resulting mixture was stirred for 1 hour, and then acetone (20 mL) was slowly introduced. After 1 hour, a solution of 5-(tert-butyl)-2-(chloromethyl)oxazole (2.19 g, 12.6 mmol) in EtOH (10 mL) was added, and the resulting mixture was cooled, concentrated in vacuo, and then partitioned between EtOAc and brine, dried (Na2S04), and concentrated. The residue was purified by an silica gel column to afford (2.1 g, 68%) of the title compound (2) as a pale red-brown solid. MS m/z 270.06 [M+H]+. tert-butyl (4-((5-(((5-(tert-butyl)oxazol-2-yl)methyl)thio)thiazol-2- yl)carbamoyl)plieiiyl)carbamate (3)
[00542] To a solution of 5-(((5-(tert-butyl)oxazol-2-yl)methyl)thio)1iiiazol-2-amirie (220 mg, 0.82 mmol) in DMF (1 mL) was added HATU (623 mg, 1.64 mmol), 4-((tert- butoxycarbonyl)amino)benzoic acid (390 mg, 1.64 mmol) and DIPEA (0.6ml, 3.28 mmol). The resulting mixture was stirred at room temperature for 1 hour. Then it was diluted with EtOAc (150 mL), washed with water and brine, dried (N&2SQ4), and concentrated. The residue was purified by an silica gel column to afford (200 mg, 50%) of the title compound (3) as a white solid. MS m/z 489.1 5[M+H]+.
4-amiiio-N-(5-(((5-(tert-biityl)oxazoI-2-yI)Mietbyl)t o)t!iiazol-2-yI)beiizaiiiide
hydrochloride (4)
[00543] To a solution of tert-butyl (4-((5-(((5-(tert-butyl)oxazol-2-yl)methy])thio)thiazol-2- yl)carbamoyl)phenyl)carbamate (200 mg, 0.41 mmol) in 4 M HC1 EtOAc (5 ml,). The resulting mixture was stirred at room temperature for 30 min. Then it was concentrated under vacuum to afford (1 74 mg, 100%) of the title compound (4) as a white solid, which was used without further purification. MS m/z 389. [M+H]"".
(E)-N-(5-(((5-(tert-butyl)oxazol-2-yl)methy^
2-enamido)benzamide (B8)
[00544] To a solution of 4-amino~ -(5~(((5-(tert-butyl)oxazol-2-yl)methyl)thio)thiazol~2~ yl)benzamide hydrochloride (75 mg, 0.177 mmol) in MeCN(5 mL) was added DIPEA (0.3ml, 2.6 mmol) and (E)-4-bromobut-2-enoyl chloride(46.85 mg, 0.256 mmol) at 0 °C for 3min. Then it was added 4.0 M dimethylamine in THF(1 mL). The resulting mixture was stirred at room temperature for 2 hours. Then it was concentrated and purified by an silica gel column to afford (7 mg, 8%) of the title compound as a slightly yellow solid, MS m/z 500, 18 [M+H]+ . Ή NMR (400 MHz, CDCI3) δ 8.57 (s, 1H), 7.90 (d, J = 7.3 Hz, 2H), 7.76 (s, 2H), 7.19 (s, IH), 7.05 (s, IH), 6.61 (s, IH), 6.23 (d, J = 15.5 Hz, IH), 3.98 (s, 2H), 3.18 (s, 2H), 2.34 (s, 6H), 1.27 (s, 9H). Synthesis ofB9
Figure imgf000228_0001
Figure imgf000228_0002
B9
5-t ©cyaiiato† azoI-2-amiiie (1)
[00545] To a solution of 5-bi inotliiazol-2~amine hydrobromide (5.2 g, 20 mmol) in methanol (100 mL) was added SCN (19.5 g, 200 mmol) at room temperature. The resulting mixture was stirred for 20 h and then concentrated under vacuum. The residue was diluted with H20 (150 mL). The pH of the solution was adjusted to 10 with 10% a2C03. The precipitate was filtered and washed with water to obtain (1.8 g, 58%) of the title compound (1) as a brown solid. MS m/z 158.95 [M+H]+.
5-(((5-(tert-butyI)oxazoI-2-yl)methyl)thio)thiazol-2-amine (2)
[00546] To a solution of 5-thiocyanatothiazol-2-amine (1.8 g, 11.46 mmol) in absolute EtOH (50 mL) was added NaBHU (0.87 g, 2.3 mmol) portionwise at room temperature. The resulting mixture was stirred for 1 hour, and then acetone (20 mL) was slowly introduced. After 1 hour, a solution of 5-(tert-butyl)-2-(chloromethyl)oxazole (2.19 g, 12,6 mmol) in EtOH ( 0 mL) was added, and the resulting mixture was cooled, concentrated in vacuo, and then partitioned between EtOAc and brine, dried (Na2S04), and concentrated. The residue was purified by an silica gel column to afford (2.1 g, 68%) of the title compound (2) as a pale red-brown solid. MS m z 270.06 [M+H]+. tert-butyl (3-((5-(((5-(tert-butyl)oxazol-2-yl)methyl)thio)thiazol-2- yl)carbamoyl)phenyl)carbamate (3)
[00547] To a solution of 5-(((5-(tert-butyl)oxazol-2-yl)methyl)thio)thtazol-2-amine (404 mg, 1.5 mmol) in DMF (2 mL) was added HATU (1.14 g, 3 mmol), 3-((tert- butoxycarbonyl)amino)benzoic acid (573 mg, 3 mmol), and DIPEA (1.05ml, 6 mmol). The resulting mixture was stirred at room temperature for 1 hour. Then it was diluted with EtOAc (200 mL), washed with water and brine, dried (Na2S04), and concentrated. The residue was purified by an silica gel column to afford (490 mg, 67%) of the title compound (3) as a white solid. MS m/z 489.15 [M+H]+.
3-amino-N-(5-(((5-(tert-butyl)oxazol-2-y^
hydrochloride (4)
[00548J To a solution of tert-butyl (3-((5-(((5-(tert-butyi)oxazol-2-yi)methy2)thio)thiazol-2- yl)carbamoy])phenyl)carbamate (245 mg, 0.5 mmol) in 4 M HC1 EtOAc (5 mL). The resulting mixture was stirred at room temperature for 30 min. Then it was concentrated under vacuum to afford (212 mg, 100%) of the title compound (4) as a white solid, which was used without further purification, MS m/z 389.11 [M+H]" .
3-(4-acrylaMiidobe!izamido)-N-(5-(((5-(tert-biityI)oxazoI-2-yI)met!iyl)tMo)t!iiazoI-2- yl)benzamide (B9)
[00549] To a solution of 3-amino-N-(5-(((5-(tert-butyl)oxazol-2-yl)memyl)thio)thiazol-2- yl)benzamide hydrochloride (212 mg, 0.5 mmol) in DMF (2 mL) was added HA!TJ (380 mg, 1 mmol), 4-acrylamidobenzoic acid (191 mg, 1 mmol), and DIPEA (0.5ml, 3 mmol). The resulting mixture was stirred at room temperature for 1 hour. Then it was diluted with EtOAc (200 mL), washed with water and brine, dried (Na2S04), and concentrated. The residue was purified by an silica gel column to afford (93 mg, 34%) of th e title compound as a white solid. MS m/z 562.18[M+H]+. !H NMR (400 MHz, DMSO-</6) δ 12,83 (s, 1H), 10,47 (s, 1H), 10.40 (s, 1H), 8.46 (s, 1H), 8.00(dd, J = 15,5.0 Hz, 3H), 7.83 (d, J= 15.0 Hz, 3H), 7.52 (d, J - 5.0 Hz, 2H), 6.75(s, IH), 6.46(d, J= 6.3 Hz, 1H), 6.31 (d, J= 6.5 Hz, 1H), 5.82 (d, J= 15.0 Hz, IH), 4.12(s, 2H), 1,22 (s, 9H).
Synthesis of Bll
Figure imgf000230_0001
[00550] To a solution of 5-bromothiazol-2-amine hydrobromide (26 g, 100 mmol) in methanol (500 mL) was added SCN (50 g, 500 mmol) at room temperature. The resulting mixture was stirred for 20 hours and then concentrated under vacuum. The residue was diluted with H20 (300 mL). The pH of the solution was adjusted to 10 with 10% Na2C03. The precipitate was filtered and washed with water to obtain (8 g, 51%) of the title compound (1) as a brown solid. MS m/z 158.95 [M+H]+.
5-(((5-(tert-butyl)oxazol-2-yl)methyl)thio)thiazol-2-amine (2)
[00551] To a solution of 5-thiocyanatothiazol-2-amine (2 g,13 mmol) in absolute EtOH (50 mL) was added NaBH4 (1 g, 26 mmol) portionwise at room temperature. The resulting mixture was stirred for 1 hour, and then acetone (20 mL) was slowly introduced. After 1 hour, a solution of 5-(tert-butyl)-2-(chloromethyl)oxazole (2.71 g,15.6 mmol) in EtOH (10 mL) was added, and the resulting mixture was cooled, concentrated in vacuo, and then partitioned between EtOAc and brine, dried (Na2S04), and concentrated. The residue was purified by an silica gel column to afford (2,8 g, 80%) of the title compound (2) as a pale red- brown solid. MS m/z 270.06 [Vl-H] '.
2-(((2-bromothiazol-5-yl)thio)methyl)-5-(tert-butyl)oxazole (3)
[00552] To a solution of 5-(((5-(tert-butyl)oxazol-2-yl)methyl)thio)thiazo3-2-amine (404 mg,l,5 mmol) in MeCN (10 mL) was added tert-butyl nitrite (239 mg, 2.25 mmol) at 0 °C. The resulting mixture was stirred for 10 min, and then CuBr2 (402 mg,1.8 mmol) was introduced. The resulting mixture was stirred at room temperature for 3 hours, the resulting mixture was concentrated in vacuo. The residue was purified by an silica gel column to afford (143 mg, 29%) of the title compound (3) as a pale yellow oil. MS m/z 333.96 [M+H]~\ tert-butyl 3~((5~(((5-(tert-botyI)oxazol-2-yl)metbyI)tMo)tMazol~2~yl)amloo)p!per!di!ie~l- carboxy!aie (4)
[00553] To a solution of 2-(((2-bromothiazol-5-yl)thio)methyl)-5-(tert-butyl)oxazole (80 mg,0,22 mmol) in NMP (0.1 mL) was added tert-butyl 3-aminopiperidine-l -carboxylate (80 mg, 0.4 mmol) and DiPEA (0.084ml, 0.48 mmol). The resulting mixture was heated at 140 °C for 8 hours. Then it was diluted with EtOAc (150 mL) at room temperature, washed with water and brine, dried Na2S04), and concentrated. The residue was purified by an silica gel column to afford (30 mg, 28%) of the title compound (4) as a slightly yellow solid. MS m/z 453.20 I - 1 I j .
5-(((5-(tert-b ityI)oxazoI-2-yl)methyI)t!iio)-T -(piperidiM-3-yI)t azoI-2-amiiie
hydrochloride (5)
[00554] To a solution of tert-butyl 3-((5-(((5-(tert-butyl)oxazol-2-yl)methyl)thio)thiazol-2- yl)armno)piperidine-l-carboxylate (38 mg, 0.084 mmol) in 4 M HC1 EtOAc (5 mL). The resulting mixture was stirred at room temperature for 30 min. Then it was concentrated under vacuum to afford (35 mg, 98%) of the title compound (5) as a white solid, which was used without further purification. MS m/z 353.14 [M+H]. -(4~(3~((5-(((5-(tert-biityl)0xazol-2-yl)methyI)thio)thlazol~2~yI)aMiiMo)plper!dloe-l- carboiiyl)pheiiyl)acryIamide (B12)
[00555] To a solution of 5-(((5-(tert-butyl)oxazol-2-yl)methyl)thio)-N-(piperidin-3- yl)thiazol-2-amine hydrochloride (35 mg, 0,082 mmol) in DMF (0,5 mL) was added HATU (62.4 mg, 0.164 mmol), 4-acrylamidobenzoic acid (31.5 mg, 0.164 mmol), and DIPEA (42.6 mg, 0.33 mmol). The resulting mixture was stirred at room temperature for 1 hour. Then it was diluted with EtOAc (70 mL), washed with water and brine, dried (Na2S04), and concentrated. The residue was purified by an silica gel column to afford (5 mg, 12%) of the title compound as a white solid. MS m/z 526.21 1 M I I j ' . 1H NMR (400 MHz, CDC13) δ 9.83 (s, 1 H), 7.59 (d, J = 7.2 Hz, 2H), 7.29 (s, 2H), 6.86 (s, 1H), 6.66 (s, 1H), 6.56 (s, 1H), 6.44 (d, J= 16.9 Hz, IH), 6.26 (s, 1H), 5.72 (s, 1H), 4.03 (s, 1H), 3.84 (s, 2H), 3.55 (s, 1H), 3.46 (d, J = 31.2 Hz, 2H), 2.03 (s, 3H), 1.84 (s, 2H), 1.32 (s, 9H). Synthesis of BIS
Figure imgf000232_0001
5-thiocyanatothiazol-2-amine (1)
[00556] To a solution of 5-bromothiazol-2-amine hydrobromide (26 g, 100 mmol) in methanol (500 mL) was added SCN (50 g, 500 mmol) at room temperature. The resulting mixture was stirred for 20 h and then concentrated under vacuum. The residue was diluted with H20 (300 mL). The pH of the solution was adjusted to 10 with 10% Na2CQ3. The precipitate was filtered and washed with water to obtain (8 g, 51%) of the title compound (1) as a brown solid. MS m/z 158.95 [M+H]+.
5-(((5-(tert-butyl)oxazol-2-yl)methyl)thio)thiazol-2-amine (2)
[00557] To a solution of 5-thiocyanatothiazol-2-amine (2 g, 13 mmol) in absolute EtOH (50 mL) was added NaBH4 (1 g, 26 mmol) portionwise at room temperature. The resulting mixture was stirred for 1 hour, and then acetone (20 mL) was slowly introduced. After 1 hour, a solution of 5-(tert-butyl)-2-(chloromethyl)oxazole (2.71 g,15.6 mmol) in EtOH (10 mL) was added, and the resulting mixture was cooled, concentrated in vacuo, and then partitioned between EtOAc and brine, dried (Na2S04), and concentrated. The residue was purified by an silica gel column to afford (2,8 g, 80%) of the title compound (2) as a pale red- brown solid. MS m/z 270.06 [M+H]+.
2-(((2-bromothiazol-5-yl)thio)methyl)-5-(tert-butyl)oxazole (3)
[00558] To a solution of 5-(((5-(tert-butyl)oxazol-2-yl)methyl)thio)thiazo3-2-amine (2.02 g, 7.5 mmol) in MeCN (50 mL) was added tert-butyl nitrite (1.2 g, 11.7 mmol) at 0 °C. The resulting mixtiffe was stirred for 10 min, and then CuBr2 (2.01 mg, 9 mmol) was introduced. The resulting mixture was stirred at room temperature for 3 hours, the resulting mixture was concentrated in vacuo. The residue was purified by an silica gel column to afford (0.6 g, 24%) of the title compound (3) as a pale yellow oil. MS m/z 333.96 [M+H]. tert-butyl 3~((5~(((5-(tert-botyI)oxazol-2-yl)metbyI)tMo)tMazol~2~yl)amloo)p!per!di!ie~l- carboxy!aie (4)
[00559] To a solution of 2-(((2-bromomiazo]-5-yl)1hio)methyl)-5-(tert-butyl)oxazole (0.6 g,1.8 mmol) in KM!' (0.6 mL) was added tert-butyl 3-arninopiperidine-l-carboxylate (0.72 mg, 3.6 mmol) and DiPEA (0.65ml, 3.6 mmol). The resulting mixture was heated at 140 °C for 8 hours. Then it was diluted with EtOAc (200 mL) at room temperature, washed with water and brine, dried Na2S04), and concentrated. The residue was purified by an silica gel column to afford (150 mg, 18.5%) of the title compound (4) as a slightly yellow solid. MS m/z 453.20 [M+H]+.
5-(((5-(tert-b ityI)oxazoI-2-yl)methyI)t!iio)-T -(piperidiM-3-yI)t azoI-2-amiiie
hydrochloride (5)
[00560] To a solution of tert-butyl 3-((5-(((5-(tert-butyl)oxazol-2-yl)methyl)thio)thiazol-2- yl)amino)piperidine-l-carboxylate (150 mg, 0.33 mmol) in 4 M HC1 EtOAc (5 mL). The resulting mixture was stirred at room temperature for 30 min. Then it was concentrated under vacuum to afford (130 mg, 93%) of the title compound (5) as a white solid, which was used without further purification. MS m/z 353.14 [M+H]. -(3-(3~((5-(((5-(tert-biityl)0xazol-2-yl)methyI)thio)thlazol-2~yI)aMiiMo)plper!dloe-l^ carbonyl)phenyl)acrylamide (B12)
[00561] To a solution of 5-(((5-(tert-butyl)oxazol-2-yl)methyl)thio)-N-(piperidin-3- yl)thiazol-2-amine hydrochloride (55 mg, 0,13 mmol) in DMF (0.5 mL) was added HATU (99 mg, 0.26 mmol), 3-acrylamidobenzoic acid (49.7 mg, 0.26 mmol), and DIPEA (67 mg, 0.52 mmol). The resulting mixture was stirred at room temperature for 1 hour. Then it was diluted with EtOAc (70 mL), washed with water and brine, dried (Na2S04), and concentrated. The residue was purified by an silica gel column to afford (12 mg, 18%) of the title compound as a white solid. MS m/z 526.21 [M-i ij ' . lll NMR (400 MHz, CDC13) δ 9.41 (s, I H), 7.85 (s, I H), 7.57 (s, I H), 7.07 (s, I H), 6.86 (s, I H), 6.64 (s, I H), 6.45 (d, J= 17.1 Hz, 1H), 6.41 - 6.20 (m, IH), 5.73 (s, IH), 5.55 (s, IH), 4.03 - 3.80 (m, 2H), 3.71 (s, IH), 3.56 (s, 2H), 2.04 (s, 2H), 1.85 (s, 4H), 1.29 (s, 9H). ! 0
Figure imgf000234_0001
3 8
5-thioc anatotliiazol-2-amine (1)
[00562] To a solution of 5~bromothiazol-2-amine hydrobromide (26 g, 100 mmol) in methanol (500 niL) was added SCN (50 g, 500 mmol) at room temperature. The resulting mixture was stirred for 20 hours and then concentrated under vacuum. The residue was diluted with ¾Q (300 mL). The H of the solution was adjusted to 10 with 10% Na2C03. The precipitate was filtered and washed with water to obtain (8 g, 51%) of the title compound (1) as a brown solid. MS m/z 158.95 [M I { j .
5-(((5-(tert-butyl)oxazol-2-yl)methyl)thio)thiazol-2-aiiiiiie (2)
[00563] To a solution of 5-thiocyanatothiazoi-2-amine (2 g, 13 mmol) in absolute EtOH (50 mL) was added NaBH4 (1 g, 26 mmol) portionwise at room temperature. The resulting mixture was stirred for 1 hour, and then acetone (20 mL) was slowly introduced. After 1 hour, a solution of 5-(tert-butyl)-2-(ch3oromethyl)oxazole (2.71 g,15.6 mmol) in EtOH (10 mL) was added, and the resulting mixture was cooled, concentrated in vacuo, and then partitioned between EtOAc and brine, dried (Na2S04), and concentrated. The residue was purified by an silica gel column to afford (2.8 g, 80%) of the title compound (2) as a pale red- brown solid. MS m/z 270.06 j M~H] \
2-(((2-bromothiazol-5-yl)thio)inethyl)-5-(tert-butyl)oxazole (3)
[00564] To a solution of 5-(((5-(tert-but>'l)oxazol-2~yl)methyl)thio)thiazol-2-amine (2.02 g, 7.5 mmol) in MeCN (50 mL) was added tert-butyl nitrite (1.2 g, 11.7 mmol) at 0 °C. The resulting mixture was stirred for 10 min, and then CuBr2 (2.01 mg, 9 mmol) was introduced. The resulting mixture was stirred at room temperature for 3 hours, the resulting mixture was concentrated in vacuo. The residue was purified by an silica gel column to afford (0.6 g, 24%) of the title compound (3) as a pale yellow oil. MS m/z 333.96 [M+H]. tert-butyl 3~((5~(((5-(tert-botyI)oxazol-2-yl)metbyI)tMo)tMazol~2~yl)amloo)p!per!di!ie~l- carboxylate (4)
[00565] To a solution of 2-(((2-bromothiazo]-5-yl)thio)methyl)-5-(tert-butyl)oxazole (0.6 g,1.8 mmol) in KM!' (0.6 mL) was added tert-butyl 3-arninopiperidine-l-carboxylate (0.72 mg, 3.6 mmol) and DiPEA (0.65ml,3.6 mmol). The resulting mixture was heated at 140 °C for 8 hours. Then it was diluted with EtOAc (200 mL) at room temperature, washed with water and brine, dried Na2S04), and concentrated. The residue was purified by an silica gel column to afford (150 mg, 18.5%) of the title compound (4) as a slightly yellow solid. MS m/z 453.20 [M+H]+.
5-(((5-(tert-b ityI)oxazoI-2-yl)methyI)t!iio)-T -(piperidiM-3-yI)t azoI-2-amiiie
hydrochloride (5)
[00566] To a solution of tert-butyl 3-((5-(((5-(tert-butyl)oxazol-2-yl)methyl)thio)thiazol-2- yl)amino)piperidine-l-carboxylate (150 mg, 0.33 mmol) in 4 M HC1 EtOAc (5 mL). The resulting mixture was stirred at room temperature for 30 min. Then it was concentrated under vacuum to afford (130 mg, 93%) of the title compound (5) as a white solid, which was used without further purification. MS m/z 353.14 [M+H]. tert-butyl (4-(3-((5-(((5-(tert-butyl)oxazol-2-yl)methyl)thio)thiazol -2- yl)amino)piperidine-l-carbonyl)phenyl)carbamate (6)
[00567] To a solution of 5-(((5-(tert-butyl)oxazol-2-yl)methyl)thio)-N-(piperidin-3- yl)thiazol-2-amine hydrochloride (65 mg, 0,153 mmol) in DMF (0,5 mL) was added HATU (118 mg, 0.31 mmol), 4-((tert-butoxycarbonyl)amino)benzoic acid (72 mg, 0.31 mmol), and DIPEA (79 mg, 0.612 mmol). The resulting mixture was stirred at room temperature for 1 hour. Then it was diluted with EtOAc (70 mL), washed with water and brine, dried (Na2S04), and concentrated. The residue was purified by an silica gel column to afford (40 mg, 43%) of the title compound (6) as a white solid. MS m/z 572.22[M+FI]" . (4-aminophenyl)(3-((5-(((5-(teii:-buty])oxazol-2-yl)methyl)t-iio)thiazol-2- yl)am!sio)plperidM~l~yI)meih.aiioiie hydrochloride (7)
[00568] To a solution of tert-butyl (4-(3-((5-(((5-(tert-butyl)oxazol-2-yl)methyl)thio)thiazol -
2~yl)aniino)piperidine-l-carbony2)pheiiy2)carbamate (40 mg, 0.07 mmol) in 4 M HCl EtOAc (1 mL). The resulting mixture was stirred at room temperature for 30 min. Then it was concentrated under vacuum to afford (35 mg, 93%) of the title compound (7) as a white solid, which was used without further purification. MS m/z 472.18 [M+H]+.
(E)-N-(4-(3-((5-(((5-(tert-bu^
earboiiyl)pbe¾yl)~4~(dimethylamisi©)bist~2~eiiamMe (B16)
[00569] To a solution of (4-aminophenyl)(3-((5-(((5-(tert-butyl)oxazol-2- yl)methy3)thio)thiazol-2-yl)amino)piperidin-l-yl)methanone hydrochloride (50 mg, 0.1 mmol) in MeCN (5 mL) was added DIPEA (65 mg, 0.5 mmol) and (E)-4-bromobut-2-enoyl chloride (22 mg, 0.12 mmol) at 0 °C for 3 min. Then it was added 4.0 M dimethylamine in THF (1 mL). The resulting mixture was stirred at room temperature for 2 hours. Then it was concentrated and purified by an silica gel column to afford (10 mg, 17%) of the title compound as a white solid. MS m/z 500.18 [M+H]+ . Ή NMR (400 MHz, MeOD) δ 7.72 (s, 2H), 7.41 (s, 2H), 7.01 - 6.88 (m, 1H), 6.74 (d, J = 22.4 Hz, 2H), 3.94 (s, 2H), 3.86 - 3.68 (m, 4H), 3.50 (s, 1H), 3.27 (d, J === 6.6 Hz, 2H), 2.44 (s, 6H), 2.23 (d, J === 21.3 Hz, IH), 2.13 (d, J = 20.0 Hz, IH), 1.98 (s, 2H), 1.72 (s, 2H), 1.45 - 1.40 (m, 9H).
Synthesis ofB17
Figure imgf000236_0001
5-Miorpho iiot azoI-2-amiiie (1)
[00570] To a mixture of 5-bromothiazol-2-amine hydrobromide (2.6 g, 10 mmol) and powdered potassium carbonate (2.77 g, 20 mmol) in NMP (5 mL) was added morpholine (1.73 mL, 20 mmol) under argon atmosphere and heated at 60 °C for 3 hours. Reaction mixture was cooled to room temperature and poured over ice cold water (100 mL), extracted with EtOAc (3 x 100 mL), washed with brine, dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The residue was purified by an silica gel column to afford (420 mg, 45.4%) of the title compound (1) as a brown solid. MS m/z 186.07[M+H]+. 3-aci7lamido-N-(5-moi holinothiazol-2-yl)benzamide (Bl 7)
[00571] To a solution of 5-morpho3inothiazol-2-aTmne (90 mg, 0.5 mmol) in DMF (0.5 mL) was added HATU (380 mg, 1 mmol), 3-acrylamidobenzoic acid (191 mg, 1 mmol), and DIPEA (129 mg, 1 mmol). The resulting mixture was stirred at room temperature for 1 hour. Then it was diluted with EtOAc (100 mL), washed with water and brine, dried
Figure imgf000237_0001
and concentrated. The residue was purified by an silica gel column to afford (36 mg, 21 %) of the title compound as a yellow solid. MS m/z 359.14 [M+H]+. Ή NMR (400 MHz, DMSO-ifc) δ 12.30 (s, 1 H), 10.37 (s, 111), 8.29 (s, I H), 7.91 (d, J === 7.2 Hz, I H), 7.78 (d, J === 7.0 Hz, IH), 7.49 (d, J = 6.9 Hz, IH), 6.78 (s, I H), 6.47 (dd, J = 15.8, 10.4 Hz, 1H), 6.31 (d, J = 16.8 Hz, IH), 5.81 (d, J = 9.8 Hz, I H), 3.75 (s, 4H), 3.05 (s, 4H).
. ./ H Br + HN N - „ S r /N + H OOC ;: isi H -
DMF ' If v' ^ S \....,·Ν
O ^
B18
-1-yl)
[00572] To a mixture of 5-bromot iazol-2-amine hydrobromide (2.6 g, 10 mmol) and powdered potassium carbonate (2.77 g, 20 mmol) in NMP (5 mL) was added 1- methylpiperazine (2.25 mL, 20 mmol) under argon atmosphere and heated at 60 °C for 3 hours. Reaction mixture was filtered and concentrated under reduced pressure. The residue was purified by an silica gel column to afford (340 mg, 34.3%) of the title compound (1) as a brown solid. MS m/z 199.10 [M+H]+.
3-aci lamido-N-(5-(4-methylpiperazin-l-yl)thiazol-2-y])benzamide (B18)
[00573] To a solution of 5-(4-methylpiperazin-l -yl)thiazol-2-amine (99 mg, 0.5 mmol) in DMF (0.5 mL) was added HAITI (380 mg, 1 mmol), 3-acrylamidobenzoic acid (191 mg, 1 mmol), and DIPEA (129 mg, 1 mmol). The resulting mixture was stirred at room temperature for 1 hour. Then it was purified by an silica gel column to afford (41 mg, 22%) of the title compound as a yellow solid. MS m/z 372.17 [M+H]+. Ή NMR (400 MHz, DMSO-ifc) δ
12.22 (s, IH), 10.35 (s, IH), 8.28 (s, IH), 7.91 (d, J= 6.9 Hz, IH), 7.78 (d, J = 6.7 Hz, IH), 7.47 (t, J= 7.7 Hz, I H), 6.71 (s, I H), 6.47 (dd, J= 16.8, 10.1 Hz, I H), 6.31 (d, J= 17.0 Hz, IH), 5.88 - 5.68 (m, IH), 3.06 (s, 4H), 2.47 (s, 4H), 2.22 (s, 3H).
Figure imgf000238_0001
5-(4-etliy]piperazin-l-yl)thiazol-2-ainine (1)
[00574] To a mixture of 5~bromothiazol-2~amine hydrobromide (2.6 g, 10 mmol) and powdered potassium carbonate (2.77 g, 20 mmol) in NMP (5 mL) was added 1- ethylpiperazine (2.28 mL, 20 mmol) under argon atmosphere and heated at 60 °C for 3 hours. Reaction mixture was filtered and concentrated under reduced pressure. The residue was purified by an silica gel column to afford (382 mg, 36%) of the title compound (1) as a brown solid. MS m/z 213.1 1 [M+H .
3-aci lainido-N-(5-(4-methylpiperazin-l-yl)thiazol-2-y])benzamide (B 1 )
[00575] To a solution of 5-(4-ethylpiperazin-l~yi)thiazoi-2-amine (106 mg, 0.5 mmol) in DMF (0.5 mL) was added HATU (380 mg, 1 mmol), 3-acrylamidobenzoic acid (191 mg, 1 mmol) and DIPEA (129 mg, 1 mmol). The resulting mixture was stirred at room temperature for 1 hour. Then it was purified by an silica gel column to afford (20 mg, 10,3%) of the title compound as a yellow solid. MS m/z 386.20 [M -H]+. Ή NMR (400 MHz, DMSO-tfc) δ 12,23 (s, I H), 10.35 (s, IH), 8.29 (s, IH), 7.91 (d, J= 7.0 Hz, 1 H), 7.79 (d, J= 6.8 Hz, IH), 7.49 (d, J = 7.3 Hz, IH), 6.72 (s, IH), 6.58 - 6.43 (m, IH), 6.31 (d, J = 17.2 Hz, IH), 5.81 (d, J= 10.0 Hz, IH), 3.07 (s, 4H), 2.52 (s, 4H), 2.38 (d, J = 6.3 Hz, 2H), 1.03 (s, 3H).
) N"V r-Br
Figure imgf000238_0002
tert-butyl 4-(2-aiiilootMazol-"5~yI)piperazloe-l-earboxylate (1)
[00576] To a mixture of 5-bromothiazol-2-amine hydrobromide (2.6 g, 10 mmol) and powdered potassium carbonate (2.77 g, 20 mmol) in NMP (5 mL) was added tert-butyl piperazine-l-carboxylate (3.72 g, 20 mmol) under argon atmosphere and heated at 60 °C for 3 hours. Reaction mixture was cooled to room temperature and poured over ice cold water (100 mL), extracted with EtOAc (3 x 100 mL), washed with brine, dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The residue was purified by an silica gel column to afford (600 mg, 42.3%) of the title compound (1) as a brown solid. MS m/z 285.13[M+H]+. tert-butyl 4-{2~(3~aerylam obesi¾amido)tbia¾ol~5-y!)pipera2;me-l-£arbox.ylate (B20) [00577] To a solution of tert-butyl 4-(2-arninothiazol-5-yl)piperazine-l-carboxylate (142 mg, 0.5 mmol) in DMF (0.5 mL) was added HATU (380 mg, 1 mmol), 3-acrylamidobenzoic acid (191 mg, 1 mmol), and DIPEA (129 mg, 1 mmol). The resulting mixture was stirred at room temperature for 1 hour. Then it was diluted with EtOAc (100 mL), washed with water and brine, dried (Na2S04), and concentrated. The residue was purified by an silica gel column to afford (31 mg, 13%) of the title compound as a yellow solid. MS m z 458.25 [M+H]+. Ή NMR (400 MHz, DMSO- ) δ 12.29 (s, 1H), 10.35 (s, IH), 8.29 (s, IH), 7.91 (d, J - 7.5 Hz, 1H), 7.79 (d, J = 7.4 Hz, H I), 7.48 (t, J = 7.9 Hz, IH), 6.79 (s, IH), 6.57 - 6.40 (m, 1H), 6.31 (d, J = 16.6 Hz, IH), 5.85 - 5.68 (m, 2H), 3.49 (s, 4H), 3.03 (s, 4H), 1.43 (s, 9H).
> o.
NaBH3CM + NH n|AJ~
Figure imgf000239_0001
tert-butyl l-(2-amiiiotMazol-5-yl)piperidiu-4-ykarbaiiiate (1)
[00579J To a mixture of 5-bromothiazol-2-amine hydrobromide (2,6 g, 10 mmol) and powdered potassium carbonate (2.77 g, 20 mmol) in NMP (5 mL) was added tert-butyl piperidin~4~ylcarbamate (4.0 g, 20 mmol) under argon atmosphere and heated at 60 °C for 3 hours. Reaction mixture was cooled to room temperature and poured over ice cold water (100 mL), extracted with EtOAc (3 x 100 mL), washed with brine, dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The residue was purified by an silica gel column to afford (400 mg, 13.4%) of the title compound (1) as a brown solid. MS m/z 299.l 5[M+H]+.
5~(4-amiiiopiperidiM-l -yl)t azol~2-aoiiiie (2)
[00580 J To a solution of tert-butyl l-(2-aminothiazol-5-yl)piperidin-4-ylcarbamate (200 mg, 0.67 mmol) in 4 M HQ EtOAc (4 mL). The resulting mixture was stirred at room
temperature for 30 min. Then it was diluted with EtOAc (100 mL). The pH of the solution was adjusted to 7 with 1 M NaOH. The organics washed with water and brine, dried (Na2S04), and concentrated to afford (120 mg, 90%) of the title compound (2) as a slightly brown solid. MS m/z 199.10 [M+H]+.
5-(4-(d!met!iyIamloo)plper!dl!i-l-yl)thiazol-2-amloe (3)
[00581] To a solution of 5-(4-arninopiperidin-l-yl)thiazol-2-amine (120 mg, 0.61 mmol) in MeOH (5 mL) was added paraformaldehyde (90 mg, 3 mmol), AcOH (1 drop), and
NaB3¾CN (251 mg, 4 mmol). The resulting mixture was stirred at room temperature for 15 hours. Then it was concentrated under reduced pressure. The residue was purified by an silica gel column to afford (9 mg, 5.8%) of the title compound (3) as a brown solid. MS m/z
Figure imgf000240_0001
3~acrylamMi>-N~(5-(4-(diraeii¾ylamiiio)piperM™-l-yl)ti¾!a¾ol~2-y!)beiizamMe (B22)
[00582] To a solution of 5-(4-(dimethylammo)piperidin-l -y])thiazol-2-amine (100 mg, 0.442 mmol) in DMF (0.5 mL) was added HATU (335 mg, 0.884 mmol), 3-acrylamidobenzoic acid (169 mg, 0.884 mmol), and DIPEA (228 mg, 1.768 mmol). The resulting mixture was stirred at room temperature for 1 hour. Then it was purified by an silica gel column to afford (35 mg, 17.5%) of the title compound as a yellow solid. MS m/z 400.20 [M+Hf. Ή MR (400 MHz, DMSOifc) δ 12.21 (s, 1H), 10.36 (s, 1H), 8.27 (s, 1H), 7.89 (s, 1H), 7.76 (s, 1H), 7.46 (s, IH), 6.69 (s, IH), 6.52 - 6.40 (m, I I I), 6.30 (d, J " 17.1 Hz, 1H), 5.79 (d, J - 9.6 Hz, 1H), 3.42 (d, J- 9.5 Hz, 2H), 2.74 (t, J= 1 1.1 Hz,2H), 2.19 (s, 7H), 1.82 (d, J = 11.2 Hz, 2H), 1.54 (d, J = 10.9 Hz, 2H).
Structure-activity Analyses for Selected Compounds
[00583] Select compounds described herein were evaluated for structure-activity analyses. Exemplar}' results are shown in Table 1 ,
Table 1. IC50 values of exemplary compounds described herein.
Figure imgf000241_0001
Figure imgf000242_0001
Figure imgf000243_0001
Figure imgf000244_0001
in£0/9lOZSil/13d 8£8W0//.10Z OAV
Figure imgf000245_0001
in£0/9lOZSil/13d 8£8W0//.10Z OAV
Figure imgf000246_0001
Figure imgf000247_0001
Figure imgf000248_0001

Figure imgf000249_0001
Genome Editing:
[00584| With regard to the exemplary results for cellular assays shown in Table 1 above, genome editing was performed as follows. The CRISPR/Cas9 system was used to mutate the endogenous CD 12 and CDK13 loci to encode for CDK12 C1039S and CDK13 C1017S, both are putative CD 12/13 inhibitor-refractory mutants. Target-specific oligonucleotides were cloned into pX330, which carries a codon-optimized version of Cas9 and was further modified to express GFP for identifying transfectants. Cells were co-transfected (X- tremeGENE 9 (Roche)) with 1) pX330 expressing Cas9 and CDK12-targeting guide RNAs and 2) a pUC57-AMP construct bearing 1500 bp of modified CDK12 reference genome that is centered around the CRISPR targeting site in CD 12. Two days after transfection, cells were sorted using GFP as a marker of transfected cells and cells were re-plated for five days. Cells were then re-plated at low density to facilitate the isolation of individual clones.
Individual clones were isolated, expanded, and PCR genotyped using mutant specific PCR primers. Following initial PCR screening, individual clones were Sanger sequenced to confirm the presence of the desired mutation. Western blot confirmed the presence of intact CDK12 kinase. The process was sequentially repeated this time with Cas9/sgRNA constructs to target and replace the CD 13 genetic loci. Subsequent experiments were conducted using a CDK12 C1039S/ CDK13 C1017S clone and a WT control clone that was carried through the entirety of the CRISPR protocol but that was verifi ed by Sanger sequencing to be WT for CDK12 and CD 13. The genomic sequence complementary to the CDK12 -directed guide RNA that was cloned into pX330 and used in the genome editing experiments is:
GGCAGGATTGCCATGAGTTG. The genomic sequence complementary to the CD 13 - directed guide RNA that was cloned into pX330 and used in the genome editing experiments is: GGCAAGATTGTCATGAGTTA. The reference genome sequence used as a repair template for CDK12 and CDK1.3 CRISPR was edited to 1) introduce DNA coding for serine, 2) introduce mutations to either remove the PAM site (NGG) targeted by CRISPR/Cas9 or introduce sufficient wobble mutations such that the guide RNA could not recognize the repair template and thus could not be cut by CRISPR/Cas9, and 3) introduce mutations that could allow for mutant and WT-specific PCR amplification.
HAP1 cell proliferation assay:
[00585] With regard to the exemplary results shown in Table 1 above, the HAP1. cell proliferation assay was performed as follows. HAP1 WT and double mutants cells were seeded at a density of 12,000 cells/ well in 96-well plates. Twenty-four hours cells were then treated with the indicated compounds in a 10-pt dose escalation format from 1 nM to 10 μΜ or DMSO control for 72 hrs. After 72 hrs, cells were assayed using CellTiter-Glo
Luminescent Cell Viability Assay (Promega) to determine cell viability by measuring the amount of ATP present in each sample cell population, which is an indicator of cell metabolic activity. Results are graphed as fraction of the DMSO control at 72 hrs. All data points were performed in biological triplicate.
[00586] HAP1 cells expressing putative inhibitor-refractory mutations in CDK12 (C1039S) and CD 13 (C1017S) show up to 20-fold less sensitivity to exemplary compounds as compared to control WT HAP1 cells. This result indicates that a substantial portion of intracellular compound activit comes from covalent inhibition of CDK12 and/or CD 13 and mutation of the targeted cysteines (CI 039 in CDK12 and CIO 17 in CDK.13) to less nucleophilic serines is sufficient to rescue a substantial portion of anti -proliferative activity,
EQUIVALENTS AND SCOPE
[00587] In the claims articles such as "a," "an," and "the" may mean one or more than one unless indicated to the contrary or otherwise evident from the context. Claims or descriptions that include "or" between one or more members of a group are considered satisfied if one, more tha one, or all of the group members are present in, employed in, or otherwise relevant to a given product or process unless indicated to the contrary or otherwise evident from the context. The invention includes embodiments in which exactly one member of the group is present in, employed in, or otherwise relevant to a given product or process. The invention includes embodiments in which more than one, or all of the group members are present in, employed in, or otherwise relevant to a given product or process,
[00588] Furthermore, the invention encompasses all variations, combinations, and permutations in which one or more limitations, elements, clauses, and descriptive terms from one or more of the listed claims is introduced into another claim. For example, any claim that is dependent on another claim can be modified to include one or more limitations found in any other claim that is dependent on the same base claim. Where elements are presented as lists, e.g., in Markush group format, each subgroup of the elements is also disclosed, and any element(s) can be removed from the group. It should it be understood that, in general, where the invention, or aspects of the invention, is/are referred to as comprising particular elements and/or features, certain embodiments of the invention or aspects of the invention consist, or consist essentially of, such elements and/or features. For purposes of simplicity, those embodiments have not been specifically set forth in haec verba herein. It is also noted that the tenns "compr sing" and "containing" are intended to be open and permits the inclusion of additional elements or steps. Where ranges are given, endpoints are included. Furthermore, unless otherwise indicated or otherwise evident from the context and understanding of one of ordinary skill in the art, values that are expressed as ranges can assume any specific value or sub-range within the stated ranges in different embodiments of the invention, to the tenth of the unit of the lower limit of the range, unless the context clearly dictates otherwise.
[00589] This application refers to various issued patents, published patent applications, journal articles, and other publications, all of which are incorporated herein by reference. If there is a con flict between any of the incorporated references and the instant specification, the specification shall control. In addition, any particular embodiment of the present invention that falls within the prior art may be explicitly excluded from any one or more of the claims. Because such embodiments are deemed to be known to one of ordinary skill in the art, they may be excluded even if the exclusion is not set forth explicitly herein. Any particular embodiment of the invention can be excluded from any claim, for any reason, whether or not related to the existence of prior art.
[0059OJ Those skilled in the art will recognize or be able to ascertain using no more than routine experimentation many equivalents to the specific embodiments described herein. The scope of the present embodiments described herein is not intended to be limited to the above Description, but rather is as set forth in the appended claims. Those of ordinary skill in the art will appreciate that various changes and modifications to this description may be made without departing from the spirit or scope of the present invention, as defined in the following claims.

Claims

What is claimed is:
1. A compound of Formula (Γ) :
Figure imgf000253_0001
or a pharmaceutically acceptable salt thereof, wherein:
R1 is hydrogen, halogen, or optionally substituted alkyl;
M ts O, S, or RM;
RM is hydrogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl , optionally substituted acyl, or a nitrogen protecting group;
Ring A is optionally substituted monocyclic carbocyclyl, optionally substituted
monocyclic heterocyclyl, optionally substituted phenyl, or optionally substituted monocyclic heteroaryl;
Ring B is optionally substituted monocyclic carbocyclyl, optionally substituted monocyclic heterocyclyl, optionally substituted phenyl, or optionally substituted monocyclic heteroaryl;
Ring C is optionally substituted monocyclic carbocyclyl, optionally substituted monocyclic heterocyclyl, optionally substituted monocyclic or bicyclic aryl, or optionally substituted monocyclic or bicyclic heteroaryl;
each instance of RA, RB, and Rc is independently hydrogen, halogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl, -OR3, -N(Ra)2, -SRa, -CN, --SCN, -N02, -N3, or optionally substituted acyl;
each instance of Ra is independently hydrogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted acyl, a nitrogen protecting group when attached to a nitrogen atom, an oxygen protecting group when attached to an oxygen atom, or a sulfur protecting group when attached to a sulfur atom, or two instances of Ra are joined to form a substituted or unsubstituted, heterocyclic ring, or substituted or unsubstituted, heteroaryl ring; each of al, bl, and cl is independently 0, 1, 2, 3, 4, 5, or 6, as valency permits;
L1 is -CH2-, ic S(-())2 ?\ -0-, -S-, -NRL1-, -C(-O)-, lc - RL1C(=0)-ft, lc - C(=0)NRL1- lb, lc ~OC(=0)~- lb, or lc -C(=0)0- ; wherein }b indicates the point of attachment is to Ring B; and '''' indicates the point of attachment is to Ring C;
L2 is -0-, -S-, -NRL2-, lb -NRL2C( ))-'¾, lb -C(0)NRL2-/m; wherein ib indicates the point of attachment is to Ring B; and lm indicates the point of attachment is to the heteroaryl ring with M;
X is Λ'·"; Ci bCi i;. CI I C! i x" Xln -CH2-~NRLX x", Xln -CH2-0-CH2-, xm -CH2- R^-CH ™ -0-, -S-, -NRLX-5 xm-0-CH2-, xm »S-CH2-, xm -8-€(=0)ΟΗ2--, or xm -NRLX-CH2-'ra; wherein xa indicates the point of attachment is to Ring A; and xm indicates the point of attachment is to the heteroaryl ring with M;
each of RLI, RL2 5 and RLX is independently hydrogen, optionally substituted Q.6 alky], or a nitrogen protecting group;
2 is any of Formulae (i~l)~(i~41):
Figure imgf000254_0001
(i-11) (i-12) (i-13) (i-14) 0-15)
Figure imgf000255_0001
253 L3 is a bond or an optionally substituted Ci-4 hydrocarbon chain, optionally wherein one or more carbon units of the hydrocarbon chain are independently replaced with -C=0- , -0-, -S-, -NRL3a~, -NRL aC(=0)-, ~C(=G)NRL3a~, -SC(=0)-, -C(=G)S~, -OC(=0)-, -
Figure imgf000256_0001
G≡C-, -S(--C))-, -S(=0)0-, -OS(=0)-, -Si===0)NRL3% -NRL3aS(===0)-, -S(=0)2-, - S(=O)20-, -OS(=0)2-, -S(=0)2NRUa-, or -NRUaS(=0)2-, wherein RL3a is hydrogen, optionally substituted C e alkyl, or a nitrogen protecting group, and wherein each occurrence of RL3° is independently hydrogen, halogen, optionally substituted alky], optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted lieterocyclyl, optionally substituted aryl, or optionally substituted heteroaryl, or two RL b groups are joined to form an optionally substituted carbocyclic or optionally substituted heterocyclic ring;
L4 is a bond or an optionally substituted, branched or unbranched C hydrocarbon chain; each of REl, RE2, and REi is independently hydrogen, halogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocvclyl, optionally substituted aiyl, optionally substituted heteroaryl, -CN, -CH2OREF", -CH2N(REE)2, -CH2SREE, - OREE, -N(REE)2, -Si(REE)3, and -SREE, wherein each occurrence of REE is
independently hydrogen, optionally substituted alkyl, optionally substituted alkoxy, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyciyl, optionally substituted aryl, or optionally substituted heteroaryl, or two REE groups are joined to form an optionally substituted heterocyclic ring;
or REl and RE3, or RE2 and RE3, or RE1 and RE2 are joined to form an optionally substituted carbocyclic or optionally substituted heterocyclic ring;
RE4 is a leaving group;
RE5 is halogen;
RE6 is hydrogen, optionally substituted Q.6 alkyl, or a nitrogen protecting group;
each instance of Y is independently O, S, or NRE?, wherein RE? is hydrogen, optionally substituted Q.e alkyl, or a nitrogen protecting group;
a is 1 or 2; and
each instance of z is independently 0, 1, 2, 3, 4, 5, or 6, as valency permits.
2. A compound of Formula I):
Figure imgf000257_0001
or a pharmaceutically acceptable salt thereof, wherein:
R1 is hydrogen, halogen, or optionally substituted alkyl;
M is O, S, or NRM;
RM is hydrogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaiyl , optionally substituted acyl, or a nitrogen protecting group;
Ring A is optionally substituted monocyclic carbocyclyl, optionally substituted monocyclic heterocyclyl, optionally substituted phenyl, or optionally substituted monocyclic heteroaiyl;
Ring B is optionally substituted monocyclic carbocyclyl, optionally substituted monocyclic heterocyclyl, optionally substituted phenyl, or optionally substituted monocyclic heteroaiyl;
Ring C is optionally substituted monocyclic carbocyclyl, optionally substituted monocyclic heterocyclyl, optionally substituted phenyl, or optionally substituted monocyclic heteroaiyl;
each instance of RA, RB, and Rc is independently hydrogen, halogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaiyl, -OR8, -N(Ra)2, -SRa, -CN, -SCN, -Ν02, -N3, or optionally substituted acyl;
each instance of Rais independently hydrogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted acyl, a nitrogen protecting group when attached to a nitrogen atom, an oxygen protecting group when attached to an oxygen atom, or a sulfur protecting group when attached to a sulfur atom, or two instances of Ra are joined to form a substituted or unsubstituted, heterocyclic ring, or substituted or unsubstituted, heteroaryl ring; each of al, bl, and cl is independently 0, 1, 2, 3, 4, 5, or 6, as valency permits;
,L! lb ic lb
-NRLI-, -C(=OK fc -NRLlC(=0)-ft, !c -C(=0) R OC(=0> or /c -C(=0)0-¾; wherein lh indicates the point of attachment is to Ring B; and ,c indicates the point of attachment is to Ring C;
L is 0 L2 lb C( =0 - lm, lb -C(==0)NRL2 - lm wherei ib indicates the point of attachment is to Ring B; and lm indicates the point of attachment is to the heteroaryl ring with M;
X is ....( -, S , -NR.1 1 X , xm -0--CB2-xa, xm -S-CH2-xa, or xm -NR^-CHr-"; wherei xa indicates the point of attachment is to Ring A; and xm indicates the point of attachment is to the heteroaryl ring with M;
each of RLl, RL2, and RLX is independently hydrogen, optionally substituted C alkyl, or a nitrogen protecting group;
R.2 is an of Formulae (i-l)-(i-41):
Figure imgf000258_0001
Figure imgf000259_0001
(1-41)
wherein:
L3 is a bond or an optionally substituted C1-4 hydrocarbon chain, optionally wherein one or more carbon units of the hydrocarbon chain are independently replaced with -C=0- , -0-, -S-, ~NRL3\ -NRL3aC(=0)~, -Ci=0)NRL3\ -SC(= -C(=0)S-, -OC(=
C(=0)O, -NRL3aC(=S)-, -c(=s; ira«s-CRL3b=CRL c£s-CRUb=€R]
C C-, -S(=0)-, -S( -())()··, -OSi -()}··, -S( )) RL3\ -NRL3eS(=€>)-, -S(=0)2-,
S(=0)20-, -OS(=0)2-, -S(=0)2 RL3\ or -NRL3aS(=G)r, wherein RL3a is hydrogen optionally substituted Ci-c alkyl, or a nitrogen protecting group, and wherein each occurrence of RL3b is independently hydrogen, halogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, or optionally substituted heteroaryl, or two RLjb groups are joined to forrn an optionally substituted carbocyclic or optionally substituted heterocyclic ring;
L4 is a bond or an optionally substituted, branched or unbranched Ci_6 hydrocarbon chain; each of REi, RE2, and RE3 is independently hydrogen, halogen, optionally substituted alky], optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryi, optionally substituted heteroaryl, -CN, -CH2OREE, -CH2N(REE)2, -CH2SREE, - OREE, -N(REE)2, -Si(REE)3, and -SREE, wherein each occurrence of REE is
independently hydrogen, optionally substituted alkyl, optionally substituted alkoxy, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, or optionally substituted heteroaryl, or two REE groups are joined to forrn an optionally- substituted heterocyclic ring;
or REl and RF'3, or RE2 and RE3, or RE! and RE2 are joined to form an optionally substituted carbocyclic or optionally substituted heterocyclic ring;
R&* is a leaving group;
RE5 is halogen;
RE6 is hydrogen, optionally substituted Ci_6 alkyl, or a nitrogen protecting group;
each instance of Y is independently O, S, or NRE7, wherein RE is hydrogen, optionally substituted Q.6 alkyl, or a nitrogen protecting group;
a is 1 or 2; and
each instance of z is independently 0, 1, 2, 3, 4, 5, or 6, as valency permits. The compound of claim 1 or 2 wherein the compound is of the formula:
Figure imgf000260_0001
pharmaceutically acceptable salt thereof.
4. The compound of any one of claims 1-3, or a pharmaceutically acceptable salt thereof, wherem the Ring B is optionally substituted monocyclic heterocyclyl.
5. The compound of any one of claims 1-4, or a pharmaceutically acceptable salt thereof, wherem the Ring B is optionally substituted piperidiny].
6. The compound of claim 5, wherein the compound is of Formula (I-i):
Figure imgf000261_0001
or a pharmaceutically acceptable salt thereof.
7. The compound of claim 5, wherein the compoimd is of Formula
Figure imgf000261_0002
or a pharmaceutically acceptable salt thereof.
8. The compound of claim 7, wherein the compound is of Formula (I-ii-a)
Figure imgf000261_0003
larmaceutically acceptable salt thereof.
The compound of claim 7, wherein the compound is of Formula (I-
Figure imgf000262_0001
or a pharmaceutically acceptable salt thereof.
10. The compound f claim 7, wherein the c mpound is of Formula (I-ii-c)
Figure imgf000262_0002
or a pharmaceutically acceptable salt thereof.
11. The compound of claim 5, wherein the compound is of Formula (I-iii):
Figure imgf000262_0003
or a pharmaceutically acceptable salt thereof.
12. The compound of claim 5, or a pharmaceutically acceptable salt thereof, wherein Ring B is optionally substituted monocyclic carbocyclyl.
13. The compound of claim 5, or a pharmaceutically acceptable salt thereof, wherein Ring B is optionally substituted cyclohexyl.
The compound of claim 13, wherein the compound is of Formula (I-iv)
Figure imgf000263_0001
or a pharmaceutically acceptable salt thereof.
15. The compound of claim 14, wherein the compound is of Formula (I-iv-a) :
Figure imgf000263_0002
or a pharmaceutically acceptable salt thereof.
16. The compound of claim 7, wherein the compound is of Formula (I-iv-b)
Figure imgf000263_0003
or a pharmaceutically acceptable salt thereof.
17. The compound of claim 1 , wherein the compound is of Formula (Γ )
Figure imgf000264_0001
or a pharmaceutically acceptable salt thereof.
18. The compound of claim 1 , or a pharmaceutically acceptable salt thereof, wherein Ring C is optionally substituted.bicyclic aryl.
19. The compound of claim 1, or a pharmaceutically acceptable salt thereof, wherein Ring C is optionally substituted.bicyclic heteroaryl.
20. The compound of claim 18 or 19, or a pharmaceutically acceptable salt thereof.
Figure imgf000264_0002
21. A compound of Formula ΙΓ) :
Figure imgf000264_0003
or a pharmaceutically acceptable salt thereof, wherein:
Rl is hydrogen, halogen, or optionally substituted alkyl;
M is O, S, or NRM;
RM is hydrogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocvciyl, optionally substituted aryl, optionally substituted heteroaryl , optionally substituted acyl, or a nitrogen protecting group;
Ring A is optionally substituted monocyclic carbocyclyl, optionally substituted monocyclic heterocyclyl, optionally substituted phenyl, or optionally substituted monocyclic heteroaryl;
Ring B is optionally substituted monocyclic carbocyclyl, optionally substituted monocyclic heterocyclyl, optionally substituted phenyl, or optionally substituted monocyclic heteroaryl;
each instance of RA and RB is independently hydrogen, halogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl, OR", -N(Re)2, -SRa, -CN, -SCN, -C(=NRe)Re, -C(===NRa)ORa, - C(=NRa)N(Ra)2, -C(=0)Ra, C(---(})Oir. -C(0)N(Ra)2, -NO,, -NRaC(-0)Ra, - NRaC(=G)ORa, -NR¾(=0)N(R8)2, -OC(=0)Ra, -OC(=0)ORa, or ~OC(=0)N(Ra)2;
each instance of Ra is independently hydrogen, optionally substituted acyl, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl, a nitrogen protecting group when attached to a nitrogen atom, an oxygen protecting group when attached to an oxygen atom, or a sulfur protecting group when attached to a sulfur atom, or two instances of Ra are joined to form a substituted or unsubstituted, heterocyclic ring, or substituted or unsubstituted, heteroaryl ring;
each of al and bl is independently 0, 1, 2, 3, 4, 5, or 6, as valency permits;
L2 is -0-, -S-, -NRL2-, ib -NRuC(=€>)- ib -C(=0)NRL2-/m; wherein lb indicates the point of attachment is to Ring B; and lm indicates the point of attachment is to the heteroaryl ring with M;
X is a bond, -0-, -S-, -NRLX-, xm O l X!!, xm -8--€Η2-, or xm -NRLX-CH2- x"; wherein xa indicates the point of attachment is to Ring A; and TOi indicates the point of attachment is to the heteroaryl ring with M;
each of RL2 and RLX is independently hydrogen, optionally substituted Cj-6 alkyl, or a nitrogen protecting group; is an of Formulae (i-l)-(i-41):
Figure imgf000266_0001
Figure imgf000266_0002
Figure imgf000267_0001
LJ is a bond or an optionally substituted C]-4 hydrocarbon chain, optionally wherein one or more carbon units of the hydrocarbon chain are independently replaced with -C=0 , -0-, -S-, -NRL3a~, -KRi ;, C( -())-, -C(-0)NRL3a~, -SC(=0)-, -C(=0)S-, -OC(=0)-, -
C(=0)0-, ~NR C(=S)-, -C .
Figure imgf000267_0002
C C-., -S(=0)-, -S(=0)0-, -OS(=0)-, L3a , L3a.
S(=0)-, -S(=0)2-
S(=0)20-, -OS(-())2-. -S(=0)2NR or -NRL-aS(-0)2-, wherein L-a is hydrogen, optionally substituted Q-s alkyl, or a nitrogen protecting group, and wherein each occurrence of RL3° is independently hydrogen, halogen, optionally substituted alkyl, optionally substituted aikenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, or optionally substituted heteroaryl, or two RL3b groups are joined to form an optionally substituted carbocyclic or optionally substituted heterocyclic ring;
L4 is a bond or an optionally substituted, branched or unbranched Ci.g hydrocarbon chain; each of RE1, RE2, and REj is independently hydrogen, halogen, optionally substituted alkyl, optionally substituted aikenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl, -CN, -CH2OREE, -CH2N(REE)2, -CH2SREE, - OR , -N(R )2, -Si(R and -SR , wherein each occurrence of R is
independently hydrogen, optionally substituted alkyl, optionally substituted alkoxy, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyi, optionally substituted aryl, or optionally substituted heteroaryl, or two REE groups are joined to form an optionally substituted heterocyclic ring;
or RF' and RE3, or RFJ and RF3, or REi and RFJ are joined to form an optionally substituted earbocyclic or optionally substituted heterocyclic ring;
RE4 is a leaving group;
RE5 is halogen;
RF'6 is hydrogen, optionally substituted Ci_6 alkyl, or a nitrogen protecting group;
each instance of Y is independently O, S, or NRE7, wherein RE7 is hydrogen, optionally substituted Ci .g alkyl, or a nitrogen protecting group;
a is 1 or 2; and
each instance of z is independently 0, 1 , 2, 3, 4, 5, or 6, as valency permits.
22. A compound of Formula II):
Figure imgf000268_0001
M is O, S, or RM;
RM is hydrogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyi, optionally substituted aryl, optionally substituted heteroaryl , optionally substituted acyl, or a nitrogen protecting group;
Ring A is optionally substituted monocyclic carbocyclyl, optionally substituted monocyclic heterocyclyi, optionally substituted phenyl, or optionally substituted monocyclic heteroaryl;
Ring B is optionally substituted monocyclic carbocyclyl, optionally substituted monocyclic heterocyclyi, optionally substituted phenyl, or optionally substituted monocyclic heteroaryl; each instance of RA and RB is independently hydrogen, halogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryi, -OR8, -N(R3)2, --SRa, -CN, --SCN, -C(= R3)Ra, -C(=NRa)GRa, - C(=NRa)N(Ra)2, -C(=0)Ra, C( -())() \ -C(===G)N(Ra)2, -N02, -NRaC(=0)Ra, - RaC(-0)ORa, - RaC(=0)N(Ra)2, -OC(-0)Ra, -OC(-0)ORa, or -OC(-0)N(Ra)2;
each instance of Ra is independently hydrogen, optionally substituted acyl, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryi, a nitrogen protecting group when attached to a nitrogen atom, an oxygen protecting group when attached to an oxygen atom, or a sulfur protecting group when attached to a sulfur atom, or two instances of Ra are joined to fonn a substituted or unsubstituted, heterocyclic ring, or substituted or imsubstituted, heteroaryi ring;
each of al and bl is independently 0, 1, 2, 3, 4, 5, or 6, as valency permits;
L is -0-, S L2 lb .NRL2C( = Im lb w- wherein io indicates the point of attachment is to Ring B; and Im indicates the point of attachment is to the heteroaryi ring with M;
X is -0-, -S-, -NRLX-, -0-CH2-xa, xm S Ci h x: or xm - RLX-CH2- xa; wherein xa indicates the point of attachment is to Ring A; and xm indicates the point of attachment is to the heteroaryi ring with M;
each of R1"2 and RL is independently hydrogen, optionally substituted Q.6 alkyl, or a nitrogen protecting group;
R' is an of Formulae (i-l)~(i~41):
Figure imgf000269_0001
(i-7) (i-9)
Figure imgf000270_0001
268
Figure imgf000271_0001
(Ml)
wherein:
L3 is a bond or an optionally substitated C 1-4 hydrocarbon chain, optionally wherein one or more carbon units of the hydrocarbon chain are independently replaced with -C=0- , -0-, -S-, -NRL3e-, -NRUaC(=0)-, -C(==Q)NRL3a-5 -SC(=0)-, -C(=0)S-, -0C(=O)-, - C(O)0-, -NRL3aC(=S)-, -C(=S)NRL3a-, trans -CRL3b^CRLih-, c¾-CRL3b-CRL3b-, - OC-, -S(=0)-, -S(=0)0-, -OS(=0)~, -S(=0)NRL3a-, -NRL3aS(=0)-, -S(=0)2-, - S(=0)20-, -OS(=0)2-, -S(0)2NRL3\ or ~NRL3aS(=0)2-, wherein RL3a is hydrogen, optionally substituted C e alkyl, or a nitrogen protecting group, and wherein each occurrence of RL3° is independently hydrogen, halogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, or optionally substituted heteroaryl, or two RL3 groups are joined to form an optionally substituted carbocyclic or optionally substituted heterocyclic ring;
L4 is a bond or an optionally substitated, branched or unbranched Q.6 hydrocarbon chain; each of RE!, RE2, and RE3 is independently hydrogen, halogen, optionally substitated alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl, -CN, -C¾OREE, -CH2N(REE)2, -CH2SREE, - OR , -N(Rtt)2, ~Si(Rtfi)3, and -SR , wherein each occurrence of R ' is
independently hydrogen, optionally substituted alkyl, optionally substituted alkoxy, optionally substituted alkenyl, optionally substituted alkynyl, optionally substitated carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, or optionally substituted heteroaryl, or two REE groups are joined to form an optionally- substituted heterocyclic ring;
or REi and REj, or RE2 and RE3, or RE! and RE2 are joined to form an optionally substituted carbocyclic or optionally substituted heterocyclic ring;
RE4 is a leaving group;
RE5 is halogen; R ' is hydrogen, optionally substituted Q .& alkyl, or a nitrogen protecting group; each instance of Y is independently O, S, or NRE?, wherein RE is hydrogen, optionally substituted Cj..6 alkyl, or a nitrogen protecting group;
a is 1 or 2; and
each instance of z is independently 0, 1 , 2, 3, 4, 5, or 6, as valency permits. 13. The compound of claim 21, wherein the compound is the formula:
Figure imgf000272_0001
or a pharmaceutically acceptable salt thereof.
24. The compound of any one of claims 21 -23, or a pharmaceutically acceptable salt thereof, wherein the Ring B is optionally substituted monocyclic heterocyclyl.
25. The compound of any one of claims 21-24, or a pharmaceutically acceptable salt thereof, wherein the Ring B is optionally substituted piperidinyl.
26. The compound of claim 25, wherein the compound is of Formula (Il-i):
Figure imgf000272_0002
or a phannaceuiically acceptable salt thereof.
27. The compound of any one of claims 21-23, or a pharmaceutically acceptable salt thereof, wherein the Ring B is optionally substituted monocyclic carbocyclyl.
28. The compound of any one of claims 21-23 and 27, or a phannaceuiically acceptable salt thereof, wherein the Ring B is optionally substituted cyclohexyl.
29. The compound of claim 27, wherein the compound is of Formula (II-iii):
Figure imgf000273_0001
or a pharmaceutically acceptable salt thereof.
30. The compound of claim 23, wherein the compound is of Formula (Il-ii):
Figure imgf000273_0002
or a pharmaceutically acceptable salt thereof.
31. The compound of any one of claims 1-30, or a pharmaceutically acceptable salt thereof, wherein Ring A is optionally substituted monocyclic heteroaryl.
32. The compound of any one of claims 1-30, or a pharmaceutically acceptable salt thereof, wherein Ring A is optionally substituted 6-membered heteroaryl.
33. The compound of any one of claims 1-30, or a pharmaceutically acceptable salt thereof, wherein Ring A is optionally substituted 5-membered heteroaryl.
34. The compound of any one of claims 1-30, or a pharmaceutically acceptable salt thereof, wherein Ring A is of the formula:
Figure imgf000273_0003
wherein:
each of Vi0, Vu, V12, V13, and V14 is independently be O, S, , RAi, C, or CRA2, as valency permits;
each instance of RAi is independently selected from the group consisting of hydrogen, substituted or unsubstituted acyi, substituted or unsubstituted alkyl, substituted or unsubstituted alkenyl, substituted or unsubstituted alkynyl, substituted or unsubstituted carbocyelyl, substituted or unsubstituted heterocyclyl, substituted or unsubstituted aryl, substituted or unsubstituted heteroaryl, and a nitrogen protecting group;
each instance of RA2 is independently selected from, the group consisting of hydrogen, halogen, substituted or unsubstituted acyl, substituted or unsubstituted alkyl, substituted or unsubstituted alkenyl, substituted or unsubstituted alkyn l, substituted or unsubstituted carbocyelyl, substituted or unsubstituted heterocyclyl, substituted or unsubstituted aryl, substituted or unsubstituted heteroaryl, -CN, -ORA , -NCR^3)^ and -SRA2a; and
each occurrence of R^a is independently selected from the group consisting of hydrogen, substituted or unsubstituted acyl, substituted or unsubstituted alkyl, substituted or unsubstituted alkenyl, substituted or unsubstituted alkynyl, substituted or unsubstituted carbocyelyl, substituted or unsubstituted heterocyclyl, substituted or unsubstituted aryl, substituted or unsubstituted heteroaryl, a nitrogen protecting group when attached to a nitrogen atom., an oxygen protecting group when attached to an oxygen, atom, and a sulfur protecting group when attached to a sulfur atom, or two RA groups are joined to form a substituted or unsubstituted heterocyclic ring.
35. The compound of claim 34, or a pharmaceutically acceptable salt thereof, wherein Ring A is of the formula:
Figure imgf000274_0001
36. The compound of claim 34, or a pharmaceutically acceptable salt thereof, wherein Ring A is of the formula:
Figure imgf000274_0002
37. The compound of any one of claims 34-36, or a pharmaceutically acceptable salt thereof, wherein RA2 is optionally substituted alkyl.
38. The compound of claim 26, or a pharmaceuticaily acceptable salt thereof, wherein RA2 is unsubstituted alkyl.
39. The compound of claim 34, or a pharmaceutically acceptable salt thereof, wherein Ring A is of the formula:
Figure imgf000275_0001
40. The compound of any one of claims 1-30, or a pharmaceutically acceptable salt thereof, wherein Ring A is optionally substituted phenyl.
The compound of claim 40, or a pharmaceutically acceptable salt thereof, wherein is unsubstituted phenyl.
42. The compound of claim 40, or a pharmaceutically acceptable salt thereof, wherein Ring A is substituted phenyl.
43. The compound of claim 40, or a pharmaceutically acceptable salt thereof, wherein Ring A is mono-substituted phenyl.
44. The compound of claim 43, or a pharmaceutically acceptable salt thereof, wherein Ring A is ortho-substituted phenyl of the formula:
Figure imgf000275_0002
45. The compound of claim 43, or a pharmaceutically acceptable salt thereof, wherein Ring A is meta-substituted phenyl of the formula:
Figure imgf000276_0001
46, The compound of claim 43, or a pharmaceutically acceptable salt thereof, wherein Ring A is para-substituted phenyl of the formula:
Figure imgf000276_0002
47. The compound of any one of claims 1-30, or a pharmaceutically acceptable salt thereof, wherein Ring A is optionally substituted monocyclic carboc clyl.
48. The compound of any one of claims 1-30, or a pharmaceutically acceptable salt thereof, wherem Ring A is optionally substituted cyclylhexyl.
49. The compound of any one of claims 1-30, or a pharmaceutically acceptable salt thereof, wherein Ring A is opiionally substituted monocyclic heterocyclyl.
50. The compound of any one of claims 1-30, or a pharmaceutically acceptable salt thereof, wherein Ring A is optionally substituted 5-membered heterocyclyl.
51. The compound of any one of claims 1 -30, or a pharmaceutically acceptable salt thereof, wherein Ring A is optionally substituted 6-membered heterocyclyl.
52. The compound of any one of claims 1-30, or a pharmaceutically acceptable salt thereof, wherem Ring A is optionally substituted 6-membered heterocyclyl with one heteroatom selected from the group of S, O, and N.
53. The compound of claim 52, or a pharmaceutically acceptable salt thereof, wherein Ring A is optionally substituted piperidinyl. 54, The compound of claim 51 , or a pharmaceutically acceptable salt thereof, wherein Ring is optionally substituted πιοφΐιο]^!, tetrahydropyranyi or piperazinyl.
55. The compound of any one of claims 1-30, or a pharmaceutically acceptable salt thereof, wherein Ring A is optionally substituted 6-membered heteroaryl.
56. The compound of claim 55, or a pharmaceutically acceptable salt thereof, wherein Ring A is optionally substituted pyridine or optionally substituted pyrirnidine.
57. The compound of claim 1 , or a pharmaceutically acceptable salt thereof, wherein Ll C\ or " S(-O b !'
58. The compound of any one of claims 1-5757, or a pharmaceutically acceptable salt thereof, wherein L1 is -C(=Q)-.
59. The compound of any one of claims 1-57, or a pharmaceutically acceptable salt thereof, wherein L! is -NRLI-.
60. The compound of any one of claims 1-57, or a pharmaceutically acceptable salt thereof, wherein L1 is " C)C(-(>)
61. The compound of any one of claims 1-57, or a pharmaceutically acceptable salt thereof, wherein L1 is lc -C(=0)0- ih.
62. The compound of any one of claims 1-57, or a pharmaceutically acceptable salt thereof, wherein L! is fc -NRLiC(-0 - '%
63. The compound of any one of claims 1-57, or a pharmaceutically acceptable salt thereof, wherein L1 is /c -C(=0)NRLl- ¾.
64. The compound of any one of claims 1-6363, or a pharmaceutically acceptable salt thereof, wherem RL1 is hydrogen.
65. The compound of any one of claims 1-63, or a pharmaceutically acceptable salt thereof, wherein L2 is lh K R! '(.'(-())
66. The compound of any one of claims 1-63, or a pharmaceutically acceptable salt thereof, wherein L2 is lb -C(0)NRL2- /m
67. The compound of any one of claims 1-63, or a pharmaceutically acceptable salt thereof, wherein If is -NRL2-.
68. The compound of any one of claims 1-67, or a pharmaceutically acceptable salt thereof, wherein RL2 is hydrogen.
69. The compound of claim 1, or a pharmaceutically acceptable salt thereof, wherein X is xtn-CH2C -xa, xm ! l CI ! '", xm C\ h N Ri X " xm C\ h O CH2 "', or xm -CH2..NRLX- CH2-
70. The compound of claim 1, or a pharmaceutically acceptable salt thereof, wherein X is xm S C("(})C! S2 v".
71. The compound of claim 21 , or a pharmaceutically acceptable salt thereof, wherein X is a bond.
72. The compound of any one of claims 1 -7171 , or a pharmaceutically acceptable salt thereof, wherein X is xm ~S~-CH2~-xa.
73. The compound of any one of claims 1-71, or a pharmaceutically acceptable salt thereof, wherein X is '"" NRi X Ci b v".
74. The compound of any one of claims 1 ~71 , or a pharmaceutically acceptable salt thereof, wherein X is -NRLX-,
75. The compound of any one of claims 73-74, or a pharmaceutically acceptable salt thereof, wherein RLX is hydrogen.
76. The compound of any one of claims 1-75, or a pharrnaceuticaliy acceptable salt thereof, wherein R1 is hydrogen.
77. The compound of any one of claims 1-75, or a pharmaceutically acceptable salt thereof* wherein R1 is halogen.
78. The compound of any one of claims 1-75, or a pharmaceutically acceptable salt thereof, wherein R! is F.
79. The compound of any one of claims 1-75, or a pharmaceutically acceptable salt thereof, wherein R1 is Ci.
80. The compound of any one of claims 1-75, or a pharmaceutically acceptable salt thereof, wherein R1 is Br.
81. The compound of any one of claims 1 -75, or a pharmaceutically acceptable salt thereof, wherein R! is I.
82. The compound of any one of claims 1-81, or a pharmaceutically acceptable salt thereof, wherein R2 comprises a dirnethylamino group.
83. The compound of claim 82, or a pharmaceutically acceptable salt thereof, wherein R is of Formula (i-1):
Figure imgf000279_0001
84. The compound of claim 83, or a pharmaceutically acceptable salt thereof, wherein ^ is of one of the following formulae:
Figure imgf000279_0002
Figure imgf000280_0001
85, The compound of any one of claims 1-84, or a pharmaceutically accep table salt thereof, wherein a 1 is 0.
86. The compound of any one of claims 1-84, or a pharmaceutically acceptable salt thereof, wherein al is 1.
87. The compound of any one of claims 1-84, or a pharmaceutically acceptable salt thereof, wherein bl is 0.
88. The compound of any one of claims 1-84, or a phannaceutically acceptable salt thereof, wherein bi is 1.
89. The compound of any one of claims 1-84, or a phannaceutically acceptable salt thereof, wherein cl is 0.
90. The compound of any one of claims 1-84, or a pharmaceutically acceptable salt thereof, wherein cl is 1.
Figure imgf000281_0001
Figure imgf000281_0002
279
Figure imgf000282_0001
or a p ami&cewiiealiy acceptable satt thereof.
92. The coiapoand o claim I or 2, wtesin. he co pound is · of one of it® following i rrouiae:
Figure imgf000282_0002
Figure imgf000283_0001
Figure imgf000283_0002
Figure imgf000284_0001
Figure imgf000285_0001
Figure imgf000285_0002
Figure imgf000286_0001
Figure imgf000286_0002
ΥϋΙ:·01··0$7·1
YLIU-01 -078-1
Figure imgf000286_0003
YUU-01-1
Figure imgf000286_0004
YUU-01-1S1-1
YU -01 -114-1
Figure imgf000286_0005
YLIU-01-158-1 or salt fc¾>.
Figure imgf000287_0001
YLilK!1 50M
Figure imgf000287_0002
Figure imgf000288_0001
Figure imgf000289_0001
or s harisaceutscaily acce table salt th reo
Figure imgf000289_0002
B2 B3
Figure imgf000290_0001
S7 or a phamjaceytfcatly acce ta le salt here f.
95. The oispOiSid of claim 2! Of 22f hfirdii. the Cfttttpoti!H? is of One ofthe follown
Figure imgf000290_0002
TNZ-€§.B 7
Figure imgf000290_0003
THZCE-B*22 or ;> phanmceutieaUy acceptable salt thereof:
96. A pharmaceutics!, com osite comprising a compound of any oao of claims I. -95, or a pharmaceuticall acceptable salt thereof, and optionally a pharmaceutically acceptable excioieat.
97. The pharmaceutical composition of claim 96, or a pharmaceutically acceptable salt thereof, wherem the pharmaceutical composition comprises a therapeutically effective amount of the compound for use in treating a proliferative disease in a subject in need thereof.
98. A method of treating a proliferative disease in a subject in need thereof, the method comprising administering to the subject a therapeutically effective amount of a compound of any of one claims 1-95, or a pharmaceutically acceptable salt thereof, or a pharmaceutical composition of any of one claims 95 or 96.
99. The method of claim. 98, wherein the subject is a mammal.
100. The method of claim 98, wherein the subject is a human.
101. The method of any of one claims 98-100, wherein the proliferative disease is associated with aberrant activities of a cyclin-dependent kinase (CDK).
102. The method of claim 101, wherem the proliferative disease is associated with overexpression of a cyclin-dependent kinase.
103. The method of any one of claims 101-102, wherein the CDK is CDK 7.
104. The method of any one of claims 101-102, wherein the CDK is CDK 12.
105. The method of any one of claims 101-102, wherein the CDK is CDK 13.
106. The method of any of one claims 98-100, wherem the proliferative disease is associated with inhibition of apoptosis.
107. The method of any of one claims 98-105, wherein the proliferative disease is cancer.
108. The method of claim 108, wherein the proliferative disease is associated with overexpression of a Myc protein.
109. The method of claim 108, wherein the proliferative disease is leukemia.
110. The method of claim 108, wherein the proliferative disease is chronic lymphocytic leukemia (CLL).
111. The method of claim 108, wherein the proliferative disease is acute lymphoblastic leukemia (ALL).
1 12. The method of claim 108, wherein the proliferative disease is melanoma.
113. The method of claim 108, wherein the proliferative disease is Burkitt's lymphoma.
114. The method of claim 108, wherein the proliferative disease is multiple myeloma.
115. The method of claim 108, wherein the proliferative disease is bone cancer.
116. The method of claim 108, wherein the proliferative disease is colorectal cancer.
117. The method of claim 108, wherein the proliferative disease is osteosarcoma.
118. The method of claim 108, wherein the proliferative disease is breast cancer.
1 19. The method of claim 108, wherein the proliferative disease is triple-negative breast cancer (TNBC).
120. The method of claim 108, wherein the proliferative disease is Ewing's sarcoma.
121. The method of claim 108, wherein the proliferative disease is brain cancer.
122. The method of claim 108, wherein the proliferative disease is neuroblastoma.
123. The method of claim 108, wherein the proliferative disease is lung cancer.
124. The method of claim 108, wherein the proliferaiive disease is small cell lung cancer (SCLC).
125. The method of claim 108, wherem the proliferative disease is non-small cell lung cancer (NSCLC).
126. The method of claim 108, wherein the proliferative disease is a benign neoplasm.
127. The method of any one of claims 98-100, wherein the proliferative disease is associated with angiogenesis.
128. The method of any one of claims 98-100, wherein the proliferative disease is an inflammatory disease.
129. The method of any one of claims 98-100, wherein the proliferative disease is rheumatoid arthritis.
130. The method of any one of claims 98-100, wherein the proliferative disease is an autoinflammatory disease.
131. The method of any one of claims 98-100, wherein the proliferative disease is an autoimmune disease.
132. A method of inhibiting the activity of a cyclin-dependent kinase (CD ) in a biological sample or subject, the method comprising administering to the subject or contacting the biological sample with a therapeutically effective amount of a compound of any one of claims 1-95, or a pharmaceutically acceptable salt thereof, or a pharmaceutical composition of any one of claims 96 or 97.
133. The method of claim 132, wherem the cyclin-dependent kinase is cyclin-dependent kinase 7 (CDK7).
134. The method of claim 132, wherein the cyclm-dependent kinase is cyclm-dependent kinase 12 (CDK.12).
135. The method of claim 132, wherein the cyclm-dependent kinase is cyclin-dependent kinase 13 (CDK13).
136. The method of claim 133, wherein the compound is capable of covalently modifying Cys312 of CDK7.
137. The method of claim 134, wherein the compound is capable of covalently modifying Cysl039 of CDK12.
138. The method of claim 135, wherein the compound is capable of covalently modifying Cysl017 ofCDK13.
139. A method of inhibiting transcription in a biological sample or subject, the method comprising:
administering to the subject or contacting the biological sample with a therapeutically effective amount of a compound of any of one claims 1-95, or a pharmaceutically acceptable salt thereof, or a pharmaceutical composition of any of one claims 96 or 97.
140. The method of claim 139. wherein transcription is inhibited for MYC, KLF2. E2F2, CD 6, CCND3, E2F3, HNRPDL, TET1, or IL7R.
141. A method of inhibiting cell growth in a biological sample or subject, the method comprising:
administering to the subject or contacting the biological sample with a therapeutically effective amount of a compound of any one of claims 1-95, or a pharmaceutically acceptable salt thereof, or a pharmaceutical composition of any of one claims 96 or 97.
142. A method of inducing apoptosis of a cell in a biological sample or subject, the method comprising: administering to the subject or contacting the biological sample with a therapeutically effective amount of a compound of any one of claims 1-95, or a phannaceutically acceptable salt thereof, or a pharmaceutical composition of any one of claims 96 or 97.
143. The method of any one of claims 98-142, further comprising administering to the subject a therapeutically effective amount of one or more pharmaceutical agents in combination with the compound, the pharmaceutically acceptable salt thereof, or the pharmaceutical composition.
144. The method of any one of claims 98-142, further comprising administering to the subject or contacting the biological sample with a therapeutically effective amount of one or more pharmaceutical agents in combination with the compound, the pharmaceutically acceptable salt thereof, or the pharmaceutical composition.
145. The method of any one of claims 143-144, wherein the pharmaceutical agent is an anti-proliferative agent.
146. The method of any one of claims 143-144, wherein the pharmaceutical agent is an inhibitor of a cyclin-dependent kinase (CDK).
147. The method of claim 146, wherein the pharmaceutical agent is an inhibitor of a cyclin-dependent kinase 7 (CDK7).
148. The method of claim 146, wherein the pharmaceutical agent is an inhibitor of a cyclin-dependent kinase 12 (CDK12).
149. The method of claim. 146, wherein the pharmaceutical agent is an inhibitor of a cyclin-dependent kinase 13 (CDK13).
150. The method of claim 147, wherein the pharmaceutical agent is capable of covalently modifying Cys312 of CDK7.
151. The method of claim 148, wherein the pharmaceutical agent is capable of covalently modifying Cysl039 of CDK.12.
152. The method of claim 149, wherein the pharmaceutical agent is capable of covalently modifying Cysl017 of CDK13.
153. A kit comprising :
a compound of any one of claims 1-95, or a pharmaceutically acceptable salt thereof, or a phannaceutical composition of any one of claims 96 or 97; and
instructions for administering to a subject or contacting a biological sample with the
compound, or a pharmaceutically acceptable salt thereof, or the pharmaceutical composition.
PCT/US2016/051118 2015-09-09 2016-09-09 Inhibitors of cyclin-dependent kinases Ceased WO2017044858A2 (en)

Priority Applications (8)

Application Number Priority Date Filing Date Title
CA2996978A CA2996978A1 (en) 2015-09-09 2016-09-09 Inhibitors of cyclin-dependent kinases
JP2018512916A JP7028766B2 (en) 2015-09-09 2016-09-09 Inhibitor of cyclin-dependent kinase
EP21193645.5A EP4019515A1 (en) 2015-09-09 2016-09-09 Inhibitors of cyclin-dependent kinases
US15/758,982 US11142507B2 (en) 2015-09-09 2016-09-09 Inhibitors of cyclin-dependent kinases
AU2016319125A AU2016319125B2 (en) 2015-09-09 2016-09-09 Inhibitors of cyclin-dependent kinases
EP16845194.6A EP3347018B1 (en) 2015-09-09 2016-09-09 Inhibitors of cyclin-dependent kinases
US17/378,622 US20220055998A1 (en) 2015-09-09 2021-07-16 Inhibitors of cyclin-dependent kinases
JP2021127000A JP2022020611A (en) 2015-09-09 2021-08-02 Inhibitors of cyclin-dependent kinases

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201562216271P 2015-09-09 2015-09-09
US62/216,271 2015-09-09

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US15/758,982 A-371-Of-International US11142507B2 (en) 2015-09-09 2016-09-09 Inhibitors of cyclin-dependent kinases
US17/378,622 Division US20220055998A1 (en) 2015-09-09 2021-07-16 Inhibitors of cyclin-dependent kinases

Publications (2)

Publication Number Publication Date
WO2017044858A2 true WO2017044858A2 (en) 2017-03-16
WO2017044858A3 WO2017044858A3 (en) 2017-04-27

Family

ID=58240329

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2016/051118 Ceased WO2017044858A2 (en) 2015-09-09 2016-09-09 Inhibitors of cyclin-dependent kinases

Country Status (6)

Country Link
US (2) US11142507B2 (en)
EP (2) EP3347018B1 (en)
JP (2) JP7028766B2 (en)
AU (1) AU2016319125B2 (en)
CA (1) CA2996978A1 (en)
WO (1) WO2017044858A2 (en)

Cited By (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2019099298A1 (en) 2017-11-16 2019-05-23 Eli Lilly And Company Compounds useful for inhibiting cdk7
WO2019213403A1 (en) 2018-05-02 2019-11-07 Kinnate Biopharma Inc. Inhibitors of cyclin-dependent kinases
WO2020046770A1 (en) * 2018-08-31 2020-03-05 Institute For Cancer Research D/B/A The Research Institute Of Fox Chase Cancer Center Kinase activity in tumors
EP3534899A4 (en) * 2016-11-03 2020-04-29 Corvus Pharmaceuticals, Inc. COMPOUNDS AND METHODS FOR MODULATION OF INTERLEUKIN-INDUCIBLE T-CELL KINASE
EP3694528A4 (en) * 2017-10-13 2021-07-28 The Regents of the University of California MTORC1 MODULATORS
WO2021242602A1 (en) 2020-05-27 2021-12-02 Eli Lilly And Company Compounds useful for inhibiting cdk7
US11390618B2 (en) 2018-06-29 2022-07-19 Kinnate Biopharma Inc. Inhibitors of cyclin-dependent kinases
US11878968B2 (en) 2021-07-09 2024-01-23 Plexium, Inc. Aryl compounds and pharmaceutical compositions that modulate IKZF2
WO2024140653A1 (en) * 2022-12-27 2024-07-04 南京圣和药业股份有限公司 Selective cdk12/13 inhibitor and application thereof
US12084453B2 (en) 2021-12-10 2024-09-10 Incyte Corporation Bicyclic amines as CDK12 inhibitors

Families Citing this family (16)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2937345B1 (en) 2009-12-29 2018-03-21 Dana-Farber Cancer Institute, Inc. Type ii raf kinase inhibitors
WO2013074986A1 (en) 2011-11-17 2013-05-23 Dana-Farber Cancer Institute, Inc. Inhibitors of c-jun-n-terminal kinase (jnk)
US10112927B2 (en) 2012-10-18 2018-10-30 Dana-Farber Cancer Institute, Inc. Inhibitors of cyclin-dependent kinase 7 (CDK7)
US9758522B2 (en) 2012-10-19 2017-09-12 Dana-Farber Cancer Institute, Inc. Hydrophobically tagged small molecules as inducers of protein degradation
WO2015058126A1 (en) 2013-10-18 2015-04-23 Syros Pharmaceuticals, Inc. Heteroaromatic compounds useful for the treatment of prolferative diseases
WO2015058140A1 (en) 2013-10-18 2015-04-23 Dana-Farber Cancer Institute, Inc. Polycyclic inhibitors of cyclin-dependent kinase 7 (cdk7)
AU2015371251B2 (en) 2014-12-23 2020-06-11 Dana-Farber Cancer Institute, Inc. Inhibitors of cyclin-dependent kinase 7 (CDK7)
CN107427521B (en) 2015-03-27 2021-08-03 达纳-法伯癌症研究所股份有限公司 Inhibitors of cyclin-dependent kinases
EP3307728A4 (en) 2015-06-12 2019-07-17 Dana Farber Cancer Institute, Inc. ASSOCIATION THERAPY USING TRANSCRIPTION INHIBITORS AND KINASE INHIBITORS
AU2017254702B2 (en) * 2016-04-22 2020-12-24 Dana-Farber Cancer Institute, Inc. Degradation of cyclin-dependent kinase 9 (CDK9) by conjugation of CDK9 inhibitors with E3 ligase ligand and methods of use
EP3544971B1 (en) 2016-11-22 2022-07-06 Dana-Farber Cancer Institute, Inc. Inhibitors of cyclin-dependent kinase 12 (cdk12) and uses thereof
JP7590185B2 (en) 2018-06-25 2024-11-26 ダナ-ファーバー キャンサー インスティテュート, インコーポレイテッド TAIRE FAMILY KINASE INHIBITORS AND USES THEREOF - Patent application
WO2020140098A1 (en) 2018-12-28 2020-07-02 Dana-Farber Cancer Institute, Inc. Inhibitors of cyclin-dependent kinase 7 and uses thereof
CN116802178A (en) * 2020-11-20 2023-09-22 耶路撒冷希伯来大学伊萨姆研发有限公司 Inhibitors of IGF2BP1-RNA binding
CA3199617A1 (en) * 2020-11-20 2022-05-27 Vladimir Spiegelman Inhibitors of igf2bp1-rna binding
CN117447466A (en) * 2022-07-19 2024-01-26 中国科学院上海药物研究所 Oxazole compounds and their preparation methods and uses

Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6214852B1 (en) 1998-10-21 2001-04-10 Bristol-Myers Squibb Company N-[5-[[[5-alkyl-2-oxazolyl]methyl]thio]-2-thiazolyl]-carboxamide inhibitors of cyclin dependent kinases
WO2004074283A1 (en) 2003-02-21 2004-09-02 Pfizer Inc. N-heterocyclyl-substituted amino-thiazole derivatives as protein kinase inhibitors
WO2008049856A2 (en) 2006-10-25 2008-05-02 Ingenium Pharmaceuticals Gmbh Methods of treating pain using cdk inhibitors
WO2015058140A1 (en) 2013-10-18 2015-04-23 Dana-Farber Cancer Institute, Inc. Polycyclic inhibitors of cyclin-dependent kinase 7 (cdk7)

Family Cites Families (276)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB796524A (en) 1956-03-21 1958-06-11 Hickson & Welch Ltd Improvements in or relating to optical whitening agents
US4231938A (en) 1979-06-15 1980-11-04 Merck & Co., Inc. Hypocholesteremic fermentation products and process of preparation
US4270537A (en) 1979-11-19 1981-06-02 Romaine Richard A Automatic hypodermic syringe
WO1984002131A1 (en) 1982-11-22 1984-06-07 Sandoz Ag Analogs of mevalolactone and derivatives thereof, processes for their production, pharmaceutical compositions containing them and their use as pharmaceuticals
US4828991A (en) 1984-01-31 1989-05-09 Akzo N.V. Tumor specific monoclonal antibodies
US4596556A (en) 1985-03-25 1986-06-24 Bioject, Inc. Hypodermic injection apparatus
US4886499A (en) 1986-12-18 1989-12-12 Hoffmann-La Roche Inc. Portable injection appliance
GB8704027D0 (en) 1987-02-20 1987-03-25 Owen Mumford Ltd Syringe needle combination
US4790824A (en) 1987-06-19 1988-12-13 Bioject, Inc. Non-invasive hypodermic injection device
US4941880A (en) 1987-06-19 1990-07-17 Bioject, Inc. Pre-filled ampule and non-invasive hypodermic injection device assembly
US4940460A (en) 1987-06-19 1990-07-10 Bioject, Inc. Patient-fillable and non-invasive hypodermic injection device assembly
US4885314A (en) 1987-06-29 1989-12-05 Merck & Co., Inc. Novel HMG-CoA reductase inhibitors
US4782084A (en) 1987-06-29 1988-11-01 Merck & Co., Inc. HMG-COA reductase inhibitors
US5339163A (en) 1988-03-16 1994-08-16 Canon Kabushiki Kaisha Automatic exposure control device using plural image plane detection areas
FR2638359A1 (en) 1988-11-03 1990-05-04 Tino Dalto SYRINGE GUIDE WITH ADJUSTMENT OF DEPTH DEPTH OF NEEDLE IN SKIN
US5312335A (en) 1989-11-09 1994-05-17 Bioject Inc. Needleless hypodermic injection device
US5064413A (en) 1989-11-09 1991-11-12 Bioject, Inc. Needleless hypodermic injection device
US5420245A (en) 1990-04-18 1995-05-30 Board Of Regents, The University Of Texas Tetrapeptide-based inhibitors of farnesyl transferase
US5190521A (en) 1990-08-22 1993-03-02 Tecnol Medical Products, Inc. Apparatus and method for raising a skin wheal and anesthetizing skin
US5527288A (en) 1990-12-13 1996-06-18 Elan Medical Technologies Limited Intradermal drug delivery device and method for intradermal delivery of drugs
US5747469A (en) 1991-03-06 1998-05-05 Board Of Regents, The University Of Texas System Methods and compositions comprising DNA damaging agents and p53
GB9118204D0 (en) 1991-08-23 1991-10-09 Weston Terence E Needle-less injector
SE9102652D0 (en) 1991-09-13 1991-09-13 Kabi Pharmacia Ab INJECTION NEEDLE ARRANGEMENT
US5328483A (en) 1992-02-27 1994-07-12 Jacoby Richard M Intradermal injection device with medication and needle guard
US5383851A (en) 1992-07-24 1995-01-24 Bioject Inc. Needleless hypodermic injection device
US5569189A (en) 1992-09-28 1996-10-29 Equidyne Systems, Inc. hypodermic jet injector
US5334144A (en) 1992-10-30 1994-08-02 Becton, Dickinson And Company Single use disposable needleless injector
EP0604181A1 (en) 1992-12-21 1994-06-29 Eli Lilly And Company Antitumor compositions and method of treatment
WO1994019357A1 (en) 1993-02-23 1994-09-01 Merrell Dow Pharmaceuticals Inc. Farnesyl:protein transferase inhibitors as anticancer agents
CA2118985A1 (en) 1993-04-02 1994-10-03 Dinesh V. Patel Heterocyclic inhibitors of farnesyl protein transferase
WO1994026723A2 (en) 1993-05-14 1994-11-24 Genentech, Inc. ras FARNESYL TRANSFERASE INHIBITORS
US5602098A (en) 1993-05-18 1997-02-11 University Of Pittsburgh Inhibition of farnesyltransferase
WO1995008542A1 (en) 1993-09-22 1995-03-30 Kyowa Hakko Kogyo Co., Ltd. Farnesyltransferase inhibitor
EP0723539B1 (en) 1993-10-15 2001-12-12 Schering Corporation Tricyclic sulfonamide compounds useful for inhibition of g-protein function and for treatment of proliferative diseases
US5661152A (en) 1993-10-15 1997-08-26 Schering Corporation Tricyclic sulfonamide compounds useful for inhibition of G-protein function and for treatment of proliferative diseases
SG48750A1 (en) 1993-10-15 1998-05-18 Schering Corp Tricyclic carbonate compounds useful for inhabition of g-protein function for treatment of proliferative diseases
US5721236A (en) 1993-10-15 1998-02-24 Schering Corporation Tricyclic carbamate compounds useful for inhibition of G-protein function and for treatment of proliferative diseases
IL111235A (en) 1993-10-15 2001-03-19 Schering Plough Corp Pharmaceutical compositions for inhibition of g-protein function and for treatment of proliferative diseases containing tricyclic compounds some such compounds and process for preparing part of them
US5719148A (en) 1993-10-15 1998-02-17 Schering Corporation Tricyclic amide and urea compounds useful for inhibition of g-protein function and for treatment of proliferative diseases
FI961621L (en) 1993-10-25 1996-04-12 Parke Davis & Co Protein: substituted tetra- and pentapeptide inhibitors of farnesyl transferase
DE69417012T2 (en) 1993-11-04 1999-10-07 Abbott Laboratories, Abbott Park CYCLOBUTAN DERIVATIVES AS INHIBITORS OF SQUALEN SYNTHETASE AND PROTEIN-FARNESYLTRANSFERASE
US5783593A (en) 1993-11-04 1998-07-21 Abbott Laboratories Inhibitors of squalene synthetase and protein farnesyltransferase
WO1995012612A1 (en) 1993-11-05 1995-05-11 Warner-Lambert Company Substituted di- and tripeptide inhibitors of protein:farnesyl transferase
US5484799A (en) 1993-12-09 1996-01-16 Abbott Laboratories Antifungal dorrigocin derivatives
WO1995024176A1 (en) 1994-03-07 1995-09-14 Bioject, Inc. Ampule filling device
US5466220A (en) 1994-03-08 1995-11-14 Bioject, Inc. Drug vial mixing and transfer device
HUT77406A (en) 1994-03-15 1998-04-28 Eisai Co., Ltd., Peptidomimetics containing 1- (4-Amino-5-thio-pent-2-en) -yl side chain and pharmaceutical compositions containing them
US6312699B1 (en) 1994-03-28 2001-11-06 Uab Research Foundation Ligands added to adenovirus fiber
AU1615895A (en) 1994-03-31 1995-10-12 Bristol-Myers Squibb Company Imidazole-containing inhibitors of farnesyl protein transferase
US5523430A (en) 1994-04-14 1996-06-04 Bristol-Myers Squibb Company Protein farnesyl transferase inhibitors
US5510510A (en) 1994-05-10 1996-04-23 Bristol-Meyers Squibb Company Inhibitors of farnesyl protein transferase
US5563255A (en) 1994-05-31 1996-10-08 Isis Pharmaceuticals, Inc. Antisense oligonucleotide modulation of raf gene expression
JPH10501259A (en) 1994-06-10 1998-02-03 ローン−プーラン・ロレ・ソシエテ・アノニム Novel farnesyltransferase inhibitors, their preparation and pharmaceutical compositions containing them
US5571792A (en) 1994-06-30 1996-11-05 Warner-Lambert Company Histidine and homohistidine derivatives as inhibitors of protein farnesyltransferase
CA2155448A1 (en) 1994-08-11 1996-02-12 Katerina Leftheris Inhibitors of farnesyl protein transferase
AU3192395A (en) 1994-08-11 1996-03-07 Banyu Pharmaceutical Co., Ltd. Substituted amide derivative
AU3192495A (en) 1994-08-12 1996-03-07 Banyu Pharmaceutical Co., Ltd. N,n-disubstituted amic acid derivative
JPH10510261A (en) 1994-12-09 1998-10-06 ワーナー−ランバート・カンパニー Protein: substituted tetra- and pentapeptide inhibitors of farnesyltransferase
US5599302A (en) 1995-01-09 1997-02-04 Medi-Ject Corporation Medical injection system and method, gas spring thereof and launching device using gas spring
JP3929069B2 (en) 1995-01-12 2007-06-13 ユニバーシティ オブ ピッツバーグ Inhibitors of prenyltransferase
FR2729390A1 (en) 1995-01-18 1996-07-19 Rhone Poulenc Rorer Sa NOVEL FARNESYL TRANSFERASE INHIBITORS, THEIR PREPARATION AND THE PHARMACEUTICAL COMPOSITIONS CONTAINING THEM
FR2730492B1 (en) 1995-02-09 1997-03-14 Rhone Poulenc Rorer Sa NOVEL FARNESYL TRANSFERASE INHIBITORS, THEIR PREPARATION AND THE PHARMACEUTICAL COMPOSITIONS CONTAINING THEM
FR2730491B1 (en) 1995-02-09 1997-03-14 Rhone Poulenc Rorer Sa NOVEL FARNESYL TRANSFERASE INHIBITORS, THEIR PREPARATION AND THE PHARMACEUTICAL COMPOSITIONS CONTAINING THEM
US5684013A (en) 1995-03-24 1997-11-04 Schering Corporation Tricyclic compounds useful for inhibition of g-protein function and for treatment of proliferative diseases
US5700806A (en) 1995-03-24 1997-12-23 Schering Corporation Tricyclic amide and urea compounds useful for inhibition of G-protein function and for treatment of proliferative diseases
IL117580A0 (en) 1995-03-29 1996-07-23 Merck & Co Inc Inhibitors of farnesyl-protein transferase and pharmaceutical compositions containing them
CA2217351C (en) 1995-04-07 2003-03-18 Schering Corporation Carbonyl-piperazinyl and piperidinyl compounds which inhibit farnesyl protein transferase
IL117798A (en) 1995-04-07 2001-11-25 Schering Plough Corp Tricyclic compounds useful for inhibition of g-protein function and for treatment of proliferative diseases and pharmaceutical compositions comprising them
US5891872A (en) 1995-04-07 1999-04-06 Schering Corporation Tricyclic compounds
US5712280A (en) 1995-04-07 1998-01-27 Schering Corporation Tricyclic compounds useful for inhibition of G-protein function and for treatment of proliferative diseases
US5831115A (en) 1995-04-21 1998-11-03 Abbott Laboratories Inhibitors of squalene synthase and protein farnesyltransferase
IL118101A0 (en) 1995-05-03 1996-09-12 Abbott Lab Inhibitors of farnesyltransferase
WO1997000252A1 (en) 1995-06-16 1997-01-03 Warner-Lambert Company Tricyclic inhibitors of protein farnesyltransferase
FR2736641B1 (en) 1995-07-10 1997-08-22 Rhone Poulenc Rorer Sa NOVEL FARNESYL TRANSFERASE INHIBITORS, THEIR PREPARATION AND THE PHARMACEUTICAL COMPOSITIONS CONTAINING THEM
FR2736638B1 (en) 1995-07-12 1997-08-22 Rhone Poulenc Rorer Sa NOVEL FARNESYL TRANSFERASE INHIBITORS, THEIR PREPARATION AND THE PHARMACEUTICAL COMPOSITIONS CONTAINING THEM
CH690163A5 (en) 1995-07-28 2000-05-31 Symphar Sa Derivatives substituted gem-diphosphonates useful as anti-cancer.
PT874846E (en) 1995-11-01 2003-08-29 Novartis Ag PURINA DERIVATIVES AND PROCESSES FOR THEIR PREPARATION
WO1997017070A1 (en) 1995-11-06 1997-05-15 University Of Pittsburgh Inhibitors of protein isoprenyl transferases
JP2000500502A (en) 1995-11-22 2000-01-18 メルク エンド カンパニー インコーポレーテッド Farnesyl-protein transferase inhibitor
EE03484B1 (en) 1995-12-08 2001-08-15 Janssen Pharmaceutica N.V. Farnesyl Protein Transferase Inhibitory (5-Imidazolyl) Methyl-2-Quinolinone Derivatives and their Use
CZ292791B6 (en) 1995-12-22 2003-12-17 Schering Corporation Tricyclic amides useful for inhibition of G-protein function and for treatment of proliferative diseases
US5893397A (en) 1996-01-12 1999-04-13 Bioject Inc. Medication vial/syringe liquid-transfer apparatus
US6008372A (en) 1996-01-16 1999-12-28 Warner-Lambert Company Substituted dinaphthylmethyl and diheteroarylmethylacetyl histidine inhibitors of protein farnesyltransferase
US6673927B2 (en) 1996-02-16 2004-01-06 Societe De Conseils De Recherches Et D'applications Scientifiques, S.A.S. Farnesyl transferase inhibitors
CA2249601A1 (en) 1996-04-03 1997-10-23 Thorsten E. Fisher Inhibitors of farnesyl-protein transferase
IL126833A0 (en) 1996-05-22 1999-08-17 Warner Lambert Co Inhibitors of protein farnesyl transferase
AU709409B2 (en) 1996-07-15 1999-08-26 Bristol-Myers Squibb Company Thiadioxobenzodiazepine inhibitors of farnesyl protein transferase
US5866702A (en) 1996-08-02 1999-02-02 Cv Therapeutics, Incorporation Purine inhibitors of cyclin dependent kinase 2
AU5719598A (en) 1996-12-30 1998-07-31 Merck & Co., Inc. Inhibitors of farnesyl-protein transferase
AU6013998A (en) 1996-12-30 1998-07-31 Merck & Co., Inc. Inhibitors of farnesyl-protein transferase
US5993412A (en) 1997-05-19 1999-11-30 Bioject, Inc. Injection apparatus
US6040321A (en) * 1997-11-12 2000-03-21 Bristol-Myers Squibb Company Aminothiazole inhibitors of cyclin dependent kinases
US6262096B1 (en) * 1997-11-12 2001-07-17 Bristol-Myers Squibb Company Aminothiazole inhibitors of cyclin dependent kinases
JP2002536968A (en) 1999-01-29 2002-11-05 イムクローン システムズ インコーポレイティド Antibodies specific for KDR and uses thereof
GB9903762D0 (en) 1999-02-18 1999-04-14 Novartis Ag Organic compounds
GB9904387D0 (en) 1999-02-25 1999-04-21 Pharmacia & Upjohn Spa Antitumour synergistic composition
AU4972900A (en) 1999-04-08 2000-11-14 Arch Development Corporation Use of anti-vegf antibody to enhance radiation in cancer therapy
PE20010306A1 (en) 1999-07-02 2001-03-29 Agouron Pharma INDAZOLE COMPOUNDS AND PHARMACEUTICAL COMPOSITIONS CONTAINING THEM USEFUL FOR THE INHIBITION OF PROTEIN KINASE
BR0013899A (en) 1999-09-10 2003-07-08 Merck & Co Inc A compound, pharmaceutical composition, processes for treating or preventing cancer, a disease in which angiogenesis is implicated, retinal vascularization, diabetic retinopathy, age-related macular degeneration, inflammatory diseases, tyrosine-dependent disease or conditions. kinase, bone-associated pathologies, and processes for producing a pharmaceutical composition, and for reducing or preventing tissue damage following a cerebral ischemic event
KR20020088406A (en) 1999-09-17 2002-11-27 애보트 게엠베하 운트 콤파니 카게 Pyrazolopyrimidines as therapeutic agents
US6921763B2 (en) 1999-09-17 2005-07-26 Abbott Laboratories Pyrazolopyrimidines as therapeutic agents
MY125768A (en) * 1999-12-15 2006-08-30 Bristol Myers Squibb Co N-[5-[[[5-alkyl-2-oxazolyl]methyl]thio]-2-thiazolyl]-carboxamide inhibitors of cyclin dependent kinases
TWI284639B (en) 2000-01-24 2007-08-01 Shionogi & Co A compound having thrombopoietin receptor agonistic effect
JP4555547B2 (en) 2000-08-10 2010-10-06 ファイザー イタリア ソシエタ ア レスポンサビリタ リミタータ Bicyclic pyrazoles as kinase inhibitors, methods for preparing them and pharmaceutical compositions containing them
EP1377579B1 (en) 2000-10-31 2009-03-25 Aventis Pharmaceuticals Inc. Acyl and sulfonyl derivatives of 6,9-disubstituted 2-(trans-1,4-diaminocyclohexyl)-purines and their use as antiproliferative agents
US7429599B2 (en) 2000-12-06 2008-09-30 Signal Pharmaceuticals, Llc Methods for treating or preventing an inflammatory or metabolic condition or inhibiting JNK
EP1345925B1 (en) 2000-12-21 2006-05-17 Vertex Pharmaceuticals Incorporated Pyrazole compounds useful as protein kinase inhibitors
AU3113902A (en) * 2000-12-21 2002-07-01 Bristol Myers Squibb Co Thiazolyl inhibitors of tec family tyrosine kinases
FR2818642B1 (en) 2000-12-26 2005-07-15 Hoechst Marion Roussel Inc NOVEL DERIVATIVES OF PURINE, PROCESS FOR PREPARING THEM, THEIR USE AS MEDICAMENTS, PHARMACEUTICAL COMPOSITIONS AND THEIR NEW USE
MXPA03008560A (en) 2001-03-22 2004-06-30 Abbot Gmbh & Co Kg Single-stage pfc + ballast control circuit/general purpose power converter.
ES2292753T4 (en) 2001-03-29 2009-02-16 Vertex Pharmaceuticals Incorporated INHIBITORS OF N-TERMINAL KINASES C-JUN (JNK) AND OTHER PROTEIN KINASES.
JP2004534743A (en) 2001-04-09 2004-11-18 ロランティス リミテッド Hedgehog
US6881737B2 (en) 2001-04-11 2005-04-19 Amgen Inc. Substituted triazinyl acrylamide derivatives and methods of use
JP2002338537A (en) 2001-05-16 2002-11-27 Mitsubishi Pharma Corp Amide compounds and their pharmaceutical uses
CA2446756C (en) 2001-06-01 2011-03-08 Vertex Pharmaceuticals Incorporated Thiazole compounds useful as inhibitors of protein kinase
DE60232510D1 (en) 2001-06-15 2009-07-16 Vertex Pharma 5- (2-AMINOPYRIMIDIN-4-YL) BENZOXOXOLEA AS PROTEIN KINASE INHIBITOR
US6939874B2 (en) 2001-08-22 2005-09-06 Amgen Inc. Substituted pyrimidinyl derivatives and methods of use
US7115617B2 (en) 2001-08-22 2006-10-03 Amgen Inc. Amino-substituted pyrimidinyl derivatives and methods of use
WO2003026664A1 (en) 2001-09-26 2003-04-03 Bayer Corporation 2-phenylamino-4- (5-pyrazolylamino) -pyramidine derivatives as kinase inhibitors, in particular, src kinase inhibitors
AU2002353186A1 (en) 2001-12-19 2003-06-30 Smithkline Beecham P.L.C. (1-h-indazol-3-yl) -amide derivatives as gsk-3 inhibitors
FR2836915B1 (en) 2002-03-11 2008-01-11 Aventis Pharma Sa AMINOINDAZOLE DERIVATIVES, PREPARATION METHOD AND INTERMEDIATES THEREOF AS MEDICAMENTS AND PHARMACEUTICAL COMPOSITIONS COMPRISING THE SAME
AU2003231231A1 (en) 2002-05-06 2003-11-11 Bayer Pharmaceuticals Corporation Pyridinyl amino pyrimidine derivatives useful for treating hyper-proliferative disorders
JP4751063B2 (en) 2002-05-17 2011-08-17 ファイザー イタリア ソシエタ ア レスポンサビリタ リミタータ Aminoindazole derivatives active as kinase inhibitors, methods for their preparation, and pharmaceutical compositions containing them
AU2003279182A1 (en) 2002-06-19 2004-01-06 Bristol-Myers Squibb Company Use of compounds having an amine nucleus in manufacture of a medicament useful for treating factor viia-associated conditions
TW200401638A (en) * 2002-06-20 2004-02-01 Bristol Myers Squibb Co Heterocyclic inhibitors of kinases
EP1554269A1 (en) 2002-07-09 2005-07-20 Vertex Pharmaceuticals Incorporated Imidazoles, oxazoles and thiazoles with protein kinase inhibiting activities
TWI329112B (en) 2002-07-19 2010-08-21 Bristol Myers Squibb Co Novel inhibitors of kinases
GB0217757D0 (en) 2002-07-31 2002-09-11 Glaxo Group Ltd Novel compounds
DE10239042A1 (en) 2002-08-21 2004-03-04 Schering Ag New fused macrocyclic pyrimidine derivatives, useful as e.g. cyclin-dependent kinase inhibitors for treating e.g. cancer, autoimmune, cardiovascular or neurodegenerative diseases or viral infections
MXPA05002571A (en) 2002-09-04 2005-09-08 Schering Corp Pyrazolopyrimidines as cyclin-dependent kinase inhibitors.
CA2497544C (en) 2002-09-04 2010-11-02 Schering Corporation Pyrazolo[1,5-a]pyrimidines compounds as cyclin dependent kinase inhibitors
US7119200B2 (en) 2002-09-04 2006-10-10 Schering Corporation Pyrazolopyrimidines as cyclin dependent kinase inhibitors
US7205308B2 (en) 2002-09-04 2007-04-17 Schering Corporation Trisubstituted 7-aminopyrazolopyrimidines as cyclin dependent kinase inhibitors
CN100376580C (en) 2002-09-04 2008-03-26 先灵公司 Pyrazolopyrimidines as cyclin dependent kinase inhibitors
US20050250837A1 (en) 2002-10-18 2005-11-10 D Mello Santosh R Use of C-Raf inhibitors for the treatment of neurodegenerative diseases
US7737153B2 (en) 2002-10-28 2010-06-15 Bayer Schering Pharma Aktiengesellschaft Heteroaryloxy-substituted phenylaminopyrimidines as rho-kinase inhibitors
UA81790C2 (en) 2002-12-19 2008-02-11 Фармация Италия С.П.А. Substituted derivatives of pyrolopyrazol as kinaze inhibitors
FR2850022B1 (en) 2003-01-22 2006-09-08 Centre Nat Rech Scient NOVEL USE OF MIFEPRISTONE AND ITS DERIVATIVES AS MODULATORS OF THE HEDGEHOG PROTEIN SIGNALING PATH AND ITS APPLICATIONS
WO2004071440A2 (en) 2003-02-06 2004-08-26 Bristol-Myers Squibb Company Thiazolyl-based compounds useful as kinase inhibitors
KR20050115252A (en) 2003-02-28 2005-12-07 데이진 화-마 가부시키가이샤 Pyrazolo[1,5-a]pyrimidine derivatives
GB0304665D0 (en) 2003-02-28 2003-04-02 Teijin Ltd Compounds
GB0305142D0 (en) 2003-03-06 2003-04-09 Eisai London Res Lab Ltd Synthesis
GB0305559D0 (en) 2003-03-11 2003-04-16 Teijin Ltd Compounds
EP1605946B1 (en) 2003-03-25 2008-05-28 Vertex Pharmaceuticals Incorporated Thiazoles useful as inhibitors of protein kinases
US20070179161A1 (en) 2003-03-31 2007-08-02 Vernalis (Cambridge) Limited. Pyrazolopyrimidine compounds and their use in medicine
WO2004100868A2 (en) 2003-04-23 2004-11-25 Abbott Laboratories Method of treating transplant rejection
JP4810427B2 (en) 2003-05-22 2011-11-09 アボット・ラボラトリーズ Indazole, benzisoxazole and benzisothiazole kinase inhibitors
SE0301906D0 (en) 2003-06-26 2003-06-26 Astrazeneca Ab New compounds
WO2005012256A1 (en) 2003-07-22 2005-02-10 Astex Therapeutics Limited 3, 4-disubstituted 1h-pyrazole compounds and their use as cyclin dependent kinases (cdk) and glycogen synthase kinase-3 (gsk-3) modulators
US7442698B2 (en) 2003-07-24 2008-10-28 Amgen Inc. Substituted heterocyclic compounds and methods of use
WO2005011597A2 (en) 2003-07-29 2005-02-10 Irm Llc Compounds and compositions as protein kinase inhibitors
TWI378923B (en) 2003-08-15 2012-12-11 Novartis Ag Pyrimidine derivatives
WO2005037845A1 (en) 2003-10-17 2005-04-28 Rigel Pharmaceuticals, Inc. Benzothiazole and thiazole[5,5-b] pyridine compositions and their use as ubiquitin ligase inhibitors
WO2005037797A1 (en) 2003-10-21 2005-04-28 Pharmacia Corporation Substituted pyrazole urea compounds for the treatment of inflammation
PL1684750T3 (en) * 2003-10-23 2010-10-29 Ab Science 2-aminoaryloxazole compounds as tyrosine kinase inhibitors
DE10357510A1 (en) 2003-12-09 2005-07-07 Bayer Healthcare Ag Heteroaryl-substituted benzenes
BRPI0418031A (en) 2003-12-22 2007-04-17 Gilead Sciences Inc phosphonate-substituted kinase inhibitors
AU2005229416B2 (en) 2004-04-02 2009-03-26 Novartis Ag Sulfonamide-thiazolpyridine derivatives as glucokinase activators useful the treatment of type 2 diabetes
DE102004017438A1 (en) 2004-04-08 2005-11-03 Bayer Healthcare Ag Hetaryloxy-substituted phenylaminopyrimidines
US20050228031A1 (en) * 2004-04-13 2005-10-13 Bilodeau Mark T Tyrosine kinase inhibitors
DE102004020570A1 (en) 2004-04-27 2005-11-24 Bayer Healthcare Ag Substituted phenylaminopyrimidines
GB0411791D0 (en) 2004-05-26 2004-06-30 Cyclacel Ltd Compounds
FR2871158A1 (en) 2004-06-04 2005-12-09 Aventis Pharma Sa SUBSTITUTED INDAZOLES, COMPOSITIONS CONTAINING SAME, METHOD OF MANUFACTURE AND USE
ES2396135T3 (en) 2004-06-10 2013-02-19 Irm Llc Compounds and compositions as protein kinase inhibitors
DE102004028862A1 (en) 2004-06-15 2005-12-29 Merck Patent Gmbh 3-aminoindazoles
MX2007002434A (en) 2004-08-31 2007-05-04 Astrazeneca Ab Quinazolinone derivatives and their use as b-raf inhibitors.
WO2006031806A2 (en) 2004-09-10 2006-03-23 Atherogenics, Inc. 2-thiopyrimidinones as therapeutic agents
MX2007003319A (en) * 2004-09-20 2007-06-05 Xenon Pharmaceuticals Inc Pyridazine derivatives for inhibiting human stearoyl-coa- desaturase.
JP2008516939A (en) 2004-10-15 2008-05-22 アストラゼネカ アクチボラグ Chemical compound
US7632854B2 (en) 2004-11-17 2009-12-15 Pfizer Italia S.R.L. Aminoindazole derivatives active as kinase inhibitors, process for their preparation and pharmaceutical compositions comprising them
CA2590110C (en) 2004-12-30 2014-06-03 Exelixis, Inc. Kinase modulators and method of use
JP2008528585A (en) 2005-01-26 2008-07-31 アイアールエム・リミテッド・ライアビリティ・カンパニー Compounds and compositions as protein kinase inhibitors
TW200639163A (en) 2005-02-04 2006-11-16 Genentech Inc RAF inhibitor compounds and methods
WO2006085685A1 (en) 2005-02-09 2006-08-17 Takeda Pharmaceutical Company Limited Pyrazole compound
EP1854793A4 (en) 2005-02-28 2011-01-26 Japan Tobacco Inc NOVEL AMINOPYRIDINE COMPOUND WITH Syk INHIBITORY ACTIVITY
FR2884516B1 (en) * 2005-04-15 2007-06-22 Cerep Sa NPY ANTAGONISTS, PREPARATION AND USES
WO2006124731A2 (en) 2005-05-12 2006-11-23 Irm Llc Compounds and compositions as protein kinase inhibitors
BRPI0610828A2 (en) 2005-05-16 2010-07-27 Irm Llc compounds and compositions as protein kinase inhibitors
DK2395004T3 (en) 2005-06-22 2016-03-21 Plexxikon Inc Pyrrolo [2,3-b] pyridine derivatives as protein kinase inhibitors
WO2007024680A1 (en) 2005-08-22 2007-03-01 Amgen Inc. Pyrazolopyridine and pyrazolopyrimidine compounds useful as kinase enzymes modulators
WO2007035428A1 (en) 2005-09-15 2007-03-29 Bristol-Myers Squibb Company Met kinase inhibitors
CA2623958C (en) 2005-09-30 2013-05-28 Banyu Pharmaceutical Co., Ltd. 2-heteroaryl-substituted indole derivative
GT200600429A (en) 2005-09-30 2007-04-30 ORGANIC COMPOUNDS
GB0520955D0 (en) 2005-10-14 2005-11-23 Cyclacel Ltd Compound
US8247556B2 (en) 2005-10-21 2012-08-21 Amgen Inc. Method for preparing 6-substituted-7-aza-indoles
US20070161645A1 (en) * 2005-11-02 2007-07-12 Targegen, Inc. Thiazole inhibitors targeting resistant kinase mutations
JP4635089B2 (en) 2005-12-21 2011-02-16 ファイザー・プロダクツ・インク Carbonylaminopyrrolopyrazole, an effective kinase inhibitor
DK1973545T3 (en) 2005-12-23 2013-02-25 Ariad Pharma Inc Bicyclic heteroaryl compounds
WO2007076161A2 (en) 2005-12-27 2007-07-05 Myriad Genetics, Inc Compounds with therapeutic activity
WO2007086584A1 (en) 2006-01-30 2007-08-02 Meiji Seika Kaisha, Ltd. NOVEL INHIBITOR OF FabK AND FabI/K
WO2007129195A2 (en) 2006-05-04 2007-11-15 Pfizer Products Inc. 4-pyrimidine-5-amino-pyrazole compounds
KR20090019796A (en) 2006-05-22 2009-02-25 쉐링 코포레이션 Pyrazolo [1,5-a] pyrimidine as CDX inhibitor
WO2007138277A1 (en) 2006-05-26 2007-12-06 Astrazeneca Ab 2-carbocycloamino-4-imidaz0lylpyrimidines as agents for the inhbition of cell proliferation
PL2526933T3 (en) 2006-09-22 2015-08-31 Pharmacyclics Llc Inhibitors of Bruton's tyrosine kinase
JP5415271B2 (en) 2006-10-11 2014-02-12 ネルビアーノ・メデイカル・サイエンシーズ・エツセ・エルレ・エルレ Substituted pyrrolo-pyrazole derivatives as kinase inhibitors
ES2403546T3 (en) 2006-11-03 2013-05-20 Pharmacyclics, Inc. Bruton tyrosine kinase activity probe and method of use
WO2008063888A2 (en) 2006-11-22 2008-05-29 Plexxikon, Inc. Compounds modulating c-fms and/or c-kit activity and uses therefor
RU2493155C2 (en) 2006-12-08 2013-09-20 Ф.Хоффманн-Ля Рош Аг Substituted pyrimidines and use thereof as jnk modulators
EP2120932B1 (en) 2006-12-20 2014-07-09 Nerviano Medical Sciences S.r.l. Indazole derivatives as kinase inhibitors for the treatment of cancer
US8148400B2 (en) * 2006-12-20 2012-04-03 Bristol-Myers Squibb Company Thiazolyl compounds useful as kinase inhibitors
WO2008080015A2 (en) 2006-12-21 2008-07-03 Plexxikon, Inc. Compounds and methods for kinase modulation, and indications therefor
EP2118112B1 (en) 2007-02-07 2015-07-08 Pfizer Inc. 3-amino-pyrrolo[3,4-c] pyrazole- 5 (1h, 4h, 6h) carbaldehyde derivatives as pkc inhibitors
KR20090130051A (en) 2007-03-14 2009-12-17 엑셀리시스, 인코포레이티드 Inhibitors of the hedgehog pathway
WO2008124393A1 (en) 2007-04-04 2008-10-16 Irm Llc Benzothiazole derivatives and their use as protein kinase inhibitors
CA2683695C (en) 2007-04-12 2013-06-18 Pfizer Inc. 3-amido-pyrrolo[3,4-c]pyrazole-5(1h,4h,6h) carbaldehyde derivatives
WO2008144253A1 (en) 2007-05-14 2008-11-27 Irm Llc Protein kinase inhibitors and methods for using thereof
EP2152079A4 (en) 2007-06-04 2011-03-09 Avila Therapeutics Inc Heterocyclic compounds and uses thereof
CA2688616A1 (en) 2007-06-05 2008-12-11 Emory University Selective inhibitors for cyclin-dependent kinases
US7928140B2 (en) 2007-08-02 2011-04-19 Amgen Inc. Benzothiazole PI3 kinase modulators for cancer treatment
US20090054392A1 (en) 2007-08-20 2009-02-26 Wyeth Naphthylpyrimidine, naphthylpyrazine and naphthylpyridazine analogs and their use as agonists of the wnt-beta-catenin cellular messaging system
WO2009032703A1 (en) 2007-08-28 2009-03-12 Irm Llc 2- (het) arylamino-6-aminopyridine derivatives and fused forms thereof as anaplastic lymphoma kinase inhibitors
WO2009028655A1 (en) 2007-08-30 2009-03-05 Takeda Pharmaceutical Company Limited Heterocyclic compound and use thereof
TW200922564A (en) * 2007-09-10 2009-06-01 Curis Inc CDK inhibitors containing a zinc binding moiety
US20100056524A1 (en) 2008-04-02 2010-03-04 Mciver Edward Giles Compound
GB0806419D0 (en) 2008-04-09 2008-05-14 Ineos Fluor Holdings Ltd Process
US20100197688A1 (en) 2008-05-29 2010-08-05 Nantermet Philippe G Epha4 rtk inhibitors for treatment of neurological and neurodegenerative disorders and cancer
TWI490214B (en) 2008-05-30 2015-07-01 艾德克 上野股份有限公司 Benzene or thiophene derivative and use thereof as vap-1 inhibitor
AU2009260519A1 (en) 2008-05-30 2009-12-23 Merck Sharp & Dohme Corp. Novel substituted azabenzoxazoles
WO2009152027A1 (en) 2008-06-12 2009-12-17 Merck & Co., Inc. 5,7-dihydro-6h-pyrrolo[2,3-d]pyrimidin-6-one derivatives for mark inhibition
EP2303890A4 (en) 2008-06-19 2012-04-11 Progenics Pharm Inc Phosphatidylinositol 3 kinase inhibitors
EP2311842A3 (en) 2008-06-24 2011-07-13 Takeda Pharmaceutical Company Limited PI3K/M TOR inhibitors
GB0812031D0 (en) * 2008-07-01 2008-08-06 7Tm Pharma As Thiazole derivatives
EP2320907A4 (en) 2008-08-05 2012-09-05 Merck Sharp & Dohme THERAPEUTIC COMPOUNDS
EP2350053B1 (en) 2008-10-17 2013-12-11 Whitehead Institute For Biomedical Research Modulators of MTOR Complexes
CN101723936B (en) 2008-10-27 2014-01-15 上海睿星基因技术有限公司 Kinase suppressor and pharmaceutical application thereof
WO2010075542A1 (en) * 2008-12-23 2010-07-01 Curis, Inc. Cdk inhibitors
WO2010092962A1 (en) 2009-02-12 2010-08-19 アステラス製薬株式会社 Hetero ring derivative
WO2010125799A1 (en) 2009-04-27 2010-11-04 塩野義製薬株式会社 Urea derivative having pi3k inhibitory activity
JP5918693B2 (en) 2009-05-05 2016-05-18 ダナ ファーバー キャンサー インスティテュート インコーポレイテッド EGFR inhibitor and disease treatment method
WO2010144416A1 (en) 2009-06-08 2010-12-16 Gaeta Federico C A SUBSTITUTED PYRAZOLO [1,5-a] PYRIDINE COMPOUNDS HAVING MULTI-TARGET ACTIVITY
EP2440055B1 (en) * 2009-06-09 2015-03-11 California Capital Equity, LLC Styryl-triazine derivatives and their therapeutical applications
EP2440058A4 (en) 2009-06-12 2012-11-21 Dana Farber Cancer Inst Inc FOUNDED HETEROCYCLIC COMPOUNDS AND USES THEREOF
FR2948367A1 (en) 2009-07-24 2011-01-28 Centre Nat Rech Scient ACYL-GUANIDINE DERIVATIVES MODULATORS OF THE HEDGEHOG PROTEIN SIGNALING PATHWAY
WO2011047119A1 (en) 2009-10-14 2011-04-21 Bristol-Myers Squibb Company Compounds for the treatment of hepatitis c
US20110207736A1 (en) 2009-12-23 2011-08-25 Gatekeeper Pharmaceuticals, Inc. Compounds that modulate egfr activity and methods for treating or preventing conditions therewith
EP2937345B1 (en) 2009-12-29 2018-03-21 Dana-Farber Cancer Institute, Inc. Type ii raf kinase inhibitors
BR112012023021A2 (en) 2010-03-16 2016-05-31 Dana Farber Cancer Inst Inc indazole compounds and their uses
MX384074B (en) 2010-05-14 2025-03-12 Dana Farber Cancer Inst Inc COMPOSITIONS AND METHODS FOR TREATING NEOPLASMS, INFLAMMATORY DISEASES AND OTHER DISORDERS.
EP2640722B1 (en) 2010-11-19 2015-11-04 F.Hoffmann-La Roche Ag Pyrazolopyridines and their use as tyk2 inhibitors
UY33817A (en) 2010-12-21 2012-07-31 Boehringer Ingelheim Int ? NEW BENCYLIC OXINDOLPIRIMIDINES ?.
WO2012090219A2 (en) * 2010-12-31 2012-07-05 Jubilant Biosys Ltd. Thiazole compounds useful as acetyl-coa carboxylase (acc) inhibitors
EP2736901A1 (en) 2011-07-28 2014-06-04 Cellzome Limited Heterocyclyl pyrimidine analogues as jak inhibitors
US20150017156A1 (en) 2011-09-16 2015-01-15 The Ohio State University Esx-mediated transcription modulators and related methods
EP2760860B8 (en) * 2011-09-28 2017-03-08 Euro-Celtique S.A. Nitrogen mustard derivatives
WO2013074986A1 (en) 2011-11-17 2013-05-23 Dana-Farber Cancer Institute, Inc. Inhibitors of c-jun-n-terminal kinase (jnk)
GB201204384D0 (en) 2012-03-13 2012-04-25 Univ Dundee Anti-flammatory agents
US9879003B2 (en) 2012-04-11 2018-01-30 Dana-Farber Cancer Institute, Inc. Host targeted inhibitors of dengue virus and other viruses
US10112927B2 (en) 2012-10-18 2018-10-30 Dana-Farber Cancer Institute, Inc. Inhibitors of cyclin-dependent kinase 7 (CDK7)
CN103319483B (en) 2012-10-19 2016-08-03 药源药物化学(上海)有限公司 A kind of preparation method of important intermediate of linagliptin
US9758522B2 (en) 2012-10-19 2017-09-12 Dana-Farber Cancer Institute, Inc. Hydrophobically tagged small molecules as inducers of protein degradation
US10000483B2 (en) 2012-10-19 2018-06-19 Dana-Farber Cancer Institute, Inc. Bone marrow on X chromosome kinase (BMX) inhibitors and uses thereof
TWI621618B (en) 2013-03-13 2018-04-21 比利時商健生藥品公司 Substituted 2-azabicyclics and their use as orexin receptor modulators
KR20210091832A (en) 2013-03-15 2021-07-22 셀젠 카르 엘엘씨 Mk2 inhibitors and uses thereof
US10130633B2 (en) * 2013-03-20 2018-11-20 Bayer Pharma Aktiengesellschaft Compounds
US9938279B2 (en) 2013-04-09 2018-04-10 Energenesis Biomedical Co., Ltd Method for treating disease or condition susceptible to amelioration by AMPK activators and compounds of formula which are useful to activate AMP-activated protein kinase (AMPK)
WO2015013635A2 (en) 2013-07-25 2015-01-29 Dana-Farber Cancer Institute, Inc. Inhibitors of transcription factors and uses thereof
WO2015025197A1 (en) 2013-08-22 2015-02-26 Jubilant Biosys Limited Substituted pyrimidine compounds, compositions and medicinal applications thereof
WO2015058126A1 (en) 2013-10-18 2015-04-23 Syros Pharmaceuticals, Inc. Heteroaromatic compounds useful for the treatment of prolferative diseases
EP3099677A4 (en) 2014-01-31 2017-07-26 Dana-Farber Cancer Institute, Inc. Diaminopyrimidine benzenesulfone derivatives and uses thereof
WO2015117087A1 (en) 2014-01-31 2015-08-06 Dana-Farber Cancer Institute, Inc. Uses of diazepane derivatives
RU2673944C2 (en) 2014-01-31 2018-12-03 Дана-Фарбер Кансер Институт, Инк. Dihydropteridinone derivatives and uses thereof
JP2017504650A (en) 2014-01-31 2017-02-09 ダナ−ファーバー キャンサー インスティテュート, インコーポレイテッド Diazepan derivatives and uses thereof
RU2016141934A (en) 2014-04-04 2018-05-07 Сирос Фармасьютикалз, Инк. CYCLINE-DEPENDENT KINASE 7 INHIBITORS (CDK7)
EP3805218A1 (en) * 2014-04-05 2021-04-14 Syros Pharmaceuticals, Inc. Inhibitors of cyclin-dependent kinase 7 (cdk7)
US10017477B2 (en) 2014-04-23 2018-07-10 Dana-Farber Cancer Institute, Inc. Janus kinase inhibitors and uses thereof
WO2015164604A1 (en) 2014-04-23 2015-10-29 Dana-Farber Cancer Institute, Inc. Hydrophobically tagged janus kinase inhibitors and uses thereof
CN104829610B (en) 2014-06-20 2017-03-15 中国科学院合肥物质科学研究院 A kind of novel cloth Shandong tyrosine kinase inhibitor
US10287268B2 (en) 2014-07-21 2019-05-14 Dana-Farber Cancer Institute, Inc. Imidazolyl kinase inhibitors and uses thereof
DK3172213T3 (en) 2014-07-21 2021-12-13 Dana Farber Cancer Inst Inc MACROCYCLIC CHINESE INHIBITORS AND USES THEREOF
US10308648B2 (en) 2014-10-16 2019-06-04 Syros Pharmaceuticals, Inc. Inhibitors of cyclin-dependent kinase 7 (CDK7)
JP6690543B2 (en) 2014-10-31 2020-04-28 宇部興産株式会社 Substituted dihydropyrrolopyrazole compound
AU2015371251B2 (en) 2014-12-23 2020-06-11 Dana-Farber Cancer Institute, Inc. Inhibitors of cyclin-dependent kinase 7 (CDK7)
CN107530329B (en) 2015-03-09 2021-10-08 奥瑞基尼探索技术有限公司 Pyrazolo[1,5-a][1,3,5]triazine and pyrazolo[1,5-a]pyrimidine derivatives useful as CDK inhibitors
CN107427521B (en) 2015-03-27 2021-08-03 达纳-法伯癌症研究所股份有限公司 Inhibitors of cyclin-dependent kinases
EP3307728A4 (en) 2015-06-12 2019-07-17 Dana Farber Cancer Institute, Inc. ASSOCIATION THERAPY USING TRANSCRIPTION INHIBITORS AND KINASE INHIBITORS
CN108348522A (en) 2015-08-28 2018-07-31 诺华股份有限公司 Pharmaceutical combination comprising (A) cyclin-dependent kinase 4/6 (CDK4/6) inhibitor LEE011 (= RIBOCICLIB) and (B) epidermal growth factor receptor (EGFR) inhibitor erlotinib for the treatment of or prevent cancer

Patent Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6214852B1 (en) 1998-10-21 2001-04-10 Bristol-Myers Squibb Company N-[5-[[[5-alkyl-2-oxazolyl]methyl]thio]-2-thiazolyl]-carboxamide inhibitors of cyclin dependent kinases
WO2004074283A1 (en) 2003-02-21 2004-09-02 Pfizer Inc. N-heterocyclyl-substituted amino-thiazole derivatives as protein kinase inhibitors
WO2008049856A2 (en) 2006-10-25 2008-05-02 Ingenium Pharmaceuticals Gmbh Methods of treating pain using cdk inhibitors
WO2015058140A1 (en) 2013-10-18 2015-04-23 Dana-Farber Cancer Institute, Inc. Polycyclic inhibitors of cyclin-dependent kinase 7 (cdk7)

Non-Patent Citations (20)

* Cited by examiner, † Cited by third party
Title
"GenBank", Database accession no. M80629
"Uniprot", Database accession no. Q9NYV4
AKHTAR ET AL.: "TFIIH kinase places bivalent marks on the carboxy- terminal domain of RNA polymerase II", MOL. CELL, vol. 34, 2009, pages 387 - 393
BERGE ET AL., J. PHARMACEUTICAL SCIENCES, vol. 66, 1977, pages 1 - 19
DESAI ET AL.: "Effects of phosphorylation by CAK on cyclin binding by CDC2 and CDK2", MOL. CELL BIOL., vol. 15, 1995, pages 345 - 350, XP002405789
DRAPKIN ET AL.: "Human cyclin-dependent kinase-activating kinase exists in three distinct complexes", PROC. NATL. ACAD. SCI. U.S.A., vol. 93, 1996, pages 6488 - 6493
ERRATUM, NATURE, vol. 474, no. 7353, 2011, pages 609 - 615
EVEN ET AL., J CELL BIOCHEM., vol. 99, no. 3, 2006, pages 890 - 904
GLOVER-CUTTER ET AL.: "TFIIH-associated CDK7 kinase functions in phosphorylation of C-terminal domain Ser7 residues, promoter-proximal pausing, and termination by RNA polymerase II", MOL. CELL BIOL., vol. 29, 2009, pages 5455 - 5464
IORNS ET AL., CARCINOGENESIS, vol. 30, no. 10, 2009, pages 1696 - 1701
KALDIS ET AL.: "Analysis of CAK activities from human cells", EUR. J. BIOCHEM., vol. 267, 2000, pages 4213 - 4221
KAURANIEMI ET AL., CANCER RES., vol. 61, no. 22, 2001, pages 8235 - 8240
KO ET AL., J. CELL SCI., vol. 114, 2001, pages 2591 - 2603
LAROCHELLE ET AL.: "Requirements for CDK7 in the assembly of CDKl/cyclin B and activation of CDK2 revealed by chemical genetics in human cells", MOL. CELL, vol. 25, 2007, pages 839 - 850
LIU. ET AL.: "Two cyclin-dependent kinases promote RNA polymerase II transcription and formation of the scaffold complex", MOL. CELL BIOL., vol. 24, 2004, pages 1721 - 1735
MARQUES ET AL., BIOCHEM BIOPHYS RES COMMUN., vol. 279, no. 3, 2000, pages 832 - 837
SERIZAWA ET AL.: "Association of CDK-activating kinase subunits with transcription factor TFIIH", NATURE, vol. 374, 1995, pages 280 - 282
SHIEKHATTAR ET AL.: "CDK-activating kinase complex is a component of human transcription factor TFIIH", NATURE, vol. 374, 1995, pages 283 - 287
T. W. GREENEP. G. M. WUTS: "Protecting Groups in Organic Synthesis", 1999, JOHN WILEY & SONS
ZANG ET AL., CANCER RES., vol. 71, no. 1, 2011, pages 29 - 39

Cited By (15)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11897874B2 (en) 2016-11-03 2024-02-13 Corvus Pharmaceuticals, Inc. Compounds and methods for modulating Interleukin-2-inducible T-cell kinase
EP3534899A4 (en) * 2016-11-03 2020-04-29 Corvus Pharmaceuticals, Inc. COMPOUNDS AND METHODS FOR MODULATION OF INTERLEUKIN-INDUCIBLE T-CELL KINASE
US11008314B2 (en) 2016-11-03 2021-05-18 Corvus Pharmaceuticals, Inc. Compounds and methods for modulating interleukin-2-inducible t-cell kinase
EP3694528A4 (en) * 2017-10-13 2021-07-28 The Regents of the University of California MTORC1 MODULATORS
WO2019099298A1 (en) 2017-11-16 2019-05-23 Eli Lilly And Company Compounds useful for inhibiting cdk7
US10472370B2 (en) 2017-11-16 2019-11-12 Eli Lilly And Company (E)-1-(4-(dimethylamino)but-2-enoyl)pyrrolidin-3-yl 4-((3-isopropyl-5-methylpyrazolo[1,5-a]pyrimidin-7-yl)amino)piperidine-1-carboxylate for inhibiting CDK7
US10787460B2 (en) 2017-11-16 2020-09-29 Eli Lilly And Company (E)-1-(4-(dimethylamino)but-2-enoyl)pyrrolidin-3-yl 4-((3-isopropyl-5-methylpyrazolo[1,5-a]pyrimidin-7-yl)amino)piperidine-1-carboxylate for inhibiting CDK7
WO2019213403A1 (en) 2018-05-02 2019-11-07 Kinnate Biopharma Inc. Inhibitors of cyclin-dependent kinases
US11447493B2 (en) 2018-05-02 2022-09-20 Kinnate Biopharma Inc. Inhibitors of cyclin-dependent kinases
US11390618B2 (en) 2018-06-29 2022-07-19 Kinnate Biopharma Inc. Inhibitors of cyclin-dependent kinases
WO2020046770A1 (en) * 2018-08-31 2020-03-05 Institute For Cancer Research D/B/A The Research Institute Of Fox Chase Cancer Center Kinase activity in tumors
WO2021242602A1 (en) 2020-05-27 2021-12-02 Eli Lilly And Company Compounds useful for inhibiting cdk7
US11878968B2 (en) 2021-07-09 2024-01-23 Plexium, Inc. Aryl compounds and pharmaceutical compositions that modulate IKZF2
US12084453B2 (en) 2021-12-10 2024-09-10 Incyte Corporation Bicyclic amines as CDK12 inhibitors
WO2024140653A1 (en) * 2022-12-27 2024-07-04 南京圣和药业股份有限公司 Selective cdk12/13 inhibitor and application thereof

Also Published As

Publication number Publication date
US20220055998A1 (en) 2022-02-24
EP4019515A1 (en) 2022-06-29
EP3347018B1 (en) 2021-09-01
JP2022020611A (en) 2022-02-01
AU2016319125A1 (en) 2018-03-22
JP7028766B2 (en) 2022-03-02
AU2016319125B2 (en) 2021-04-08
CA2996978A1 (en) 2017-03-16
US11142507B2 (en) 2021-10-12
EP3347018A4 (en) 2019-04-03
WO2017044858A3 (en) 2017-04-27
US20180362483A1 (en) 2018-12-20
JP2018526413A (en) 2018-09-13
US20200172499A9 (en) 2020-06-04
EP3347018A2 (en) 2018-07-18

Similar Documents

Publication Publication Date Title
US12098154B2 (en) Inhibitors of cyclin-dependent kinases
US20220055998A1 (en) Inhibitors of cyclin-dependent kinases
AU2015371251B2 (en) Inhibitors of cyclin-dependent kinase 7 (CDK7)
AU2019413694B2 (en) Inhibitors of cyclin-dependent kinase 7 and uses thereof
AU2016283105A1 (en) 4,6-pyrimidinylene derivatives and uses thereof
EP3313529A1 (en) Fused bicyclic pyrimidine derivatives and uses thereof
AU2020319005B2 (en) Inhibitors of cyclin-dependent kinase 7 and uses thereof
AU2015335788A1 (en) Thiazolyl-containing compounds for treating proliferative diseases
KR20180049058A (en) Cyanothienotriazolodiazepines and their uses
CA2988330C (en) 4,6-pyrimidinylene derivatives and uses thereof

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 16845194

Country of ref document: EP

Kind code of ref document: A2

ENP Entry into the national phase

Ref document number: 2996978

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2018512916

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2016319125

Country of ref document: AU

Date of ref document: 20160909

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2016845194

Country of ref document: EP