WO2017044308A1 - Synthetic antibodies to bax and uses thereof - Google Patents

Synthetic antibodies to bax and uses thereof Download PDF

Info

Publication number
WO2017044308A1
WO2017044308A1 PCT/US2016/048508 US2016048508W WO2017044308A1 WO 2017044308 A1 WO2017044308 A1 WO 2017044308A1 US 2016048508 W US2016048508 W US 2016048508W WO 2017044308 A1 WO2017044308 A1 WO 2017044308A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
bax
region
amino acid
acid sequence
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2016/048508
Other languages
French (fr)
Inventor
Evripidis Gavathiotis
Jonathan R. Lai
Sachdev Sidhu
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
University of Toronto
Albert Einstein College of Medicine
Original Assignee
University of Toronto
Albert Einstein College of Medicine
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by University of Toronto, Albert Einstein College of Medicine filed Critical University of Toronto
Priority to CA2998115A priority Critical patent/CA2998115C/en
Priority to US15/756,997 priority patent/US10294294B2/en
Publication of WO2017044308A1 publication Critical patent/WO2017044308A1/en
Anticipated expiration legal-status Critical
Priority to US16/261,703 priority patent/US10759851B2/en
Priority to US16/988,947 priority patent/US11174308B2/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6843Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a material from animals or humans
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/10Dispersions; Emulsions
    • A61K9/127Synthetic bilayered vehicles, e.g. liposomes or liposomes with cholesterol as the only non-phosphatidyl surfactant
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/575Immunoassay; Biospecific binding assay; Materials therefor for cancer
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/005Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies constructed by phage libraries
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/10Immunoglobulins specific features characterized by their source of isolation or production
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/55Fab or Fab'
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2500/00Screening for compounds of potential therapeutic value
    • G01N2500/04Screening involving studying the effect of compounds C directly on molecule A (e.g. C are potential ligands for a receptor A, or potential substrates for an enzyme A)
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2510/00Detection of programmed cell death, i.e. apoptosis

Definitions

  • Apoptosis plays a critical role in maintaining normal tissue homoeostasis in multicellular organisms and its deregulation results in an imbalance of homeostasis contributing to several diseases (1,2)
  • the BCL-2 protein family plays a central role in regulating the mitochondrial pathway of apoptosis (3,4)
  • the mitochondrial outer membrane permeabilization (MOMP) is considered the key event that is regulated by the complex network of protein-protein interactions between pro-apoptotic and anti-apoptotic members of the BCL-2 family.
  • BAX and/or BAK Activation of pro-apoptotic members BAX and/or BAK is required for induction of MOMP, whereas the anti-apoptotic or survival proteins such as BCL-2, BCL-XL and MCL-1, inhibit the pro-apoptotic proteins and prevent MOMP.
  • Activation of BAX and BAK or inhibition of anti-apoptotic BCL-2 proteins is regulated by direct interaction with the BH3-only proteins.
  • BAX activation pathway of BAX represents the gateway to apoptosis and understanding the function of BAX and its regulation mechanisms is an area of intensive investigation.
  • BAX is predominantly found in the cytosolic compartment in an inactive conformation (5,6).
  • BAX Upon cellular stress, BAX is triggered and undergoes a series of conformational changes that enable its translocation to the mitochondrial membrane and oligomerization leading to MOMP induction (7,8).
  • the structure of the BAX monomer in the inactive conformation was previously determined by nuclear magnetic resonance (NMR) spectroscopy (9).
  • NMR nuclear magnetic resonance
  • BAX In contrast to BAK and anti-apoptotic BCL-2 proteins that reside at the mitochondrial outer membrane, the structure of BAX was determined with its hydrophobic C-terminal helix a9 bound to the canonical hydrophobic groove. When the C-terminal a9 helix dissociates from the canonical hydrophobic groove, it binds to the mitochondrial outer membrane facilitating the mitochondrial translocation of BAX (9). Structural analysis of a hydrocarbon stapled BIM BH3 helix bound to monomeric BAX uncovered an activation site at the N-terminal surface of BAX (10).
  • This activation site regulates the trigger mechanism for conformational activation of cytosolic BAX leading to the release of the hydrophobic a9 helix and exposure of the hydrophobic a2 helix (BH3 domain) (10-12).
  • Mitochondrial translocated BAX undergoes further conformational changes on the membrane that induce BAX oligomerization and MOMP (13-16), or is inhibited by anti-apoptotic Bcl-2 proteins (17-20).
  • a number of diseases and disorder are associated with premature or unwanted cell death and characterized by abnormal activation of BAX.
  • the present invention addresses the need for inhibitors of BAX activation for therapeutic treatments.
  • the present invention discloses synthetic fragment antigen-binding (Fab) antibodies that bind to an N-terminal activation site of BCL-2-associated X-protein (BAX) and inhibit BAX activation. Also disclosed are methods of using the Fabs for measuring inactive monomeric BAX levels, screening for small molecules that bind to an N-terminal activation site of BAX, inhibiting apoptotic cell death, and predicting the ability of a cancer therapy to promote apoptotic cell death.
  • Fab fragment antigen-binding
  • Fig. 1A-1D Discovery of synthetic antibody fragments that bind with high affinity to BAX at overlapping binding sites.
  • A Synthetic antibody fragments (Fabs) that bind to BAX with the corresponding variable sequences of complementarity determining regions (CDRs) and half-maximal binding titers (EC5 0 ) as determined by ELISA.
  • B Top panel: Binding affinity (K D ), association rate constant (k a ) and dissociation rate constant (k d ) for select synthetic Fabs that bind to BAX as determined by biolayer interferometry. ELISA binding EC5 0 S are shown for comparison.
  • SEQ ID NOs for CDRL3, CDRH1, CDRH2, and CDRH3 are respectively, SEQ ID NO: 1-4 for Fab 2B1, SEQ ID NO:5-8 for 3E8, SEQ ID NO:9-12 for 3G11, SEQ ID NO: 13-16 for 2D9, SEQ ID NO: 17-20 for 3G9, SEQ ID NO:21-24 for 2C11, SEQ ID NO:25-28 for 3H4, SEQ ID NO:29-32 for 2A6, SEQ ID NO:33-36 for 3H1, SEQ ID NO:37-40 for 2A2, SEQ ID NO:41-44 for 3G3, SEQ ID NO:45-48 for 2D5, SEQ ID NO:49- 52 for 2D2, and SEQ ID NO:53-56 for 2A5.
  • Fig. 2A-2F Synthetic Fabs inhibit BAX activation induced by pro-apoptotic tBID in liposomal assay.
  • A Synthetic BAX-binding Fabs or a VEGF specific Fab (YADS1) at 2 ⁇ have no capacity to induce BAX-mediated liposomal ANT/DPX release while tBID induced potent BAX-mediated liposomal release.
  • B BAX-binding Fabs at 2 ⁇ , except 2A5 and YADS 1, inhibit tBID-induced BAX-mediated liposomal ANT/DPX release.
  • Bars represent mean ⁇ SD value at 90 min that is normalized to tBID-induced maximum ANTS/DPX release at 90 min (C-F).
  • Fig. 3A-3B Synthetic Fab 3G11 inhibit BAX-mediated cytochrome c release and BAX mitochondrial translocation induced by pro-apoptotic tBID in isolated mitochondria.
  • A Fab 3G11 inhibits dose-responsively tBID-induced BAX-mediated cytochrome c release from isolated BAK mitochondria.
  • B 3G11 Fab inhibits dose-responsively tBID-induced BAX mitochondrial translocation in isolated BAK " " mitochondria.
  • Data shown are representative of at least three independent experiments.
  • Fig. 4. 3G11 binds to the N-terminal surface of BAX. % deuterium incorporation of unbound BAX conformation was determined in solution. HXMS analysis suggests increased rates of deuterium exchange in the N-terminal region of BAX, the al-a2 loop and helices ⁇ 2, part of a5, a8, and a9. The relative difference of % deuterium incorporation of BAX conformation bound to 3 Gi l minus the % deuterium incorporation of BAX conformation alone was also determined. HXMS analysis suggests increased protection from deuterium incorporation in residues of helices al, a6, part of a5 and the al-a2 loop compared to the unbound BAX. The regions of significant protection from deuterium incorporation (> - 20%) are highlighted in dark on the sequence of BAX (SEQ ID NO:57). The ribbon representation of the full length BAX structure (PDB ID: 16F6) is shown in the bottom portion of the figure.
  • FIG. 5A-5F Select BAX mutants inhibit functional inhibition and binding to BAX by 3G11.
  • A-D Representative liposomal ANTS/DPX release experiments in kinetic representation showing the inhibitory activity of 3 Gi l (2 ⁇ ) with BAX WT that is weakened by the K21E mutation and completely abolished by the R134E or the double mutation R134E/K21E. Experiments performed with 400 nM BAX WT or BAX mutants, 30 nM tBID and 2 ⁇ 3G11.
  • E % Inhibition based on the maximum tB ID-induced BAX activation for BAX WT and mutants at 90 min in presence or absence of 3G11 Fab.
  • the invention provides a synthetic fragment antigen-binding (Fab) antibody that binds to an N-terminal activation site of BCL-2-associated X-protein (BAX) and inhibits BAX activation.
  • BAX BCL-2-associated X-protein
  • the antibody maintains BAX in its inactive, monomeric form.
  • the antibody can bind to residues of helices al and a6, and to residues of al-a2 loop of BAX.
  • the antibody binds to BAX with a half-maximal binding (EC 50 ) affinity of 2nM-70nM.
  • the antibody blocks the interaction of BAX with a BAX activating partner, such as, for example, tBID, PUMA, BIM and/or NOXA.
  • the Fab is selected from the group consisting of
  • 2B1 Fab having a CDRL3 region comprising the amino acid sequence QYSGSGHYLI (SEQ ID NO: l), a CDRH1 region comprising the amino sequence IYSSSM (SEQ ID NO:2), a CDRH2 region comprising the amino acid sequence SISSSSSYTS (SEQ ID NO:3) and a CDRH3 region comprising the amino acid sequence RGYWYYWAWWASAMD (SEQ ID NO:4); 3E8 Fab, having a CDRL3 region comprising the amino acid sequence QSSYSLI (SEQ ID NO:5), a CDRH1 region comprising the amino sequence LSYYSM (SEQ ID NO: 6), a CDRH2 region comprising the amino acid sequence SISPYYGYTY (SEQ ID NO:7) and a CDRH3 region comprising the amino acid sequence RGGAYYFGYYGSGSYAMD (SEQ ID NO: 8);
  • 3G11 Fab having a CDRL3 region comprising the amino acid sequence QWSFGPI (SEQ ID NO:9), a CDRH1 region comprising the amino sequence ISYYSM (SEQ ID NO: 10), a CDRH2 region comprising the amino acid sequence SIYPYSSSTY (SEQ ID NO: 11) and a CDRH3 region comprising the amino acid sequence RSSAMD (SEQ ID NO: 12);
  • 2D9 Fab having a CDRL3 region comprising the amino acid sequence QWSHYLI (SEQ ID NO: 13), a CDRH1 region comprising the amino sequence LYYYSM (SEQ ID NO: 14), a CDRH2 region comprising the amino acid sequence SISPSYGYTS (SEQ ID NO: 15) and a CDRH3 region comprising the amino acid sequence RSSFYYYALD (SEQ ID NO: 16);
  • 3G9 Fab having a CDRL3 region comprising the amino acid sequence QHYYYSPWPI (SEQ ID NO: 17), a CDRH1 region comprising the amino sequence LYSYYI (SEQ ID NO: 18), a CDRH2 region comprising the amino acid sequence SISPYYSSTY (SEQ ID NO: 19) and a CDRH3 region comprising the amino acid sequence RSSYSYAGMD (SEQ ID NO: 20);
  • 2C11 Fab having a CDRL3 region comprising the amino acid sequence QSYVSPI (SEQ ID NO:21), a CDRH1 region comprising the amino sequence ISSYYI (SEQ ID NO:22), a CDRH2 region comprising the amino acid sequence SISSYYSSTY (SEQ ID NO:23) and a CDRH3 region comprising the amino acid sequence RV S YGHAYVGYS SGMD (SEQ ID NO:24);
  • 3H4 Fab having a CDRL3 region comprising the amino acid sequence QSWYYSYPI (SEQ ID NO: 25), a CDRH1 region comprising the amino sequence LSYSSM (SEQ ID NO:26), a CDRH2 region comprising the amino acid sequence SISSYYSYTS (SEQ ID NO:27) and a CDRH3 region comprising the amino acid sequence RYYGYGGGID (SEQ ID NO:28);
  • 2A6 Fab having a CDRL3 region comprising the amino acid sequence QSAGGYPLI (SEQ ID NO:29), a CDRH1 region comprising the amino sequence IYYSSM (SEQ ID NO:30), a CDRH2 region comprising the amino acid sequence SISPYSSYTS (SEQ ID NO:31) and a CDRH3 region comprising the amino acid sequence RSFGYGWAFD (SEQ ID NO:32);
  • 3H1 Fab having a CDRL3 region comprising the amino acid sequence QHSYPI (SEQ ID NO:33), a CDRH1 region comprising the amino sequence ISYSSI (SEQ ID NO:34), a CDRH2 region comprising the amino acid sequence SIYSYSGSTY (SEQ ID NO: 35) and a CDRH3 region comprising the amino acid sequence RYGAMD (SEQ ID NO:36);
  • 2A2 Fab having a CDRL3 region comprising the amino acid sequence QYYYPI (SEQ ID NO:37), a CDRH1 region comprising the amino sequence ISSSSI (SEQ ID NO:38), a CDRH2 region comprising the amino acid sequence SIYSYYGYTY (SEQ ID NO:39) and a CDRH3 region comprising the amino acid sequence RYSAMD (SEQ ID NO: 40);
  • 3G3 Fab having a CDRL3 region comprising the amino acid sequence QGAWSGGHLI (SEQ ID NO:41), a CDRH1 region comprising the amino sequence LSYSSM (SEQ ID NO:42), a CDRH2 region comprising the amino acid sequence YISPYYGYTY (SEQ ID NO:43) and a CDRH3 region comprising the amino acid sequence RGWAYYYGYWGP S GLD (SEQ ID NO:44);
  • 2D5 Fab having a CDRL3 region comprising the amino acid sequence QWGYSHSHLI (SEQ ID NO:45), a CDRH1 region comprising the amino sequence ISYSS (SEQ ID NO:46), a CDRH2 region comprising the amino acid sequence SISPYYGSTY (SEQ ID NO:47) and a CDRH3 region comprising the amino acid sequence RSHFGALD (SEQ ID NO:48);
  • 2D2 Fab having a CDRL3 region comprising the amino acid sequence QSYYWVSPF (SEQ ID NO:49), a CDRH1 region comprising the amino sequence LYYSSI (SEQ ID NO:50), a CDRH2 region comprising the amino acid sequence SIYPYSGSTY (SEQ ID NO:51) and a CDRH3 region comprising the amino acid sequence RSYGYAMD (SEQ ID NO:52); and
  • 2A5 Fab having a CDRL3 region comprising the amino acid sequence QYHYWYYPI (SEQ ID NO:53), a CDRH1 region comprising the amino sequence ISYYSM (SEQ ID NO:54), a CDRH2 region comprising the amino acid sequence SISPYYGSTY (SEQ ID NO:55) and a CDRH3 region comprising the amino acid sequence RAGAMD (SEQ ID NO:56).
  • the Fabs bind to and inhibit BAX.
  • the Fabs can be produced reproducibly in large amounts using bacterial expression or mammalian expression systems.
  • the invention further provides a method of inhibiting apoptotic cell death by contacting BCL-2-associated X-protein (BAX) with any of the synthetic Fab antibodies disclosed herein in an amount effective to inhibit activation of BAX and apoptotic cell death.
  • BAX BCL-2-associated X-protein
  • the synthetic Fab antibody can be conjugated to a therapeutic agent and/or to an agent that facilitates transport across a cell membrane.
  • the synthetic Fab antibody can administered to a subject using any known method effective to administer an amount of the antibody that inhibits activation of BAX, including, for example, lentiviral or adenoviral expression, a plasmid, nanoparticles or liposomes.
  • the synthetic Fab antibody can be administered to a subject having, for example, a disease or disorder selected from the group consisting of a cardiovascular disease or disorder (e.g., arteriosclerosis, heart failure, heart transplantation, aneurism, chronic pulmonary disease, ischemic heart disease, hypertension, thrombosis, and/or cardiomyopathies), a neurodegenerative or neurological disease or disorder (e.g., Alzheimer's disease, Parkinson's disease, Huntington's disease, retinitis pigmentosa, spinal muscular atrophy, various forms of cerebellar degeneration, and/or amyotrophic lateral sclerosis), a liver disease or disorder, a kidney disease or disorder, a metabolic disease or disorder, an immunological disorder (e.g., organ transplant rejection, arthritis, lupus, IBD, Crohn's disease, asthma, multiple sclerosis, and/or diabetes), ischemia (e.g., stroke, myocardial infarction and/or reperfusion injury), infertility,
  • Also provided is a method for measuring inactive monomelic BAX levels in a tissue sample from a subject comprising contacting the sample with any of the synthetic Fab antibodies disclosed herein and measuring the amount of antibody bound to the sample, wherein the amount of bound antibody is indicative of the level of inactive monomeric BAX in the tissue sample.
  • a method for screening for small molecules that bind to an N- terminal activation site of BAX comprising contacting BAX with any of the synthetic Fab antibodies disclosed herein in the presence and in the absence of a small molecule and measuring the amount of antibody that binds to BAX, wherein a decrease in the amount of antibody binding to BAX in the presence of the small molecule indicates that the small molecule is a candidate for binding to the N-terminal activation site of BAX. It is also possible that the small molecule binds to a site on BAX that causes allosteric conformational changes that cause a decrease in the amount of antibody binding to BAX.
  • the method can comprise a competitive ELISA screening assay.
  • the methods are useful for identifying therapeutic cell death inhibitors.
  • the methods are useful for identifying therapeutic cell death activators.
  • the small molecule has a molecular weight of 2000 daltons or less. In an embodiment of the methods described herein, the small molecule has a molecular weight of 1500 daltons or less. In an embodiment of the methods described herein, the small molecule has a molecular weight of 1000 daltons or less. In an embodiment of the methods described herein, the small molecule has a molecular weight of 800 daltons or less. In an embodiment of the methods described herein, the small molecule has a molecular weight of either 2000, 1500, 1000, 800, 700, 600, 500 or 400 daltons or less. In an embodiment of the methods described herein, the small molecule is a small organic molecule.
  • the synthetic Fab antibody can be labeled with a detectable label, such as a fluorescent label or a radioactive label.
  • the antibody can be biotinylated.
  • BAX is BCL-2-associated X-protein.
  • the BAX is mammalian.
  • the BAX is a human BAX.
  • the BAX comprises consecutive amino acid residues having the following sequence:
  • Synthetic antibody technology was applied to BCL-2 family proteins to probe novel conformations and functional regions on the surface of BAX.
  • Synthetic antibody discovery utilizes diversity targeted to the antibody complementarity determining regions (CDRs) that is encoded by designed, synthetic oligonucleotides and screened by phage or yeast display (22,23). Since library construction and selection is performed entirely in vitro, the state of the target can be controlled through the antibody discovery process. Therefore, the specificity of the output antibodies can be tuned to user-specified stringency (24,25). Using a phage display screen, synthetic antibodies were identified that bind with high affinity and specificity to BAX.
  • CDRs antibody complementarity determining regions
  • BAX can be expressed and purified readily, and studied by NMR and other biophysical techniques, it is prone to aggregation under some conditions (such as detergents). This aggregation phenomenon is presumably linked to its function of forming oligomeric pores in the mitochondrial membrane, but presents a daunting challenge in raising conformation-specific antibodies using techniques requiring immunization. Thus, there was a strong rationale for utilizing in vitro selection. [0030] Antibodies were identified that can be used as structural and biochemical probes to dissect key regulatory mechanisms and conformations of BAX (26,27). Fourteen novel synthetic antibody fragments (Fabs) were identified that specifically target BAX. These synthetic Fabs have no significant homology in the CDR sequences suggesting a diversity of molecular interactions with BAX.
  • Fabs novel synthetic antibody fragments
  • the synthetic Fabs inhibit BAX in assays using liposomal membranes or isolated mitochondria. Further analysis using isolated mitochondria suggest that the Fabs bind to cytosolic BAX and inhibit its ability to translocate and insert onto the mitochondria outer membrane. Structural studies using NMR and hydrogen/deuterium exchange mass spectrometry showed that a representative synthetic Fab (3G11) forms a stoichiometric and stable complex with monomeric and inactive BAX, with a binding site that involves residues of helices al/a6 and of the al-a2 loop.
  • BAX AC truncated a9 BAX
  • BAX mutants in pTYBl vector New England Biolabs were expressed in BL21 CodonPlus (DE3)-RIPL + E. coli strain and purified as previously described (9, 10).
  • Fab protein expression The phage display vectors for the 14 identified clones were converted to Fab protein expression vectors by insertion of a stop codon and a 6- Histidine tag upstream of the P3 gene fusion. Fab proteins were expressed periplasmically in E. coli BL21(DE3) (New England Biolabs, Ipswich, MA) by growth in low-phosphate media at 30°C for 18-22 h. The cells were harvested by centrifugation and lysed by using the BugBuster lysis reagent according to the manufacturer's instructions (Novagen, Madison, WI).
  • the lysate was subjected to centrifugation, and the supernatant was applied to a nickel column (Ni-NTA resin, Qiagen, Valencia, CA) pre-equilibrated with Tris-buffered saline (TBS), pH 7.
  • TBS Tris-buffered saline
  • the Fab-bound Ni-NTA column was then washed with 20-column volume TBS buffer with 20 mM imidazole.
  • the protein was eluted with TBS buffer with 250 mM imidazole.
  • the eluent was dialyzed into PBS at pH 8.0, and applied to a Protein A affinity column (beads from Pierce Thermo Scientific, Rockford, IL) for further purification.
  • the Fab-bound beads were washed with PBS, pH 8.0 (15 column volumes), and the Fab proteins were eluted with 100 mM glycine, pH 2.0. The eluted Fab proteins were immediately neutralized to ⁇ pH 7 using 1 M Tris buffer, pH 8.0. Fractions containing the Fab proteins were buffer-exchanged into PBS, pH 7.0 and were used directly in following binding and activity assays, or flash-frozen and stored at 80°C for future use. The Fab protein concentrations were determined by measuring the absorbance at 280 nm. The extinction coefficients at 280 nm were calculated from the Fab protein sequences using ExPASy.
  • the wells were washed with PBS, developed with 3,3',5,5'-tetramethylbenzidine (TMB) substrate, and quenched with 0.5 M H2SO4.
  • TMB 3,3',5,5'-tetramethylbenzidine
  • the absorbance at 450 nm was determined.
  • the data were fit to a standard four parameter logistic equation by using GraphPad Prism (GraphPad Software, La Jolla, CA).
  • the half-maximal binding (EC5 0 ) values were obtained from the inflection point of the curve.
  • Liposome Permeabilization Assay - Liposomes were composed of the following molar percentages of lipids (Avanti Polar Lipids): phosphatidylcholine, 48%; phosphatidylinositol, 10%; phosphatidylethanolamine, 28%; dioleoyl phosphatidylserine, 10%; and tetraoleoyl cardiolipin, 4% and were loaded with ANTS/DPX (Molecular Probe) upon extrusion.
  • ANTS/DPX Molecular Probe
  • assay buffer (10 mM HEPES, pH 7, 200 mM KC1, and 1 mM MgC ⁇
  • 1% Triton treatment is used to determine the maximum amount of liposomal release per assay, and this value sets the 100% value for the kinetic curve figures whereas the calculated percent release value for the bar graphs was calculated by using the percent release value of tBid-induced BAX mediated ANT/DPX release as 100%.
  • BAX translocation assay - Mitochondria from liver of Bak '1' mice (0.75mg/ml) were resuspended in experimental buffer (125 mM KC1, 10 mM Tris-MOPS [pH 7.4], 5 mM glutamate, 2.5 mM malate, 1 mM KP0 4 , O. lmM EGTA-Tris [pH 7.4]) and treated with the indicated concentrations of 3G11 recombinant BAX (200 nM) and tBid (lOOnM), singly and in combination, and incubated at room temperature for 20 min.
  • experimental buffer 125 mM KC1, 10 mM Tris-MOPS [pH 7.4], 5 mM glutamate, 2.5 mM malate, 1 mM KP0 4 , O. lmM EGTA-Tris [pH 7.4]
  • the supernatant fractions were isolated by centrifugation at 5500xg for 10 min and the mitochondrial pellets resuspended and washed with 0.1M sodium carbonate (pH 11.5) for 20 min, centrifuged at 13,000xg for 10 min at 4°C, and then solubilized in 1% Triton X-100/PBS for 1 h at 4°C. Mitochondrial supernatant and pellet fractions were separated by 4-12% NuPage (Invitrogen) gels and analyzed by immunoblotting with anti-BAX antibody (Cell Signaling Cat. 2772).
  • Mitochondrial release assay Mitochondrial release assay - Mitochondria from liver of Bak ⁇ ' mice (1.5mg/ml) were resuspended in experimental buffer (125 mM KC1, 10 mM Tris-MOPS [pH 7.4], 5 mM glutamate, 2.5 mM malate, 1 mM KP0 4 , O. lmM EGTA-Tris [pH 7.4]) and treated with the indicated concentrations of 3G11 recombinant BAX (400 nM) and tBid (30nM), singly and in combination, and incubated at room temperature for 60 min.
  • experimental buffer 125 mM KC1, 10 mM Tris-MOPS [pH 7.4], 5 mM glutamate, 2.5 mM malate, 1 mM KP0 4 , O. lmM EGTA-Tris [pH 7.4]
  • the supernatants were isolated by centrifugation at 5500xg for 10 min and the mitochondrial pellets solubilized in 1% Triton X-100/PBS. Mitochondrial supernatant and pellet fractions were separated by 4-12% NuPage (Invitrogen) gels and analyzed by immunoblotting with anti-cytochrome c antibody (BD Biosciences Cat. 556433).
  • NMR samples and spectroscopy - Uniformly 15N-labeled full-length human BAX was generated as previously described .
  • Protein samples of BAX and BAX-3G11 mixtures at indicated concentrations were prepared in 25 mM sodium phosphate, 50 mM NaCl solution at pH 6.0 in 5% D20.
  • Correlation 1H-15N HSQC and 1H-15N TROSY spectra were acquired at 25°C on a Bruker 600 MHz NMR spectrometer equipped with a cryogenic probe, processed using Topsin, and analyzed with CCPNMR.
  • BAX wild type cross-peak assignments were applied as previously reported (9).
  • the quenched samples were frozen on dry ice and then subjected to an immobilized pepsin column (1x20mm, 30 mg/ ml porcine pepsin (Sigma)) for online digestion for 40 sec.
  • the resulting peptides were collected on a CI 8 trap (Michrom MAGIC C18AQ 0.2x2) and separated using a reversed phase C18 column (Michrom MAGIC C18AQ 0.2x50 3um 20 ⁇ ) with a 30 min linear gradient of 0.046% (v/v) trifluoroacetic acid, 6.4% (v/v) acetonitrile to 0.03% (v/v) trifiuoroacetic acid, 38.4% (v/v) acetonitrile.
  • the effluent was directed into an OrbiTtrap Elite mass spectrometer (Thermo-Fisher Sci. Inc) for MS analysis.
  • the instrument was operated in positive ESI mode and the resolution of the instrument was set at 60,000.
  • Proteome Discoverer software (Thermo Fisher Sci. Inc.) was used to identify the sequence of the resulting peptides.
  • the optimal quench condition with the best coverage map of BAX (0.08M GuHCl in 0.8% formic acid) was used for subsequent functionally deuterated studies.
  • Hydrogen-deuterium exchange reactions were initiated by diluting 3 ⁇ of pre-chilled protein stock solution (free BAX, 1 mg/ml, or antibody-bound BAX, 2mg/ml) into 9 ⁇ D20 buffer (8.3 mM Tris, 150 mM NaCl, in D20, pDREAD 7.2). The samples were incubated at 0 °C for 10 sec, 100 sec and 1000 sec. The exchange reaction was terminated by the addition of 18 ⁇ of optimized quench solution at 0 °C and samples were immediately frozen on dry ice and stored at -80°C. In addition, un-deuterated samples and equilibrium-deuterated control samples were also prepared as previously described (29).
  • the deuterated samples were then loaded onto above instrument for DXMS analysis.
  • the centroids of the isotopic envelopes of un-deuterated, functionally deuterated, and equilibrium deuterated peptides were measured using HDExaminer, and then converted to corresponding deuteration levels with corrections for back-exchange (30).
  • HADDOCK calculations were performed with Crystallography and NMR system solve (CNS) within the HADDOCK web server using the prediction interface (31).
  • HADDOCK calculations generated models of the complex that are in agreement with experimental distance restraints and have optimal electrostatic and van der Waals interactions based on a combination of molecular dynamics and energy minimization.
  • HADDOCK docking was performed using the BAX NMR structural ensemble imported directly from the PDB (PDB ID: 1F16).
  • the 3G11 structural model was generated using PIGS software based on structural homology modeling of known Fab structures of the same family that have different amino acid composition of CDR regions (32).
  • active residues for BAX included residues 19-25 and 123-142; active residues for 3G11 were defined as Heavy Chain: 26-32 (Loop 1), 52-54 (Loop 2), 96-101 (loop 3) and Light Chain; 141-148, 165-168, and 206-211.
  • HADDOCK structure calculation 1000 orientations/structures of the complex were generated by rigid-body docking energy minimization of the individual structures. The 188 lowest energy structures were semi-flexibly refined in torsion angle space and then refined in explicit solvent.
  • RMSD the overall lowest energy structure
  • 3G11 was localized to N-terminal trigger site. Ribbon diagrams and molecular models were depicted using PYMOL (Schrodinger).
  • Library F A restricted diversity phage antigen-binding fragment (Fab) library (“Library F") was used to select a panel of Fabs that bind to monomeric BAX (9).
  • Library F was designed to contain mostly binomial Tyr/Ser diversity in CDR-H1 and H2, and expanded diversity, encoding the nine amino acids Tyr/Ser/Gly/Ala/Phe/Trp/His/Pro/Val in a 5/4/4/2/1/1/1/1/1 ratio, at CDR- L3 and H3 (33).
  • the CDR-L3 and H3 loops vary in size.
  • Fabs were expressed and purified and the half-maximal binding titers (EC5 0 ) for BAX using ELISA were determined.
  • the EC5 0 values ranged from high affinity 2.3 nM (2B1) to moderate affinity 250 nM (2A5) with most Fabs having single or double digit nM nanomolar EC5 0 (Fig. 1A).
  • Select Fabs 3G11, 3E8, 2A5 and 2B1 were evaluated for binding kinetics to monomeric BAX using Biolayer Interferometry (Fig. IB).
  • the binding affinities (K D values) and ranking of the Fab proteins based on binding correlate with the EC5 0 from ELISA.
  • Fabs 3G11, 3E8 and 2B1 were the highest-affinity binders to BAX, while Fab 2A5 was the lowest-affinity binder (Fig. 1A, IB). Hence, an array of 14 high- affinity antibodies against monomeric BAX was identified.
  • Fab 2A5 does not compete b3Gl l binding likely because it is a much weaker binder than 3G11. Furthermore, a study was also conducted of how binding of phage- expressed Fabs ( ⁇ ) can be competitively inhibited by free Fab proteins. The data showed that phage-expressed Fab binding was inhibited to varying degrees in the presence of 100 nM Fab protein for many of the clones and that, in each case, the phage-expressed Fab for a particular clone could be inhibited by its own Fab protein (Fig. ID).
  • Synthetic Antibodies Inhibit BH3-triggered BAX activation and MOMP -
  • liposomal assays were performed that explicitly evaluate how BH3 -triggered BAX forms a pore in a membrane environment made from similar lipid composition of mitochondria without the contribution of other mitochondrial factors (34).
  • Selected Fabs have the potential to activate BAX by engaging one of the activation sites of BAX either at its N-terminal or C-terminal surface (10,15,35,36) or inhibit BAX activation by inhibiting the BAX binding surface of the activator protein tBID or conformational changes associated with BAX activation (12,15,16,20,37).
  • Fabs can inhibit BAX activation in the presence of mitochondrial membranes loaded with anti-apoptotic BCl-2 or other mitochondrial proteins
  • mouse liver mitochondria were isolated from Bak '1' mice to perform a mitochondrial release assay.
  • Combination of tBID and BAX was exposed to several doses of Fab 3G11, which demonstrated dose-responsive inhibition of mitochondrial cytochrome c release induced by activated BAX, as assessed by separation of the supernatant and mitochondrial fractions and western analysis (Fig. 3A).
  • BAX localization was determined to examine whether inhibition by Fab 3G11 was due to prevention of BAX translocation to the membrane or blocking of the membrane integration and oligomerization on the outer mitochondrial membrane.
  • Fab 3G11 Protein Forms a Stable and Stoichiometric Complex with BAX -
  • SEC size-exclusion chromatography
  • HXMS hydrogen-deuterium exchange mass spectrometry
  • the HXMS analysis suggests that the binding region of the 3G11 is localized on the N-terminal surface of the BAX structure and overlaps with the 1) N-terminal trigger site of BAX (al/a6) that controls a series of conformational changes upon BH3 domain activation (11-12) and 2) the binding epitope (residues 12-24) that is recognized by the 6A7 antibody only on the conformational active BAX (Fig. 4).
  • the al-a2 loop whose displacement was determined to be essential for the initiation of conformational changes upon BH3-triggered BAX activation (12), is protected by the Fab binding interaction.
  • the binding interaction of 3G11 to BAX is localized to the N-terminal surface of BAX, overlapping with the N-terminal trigger site and preventing conformational changes that lead to activation of the monomeric BAX.
  • vMIA cytomegalovirus protein
  • BCL-2 (20) proteins suggested potential sites that intervene with BAX activation, interestingly, none of these peptides directly block the N-terminal activation site of the soluble BAX or the C-terminal activation site of the mitochondrial associated BAX.
  • a protein-protein structure calculation approach (39) was used to further confirm this novel interaction of 3G11 bound to the N-terminal surface of BAX.
  • HADDOCK structure calculations were performed using ambiguous interaction restraints between BAX residues determined by HXMS to be most protected from solvent upon 3G11 binding (residues of the al, a6 and the al-a2 loop) and residues of the CDR regions present in the 3G11 protein sequence. Furthermore, calculations included an NMR structural ensemble of BAX with different loop conformations. Based on these calculations, the 3G11 binds more favorably in a direct interaction with N-terminal trigger site of BAX and the closed conformation of al-a2 loop (10,12). 3G11 protein makes interactions of hydrophobic and hydrophilic nature with the solvent-exposed hydrophobic residues and polar/charged residues of the BAX trigger site covering a large interface surface of (1640 A).
  • 3G11 binds C-terminal truncated BAX, which mimics the mitochondrial-associated BAX (15). Mitochondrial inserted BAX oligomerizes and undergoes dramatic conformational changes of the monomeric BAX to such extent that the N-terminal surface of BAX is not available for binding to Fabs (13,15,16,40). Therefore, selected Fabs are expected to be conformational specific for cytosolic and mitochondrial-associated BAX and inhibit both conformations from proceeding along the BAX activation process.
  • BAX is shown to have two different activation sites depending on its cytosolic or mitochondrial associated conformations; the N-terminal BH3 pocket (trigger site) and the C- terminal BH3 pocket.
  • N-terminal BH3 pocket trigger site
  • C- terminal BH3 pocket C- terminal BH3 pocket.
  • a stapled helical peptide of the BH4 domain of BCL-2 protein binds to a cleft formed by select residues of the al-a2 loop, a2, a3, a5 and a6 (20).
  • a helical peptide of the cytomegalovirus protein vMIA binds to a distinct site at the same side of the BAX structure that includes the loops of ⁇ 3- ⁇ 4 and ⁇ 5- ⁇ 6 (38). In both cases, the peptides bind to a geographically distinct site that have no overlap with either of the N- terminal or C-terminal activation site. Therefore, these mechanisms of BAX inhibition reflect allosteric mechanisms that suppress conformational changes upon BAX activation.
  • the present data indicate that the direct inhibition mechanism of BAX by 3G11 Fab through interaction with the N-terminal activation site is a feasible and effective mechanism of BAX inhibition.
  • Rapamycin protects against apoptotic neuronal death and improves neurologic function after traumatic brain injury in mice via modulation of the mTOR-p53-Bax axis. J. Surg. Res. 194, 239-247
  • HADDOCK a protein-protein docking approach based on biochemical or biophysical information. J. Amer. Chem. Soc. 125, 1731-1737

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • Molecular Biology (AREA)
  • Engineering & Computer Science (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Epidemiology (AREA)
  • Biochemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Dispersion Chemistry (AREA)
  • Hematology (AREA)
  • Urology & Nephrology (AREA)
  • Biomedical Technology (AREA)
  • Zoology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Physics & Mathematics (AREA)
  • Analytical Chemistry (AREA)
  • Food Science & Technology (AREA)
  • Biotechnology (AREA)
  • Microbiology (AREA)
  • Pathology (AREA)
  • General Physics & Mathematics (AREA)
  • Cell Biology (AREA)
  • Peptides Or Proteins (AREA)
  • Hospice & Palliative Care (AREA)
  • Oncology (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)

Abstract

Synthetic fragment antigen-binding (Fab) antibodies are disclosed that bind to an N- terminal activation site of BCL-2-associated X-protein (BAX) and inhibit BAX activation. Also disclosed are methods of using the Fabs for measuring inactive monomeric BAX levels, screening for small molecules that bind to an N-terminal activation site of BAX, inhibiting apoptotic cell death, and predicting the ability of a cancer therapy to promote apoptotic cell death.

Description

SYNTHETIC ANTIBODIES TO BAX AND USES THEREOF
CROSS-REFERENCE TO RELATED APPLICATION
[0001] This application claims the benefit of U.S. Provisional patent application No. 62/216,400, filed on September 10, 2015, the contents of which is herein incorporated by reference in its entirety.
STATEMENT OF GOVERNMENT INTEREST
[0002] This invention was made with government support under grant numbers HL095929, CA178394 and CA155472 awarded by the National Institutes of Health. The government has certain rights in the invention.
BACKGROUND OF THE INVENTION
[0003] Throughout this application various publications are referred to by number in parentheses. Full citations for these references may be found at the end of the specification. The disclosures of these publications, and all patents, patent application publications and books referred to herein, are hereby incorporated by reference in their entirety into the subject application to more fully describe the art to which the subject invention pertains.
[0004] Apoptosis plays a critical role in maintaining normal tissue homoeostasis in multicellular organisms and its deregulation results in an imbalance of homeostasis contributing to several diseases (1,2) The BCL-2 protein family plays a central role in regulating the mitochondrial pathway of apoptosis (3,4) The mitochondrial outer membrane permeabilization (MOMP) is considered the key event that is regulated by the complex network of protein-protein interactions between pro-apoptotic and anti-apoptotic members of the BCL-2 family. Activation of pro-apoptotic members BAX and/or BAK is required for induction of MOMP, whereas the anti-apoptotic or survival proteins such as BCL-2, BCL-XL and MCL-1, inhibit the pro-apoptotic proteins and prevent MOMP. Activation of BAX and BAK or inhibition of anti-apoptotic BCL-2 proteins is regulated by direct interaction with the BH3-only proteins.
[0005] The activation pathway of BAX represents the gateway to apoptosis and understanding the function of BAX and its regulation mechanisms is an area of intensive investigation. BAX is predominantly found in the cytosolic compartment in an inactive conformation (5,6). Upon cellular stress, BAX is triggered and undergoes a series of conformational changes that enable its translocation to the mitochondrial membrane and oligomerization leading to MOMP induction (7,8). The structure of the BAX monomer in the inactive conformation was previously determined by nuclear magnetic resonance (NMR) spectroscopy (9). The inactive BAX structure adopts a typical BCL-2 fold, consisting of nine a-helices linked with variable loops. In contrast to BAK and anti-apoptotic BCL-2 proteins that reside at the mitochondrial outer membrane, the structure of BAX was determined with its hydrophobic C-terminal helix a9 bound to the canonical hydrophobic groove. When the C-terminal a9 helix dissociates from the canonical hydrophobic groove, it binds to the mitochondrial outer membrane facilitating the mitochondrial translocation of BAX (9). Structural analysis of a hydrocarbon stapled BIM BH3 helix bound to monomeric BAX uncovered an activation site at the N-terminal surface of BAX (10). This activation site regulates the trigger mechanism for conformational activation of cytosolic BAX leading to the release of the hydrophobic a9 helix and exposure of the hydrophobic a2 helix (BH3 domain) (10-12). Mitochondrial translocated BAX undergoes further conformational changes on the membrane that induce BAX oligomerization and MOMP (13-16), or is inhibited by anti-apoptotic Bcl-2 proteins (17-20).
[0006] A number of diseases and disorder are associated with premature or unwanted cell death and characterized by abnormal activation of BAX. The present invention addresses the need for inhibitors of BAX activation for therapeutic treatments.
SUMMARY OF THE INVENTION
[0007] The present invention discloses synthetic fragment antigen-binding (Fab) antibodies that bind to an N-terminal activation site of BCL-2-associated X-protein (BAX) and inhibit BAX activation. Also disclosed are methods of using the Fabs for measuring inactive monomeric BAX levels, screening for small molecules that bind to an N-terminal activation site of BAX, inhibiting apoptotic cell death, and predicting the ability of a cancer therapy to promote apoptotic cell death.
BRIEF DESCRIPTION OF THE DRAWINGS
[0008] Fig. 1A-1D. Discovery of synthetic antibody fragments that bind with high affinity to BAX at overlapping binding sites. (A) Synthetic antibody fragments (Fabs) that bind to BAX with the corresponding variable sequences of complementarity determining regions (CDRs) and half-maximal binding titers (EC50) as determined by ELISA. (B) Top panel: Binding affinity (KD), association rate constant (ka) and dissociation rate constant (kd) for select synthetic Fabs that bind to BAX as determined by biolayer interferometry. ELISA binding EC50S are shown for comparison. Bottom panel: A representative biolayer interferometry experiment using immobilized 3 Gi l and three different BAX concentrations (C) Synthetic Fabs, except 2A5, compete biotinylated 3G11 (b3Gl l) from binding to BAX using a competitive ELISA. (D) Binding of selected phage-bound expressed Fabs (Φ) to BAX as competitively inhibited by the corresponding free synthetic Fab proteins (100 nM). All synthetic Fabs, except 2A5, show at least 40% competition efficacy to different phage- bound expressed Fabs. Data shown in (B-D) represent mean ± SD from at least three independent experiments. In (A), SEQ ID NOs for CDRL3, CDRH1, CDRH2, and CDRH3 are respectively, SEQ ID NO: 1-4 for Fab 2B1, SEQ ID NO:5-8 for 3E8, SEQ ID NO:9-12 for 3G11, SEQ ID NO: 13-16 for 2D9, SEQ ID NO: 17-20 for 3G9, SEQ ID NO:21-24 for 2C11, SEQ ID NO:25-28 for 3H4, SEQ ID NO:29-32 for 2A6, SEQ ID NO:33-36 for 3H1, SEQ ID NO:37-40 for 2A2, SEQ ID NO:41-44 for 3G3, SEQ ID NO:45-48 for 2D5, SEQ ID NO:49- 52 for 2D2, and SEQ ID NO:53-56 for 2A5.
[0009] Fig. 2A-2F. Synthetic Fabs inhibit BAX activation induced by pro-apoptotic tBID in liposomal assay. (A) Synthetic BAX-binding Fabs or a VEGF specific Fab (YADS1) at 2 μΜ have no capacity to induce BAX-mediated liposomal ANT/DPX release while tBID induced potent BAX-mediated liposomal release. (B) BAX-binding Fabs at 2 μΜ, except 2A5 and YADS 1, inhibit tBID-induced BAX-mediated liposomal ANT/DPX release. Bars represent mean ± SD value at 90 min that is normalized to tBID-induced maximum ANTS/DPX release at 90 min (C-F). Representative liposomal ANTS/DPX release experiments in kinetic representation showing the inhibitory activity of Fabs 3G11, 2B1 and 3E8 at 0.5 μΜ, 1 μΜ and 2 μΜ Fab whereas 2A5 had no inhibitory effect. Experiments performed with 400 nM BAX, 30 nM tBID and up to 2 uM Fabs (A-F). Data shown in (A-F) represent mean ± SD from triplicates normalized using either tBid-induced BAX mediated ANTS/DPX release as 100% (A-B) or 1% triton release as 100% (C-F). Data shown are representative of at least three independent experiments.
[0010] Fig. 3A-3B. Synthetic Fab 3G11 inhibit BAX-mediated cytochrome c release and BAX mitochondrial translocation induced by pro-apoptotic tBID in isolated mitochondria. (A) Fab 3G11 inhibits dose-responsively tBID-induced BAX-mediated cytochrome c release from isolated BAK mitochondria. (B) 3G11 Fab inhibits dose-responsively tBID-induced BAX mitochondrial translocation in isolated BAK" " mitochondria. Data shown are representative of at least three independent experiments.
[0011] Fig. 4. 3G11 binds to the N-terminal surface of BAX. % deuterium incorporation of unbound BAX conformation was determined in solution. HXMS analysis suggests increased rates of deuterium exchange in the N-terminal region of BAX, the al-a2 loop and helices α2, part of a5, a8, and a9. The relative difference of % deuterium incorporation of BAX conformation bound to 3 Gi l minus the % deuterium incorporation of BAX conformation alone was also determined. HXMS analysis suggests increased protection from deuterium incorporation in residues of helices al, a6, part of a5 and the al-a2 loop compared to the unbound BAX. The regions of significant protection from deuterium incorporation (> - 20%) are highlighted in dark on the sequence of BAX (SEQ ID NO:57). The ribbon representation of the full length BAX structure (PDB ID: 16F6) is shown in the bottom portion of the figure.
[0012] Fig. 5A-5F. Select BAX mutants inhibit functional inhibition and binding to BAX by 3G11. (A-D) Representative liposomal ANTS/DPX release experiments in kinetic representation showing the inhibitory activity of 3 Gi l (2 μΜ) with BAX WT that is weakened by the K21E mutation and completely abolished by the R134E or the double mutation R134E/K21E. Experiments performed with 400 nM BAX WT or BAX mutants, 30 nM tBID and 2 μΜ 3G11. (E) % Inhibition based on the maximum tB ID-induced BAX activation for BAX WT and mutants at 90 min in presence or absence of 3G11 Fab. (F) ELISA binding profiles for 3G11 binding to BAX WT and mutants. Half-maximal binding titers (EC50) were determined as follows: 8 ± 2 nM for BAX WT, 29 ± 4 for K21E, 89 ± 2 nM for R134E mutant and 91 ± 2 nM for the R134E/K21E double mutant. Data shown in (A-D) represent mean ± SD from triplicates and at least two independent experiments.
DETAILED DESCRIPTION OF THE INVENTION
[0013] The invention provides a synthetic fragment antigen-binding (Fab) antibody that binds to an N-terminal activation site of BCL-2-associated X-protein (BAX) and inhibits BAX activation. Preferably, the antibody maintains BAX in its inactive, monomeric form. The antibody can bind to residues of helices al and a6, and to residues of al-a2 loop of BAX. Preferably, the antibody binds to BAX with a half-maximal binding (EC50) affinity of 2nM-70nM. Preferably, the antibody blocks the interaction of BAX with a BAX activating partner, such as, for example, tBID, PUMA, BIM and/or NOXA.
[0014] In different embodiments, the Fab is selected from the group consisting of
2B1 Fab, having a CDRL3 region comprising the amino acid sequence QYSGSGHYLI (SEQ ID NO: l), a CDRH1 region comprising the amino sequence IYSSSM (SEQ ID NO:2), a CDRH2 region comprising the amino acid sequence SISSSSSYTS (SEQ ID NO:3) and a CDRH3 region comprising the amino acid sequence RGYWYYWAWWASAMD (SEQ ID NO:4); 3E8 Fab, having a CDRL3 region comprising the amino acid sequence QSSYSLI (SEQ ID NO:5), a CDRH1 region comprising the amino sequence LSYYSM (SEQ ID NO: 6), a CDRH2 region comprising the amino acid sequence SISPYYGYTY (SEQ ID NO:7) and a CDRH3 region comprising the amino acid sequence RGGAYYFGYYGSGSYAMD (SEQ ID NO: 8);
3G11 Fab, having a CDRL3 region comprising the amino acid sequence QWSFGPI (SEQ ID NO:9), a CDRH1 region comprising the amino sequence ISYYSM (SEQ ID NO: 10), a CDRH2 region comprising the amino acid sequence SIYPYSSSTY (SEQ ID NO: 11) and a CDRH3 region comprising the amino acid sequence RSSAMD (SEQ ID NO: 12);
2D9 Fab, having a CDRL3 region comprising the amino acid sequence QWSHYLI (SEQ ID NO: 13), a CDRH1 region comprising the amino sequence LYYYSM (SEQ ID NO: 14), a CDRH2 region comprising the amino acid sequence SISPSYGYTS (SEQ ID NO: 15) and a CDRH3 region comprising the amino acid sequence RSSFYYYALD (SEQ ID NO: 16);
3G9 Fab, having a CDRL3 region comprising the amino acid sequence QHYYYSPWPI (SEQ ID NO: 17), a CDRH1 region comprising the amino sequence LYSYYI (SEQ ID NO: 18), a CDRH2 region comprising the amino acid sequence SISPYYSSTY (SEQ ID NO: 19) and a CDRH3 region comprising the amino acid sequence RSSYSYAGMD (SEQ ID NO: 20);
2C11 Fab, having a CDRL3 region comprising the amino acid sequence QSYVSPI (SEQ ID NO:21), a CDRH1 region comprising the amino sequence ISSYYI (SEQ ID NO:22), a CDRH2 region comprising the amino acid sequence SISSYYSSTY (SEQ ID NO:23) and a CDRH3 region comprising the amino acid sequence RV S YGHAYVGYS SGMD (SEQ ID NO:24);
3H4 Fab, having a CDRL3 region comprising the amino acid sequence QSWYYSYPI (SEQ ID NO: 25), a CDRH1 region comprising the amino sequence LSYSSM (SEQ ID NO:26), a CDRH2 region comprising the amino acid sequence SISSYYSYTS (SEQ ID NO:27) and a CDRH3 region comprising the amino acid sequence RYYGYGGGID (SEQ ID NO:28);
2A6 Fab, having a CDRL3 region comprising the amino acid sequence QSAGGYPLI (SEQ ID NO:29), a CDRH1 region comprising the amino sequence IYYSSM (SEQ ID NO:30), a CDRH2 region comprising the amino acid sequence SISPYSSYTS (SEQ ID NO:31) and a CDRH3 region comprising the amino acid sequence RSFGYGWAFD (SEQ ID NO:32);
3H1 Fab, having a CDRL3 region comprising the amino acid sequence QHSYPI (SEQ ID NO:33), a CDRH1 region comprising the amino sequence ISYSSI (SEQ ID NO:34), a CDRH2 region comprising the amino acid sequence SIYSYSGSTY (SEQ ID NO: 35) and a CDRH3 region comprising the amino acid sequence RYGAMD (SEQ ID NO:36);
2A2 Fab, having a CDRL3 region comprising the amino acid sequence QYYYPI (SEQ ID NO:37), a CDRH1 region comprising the amino sequence ISSSSI (SEQ ID NO:38), a CDRH2 region comprising the amino acid sequence SIYSYYGYTY (SEQ ID NO:39) and a CDRH3 region comprising the amino acid sequence RYSAMD (SEQ ID NO: 40);
3G3 Fab, having a CDRL3 region comprising the amino acid sequence QGAWSGGHLI (SEQ ID NO:41), a CDRH1 region comprising the amino sequence LSYSSM (SEQ ID NO:42), a CDRH2 region comprising the amino acid sequence YISPYYGYTY (SEQ ID NO:43) and a CDRH3 region comprising the amino acid sequence RGWAYYYGYWGP S GLD (SEQ ID NO:44);
2D5 Fab, having a CDRL3 region comprising the amino acid sequence QWGYSHSHLI (SEQ ID NO:45), a CDRH1 region comprising the amino sequence ISYSS (SEQ ID NO:46), a CDRH2 region comprising the amino acid sequence SISPYYGSTY (SEQ ID NO:47) and a CDRH3 region comprising the amino acid sequence RSHFGALD (SEQ ID NO:48);
2D2 Fab, having a CDRL3 region comprising the amino acid sequence QSYYWVSPF (SEQ ID NO:49), a CDRH1 region comprising the amino sequence LYYSSI (SEQ ID NO:50), a CDRH2 region comprising the amino acid sequence SIYPYSGSTY (SEQ ID NO:51) and a CDRH3 region comprising the amino acid sequence RSYGYAMD (SEQ ID NO:52); and
2A5 Fab, having a CDRL3 region comprising the amino acid sequence QYHYWYYPI (SEQ ID NO:53), a CDRH1 region comprising the amino sequence ISYYSM (SEQ ID NO:54), a CDRH2 region comprising the amino acid sequence SISPYYGSTY (SEQ ID NO:55) and a CDRH3 region comprising the amino acid sequence RAGAMD (SEQ ID NO:56).
[0015] The complete heavy and light chain variable domain amino acid sequences for the
14 Fabs are shown below.
1) 3E8 heavy chain, 242 residues
EVQLVESGGGLVQPGGSLRLSCAASGFNLSYYSMHWVRQAPGKGLEWVASISPYYG YTYY AD S VKGRFTI S ADTS KNTAYLQMNS LRAEDT AV YYC ARGGAYYF GYYGS GS YAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVS WNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKK VEPKS CDKTHTCHHHHHH (SEQ ID NO:58)
light chain, 225 residues
DIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGV
PSRFSGSRSGTDFTLTISSLQPEDFATYYCQQSSYS LITFGQGTKVEIKRTVAAPSV
FIFPPSDSQLKSGTASVVCLLN FYPREAKVQWKVDNALQSGNSQESVTEQDSKDST YSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGECGGSDYKDDDDK
(SEQ ID NO:59)
2) 3G3
heavy chain, 240 residues
EVQLVESGGGLVQPGGSLRLSCAASGFNLSYSSMHWVRQAPGKGLEWVAYISPYYG YTYYADSVKGRFTISADTSK TAYLQMNSLRAEDTAVYYCARGWAYYYGYWGPS- -GLDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSW NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE PKSCDKTHTC HHHHHH (SEQ ID NO:60)
light chain, 228 residues
DIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGV PSRFSGSRSGTDFTLTISSLQPEDFATYYCQQGAWSGGHLITFGQGTKVEIKRTVAAPS VFIFPPSDSQLKSGTASVVCLLN FYPREAKVQWKVDNALQSGNSQESVTEQDSKDS TYSLS STLTLSKADYEKHKVYACEVTHXGLS SPVTKSFNRGECGGSDYKDDDDK
(SEQ ID N0:61)
3) 3G9
heavy chain, 234 residues
EVQLVESGGGLVQPGGSLRLSCAASGFNLYSYYIHWVRQAPGKGLEWVASISPYYSS
TYYADSVKGRFTISADTSK TAYLQMNSLRAEDTAVYYCARSSYSYA GM
DYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSG ALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS CDKTHTC HHHHHH (SEQ ID NO:62)
light chain, 228 residues
DIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGV PSRFSGSRSGTDFTLTISSLQPEDFATYYCQQHYYYSPWPITFGQGTKVEIKRTVAAPS VFIFPPSDSQLKSGTASVVCLLN FYPREAKVQWKVDNALQSGNSQESVTEQDSKDS TYSLS STLTLSKADYEKHKVYACEVTHQGLS SPVTKSFNRGECGGSDYKDDDDK
(SEQ ID NO:63)
4) 3G11
heavy chain, 230 residues
EVQLVESGGGLVQPGGSLRLSCAASGFNISYYSMHWVRQAPGKGLEWVASIYPYSSS
TYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSS AMD
YWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGA LTS GVHTFP AVLQ S S GL YSL S S V VTVP S S S LGTQTYICNVNHKP SNTKVDKKVEPKS C DKTHTCHHHHHH (SEQ ID NO: 64)
light chain, 225 residues
DIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGV
PSRFSGSRSGTDFTLTISSLQPEDFATYYCQQWSFG PITF GQ GTKVEIKRTV AAP S V
FIFPPSDSQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDST YSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGECGGSDYKDDDDK
(SEQ ID NO:65)
5) 3H1
heavy chain, 230 residues
EVQLVESGGGLVQPGGSLRLSCAASGFNISYSSIHWVRQAPGKGLEWVASIYSYSGS
TYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARYG AM
DYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSG ALTS GVHTFP AVLQ S S GLYSL S S V VTVP S S S LGTQTYICNVNHKP SNTKVDKKVEPKS CDKTHTCHHHHHH (SEQ ID NO: 66)
light chain, 224 residues
DIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGV
PSRFSGSRSGTDFTLTISSLQPEDFATYYCQQHSY PITFGQGTKVEIKRTVAAPSV
FIFPPSDSQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDST YSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGECGGSDYKDDDDK
(SEQ ID NO:67)
6) 3H4
heavy chain, 234 residues
EVQLVESGGGLVQPGGSLRLSCAASGFNLSYSSMHWVRQAPGKGLEWVASISSYYS
YTSYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARYYGYGG G
IDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNS GALTS GVHTFP AVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK SCDKTHTC HHHHHH (SEQ ID NO:68) light chain, 227 residues
DIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGV PSRFSGSRSGTDFTLTISSLQPEDFATYYCQQSWYYSY-PITFGQGTKVEIKRTVAAPS VFIFPPSDSQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDS TYSLS STLTLSKADYEKHKVYACEVTHQGLS SPVTKSFNRGECGGSDYKDDDDK
(SEQ ID NO:69)
7) 2A2
heavy chain, 230 residues
EVQLVESGGGLVQPGGSLRLSCAASGFNISSSSIHWVRQAPGKGLEWVASIYSYYGY
TYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARYS AMD
YWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGA LTS GVHTFP AVLQ S S GL YSL S S V VTVP S S S LGTQTYICNVNHKP SNTKVDKKVEPKS C DKTHTC HHHHHH (SEQ ID NO: 70)
light chain, 224 residues DIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGV
PSRFSGSRSGTDFTLTISSLQPEDFATYYCQQYYY PITFGQGTKVEIKRTVAAPSV
FIFPPSDSQLKSGTASVVCLLN FYPREAKVQWKVDNALQSGNSQESVTEQDSKDST YSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGECGGSDYKDDDDK
(SEQ ID NO:71)
8) 2A5
heavy chain, 230 residues
EVQLVESGGGLVQPGGSLRLSCAASGFNIYSSSMHWVRQAPGKGLEWVASISSSSSY
TSYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCAR-AG AMDYWGQG
TLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVH TFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTC HHHHHH (SEQ ID NO:72)
light chain, 227 residues
DIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGV PSRFSGSRSGTDFTLTISSLQPEDFATYYCQQYHYWYY-PITFGQGTKVEIKRTVAAPS VFIFPPSDSQLKSGTASVVCLLN FYPREAKVQWKVDNALQSGNSQESVTEQDSKDS TYSLS STLTLSKADYEKHKVYACEVTHXGLS SPVTKSFNRGECGGSDYKDDDDK
(SEQ ID NO:73)
9) 2A6
heavy chain, 234 residues
EVQLVESGGGLVQPGGSLRLSCAASGFNIYYSSMHWVRQAPGKGLEWVASISPYSSY
TS Y AD S VKGRFTI S ADTS K TAYLQMNS LRAEDTAV YYC ARS FGYGW AF
DYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSG ALTS GVHTFP AVLQ S S GLYSL S S V VTVP S S S LGTQTYICNVNHKP SNTKVDKKVEPKS CDKTHTC HHHHHH (SEQ ID NO:74)
light chain, 227 residues
DIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGV PSRFSGSRSGTDFTLTISSLQPEDFATYYCQQSAGGYP-LITFGQGTKVEIKRTVAAPS VFIFPPSDSQLKSGTASVVCLLN FYPREAKVQWKVDNALQSGNSQESVTEQDSKDS TYSLS STLTLSKADYEKHKVYACEVTHXGLS SPVTKSFNRGECGGSDYKDDDDK
(SEQ ID NO:75)
10) 2B1
heavy chain, 239 residues
EVQLVESGGGLVQPGGSLRLSCAASGFNIYSSSMHWVRQAPGKGLEWVASISSSSSY
TSYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARGYWYYWAWWAS
AMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSW NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE PKSCDKTHTC HHHHHH (SEQ ID NO:76)
light chain, 228 residues
DIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGV PSRFSGSRSGTDFTLTISSLQPEDFATYYCQQYSGSGHYLITFGQGTKVEIKRTVAAPS VFIFPPSDSQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDS TYSLS STLTLSKADYEKHKVYACEVTHQGLS SPVTKSFNRGECGGSDYKDDDDK
(SEQ ID NO:77) 11) 2C11
heavy chain, 240 residues
EVQLVESGGGLVQPGGSLRLSCAASGFNISSYYIHWVRQAPGKGLEWVASISSYYSS TYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARVSYGHAYVGYSS— G MDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWN SGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP KSCDKTHTC HHHHHH (SEQ ID NO:78) light chain, 225 residues
DIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGV
PSRFSGSRSGTDFTLTISSLQPEDFATYYCQQSYVS PITFGQGTKVEIKRTVAAPSV
FIFPPSDSQLKSGTASVVCLLN FYPREAKVQWKVDNALQSGNSQESVTEXDSKDST YSLSSTLTLSKADYEKHKVYACEVTHXGLSSPVTKSFNRGECGGSDYKDDDDK
(SEQ ID NO:79)
12) 2D2
heavy chain, 232 residues
EVQLVESGGGLVQPGGSLRLSCAASGFNLYYSSIHWVRQAPGKGLEWVASIYPYSGS
TYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSYGY AM
DYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSG ALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS CDKTHTC HHHHHH (SEQ ID NO: 80) light chain, 227 residues
DIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGV PSRFSGSRSGTDFTLTISSLQPEDFATYYCQQSYYWVS-PFTFGQGTKVEIKRTVAAPS VFIFPPSDSQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDS TYSLS STLTLSKADYEKHKVYACEVTHQGLS SPVTKSFNRGECGGSDYKDDDDK
(SEQ ID NO:81)
13) 2D5
heavy chain, 232 residues
EVQLVESGGGLVQPGGSLRLSCAASGFNISYSSIHWVRQAPGKGLEWVASISPYYGS
TYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSHFG ALD
YWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGA LTS GVHTFP AVLQ S S GL YSL S S V VTVP S S S LGTQTYICNVNHKP SNTKVDKKVEPKS C DKTHTC HHHHHH (SEQ ID NO: 82) light chain, 228 residues
DIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGV PSRFSGSRSGTDFTLTISSLQPEDFATYYCQQWGYSHSHLITFGQGTKVEIKRTVAAPS VFIFPPSDSQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDS TYSLS STLTLSKADYEKHKVYACEVTHXGLS SPVTKSFNRGECGGSDYKDDDDK
(SEQ ID NO: 83)
14) 2D9
heavy chain, 234 residues
EVQLVESGGGLVQPGGSLRLSCAASGFNLYYYSMHWVRQAPGKGLEWVASISPSYG YTSYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSSFYYY AL DYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSG ALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVD KKVEPKSCDKTHTC HHHHHH (SEQ ID NO:84) light chain, 225residues
DIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGV
PSRFSGSRSGTDFTLTISSLQPEDFATYYCQQWSHY LITF GQ GTKVEIKRTV AAP S
VFIFPPSDSQLKSGTASVVCLLN FYPREAKVQWKVDNALQSGNSQESVTEQDSKDS TYSLS STLTLSKADYEKHKVYACEVTHQGLS SPVTKSFNRGECGGSDYKDDDDK
(SEQ ID NO: 85).
[0016] The Fabs bind to and inhibit BAX.
[0017] The Fabs can be produced reproducibly in large amounts using bacterial expression or mammalian expression systems.
[0018] The invention further provides a method of inhibiting apoptotic cell death by contacting BCL-2-associated X-protein (BAX) with any of the synthetic Fab antibodies disclosed herein in an amount effective to inhibit activation of BAX and apoptotic cell death. The synthetic Fab antibody can be conjugated to a therapeutic agent and/or to an agent that facilitates transport across a cell membrane. The synthetic Fab antibody can administered to a subject using any known method effective to administer an amount of the antibody that inhibits activation of BAX, including, for example, lentiviral or adenoviral expression, a plasmid, nanoparticles or liposomes.
[0019] The synthetic Fab antibody can be administered to a subject having, for example, a disease or disorder selected from the group consisting of a cardiovascular disease or disorder (e.g., arteriosclerosis, heart failure, heart transplantation, aneurism, chronic pulmonary disease, ischemic heart disease, hypertension, thrombosis, and/or cardiomyopathies), a neurodegenerative or neurological disease or disorder (e.g., Alzheimer's disease, Parkinson's disease, Huntington's disease, retinitis pigmentosa, spinal muscular atrophy, various forms of cerebellar degeneration, and/or amyotrophic lateral sclerosis), a liver disease or disorder, a kidney disease or disorder, a metabolic disease or disorder, an immunological disorder (e.g., organ transplant rejection, arthritis, lupus, IBD, Crohn's disease, asthma, multiple sclerosis, and/or diabetes), ischemia (e.g., stroke, myocardial infarction and/or reperfusion injury), infertility, a blood disorder (e.g., fanconi anemia, aplastic anemia, thalassemia, congenital neutropenia, and/or myelodysplasia), renal hypoxia, diabetes, hepatitis, asthma and AIDS.
[0020] Also provided is a method for measuring inactive monomelic BAX levels in a tissue sample from a subject comprising contacting the sample with any of the synthetic Fab antibodies disclosed herein and measuring the amount of antibody bound to the sample, wherein the amount of bound antibody is indicative of the level of inactive monomeric BAX in the tissue sample.
[0021] Further provided is a method for screening for small molecules that bind to an N- terminal activation site of BAX comprising contacting BAX with any of the synthetic Fab antibodies disclosed herein in the presence and in the absence of a small molecule and measuring the amount of antibody that binds to BAX, wherein a decrease in the amount of antibody binding to BAX in the presence of the small molecule indicates that the small molecule is a candidate for binding to the N-terminal activation site of BAX. It is also possible that the small molecule binds to a site on BAX that causes allosteric conformational changes that cause a decrease in the amount of antibody binding to BAX.
[0022] The method can comprise a competitive ELISA screening assay. In an embodiment of the methods described herein, the methods are useful for identifying therapeutic cell death inhibitors. In an embodiment of the methods described herein, the methods are useful for identifying therapeutic cell death activators.
[0023] In an embodiment of the methods described herein, the small molecule has a molecular weight of 2000 daltons or less. In an embodiment of the methods described herein, the small molecule has a molecular weight of 1500 daltons or less. In an embodiment of the methods described herein, the small molecule has a molecular weight of 1000 daltons or less. In an embodiment of the methods described herein, the small molecule has a molecular weight of 800 daltons or less. In an embodiment of the methods described herein, the small molecule has a molecular weight of either 2000, 1500, 1000, 800, 700, 600, 500 or 400 daltons or less. In an embodiment of the methods described herein, the small molecule is a small organic molecule.
[0024] Still further provided is a method of predicting the ability of a cancer therapy to promote apoptotic cell death comprising contacting a cancerous tissue sample with any of the synthetic Fab antibodies disclosed herein, with and without the cancer therapy, and measuring the amount of antibody that binds to the tissue sample, wherein a decrease in the amount of bound antibody with the cancer therapy indicates that the cancer therapy promotes activation of BAX and apoptotic cell death, and the amount of bound antibody without the cancer therapy can predict the capacity of the cancer therapy to promote activation of BAX and apoptotic cell death in the cancerous tissue. [0025] In the methods disclosed herein, the synthetic Fab antibody can be labeled with a detectable label, such as a fluorescent label or a radioactive label. The antibody can be biotinylated.
[0026] As used herein, "BAX" is BCL-2-associated X-protein. In an embodiment, the BAX is mammalian. In a preferred embodiment, the BAX is a human BAX. In an embodiment, the BAX comprises consecutive amino acid residues having the following sequence:
MDGSGEQPRGGGPTS SEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGD ELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRWALFYFASKLVLKALCTKVPEL I RTI MGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVT I FVAGVLTASLT IWKKMG (SEQ ID NO:57, human).
[0027] All combinations of the various elements described herein are within the scope of the invention unless otherwise indicated herein or otherwise clearly contradicted by context.
[0028] This invention will be better understood from the Experimental Details, which follow. However, one skilled in the art will readily appreciate that the specific methods and results discussed are merely illustrative of the invention as described more fully in the claims that follow thereafter.
EXPERIMENTAL DETAILS
Introduction
[0029] Synthetic antibody technology was applied to BCL-2 family proteins to probe novel conformations and functional regions on the surface of BAX. Synthetic antibody discovery utilizes diversity targeted to the antibody complementarity determining regions (CDRs) that is encoded by designed, synthetic oligonucleotides and screened by phage or yeast display (22,23). Since library construction and selection is performed entirely in vitro, the state of the target can be controlled through the antibody discovery process. Therefore, the specificity of the output antibodies can be tuned to user-specified stringency (24,25). Using a phage display screen, synthetic antibodies were identified that bind with high affinity and specificity to BAX. Although BAX can be expressed and purified readily, and studied by NMR and other biophysical techniques, it is prone to aggregation under some conditions (such as detergents). This aggregation phenomenon is presumably linked to its function of forming oligomeric pores in the mitochondrial membrane, but presents a formidable challenge in raising conformation-specific antibodies using techniques requiring immunization. Thus, there was a strong rationale for utilizing in vitro selection. [0030] Antibodies were identified that can be used as structural and biochemical probes to dissect key regulatory mechanisms and conformations of BAX (26,27). Fourteen novel synthetic antibody fragments (Fabs) were identified that specifically target BAX. These synthetic Fabs have no significant homology in the CDR sequences suggesting a diversity of molecular interactions with BAX. They bind to BAX with nanomolar affinities and occupy overlapping binding sites on BAX. Additionally, the synthetic Fabs inhibit BAX in assays using liposomal membranes or isolated mitochondria. Further analysis using isolated mitochondria suggest that the Fabs bind to cytosolic BAX and inhibit its ability to translocate and insert onto the mitochondria outer membrane. Structural studies using NMR and hydrogen/deuterium exchange mass spectrometry showed that a representative synthetic Fab (3G11) forms a stoichiometric and stable complex with monomeric and inactive BAX, with a binding site that involves residues of helices al/a6 and of the al-a2 loop. Therefore, binding of the synthetic Fabs overlaps with the N-terminal activation site of BAX suggesting a novel mechanism of BAX inhibition through direct competition with the BAX activation process. These Fabs provide new tools for probing BAX activity in an unparalleled manner and provide a strategy for therapeutic inhibition of BAX in disease.
Materials and Methods
[0031] Production of Recombinant BAX - Human full-length wild type BAX, truncated a9 BAX (BAX AC) and BAX mutants in pTYBl vector (New England Biolabs) were expressed in BL21 CodonPlus (DE3)-RIPL + E. coli strain and purified as previously described (9, 10).
[0032] Fab protein expression - The phage display vectors for the 14 identified clones were converted to Fab protein expression vectors by insertion of a stop codon and a 6- Histidine tag upstream of the P3 gene fusion. Fab proteins were expressed periplasmically in E. coli BL21(DE3) (New England Biolabs, Ipswich, MA) by growth in low-phosphate media at 30°C for 18-22 h. The cells were harvested by centrifugation and lysed by using the BugBuster lysis reagent according to the manufacturer's instructions (Novagen, Madison, WI). The lysate was subjected to centrifugation, and the supernatant was applied to a nickel column (Ni-NTA resin, Qiagen, Valencia, CA) pre-equilibrated with Tris-buffered saline (TBS), pH 7. The Fab-bound Ni-NTA column was then washed with 20-column volume TBS buffer with 20 mM imidazole. Next, the protein was eluted with TBS buffer with 250 mM imidazole. The eluent was dialyzed into PBS at pH 8.0, and applied to a Protein A affinity column (beads from Pierce Thermo Scientific, Rockford, IL) for further purification. The Fab-bound beads were washed with PBS, pH 8.0 (15 column volumes), and the Fab proteins were eluted with 100 mM glycine, pH 2.0. The eluted Fab proteins were immediately neutralized to ~ pH 7 using 1 M Tris buffer, pH 8.0. Fractions containing the Fab proteins were buffer-exchanged into PBS, pH 7.0 and were used directly in following binding and activity assays, or flash-frozen and stored at 80°C for future use. The Fab protein concentrations were determined by measuring the absorbance at 280 nm. The extinction coefficients at 280 nm were calculated from the Fab protein sequences using ExPASy.
[0033] Origin of sequence of the CDR regions - The antibody framework of all the BAX antibodies is a common scaffold based on Herceptin (mAb 4D5), which is a humanized variant of a mouse anti-Her2 monoclonal antibody developed by Genentech (South San Francisco, CA). The complementarity determining regions (CDRs), which bind the antigen and provide the mAb specificity, contain wholely "synthetic" (artificial) sequences. The nature of these synthetic CDR sequences reflects the engineered nature of the phage antibody library from which the antibodies were obtained: Koellhoffer et al., Chembiochem, 2012, 13, 2549.
[0034] Sequences of antibodies expressed in cells - The BAX antibodies were converted to single chain variable fragments (scFvs) and cloned into cell expression plasmids (discussed below). DNA sequences for the scFv open reading frames are indicated below for different Fabs:
3E8, SEQ ID NO:86
GGATCCGACATCCAGATGACCCAGTCCCCAAGCTCCCTGAGCGCATCCGTGGGCGATAGGGTGACCATCA CATGCAGGGCATCTCAGAGCGTGTCTAGCGCAGTGGCATGGTACCAGCAGAAGCCAGGCAAGGCCCCTAA GCTGCTGATCTACAGCGCCTCCTCTCTGTATTCCGGAGTGCCTTCTCGGTTCTCCGGCAGCCGGAGCGGA ACCGACTTTACCCTGACAATCAGCTCCCTGCAGCCAGAGGATTTCGCCACATACTATTGCCAGCAGTCTA GCTACTCCCTGATCACCTTTGGCCAGGGCACAAAGGTGGAGATCAAGGGAGGAGGCAGCGGAGGAGGCTC CGGAGGCGGCTCTGAGGTGCAGCTGGTGGAGAGCGGAGGAGGACTGGTGCAGCCTGGAGGCAGCCTGAGG CTGTCCTGTGCAGCATCTGGCTTCAACCTGTCTTACTATAGCATGCACTGGGTGCGCCAGGCACCAGGCA AGGGCCTGGAGTGGGTGGCCTCCATCTCTCCCTACTATGGCTACACCTACTATGCCGACTCTGTGAAGGG CCGGTTCACAATCAGCGCCGATACCTCCAAGAACACAGCCTATCTGCAGATGAATAGCCTGAGGGCAGAG GACACCGCAGT GTACTATTGTGCCAGAGGCGGCGCCTACTATTTTGGCTACTATGGCAGCGGCTCCTACG CCATGGATTATTGGGGCCAGGGCACCCTGGTGACAGTGTCCTCTTAATCTAGA
3G11, SEQ ID NO:87
GGATCCGACATCCAGATGACCCAGAGCCCAAGCTCCCTGAGCGCATCCGTGGGCGATAGGGTGACCATCA CATGCAGGGCATCTCAGAGCGTGTCTAGCGCAGTGGCATGGTACCAGCAGAAGCCAGGCAAGGCCCCTAA GCTGCTGATCTACTCCGCCTCCTCTCTGTATAGCGGCGTGCCTTCCCGGTTCTCCGGCAGCCGGAGCGGA ACCGACTTTACCCTGACAATCAGCTCCCTGCAGCCTGAGGATTTCGCCACATACTATTGCCAGCAGTGGA GCTTCGGCCCAATCACCTTTGGCCAGGGCACAAAGGTGGAGATCAAGGGAGGAGGCTCTGGAGGAGGCAG CGGAGGCGGCTCCGAGGTGCAGCTGGTGGAGTCCGGCGGCGGCCTGGTGCAGCCAGGAGGCTCTCTGAGG CTGAGCTGTGCCGCCTCCGGCTTCAACATCTCCTACTATTCTATGCACTGGGTGCGCCAGGCACCAGGCA AGGGCCTGGAGTGGGTGGCCTCCATCTACCCCTATTCTAGCTCCACCTACTATGCCGACTCTGTGAAGGG CCGGTTTACAATCTCTGCCGATACCAGCAAGAACACAGCCTACCTGCAGATGAATAGCCTGAGGGCAGAG GACACCGCAGT GTACTATTGTGCCAGATCTAGCGCCATGGATTATTGGGGCCAGGGCACCCTGGTGACAG TGTCCTCTTAATCTAGA 3H1, SEQ ID NO:88
GGATCCGACATCCAGATGACCCAGAGCCCAAGCTCCCTGAGCGCATCCGTGGGCGATAGGGTGACCATCA CATGCAGGGCATCTCAGAGCGTGTCTAGCGCAGTGGCATGGTACCAGCAGAAGCCAGGCAAGGCCCCTAA GCTGCTGATCTACAGCGCCTCCTCTCTGTATTCCGGAGTGCCTTCTCGGTTCTCCGGCAGCCGGAGCGGA ACCGACTTTACCCTGACAATCAGCTCCCTGCAGCCAGAGGATTTCGCCACATACTATTGCCAGCAGCACT CCTACCCCATCACCTTTGGCCAGGGCACAAAGGTGGAGATCAAGGGAGGAGGCAGCGGAGGAGGCTCCGG AGGCGGCTCTGAGGTGCAGCTGGTGGAGTCCGGAGGAGGACTGGTGCAGCCTGGAGGCAGCCTGAGGCTG TCCTGTGCAGCATCTGGCTTCAACATCTCTTACTCTAGCATCCACTGGGTGCGCCAGGCACCAGGCAAGG GCCTGGAGTGGGTGGCCTCTATCTACTCCTATTCTGGCAGCACCTACTATGCCGACAGCGTGAAGGGCCG GTTTACAATCAGCGCCGATACCTCCAAGAACACAGCCTATCTGCAGATGAATTCCCTGAGGGCAGAGGAC ACCGCAGTGTACTATTGTGCCAGATACGGCGCCATGGATTATTGGGGCCAGGGCACCCTGGTGACAGTGT CCTCTTAATCTAGA
2B1, SEQ ID NO:89
GGATCCGACATCCAGATGACCCAGTCCCCAAGCTCCCTGAGCGCATCCGTGGGCGATAGGGTGACCATCA CATGCAGGGCATCTCAGAGCGTGTCTAGCGCAGTGGCATGGTACCAGCAGAAGCCAGGCAAGGCCCCTAA GCTGCTGATCTACAGCGCCTCCTCTCTGTATAGCGGCGTGCCATCCCGGTTCTCCGGCAGCCGGAGCGGA ACCGACTTTACCCTGACAATCAGCTCCCTGCAGCCCGAGGATTTCGCCACATACTATTGCCAGCAGTACT CCGGCTCTGGCCACTATCTGATCACCTTTGGCCAGGGCACAAAGGTGGAGATCAAGGGAGGAGGCTCTGG AGGAGGCAGCGGAGGCGGCTCCGAGGTGCAGCTGGTGGAGTCCGGCGGCGGCCTGGTGCAGCCTGGAGGC TCTCTGAGGCTGAGCTGTGCAGCATCCGGCTTCAACATCTACTCTAGCTCCATGCACTGGGTGCGCCAGG CACCAGGCAAGGGCCTGGAGTGGGTGGCCAGCATCTCTAGCTCCTCTAGCTACACCTCTTATGCCGACAG CGTGAAGGGCCGGTTTACAATCTCCGCCGATACCTCTAAGAACACAGCCTATCTGCAGATGAATTCCCTG AGGGCAGAGGACACCGCAGTGTACTATTGTGCCAGAGGCTACTGGTACTATTGGGCCTGGTGGGCCAGCG CCATGGATTATTGGGGCCAGGGCACCCTGGTGACAGTGTCCTCTTAATCTAGA
2D9, SEQ ID NO:90
GGATCCGACATCCAGATGACCCAGAGCCCAAGCTCCCTGAGCGCATCCGTGGGCGATAGGGTGACCATCA CATGCAGGGCATCTCAGAGCGTGTCTAGCGCAGTGGCATGGTACCAGCAGAAGCCAGGCAAGGCCCCTAA GCTGCTGATCTACAGCGCCTCCTCTCTGTATTCCGGAGTGCCTTCTCGGTTCTCCGGCAGCCGGAGCGGA ACCGACTTTACCCTGACAATCAGCTCCCTGCAGCCAGAGGATTTCGCCACATACTATTGCCAGCAGTGGT CCCACTATCTGATCACCTTTGGCCAGGGCACAAAGGTGGAGATCAAGGGAGGAGGCAGCGGAGGAGGCTC CGGAGGCGGCTCTGAGGTGCAGCTGGTGGAGTCCGGAGGAGGACTGGTGCAGCCTGGAGGCAGCCTGAGG CTGTCCTGTGCAGCATCTGGCTTCAACCTGTACTATTACTCTATGCACTGGGTGCGCCAGGCACCAGGCA AGGGCCTGGAGTGGGTGGCCTCCATCTCTCCCAGCTACGGCTATACCAGCTACGCCGACTCCGTGAAGGG CCGGTTCACAATCTCTGCCGATACCAGCAAGAACACAGCCTATCTGCAGATGAATTCCCTGCGGGCCGAG GACACCGCCGT GTATTACTGTGCCAGATCTAGCTTTTATTACTATGCCCTGGATTACTGGGGCCAGGGAA CCCTGGTGACAGT GTCCTCTTAATCTAGA .
[0035] Cloning and procedures for in cell expression - The characterized mAbs were cloned to mammalian expression vectors (pCDNA3.1 or pMSCV PIG: Puro IRES GFP) in a reduced Fab form constructed by linear two copies of single chain variable Fragments (scFv) to ensure proper folding and expression. pCDNA3.1 is available from Addgene (Cambridge, MA) and GenScript (Piscataway, NJ) used it to clone the Fab sequences. Memorial Sloan Kettering Cancer Center (New York, NY) subcloned the Fab sequences from pCDNA3.1 to pMSCV. To easily detect the expression of Fabs and use them in pull-down experiments, 6 Myc tag sequences were included as an N-terminal tag to each scFv sequence during the cloning process. Transient expression of five Fabs in Mouse Embryo Fibroblasts (MEF) demonstrated that all Fabs are well expressed at similar levels. For more efficient transfection, Fab plasmids were transduced with retroviral transfection and stable Fab- expressing clones were selected using GFP as a selection marker. Co-immunoprecipation experiments using anti-myc agarose beads pulled down the Fabs and demonstrated their capacity to bind BAX in cells using anti-BAX Western analysis.
[0036] Direct binding ELISAs - BAX (1 μg per well) was first immobilized on 96-well EIA/RIA plate (Corning Incorporated, Corning, NY) at room temperature for 1 h or at 4°C for overnight. PBS containing 3% BSA was used to block the wells after BAX immobilization (incubation for 1.5 h at room temperature). The Fabs were diluted into PBS buffer (pH 7.0), applied to the wells, and incubated for 1 h at room temperature. The plates were then washed with PBS and incubated for 1 h with horseradish peroxidase/anti-FLAG M2 antibody conjugate (binding to the FLAG tag at the C-terminus of Fab light chain). The wells were washed with PBS, developed with 3,3',5,5'-tetramethylbenzidine (TMB) substrate, and quenched with 0.5 M H2SO4. The absorbance at 450 nm was determined. The data were fit to a standard four parameter logistic equation by using GraphPad Prism (GraphPad Software, La Jolla, CA). The half-maximal binding (EC50) values were obtained from the inflection point of the curve.
[0037] Competitive Binding ELISAs - Six Fab clones (3H1, 3G11, 3E8, 2A5, 2D9 and 2B1) were chosen for the competition ELISAs. Two different approaches were used. In the first approach, non-biotinylated Fabs were used to compete with the binding of biotinylated 3G11 (b3Gl l). To immobilized BAX on the 96-well EIA/RIA plate (Coming Incorporated, Coming, NY), a mixture of 50 nM b3Gl l and increasing amount of each of the six selected Fabs were added. After washes, only the binding of b3Gl 1 was monitored using horseradish peroxidase/streptavidin conjugate and TMB substrate. In the second approach, purified Fab proteins were used to compete with Fabs displayed at the phage surface. Similarly, to immobilized BAX on the 96-well EIA/RIA plate (Coming Incorporated, Coming, NY), a mixture of Fab-displayed phage (with a titer of -1012 pfu/mL) and 100 nM of each of the six selected Fab proteins were added. Only the binding of Fab-phage complex binding was monitored using horseradish peroxidase/anti-M13 antibody conjugate and TMB substrate.
[0038] Biolayer Inter ferometry - The forteBio BLItz system (Pall Corporation, Menlo Park, CA) was used to determine the binding kinetics and affinity between BAX and Fab proteins. Ni-NTA biosensors (Pall Corporation, Menlo Park, CA) were used for initial Fab protein immobilization, which was followed by BAX association and dissociation interaction analysis. 10 μg/mL Fab was used for immobilizing at pH 7. For each Fab protein, at least three different BAX concentrations, varying from 30 nM to 1.2 μΜ, were used, and subsequently global fitting was used to generate the ka (association rate constant), kd (dissociation rate constant) and KD (equilibrium dissociation constant) values.
[0039] Size-exclusion Chromatography - Superdex 75 10/300 GL and 200 10/300 GL (GE Healthcare) columns were used for size exclusion chromatography of recombinant BAX and Fab-BAX complex. Proteins were injected in columns equilibrated with a buffer containing 20 mM HEPES pH 7.2, and 150 mM KC1.
[0040] Liposome Permeabilization Assay - Liposomes were composed of the following molar percentages of lipids (Avanti Polar Lipids): phosphatidylcholine, 48%; phosphatidylinositol, 10%; phosphatidylethanolamine, 28%; dioleoyl phosphatidylserine, 10%; and tetraoleoyl cardiolipin, 4% and were loaded with ANTS/DPX (Molecular Probe) upon extrusion. Fabs at the indicated concentrations in 96-well format (Corning), with and without BAX (400 nM) or BAX (400nM) and tBID (30 nM) and then liposomes were added (10 \L from 1 mL lipid stock) in assay buffer (10 mM HEPES, pH 7, 200 mM KC1, and 1 mM MgC^) to a final volume of 100 μΐ. ANTS/DPX release was quantified based on the increase in fluorescence intensity that occurs when the ANTS fluorophore is separated from the DPX quencher upon release from the liposomes into solution. Fluorescence (λβχ = 355 nm and em = 520 nM) was measured over time at 30°C using a Tecan Infinite M1000 plate reader. The percentage release of ANTS/DPX at 90 min was calculated as percentage release = ((F - F0)/(F100 - F0)) χ 100, where F0 and F100 are baseline and maximal fluorescence, respectively. 1% Triton treatment is used to determine the maximum amount of liposomal release per assay, and this value sets the 100% value for the kinetic curve figures whereas the calculated percent release value for the bar graphs was calculated by using the percent release value of tBid-induced BAX mediated ANT/DPX release as 100%.
[0041] BAX translocation assay - Mitochondria from liver of Bak'1' mice (0.75mg/ml) were resuspended in experimental buffer (125 mM KC1, 10 mM Tris-MOPS [pH 7.4], 5 mM glutamate, 2.5 mM malate, 1 mM KP04, O. lmM EGTA-Tris [pH 7.4]) and treated with the indicated concentrations of 3G11 recombinant BAX (200 nM) and tBid (lOOnM), singly and in combination, and incubated at room temperature for 20 min. The supernatant fractions were isolated by centrifugation at 5500xg for 10 min and the mitochondrial pellets resuspended and washed with 0.1M sodium carbonate (pH 11.5) for 20 min, centrifuged at 13,000xg for 10 min at 4°C, and then solubilized in 1% Triton X-100/PBS for 1 h at 4°C. Mitochondrial supernatant and pellet fractions were separated by 4-12% NuPage (Invitrogen) gels and analyzed by immunoblotting with anti-BAX antibody (Cell Signaling Cat. 2772). [0042] Mitochondrial release assay - Mitochondria from liver of Bak~ ' mice (1.5mg/ml) were resuspended in experimental buffer (125 mM KC1, 10 mM Tris-MOPS [pH 7.4], 5 mM glutamate, 2.5 mM malate, 1 mM KP04, O. lmM EGTA-Tris [pH 7.4]) and treated with the indicated concentrations of 3G11 recombinant BAX (400 nM) and tBid (30nM), singly and in combination, and incubated at room temperature for 60 min. The supernatants were isolated by centrifugation at 5500xg for 10 min and the mitochondrial pellets solubilized in 1% Triton X-100/PBS. Mitochondrial supernatant and pellet fractions were separated by 4-12% NuPage (Invitrogen) gels and analyzed by immunoblotting with anti-cytochrome c antibody (BD Biosciences Cat. 556433).
[0043] Western Blotting - Samples from the mitochondria and translocation assay were electrophoretically separated on 4-12% NuPage (Invitrogen) gels, transferred to mobilon-FL PVDF membranes (Millipore) and subjected to immunoblotting. For visualization of proteins with Odyssey Infrared Imaging System (LI-COR Biosciences) membranes were blocked in PBS containing 3% milk powder. Primary BAX antibody (Cell Signaling 2772S) was incubated overnight at 4°C in a 1 : 1,000 dilution. After washing, membranes were incubated with an IRdye800-conjugated goat anti-rabbit IgG secondary antibody (LI-COR Biosciences) in a 1 : 10,000 dilution. Proteins were detected with Odyssey Infrared Imaging System.
[0044] NMR samples and spectroscopy - Uniformly 15N-labeled full-length human BAX was generated as previously described . Protein samples of BAX and BAX-3G11 mixtures at indicated concentrations were prepared in 25 mM sodium phosphate, 50 mM NaCl solution at pH 6.0 in 5% D20. Correlation 1H-15N HSQC and 1H-15N TROSY spectra were acquired at 25°C on a Bruker 600 MHz NMR spectrometer equipped with a cryogenic probe, processed using Topsin, and analyzed with CCPNMR. BAX wild type cross-peak assignments were applied as previously reported (9).
[0045] Hydrogen/Deuterium exchange mass spectrometry - Prior to hydrogen-deuterium exchange experiments, the quench condition for best sequence coverage of BAX was optimized as previously described (28). Briefly, 3 μΐ of stock solution of BAX at 1.0 mg/ml was mixed with 9 μΐ of H20 buffer (8.3 mM Tris, 150 mM NaCl, in H20, pH7.2) at 0 °C and then quenched with 18 μΐ of ice cold quench solutions of 0.8% formic acid, 16% Glycerol, and GdnHCl at final concentrations of 0.05 M, 0.5 M, 1.0 M and 2.0 M. The quenched samples were frozen on dry ice and then subjected to an immobilized pepsin column (1x20mm, 30 mg/ ml porcine pepsin (Sigma)) for online digestion for 40 sec. The resulting peptides were collected on a CI 8 trap (Michrom MAGIC C18AQ 0.2x2) and separated using a reversed phase C18 column (Michrom MAGIC C18AQ 0.2x50 3um 20θΑ) with a 30 min linear gradient of 0.046% (v/v) trifluoroacetic acid, 6.4% (v/v) acetonitrile to 0.03% (v/v) trifiuoroacetic acid, 38.4% (v/v) acetonitrile. The effluent was directed into an OrbiTtrap Elite mass spectrometer (Thermo-Fisher Sci. Inc) for MS analysis. The instrument was operated in positive ESI mode and the resolution of the instrument was set at 60,000. Proteome Discoverer software (Thermo Fisher Sci. Inc.) was used to identify the sequence of the resulting peptides. The optimal quench condition with the best coverage map of BAX (0.08M GuHCl in 0.8% formic acid) was used for subsequent functionally deuterated studies. Hydrogen-deuterium exchange reactions were initiated by diluting 3 μΐ of pre-chilled protein stock solution (free BAX, 1 mg/ml, or antibody-bound BAX, 2mg/ml) into 9 μΐ D20 buffer (8.3 mM Tris, 150 mM NaCl, in D20, pDREAD 7.2). The samples were incubated at 0 °C for 10 sec, 100 sec and 1000 sec. The exchange reaction was terminated by the addition of 18 μΐ of optimized quench solution at 0 °C and samples were immediately frozen on dry ice and stored at -80°C. In addition, un-deuterated samples and equilibrium-deuterated control samples were also prepared as previously described (29). The deuterated samples were then loaded onto above instrument for DXMS analysis. The centroids of the isotopic envelopes of un-deuterated, functionally deuterated, and equilibrium deuterated peptides were measured using HDExaminer, and then converted to corresponding deuteration levels with corrections for back-exchange (30).
[0046] Structure calculations - Structure calculations were performed with Crystallography and NMR system solve (CNS) within the HADDOCK web server using the prediction interface (31). HADDOCK calculations generated models of the complex that are in agreement with experimental distance restraints and have optimal electrostatic and van der Waals interactions based on a combination of molecular dynamics and energy minimization. HADDOCK docking was performed using the BAX NMR structural ensemble imported directly from the PDB (PDB ID: 1F16). The 3G11 structural model was generated using PIGS software based on structural homology modeling of known Fab structures of the same family that have different amino acid composition of CDR regions (32). Calculations were performed with ambiguous interaction restraints (AIR) derived from the hydrogen deuterium exchange mass spectrometry data and residues of the CDR regions of 3G11. For BAX AIR calculations, only residues that exhibited significant protection of hydrogen deuterium exchange upon titration and solvent accessibility over 50% as determined by the program NACCESS (Hubbard and Thornton, 1993) were defined as active residues; passive residues were automatically assigned by the HADDOCK web interface as those residues surrounding the active residues. For 3G11, AIR restraints were assigned based on residues involved in the CDRH1, CDRH2, CDRH3, and CDRL3. Specifically, active residues for BAX included residues 19-25 and 123-142; active residues for 3G11 were defined as Heavy Chain: 26-32 (Loop 1), 52-54 (Loop 2), 96-101 (loop 3) and Light Chain; 141-148, 165-168, and 206-211. In each HADDOCK structure calculation, 1000 orientations/structures of the complex were generated by rigid-body docking energy minimization of the individual structures. The 188 lowest energy structures were semi-flexibly refined in torsion angle space and then refined in explicit solvent. 132 structures formed the most populous cluster (HADDOCK score = -140.5 ± 12.1 and Z-score = -1.7) with RMSD from the overall lowest energy structure (1.9 ± 1.1 A) calculated on the backbone (CA, C, N, O, P) atoms of all residues involved in intermolecular contact using a 10 A cut-off. In all cases 3G11 was localized to N-terminal trigger site. Ribbon diagrams and molecular models were depicted using PYMOL (Schrodinger).
Results
[0047] Discovery of 14 Novel Synthetic Antibodies Targeting Monomeric BAX - A restricted diversity phage antigen-binding fragment (Fab) library ("Library F") was used to select a panel of Fabs that bind to monomeric BAX (9). Library F was designed to contain mostly binomial Tyr/Ser diversity in CDR-H1 and H2, and expanded diversity, encoding the nine amino acids Tyr/Ser/Gly/Ala/Phe/Trp/His/Pro/Val in a 5/4/4/2/1/1/1/1/1 ratio, at CDR- L3 and H3 (33). In addition, the CDR-L3 and H3 loops vary in size. The expanded diversity in CDR-L3 and H3 in Library F was designed to mimic the distribution of amino acids in functional CDR-H3 segments of natural antibodies. Library F was screened against the monomeric BAX, which that was purified after utilizing chitin-column affinity purification and size exclusion chromatography (10). After 2-3 rounds of stringent selection, a panel of 14 BAX-specific Fabs with diverse CDR sequences was obtained (Fig. 1A). These clones were isolated from two distinct panning regimes, one in which biotinylated BAX was immobilized onto streptavidin-coated wells, and another in which BAX was coated directly on the wells. The properties of the selected clones were similar from either screening regime and thus further analyzed as a single conglomerated panel. Sequence comparison between the 14 Fabs revealed high diversity of residues and loop sizes in many positions with no apparent sequence homology in CDR segments from any two clones, demonstrating the diverse modes of interaction with BAX.
[0048] Fabs were expressed and purified and the half-maximal binding titers (EC50) for BAX using ELISA were determined. The EC50 values ranged from high affinity 2.3 nM (2B1) to moderate affinity 250 nM (2A5) with most Fabs having single or double digit nM nanomolar EC50 (Fig. 1A). Select Fabs 3G11, 3E8, 2A5 and 2B1 were evaluated for binding kinetics to monomeric BAX using Biolayer Interferometry (Fig. IB). The binding affinities (KD values) and ranking of the Fab proteins based on binding correlate with the EC50 from ELISA. In both assays, Fabs 3G11, 3E8 and 2B1 were the highest-affinity binders to BAX, while Fab 2A5 was the lowest-affinity binder (Fig. 1A, IB). Hence, an array of 14 high- affinity antibodies against monomeric BAX was identified.
[0049] To explore if the Fabs engaged overlapping or distinct epitopes on BAX, competitive ELISA was performed using six of the clones (3H1, 3G11, 3E8, 2A5, 2D9 and 2B1) whose EC50 values cover the entire affinity range. A competitive ELISA was performed in which Fab 3G11 was first biotinylated (b3Gl l) and binding of b3Gl l to BAX in the presence of other non-biotinylated Fab proteins was analyzed. All Fabs except Fab 2A5 demonstrated competitive inhibition of b3Gl l binding with IC50S ranging from nM to μΜ (Fig. 1C). Fab 2A5 does not compete b3Gl l binding likely because it is a much weaker binder than 3G11. Furthermore, a study was also conducted of how binding of phage- expressed Fabs (Φ) can be competitively inhibited by free Fab proteins. The data showed that phage-expressed Fab binding was inhibited to varying degrees in the presence of 100 nM Fab protein for many of the clones and that, in each case, the phage-expressed Fab for a particular clone could be inhibited by its own Fab protein (Fig. ID). Again, Fab 2A5, the lowest affinity clone (EC50 = 250 nM) had little effect on Fab phage binding for all the other clones, but all the other Fabs proteins could significantly inhibit Fab 2A5 phage binding. On the contrary, Fabs 3E8 and 2B1, the highest affinity clones (EC50S = 2.6 nM and 2.3 nM, respectively) showed the strongest inhibition on all Fab phage binding. Therefore, the competitive ELISA data matches predictions based on ELISA half-maximal binding titers and KD values. These results indicate that, to a large extent, these Fabs have overlapping epitopes on the BAX surface with a range of affinities, but many in the low nanomolar range.
[0050] Synthetic Antibodies Inhibit BH3-triggered BAX activation and MOMP - To examine how binding to BAX by Fabs proteins modulates BAX function, liposomal assays were performed that explicitly evaluate how BH3 -triggered BAX forms a pore in a membrane environment made from similar lipid composition of mitochondria without the contribution of other mitochondrial factors (34). Selected Fabs have the potential to activate BAX by engaging one of the activation sites of BAX either at its N-terminal or C-terminal surface (10,15,35,36) or inhibit BAX activation by inhibiting the BAX binding surface of the activator protein tBID or conformational changes associated with BAX activation (12,15,16,20,37). Therefore, the capacity of the Fabs to either activate BAX or inhibit BAX activation induced by tBID was examined. None of the 14 Fabs had an effect on the liposomal integrity alone; neither does an unrelated vascular-endothelial growth factor (VEGF)-specific Fab (YADS 1, negative control). Furthermore, none of the Fab proteins activated BAX and induced liposomal release (Fig. 2A). However, when tBID and BAX are combined with liposomes, liposomal release is robust as expected (Fig. 2A, 2B). In contrast, high affinity Fabs when combined with tBID and BAX inhibited tBID-triggered BAX activation significantly, or completely, at 2μΜ, in all cases, except with the exception of the lower affinity clone Fab 2A5 and the negative control YADS1 (Fig. 2B). Three of the highest binding Fabs 3G11, 3E8 and 2B1 yielded dose-responsive and time-dependent inhibition of liposomal release whereas the weaker binder 2A5 had no effect even at 2μΜ (Fig. 2C-2F).
[0051] To examine whether Fabs can inhibit BAX activation in the presence of mitochondrial membranes loaded with anti-apoptotic BCl-2 or other mitochondrial proteins, mouse liver mitochondria were isolated from Bak'1' mice to perform a mitochondrial release assay. Combination of tBID and BAX was exposed to several doses of Fab 3G11, which demonstrated dose-responsive inhibition of mitochondrial cytochrome c release induced by activated BAX, as assessed by separation of the supernatant and mitochondrial fractions and western analysis (Fig. 3A). Moreover, using the mitochondria assay, BAX localization was determined to examine whether inhibition by Fab 3G11 was due to prevention of BAX translocation to the membrane or blocking of the membrane integration and oligomerization on the outer mitochondrial membrane. Fab 3G11 dose-responsively inhibited the capacity of BAX for mitochondrial translocation suggesting that 3Gl l 's high affinity binding to the monomeric BAX either competes binding of tBID or prevents conformational changes of BAX required for its mitochondrial translocation (Fig. 3B). Taken together, these data indicate that these Fab proteins inhibit BH3 -triggered BAX activation and MOMP by restraining mitochondrial membrane translocation of BAX.
[0052] Fab 3G11 Protein Forms a Stable and Stoichiometric Complex with BAX - To investigate the effect of synthetic Fab proteins on the structure of BAX, the stability and stoichiometry of several Fab-BAX complexes were studied upon mixing the protein at various concentrations and analyzing by size-exclusion chromatography (SEC) (data not shown). Based on gel SEC and SDS-PAGE analysis, binding of the Fab 3G11 to BAX results in a stable 1 : 1 stoichiometric complex. 3G11 was selected for further structural analysis because of its high affinity and low dissociation constant (Fig. IB). Next, structural effects of the 3G111 were analyzed based on 1H-15N HSQC spectra of full length BAX monomer at several doses of 3G11. The HSQC spectra are in agreement with the 3G11 and BAX forming a stable complex, with a 1 : 1 stoichiometry and in slow exchange on the NMR time scale as evidenced by the dose-dependent loss of intensity of the cross peaks of the monomeric BAX and lack of new chemical shifts upon 3G11 titration. Despite the 3G11-BAX complex formation evidenced by the NMR titration, it is not possible to observe the XH-15N cross peaks of the complex in the XH-15N HSQC spectra due to the size of the complex (70 KDa).
[0053] Fab 3G11 Protein Binds the N-terminal Surface of BAX to Prevent BAX Activation - To further analyze the Fab-BAX interaction, the changes on the BAX structure were analyzed by measuring the solvent accessibility and hydrogen-deuterium exchange of the backbone amide hydrogens using hydrogen-deuterium exchange mass spectrometry (HXMS). First, the deuterium exchange of unbound BAX was analyzed in solution, which underlined the different deuterium exchange rates for exposed or unfolded regions (N- terminus, al-a2 loop) and more solvent-protected or structured regions including a2, a3-a4, a5, a6-a8. Upon 3G11-BAX complex formation at stoichiometric levels, deuterium exchange, sample digestion, preparation and analysis was performed in the same conditions as with free BAX. Interestingly, HXMS analysis of the Fab-bound BAX in solution highlighted significant solvent protection in helix al and a6 and the al-a2 loop while other regions of the BAX structure had little to no change in the deuterium incorporation upon interaction with the 3G11. Furthermore, HXMS showed a modest increase in solvent accessibility for residues in helices a7, a8 and partially a9 and a2 that are found at the C- terminal surface of BAX. Binding of the 3G11 Fab to full-length BAX (BAX WT) and to the C-terminal helix a9-truncated BAX (BAX AC) was determined with similar dissociation constant KD (Table 1), suggesting that major contacts of 3 Gi l occur elsewhere from the a9 or the canonical hydrophobic groove of BAX.
[0054] The HXMS analysis suggests that the binding region of the 3G11 is localized on the N-terminal surface of the BAX structure and overlaps with the 1) N-terminal trigger site of BAX (al/a6) that controls a series of conformational changes upon BH3 domain activation (11-12) and 2) the binding epitope (residues 12-24) that is recognized by the 6A7 antibody only on the conformational active BAX (Fig. 4). Interestingly, the al-a2 loop, whose displacement was determined to be essential for the initiation of conformational changes upon BH3-triggered BAX activation (12), is protected by the Fab binding interaction. Thus, the binding interaction of 3G11 to BAX is localized to the N-terminal surface of BAX, overlapping with the N-terminal trigger site and preventing conformational changes that lead to activation of the monomeric BAX. [0055] Although recent structural studies based on peptides from the cytomegalovirus protein vMIA (38) and BCL-2 (20) proteins suggested potential sites that intervene with BAX activation, interestingly, none of these peptides directly block the N-terminal activation site of the soluble BAX or the C-terminal activation site of the mitochondrial associated BAX. A protein-protein structure calculation approach (39) was used to further confirm this novel interaction of 3G11 bound to the N-terminal surface of BAX. HADDOCK structure calculations were performed using ambiguous interaction restraints between BAX residues determined by HXMS to be most protected from solvent upon 3G11 binding (residues of the al, a6 and the al-a2 loop) and residues of the CDR regions present in the 3G11 protein sequence. Furthermore, calculations included an NMR structural ensemble of BAX with different loop conformations. Based on these calculations, the 3G11 binds more favorably in a direct interaction with N-terminal trigger site of BAX and the closed conformation of al-a2 loop (10,12). 3G11 protein makes interactions of hydrophobic and hydrophilic nature with the solvent-exposed hydrophobic residues and polar/charged residues of the BAX trigger site covering a large interface surface of (1640 A).
[0056] To validate the 3G11 direct interaction with the N-terminal trigger site, it was tested whether mutations on BAX can disrupt binding to 3G11 and affect its inhibitory activity of 3G11 in liposomal ANTS/DPX release assays. The 3G11-BAX structural model was used. Residues on BAX were selected that form contacts with residues of 3G11 using a 3A cutoff. Residues K21 in helix al and R134 in helix a6 have previously been shown to interact with the stapled BIM BH3 peptide that activates BAX through the N-terminal trigger site (10). Further analysis of the structural model showed that R134 residue forms hydrogen bonds with four residues (S30, Y31, Y32, S33) in 3G11 CDR-H1 loop while the K21 residue is predicted to form one hydrogen bond interaction with residue S143 in 3G11. Consistently with the predicted contributions of each residue to the interaction with 3G11 Fab, liposomal ANTS/DPX release experiments showed that the inhibition effect of 3G11 on BAX WT activation by tBID is weakened with the presence of the K21E mutation, but it is was completely abolished with the R134E mutation (Fig. 5A-5E). Likewise, the double mutation R134E/K21E also abolished the capacity of 3G11 to inhibit BAX activation (Fig. 5D, 5E). The inability of 3G11 to inhibit activation of these BAX mutants is consistent with the decreased affinity of 3G11 to these BAX mutants as determined by ELISA binding experiments (Fig. 5F). Thus, the data suggest that 3G11 binds and blocks access to the N- terminal trigger site of BAX and therefore directly prevents BAX activation and its associated conformational changes. In accordance, mapping the predicted BAX interacting residues based on the 3G11-BAX structural model and residues of the trigger site that interact with the stapled BIM BH3 peptide as determined by NMR studies demonstrates an extensive overlap (10). Taken together, these results suggest a novel mechanism of BAX inhibition and demonstrate the capacity of the reported Fabs as structural and functional probes of BAX.
Discussion
[0057] Decision of cellular life or death through the mitochondrial apoptotic pathway, in physiological or disease conditions, is mainly controlled by the interactions among the BCL1- 2 family proteins. Activation of pro-apoptotic BAX is essential for apoptosis to proceed through mitochondrial dysfunction and caspases activation. Here, synthetic antibody technology was harnessed to generate high affinity BAX binding antibody fragments (Fabs). The screen identified at least 14 different Fabs with sequence diversity in CDR regions that bind with nM affinity to BAX. Interestingly, the competitive ELISAs confirmed that the identified Fab proteins bind to overlapping regions of the BAX surface. Selected Fabs bind full length BAX, which represents cytosolic BAX (9). It was demonstrated that 3G11 binds C-terminal truncated BAX, which mimics the mitochondrial-associated BAX (15). Mitochondrial inserted BAX oligomerizes and undergoes dramatic conformational changes of the monomeric BAX to such extent that the N-terminal surface of BAX is not available for binding to Fabs (13,15,16,40). Therefore, selected Fabs are expected to be conformational specific for cytosolic and mitochondrial-associated BAX and inhibit both conformations from proceeding along the BAX activation process.
[0058] All of the identified BAX-binding Fabs inhibit BAX activation triggered by pro- apoptotic tBID in liposomal and mitochondrial assays. Further investigation of the mechanism, using Fab 3Gl lprotein, indicated that the Fabs bind to the N-terminal surface of BAX without causing significant conformational changes on BAX. HADDOCK calculations and mutagenesis show that 3 Gi l binds to an extended surface on BAX that includes the N- terminal trigger site (helices al/a6), which BIM, BID, and PUMA pro-apoptotic BH3 helices bind to trigger BAX activation (10,11,36,38,41). The data indicate that 3G11 competitively inhibits tBID-mediated BAX activation by blocking access to the N-terminal trigger site and preventing N-terminal conformational changes associated with BAX activation (11,36). Indeed, 3G11 -binding prevents mitochondrial translocation of BAX, which requires significant conformational changes and integration into the membrane (13,15,16,40).
[0059] BAX is shown to have two different activation sites depending on its cytosolic or mitochondrial associated conformations; the N-terminal BH3 pocket (trigger site) and the C- terminal BH3 pocket. Although several proteins have been reported to directly bind BAX and inhibit its activation, only two other studies reported structural evidence of the binding interaction on the surface of BAX. A stapled helical peptide of the BH4 domain of BCL-2 protein binds to a cleft formed by select residues of the al-a2 loop, a2, a3, a5 and a6 (20). A helical peptide of the cytomegalovirus protein vMIA binds to a distinct site at the same side of the BAX structure that includes the loops of α3-α4 and α5-α6 (38). In both cases, the peptides bind to a geographically distinct site that have no overlap with either of the N- terminal or C-terminal activation site. Therefore, these mechanisms of BAX inhibition reflect allosteric mechanisms that suppress conformational changes upon BAX activation. The present data indicate that the direct inhibition mechanism of BAX by 3G11 Fab through interaction with the N-terminal activation site is a feasible and effective mechanism of BAX inhibition.
[0060] Pharmacological targeting of BAX whether to either promote or inhibit its activation has been proposed to be a promising therapeutic strategy. However, discovery of pharmacological modulators of BAX has been challenging due to limited insights or lack of appropriate probes to use for small molecule discovery. Recently, small molecule BAX activators that bind to the BAX trigger site have been identified using a competitive binding assay of the stapled BIM BH3 peptide activator that binds to the same site (42). Likewise, the application of synthetic antibodies to BAX provides a novel opportunity to use Fabs as probes for screening small molecule libraries using a competitive binding assay between the identified inhibitory Fabs and BAX. Such small molecule inhibitors that bind directly to the BAX trigger site will be effective for development of therapeutics.
Table 1. Binding kinetics and thermodynamics of Fab 3G1 1 with BAX WT and BAX A C.
Figure imgf000028_0001
REFERENCES
1. Fuchs, Y., and Steller, H. (2011) Programmed cell death in animal development and disease. Cell 147, 742-758
2. Danial, N. N., and Korsmeyer, S. J. (2004) Cell death: critical control points. Cell 116, 205-219 3. Youle, R. J., and Strasser, A. (2008) The BCL-2 protein family: opposing activities that mediate cell death. Nat. Rev. Mol. Cell Biol. 9, 47-59
4. Chipuk, J. E., Moldoveanu, T., Llambi, F., Parsons, M. J., and Green, D. R. (2010) The BCL-2 family reunion. Mol. Cell 37, 299-310
5. Hsu, Y. T., Wolter, K. G., and Youle, R. J. (1997) Cytosol-to-membrane redistribution of Bax and Bcl-X(L) during apoptosis. Proc. Nat. Acad. Sci. USA 94, 3668- 3672
6. Wolter, K. G, Hsu, Y. T., Smith, C. L., Nechushtan, A., Xi, X. G, and Youle, R. J. (1997) Movement of Bax from the cytosol to mitochondria during apoptosis. J. Cell Biol. 139, 1281-1292
7. Walensky, L. D., and Gavathiotis, E. (2011) BAX unleashed: the biochemical transformation of an inactive cytosolic monomer into a toxic mitochondrial pore. Trends Bioch. Sci. 36, 642-652
8. Westphal, D., Kluck, R. M., and Dewson, G. (2014) Building blocks of the apoptotic pore: how Bax and Bak are activated and oligomerize during apoptosis. Cell Death Diff. 21, 196-205
9. Suzuki, M., Youle, R. I, and Tjandra, N. (2000) Structure of Bax: coregulation of dimer formation and intracellular localization. Cell 103, 645-654
10. Gavathiotis, E., Suzuki, M., Davis, M. L., Pitter, K., Bird, G. H., Katz, S. G, Tu, H. C, Kim, H., Cheng, E. H., Tjandra, N., and Walensky, L. D. (2008) BAX activation is initiated at a novel interaction site. Nature 455, 1076-1081
11. Kim, H., Tu, H. C, Ren, D., Takeuchi, O., Jeffers, J. R, Zambetti, G. P., Hsieh, J. J., and Cheng, E. H. (2009) Stepwise activation of BAX and BAK by tBID, BIM, and PUMA initiates mitochondrial apoptosis. Mol. Cell 36, 487-499
12. Gavathiotis, E., Reyna, D. E., Davis, M. L., Bird, G. H., and Walensky, L. D. (2010) BH3 -triggered structural reorganization drives the activation of proapoptotic BAX. Mol. Cell 40, 481-492
13. Gahl, R. F., He, Y., Yu, S., and Tjandra, N. (2014) Conformational rearrangements in the pro-apoptotic protein, Bax, as it inserts into mitochondria: a cellular death switch. J. Biol. Chem. 289, 32871-32882 14. Lovell, J. F., Billen, L. P., Bindner, S., Shamas-Din, A., Fradin, C, Leber, B., and Andrews, D. W. (2008) Membrane binding by tBid initiates an ordered series of events culminating in membrane permeabilization by Bax. Cell 135, 1074-1084
15. Czabotar, P. E., Westphal, D., Dewson, G., Ma, S., Hockings, C, Fairlie, W. D., Lee, E. F., Yao, S., Robin, A. Y., Smith, B. J., Huang, D. C, Kluck, R. M., Adams, J. M., and Colman, P. M. (2013) Bax crystal structures reveal how BH3 domains activate Bax and nucleate its oligomerization to induce apoptosis. Cell 152, 519-531
16. Bleicken, S., Jeschke, G., Stegmueller, C, Salvador-Gallego, R., Garcia-Saez, A. J., and Bordignon, E. (2014) Structural model of active Bax at the membrane. Mol. Cell 56, 496-505
17. Sattler, M., Liang, H., Nettesheim, D., Meadows, R. P., Harlan, J. E., Eberstadt, M., Yoon, H. S., Shuker, S. B., Chang, B. S., Minn, A. J., Thompson, C. B., and Fesik, S. W. (1997) Structure of Bcl-xL-Bak peptide complex: recognition between regulators of apoptosis. Science 275, 983-986
18. Ding, J., Zhang, Z., Roberts, G. J., Falcone, M., Miao, Y., Shao, Y., Zhang, X.
C, Andrews, D. W., and Lin, J. (2010) Bcl-2 and Bax interact via the BH1-3 groove-BH3 motif interface and a novel interface involving the BH4 motif. J. Biol. Chem. 285, 28749- 28763
19. Ding, K., Wang, H., Wu, Y., Zhang, L., Xu, J., Li, T., Ding, Y., Zhu, L., and He, J. (2015) Rapamycin protects against apoptotic neuronal death and improves neurologic function after traumatic brain injury in mice via modulation of the mTOR-p53-Bax axis. J. Surg. Res. 194, 239-247
20. Barclay, L. A., Wales, T. E., Garner, T. P., Wachter, F., Lee, S., Guerra, R. M., Stewart, M. L., Braun, C. R, Bird, G. H., Gavathiotis, E., Engen, J. R, and Walensky, L.
D. (2015) Inhibition of Pro-apoptotic BAX by a noncanonical interaction mechanism. Mol. Cell 57, 873-886
21. Czabotar, P. E., Lessene, G, Strasser, A., and Adams, J. M. (2014) Control of apoptosis by the BCL-2 protein family: implications for physiology and therapy. Nat. Rev.. Mol. Cell Biol. 15, 49-63
22. Sidhu, S. S., and Fellouse, F. A. (2006) Synthetic therapeutic antibodies. Nat. Chem. Biol. 2, 682-688 23. Paduch, M., Koide, A., Uysal, S., Rizk, S. S., Koide, S., and Kossiakoff, A. A. (2013) Generating conformation-specific synthetic antibodies to trap proteins in selected functional states. Methods 60, 3-14
24. Fellouse, F. A., Esaki, K, Birtalan, S., Raptis, D., Cancasci, V. J., Koide, A., Jhurani, P., Vasser, M., Wiesmann, C, Kossiakoff, A. A., Koide, S., and Sidhu, S. S. (2007) High-throughput generation of synthetic antibodies from highly functional minimalist phage- displayed libraries. J. Mol. Biol. 373, 924-940
25. Koellhoffer, J. F., Chen, G., Sandesara, R. G, Bale, S., Saphire, E. O., Chandran, K, Sidhu, S. S., and Lai, J. R. (2012) Two synthetic antibodies that recognize and neutralize distinct proteolytic forms of the ebola virus envelope glycoprotein. Chembiochem 13, 2549-2557
26. Koerber, J. T., Thomsen, N. D., Hannigan, B. T., Degrado, W. F., and Wells, J. A. (2013) Nature-inspired design of motif-specific antibody scaffolds. Nat. Biotech. 31, 916-921
27. Gao, J., Sidhu, S. S., and Wells, J. A. (2009) Two-state selection of conformation-specific antibodies. Proc. Nat. Acad. Sci. USA 106, 3071-3076
28. Marsh, J. J., Guan, H. S., Li, S., Chiles, P. G., Tran, D., and Morris, T. A. (2013) Structural insights into fibrinogen dynamics using amide hydrogen/deuterium exchange mass spectrometry. Biochem. 52, 5491-5502
29. Li, S., Tsalkova, T., White, M. A., Mei, F. C, Liu, T., Wang, D., Woods, V. L., Jr., and Cheng, X. (2011) Mechanism of intracellular cAMP sensor Epac2 activation: cAMP-induced conformational changes identified by amide hydrogen/deuterium exchange mass spectrometry (DXMS). J. Biol. Chem. 286, 17889-17897
30. Zhang, Z., and Smith, D. L. (1993) Determination of amide hydrogen exchange by mass spectrometry: a new tool for protein structure elucidation. Prot. Science 2, 522-531
31. de Vries, S. J., van Dijk, M., and Bonvin, A. M. (2010) The HADDOCK web server for data-driven biomolecular docking. Nat. Prot. 5, 883-897
32. Marcatili, P., Olimpieri, P. P., Chailyan, A., and Tramontano, A. (2014) Antibody structural modeling with prediction of immunoglobulin structure (PIGS). Nat. Prot. 9, 2771-2783 33. Persson, H., Ye, W., Wernimont, A., Adams, J. J., Koide, A., Koide, S., Lam, R., and Sidhu, S. S. (2013) CDR-H3 diversity is not required for antigen recognition by synthetic antibodies. J. Mol. Biol. 425, 803-811
34. Yethon, J. A., Epand, R. F., Leber, B., Epand, R. M., and Andrews, D. W. (2003) Interaction with a membrane surface triggers a reversible conformational change in Bax normally associated with induction of apoptosis. J. Biol. Chem. 278, 48935-48941
35. Edwards, A. L., Gavathiotis, E., LaBelle, J. L., Braun, C. R., Opoku-Nsiah, K.
A. , Bird, G. H., and Walensky, L. D. (2013) Multimodal interaction with BCL-2 family proteins underlies the proapoptotic activity of PUMA BH3. Chem. & Biol.20. 888-902
36. Leshchiner, E. S., Braun, C. R, Bird, G. H., and Walensky, L. D. (2013) Direct activation of full-length proapoptotic BAK. Proc. Nat. Acad. Sci. USA 110, E986-995
37. Ding, J., Mooers, B. H., Zhang, Z., Kale, J., Falcone, D., McNichol, J., Huang,
B. , Zhang, X. C, Xing, C, Andrews, D. W., and Lin, J. (2014) After embedding in membranes antiapoptotic Bcl-XL protein binds both Bcl-2 homology region 3 and helix 1 of proapoptotic Bax protein to inhibit apoptotic mitochondrial permeabilization. J. Biol. Chem. 289, 11873-11896
38. Ma, J., Edlich, F., Bermejo, G. A., Norris, K. L., Youle, R. J., and Tjandra, N. (2012) Structural mechanism of Bax inhibition by cytomegalovirus protein vMIA. Proc. Nat. Acad. Sci. USA 109, 20901-20906
39. Dominguez, C, Boelens, R, and Bonvin, A. M. (2003) HADDOCK: a protein-protein docking approach based on biochemical or biophysical information. J. Amer. Chem. Soc. 125, 1731-1737
40. Annis, M. G, Soucie, E. L., Dlugosz, P. J., Cruz-Aguado, J. A., Penn, L. Z., Leber, B., and Andrews, D. W. (2005) Bax forms multispanning monomers that oligomerize to permeabilize membranes during apoptosis. EMBO J. 24, 2096-2103
41. Tsai, C. J., Liu, S., Hung, C. L., Jhong, S. R., Sung, T. C, and Chiang, Y. W. (2015) BAX-induced apoptosis can be initiated through a conformational selection mechanism. Structure 23, 139-148
42. Gavathiotis, E., Reyna, D. E., Bellairs, J. A., Leshchiner, E. S., and Walensky, L. D. (2012) Direct and selective small-molecule activation of proapoptotic BAX. Nat. Chem. Biol. 8, 639-645 43. Billard, C. (2012) Development of Noxa-like BH3 mimetics for apoptosis- based therapeutic strategy in chronic lymphocytic leukemia. Mol. Cancer Res. 10, 673-676

Claims

What is claimed is:
1. A synthetic fragment antigen-binding (Fab) antibody that binds to an N-terminal activation site of BCL-2-associated X-protein (BAX) and inhibits BAX activation.
2. The synthetic Fab antibody of claim 1, wherein the antibody maintains BAX in its inactive, monomeric form.
3. The synthetic Fab antibody of claim 1 or 2, wherein the antibody binds to residues of helices al and a6, and to residues of al-a2 loop of BAX.
4. The synthetic Fab antibody of any of claims 1-3, wherein the antibody binds to BAX with a half-maximal binding (EC50) affinity of 2nM-70nM.
5. The synthetic Fab antibody of any of claims 1-4, wherein the antibody blocks the interaction of BAX with a BAX activating partner.
6. The synthetic Fab antibody of claim 5, wherein the BAX activating partner is selected from the group consisting of tBID, PUMA, BIM and NOXA.
7. The synthetic Fab antibody of any of claims 1-6. wherein the antibody is selected from the group consisting of
2B1 Fab, having a CDRL3 region comprising the amino acid sequence QYSGSGHYLI (SEQ ID NO: l), a CDRHl region comprising the amino sequence IYSSSM (SEQ ID NO:2), a CDRH2 region comprising the amino acid sequence SISSSSSYTS (SEQ ID NO:3) and a CDRH3 region comprising the amino acid sequence RGYWYYWAWWASAMD (SEQ ID NO:4);
3E8 Fab, having a CDRL3 region comprising the amino acid sequence QSSYSLI (SEQ ID NO:5), a CDRHl region comprising the amino sequence LSYYSM (SEQ ID NO: 6), a CDRH2 region comprising the amino acid sequence SISPYYGYTY (SEQ ID NO:7) and a CDRH3 region comprising the amino acid sequence RGGAYYFGYYGSGSYAMD (SEQ ID NO: 8);
3G11 Fab, having a CDRL3 region comprising the amino acid sequence QWSFGPI (SEQ ID NO:9), a CDRHl region comprising the amino sequence ISYYSM (SEQ ID NO: 10), a CDRH2 region comprising the amino acid sequence SIYPYSSSTY (SEQ ID NO: 11) and a CDRH3 region comprising the amino acid sequence RSSAMD (SEQ ID NO: 12);
2D9 Fab, having a CDRL3 region comprising the amino acid sequence QWSHYLI (SEQ ID NO: 13), a CDRH1 region comprising the amino sequence LYYYSM (SEQ ID NO: 14), a CDRH2 region comprising the amino acid sequence SISPSYGYTS (SEQ ID NO: 15) and a CDRH3 region comprising the amino acid sequence RSSFYYYALD (SEQ ID NO: 16);
3G9 Fab, having a CDRL3 region comprising the amino acid sequence QHYYYSPWPI (SEQ ID NO: 17), a CDRH1 region comprising the amino sequence LYSYYI (SEQ ID NO: 18), a CDRH2 region comprising the amino acid sequence SISPYYSSTY (SEQ ID NO: 19) and a CDRH3 region comprising the amino acid sequence RSSYSYAGMD (SEQ ID NO: 20);
2C11 Fab, having a CDRL3 region comprising the amino acid sequence QSYVSPI (SEQ ID NO:21), a CDRH1 region comprising the amino sequence ISSYYI (SEQ ID NO:22), a CDRH2 region comprising the amino acid sequence SISSYYSSTY (SEQ ID NO:23) and a CDRH3 region comprising the amino acid sequence RV S YGHAYVGYS SGMD (SEQ ID NO:24);
3H4 Fab, having a CDRL3 region comprising the amino acid sequence QSWYYSYPI (SEQ ID NO: 25), a CDRH1 region comprising the amino sequence LSYSSM (SEQ ID NO:26), a CDRH2 region comprising the amino acid sequence SISSYYSYTS (SEQ ID NO:27) and a CDRH3 region comprising the amino acid sequence RYYGYGGGID (SEQ ID NO:28);
2A6 Fab, having a CDRL3 region comprising the amino acid sequence QSAGGYPLI (SEQ ID NO:29), a CDRH1 region comprising the amino sequence IYYSSM (SEQ ID NO:30), a CDRH2 region comprising the amino acid sequence SISPYSSYTS (SEQ ID NO:31) and a CDRH3 region comprising the amino acid sequence RSFGYGWAFD (SEQ ID NO:32);
3H1 Fab, having a CDRL3 region comprising the amino acid sequence QHSYPI (SEQ ID NO:33), a CDRH1 region comprising the amino sequence ISYSSI (SEQ ID NO:34), a CDRH2 region comprising the amino acid sequence SIYSYSGSTY (SEQ ID NO: 35) and a CDRH3 region comprising the amino acid sequence RYGAMD (SEQ ID NO:36); 2A2 Fab, having a CDRL3 region comprising the amino acid sequence QYYYPI (SEQ ID NO:37), a CDRH1 region comprising the amino sequence ISSSSI (SEQ ID NO:38), a CDRH2 region comprising the amino acid sequence SIYSYYGYTY (SEQ ID NO:39) and a CDRH3 region comprising the amino acid sequence RYSAMD (SEQ ID NO: 40);
3G3 Fab, having a CDRL3 region comprising the amino acid sequence QGAWSGGHLI (SEQ ID NO:41), a CDRH1 region comprising the amino sequence LSYSSM (SEQ ID NO:42), a CDRH2 region comprising the amino acid sequence YISPYYGYTY (SEQ ID NO:43) and a CDRH3 region comprising the amino acid sequence RGWAYYYGYWGP S GLD (SEQ ID NO:44);
2D5 Fab, having a CDRL3 region comprising the amino acid sequence QWGYSHSHLI (SEQ ID NO:45), a CDRH1 region comprising the amino sequence ISYSS (SEQ ID NO:46), a CDRH2 region comprising the amino acid sequence SISPYYGSTY (SEQ ID NO:47) and a CDRH3 region comprising the amino acid sequence RSHFGALD (SEQ ID NO:48);
2D2 Fab, having a CDRL3 region comprising the amino acid sequence QSYYWVSPF (SEQ ID NO:49), a CDRH1 region comprising the amino sequence LYYSSI (SEQ ID NO:50), a CDRH2 region comprising the amino acid sequence SIYPYSGSTY (SEQ ID NO:51) and a CDRH3 region comprising the amino acid sequence RSYGYAMD (SEQ ID NO:52); and
2A5 Fab, having a CDRL3 region comprising the amino acid sequence QYHYWYYPI (SEQ ID NO:53), a CDRH1 region comprising the amino sequence ISYYSM (SEQ ID NO:54), a CDRH2 region comprising the amino acid sequence SISPYYGSTY (SEQ ID NO:55) and a CDRH3 region comprising the amino acid sequence RAGAMD (SEQ ID NO:56).
8. A method of inhibiting apoptotic cell death by contacting BCL-2-associated X-protein (BAX) with the synthetic Fab antibody of any of claims 1-7 in an amount effective to inhibit activation of BAX and apoptotic cell death.
9. The method of claim 8, wherein the synthetic Fab antibody is conjugated to a therapeutic agent.
10. The method of claim 8 or 9, wherein the synthetic Fab antibody is conjugated to an agent that facilitates transport across a cell membrane.
11. The method of any of claims 8-10, wherein the synthetic Fab antibody is administered to a subject using lentiviral or adenoviral expression, a plasmid, nanoparticles or liposomes.
12. The method of any of claims 8-10, wherein the synthetic Fab antibody is administered to a subject having a disease or disorder selected from the group consisting of a cardiovascular disease or disorder, a neurodegenerative or neurological disease or disorder, a liver disease or disorder, a kidney disease or disorder, a metabolic disease or disorder, an immunological disorder, ischemia, infertility, a blood disorder, renal hypoxia, diabetes, hepatitis, asthma and AIDS.
13. A method for measuring inactive monomeric BAX levels in a tissue sample from a subject comprising contacting the sample with the synthetic Fab antibody of any of claims 1- 7 and measuring the amount of antibody bound to the sample, wherein the amount of bound antibody is indicative of the level of inactive monomeric BAX in the tissue sample.
14. A method for screening for small molecules that bind to an N-terminal activation site of BAX comprising contacting BAX with the synthetic Fab antibody of any of claims 1-7 in the presence and in the absence of a small molecule and measuring the amount of antibody that binds to BAX, wherein a decrease in the amount of antibody binding to BAX in the presence of the small molecule indicates that the small molecule is a candidate for binding to an N-terminal activation site of BAX.
15. The method of claim 14, wherein the method is a competitive ELISA screening assay.
16. A method of predicting the ability of a cancer therapy to promote apoptotic cell death comprising contacting a cancerous tissue sample with the synthetic Fab antibody of any of claims 1-7, with and without the cancer therapy, and measuring the amount of antibody that binds to the tissue sample, wherein a decrease in the amount of bound antibody with the cancer therapy indicates that the cancer therapy promotes activation of BAX and apoptotic cell death, and the amount of bound antibody without the cancer therapy can predict the capacity of the cancer therapy to promote activation of BAX and apoptotic cell death in the cancerous tissue.
17. The method of any of claims 13-16, wherein the synthetic Fab antibody is labeled with a fluorescent label or a radioactive label.
PCT/US2016/048508 2015-09-10 2016-08-25 Synthetic antibodies to bax and uses thereof Ceased WO2017044308A1 (en)

Priority Applications (4)

Application Number Priority Date Filing Date Title
CA2998115A CA2998115C (en) 2015-09-10 2016-08-25 Synthetic antibodies to bax and uses thereof
US15/756,997 US10294294B2 (en) 2015-09-10 2016-08-25 Synthetic antibodies to BAX and uses thereof
US16/261,703 US10759851B2 (en) 2015-09-10 2019-01-30 Synthetic antibodies to BAX and uses thereof
US16/988,947 US11174308B2 (en) 2015-09-10 2020-08-10 Synthetic antibodies to BAX and uses thereof

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201562216400P 2015-09-10 2015-09-10
US62/216,400 2015-09-10

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US15/756,997 A-371-Of-International US10294294B2 (en) 2015-09-10 2016-08-25 Synthetic antibodies to BAX and uses thereof
US16/261,703 Division US10759851B2 (en) 2015-09-10 2019-01-30 Synthetic antibodies to BAX and uses thereof

Publications (1)

Publication Number Publication Date
WO2017044308A1 true WO2017044308A1 (en) 2017-03-16

Family

ID=58240410

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2016/048508 Ceased WO2017044308A1 (en) 2015-09-10 2016-08-25 Synthetic antibodies to bax and uses thereof

Country Status (2)

Country Link
US (3) US10294294B2 (en)
WO (1) WO2017044308A1 (en)

Cited By (13)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2019191079A1 (en) * 2018-03-26 2019-10-03 The University Of Chicago Methods and compositions for targeting liver and lymph node sinusoidal endothelial cell c-type lectin (lsectin)
US10800838B2 (en) 2010-08-10 2020-10-13 École Polytechnique Fédérale De Lausanne (Epfl) Erythrocyte-binding therapeutics
US10821157B2 (en) 2014-02-21 2020-11-03 Anokion Sa Glycotargeting therapeutics
US10919963B2 (en) 2010-08-10 2021-02-16 École Polytechnique Fédérale De Lausanne (Epfl) Erythrocyte-binding therapeutics
US10940209B2 (en) 2014-02-21 2021-03-09 École Polytechnique Fédérale De Lausanne (Epfl) Glycotargeting therapeutics
US10946079B2 (en) 2014-02-21 2021-03-16 Ecole Polytechnique Federale De Lausanne Glycotargeting therapeutics
US10953101B2 (en) 2014-02-21 2021-03-23 École Polytechnique Fédérale De Lausanne (Epfl) Glycotargeting therapeutics
US11246943B2 (en) 2010-08-10 2022-02-15 École Polytechnique Fédérale De Lausanne (Epfl) Antigen-specific tolerance and compositions for induction of same
US11253579B2 (en) 2017-06-16 2022-02-22 The University Of Chicago Compositions and methods for inducing immune tolerance
WO2022261337A3 (en) * 2021-06-11 2023-01-26 The Regents Of The University Of California Antibodies that stimulate nk cell-mediated cytotoxicity
US20230183336A1 (en) * 2019-08-14 2023-06-15 Modmab Therapeutics Inc. Antibodies that bind to lrp5 proteins and methods of use
WO2023060192A3 (en) * 2021-10-06 2023-09-07 The University Of Chicago Survivin targeting polypeptides for detection and treatment of cancer
US12383617B2 (en) 2018-05-09 2025-08-12 The University Of Chicago Compositions and methods concerning immune tolerance

Families Citing this family (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
AU2015266959A1 (en) 2014-05-30 2017-01-19 Albert Einstein College Of Medicine, Inc. Targeting dimerization of BAX to modulate BAX activity
US10294294B2 (en) 2015-09-10 2019-05-21 Albert Einstein College Of Medicine Synthetic antibodies to BAX and uses thereof
CA3080120C (en) 2017-10-27 2023-11-21 New York University Anti-galectin-9 antibodies and uses thereof
EP3877416A4 (en) * 2018-10-30 2022-07-27 Magenta Therapeutics, Inc. ANTI-CD45 ANTIBODIES AND THEIR CONJUGATES
JP7581238B2 (en) * 2019-05-01 2024-11-12 ニューヨーク・ユニバーシティ Anti-galectin 9 antibodies and uses thereof
WO2022094622A1 (en) * 2020-11-02 2022-05-05 The University Of Chicago Polypeptides for detection and treatment of sars-cov-2

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8361462B2 (en) * 2005-09-01 2013-01-29 National Research Council Of Canada Anti-apoptotic protein antibodies

Family Cites Families (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA2700925C (en) 2007-09-26 2016-08-23 Dana Farber Cancer Institute Methods and compositions for modulating bcl-2 family polypeptides
EP3401684B1 (en) 2008-10-10 2022-03-16 Dana Farber Cancer Institute, Inc. Chemical modulators of pro-apoptotic bax and bcl-2 polypeptides
CA2851788C (en) 2011-10-11 2022-11-29 Dana-Farber Cancer Institute, Inc. Pyrazol-3-ones that activate pro-apoptotic bax
US20150335671A1 (en) 2013-01-14 2015-11-26 Albert Einstein College Of Medicine Of Yeshiva University Small-molecule binding site on pro-apoptotic bax regulates inhibition of bax activity
AU2015266959A1 (en) 2014-05-30 2017-01-19 Albert Einstein College Of Medicine, Inc. Targeting dimerization of BAX to modulate BAX activity
US10294294B2 (en) 2015-09-10 2019-05-21 Albert Einstein College Of Medicine Synthetic antibodies to BAX and uses thereof

Patent Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8361462B2 (en) * 2005-09-01 2013-01-29 National Research Council Of Canada Anti-apoptotic protein antibodies

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
GAVATHIOTIS, E ET AL.: "BH3-Triggered Structural Reorganization Drives the Activation of Proapoptotic BAX.", MOLECULAR CELL ., vol. 40, no. 3, 12 November 2010 (2010-11-12), pages 481 - 492, XP055370772 *
UCHIME, O ET AL.: "Synthetic Antibodies Inhibit Bcl-2-associated X Protein (BAX) through Blockade of the N-terminal Activation Site.", JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 291, no. 1, 12 November 2015 (2015-11-12), pages 89 - 102, XP055370781 *

Cited By (19)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11884721B2 (en) 2010-08-10 2024-01-30 École Polytechnique Fédérale De Lausanne (Epfl) Erythrocyte-binding therapeutics
US10800838B2 (en) 2010-08-10 2020-10-13 École Polytechnique Fédérale De Lausanne (Epfl) Erythrocyte-binding therapeutics
US10919963B2 (en) 2010-08-10 2021-02-16 École Polytechnique Fédérale De Lausanne (Epfl) Erythrocyte-binding therapeutics
US11246943B2 (en) 2010-08-10 2022-02-15 École Polytechnique Fédérale De Lausanne (Epfl) Antigen-specific tolerance and compositions for induction of same
US12060414B2 (en) 2010-08-10 2024-08-13 École Polytechnique Fédérale De Lausanne (Epfl) Erythrocyte-binding therapeutics
US10821157B2 (en) 2014-02-21 2020-11-03 Anokion Sa Glycotargeting therapeutics
US10940209B2 (en) 2014-02-21 2021-03-09 École Polytechnique Fédérale De Lausanne (Epfl) Glycotargeting therapeutics
US10946079B2 (en) 2014-02-21 2021-03-16 Ecole Polytechnique Federale De Lausanne Glycotargeting therapeutics
US10953101B2 (en) 2014-02-21 2021-03-23 École Polytechnique Fédérale De Lausanne (Epfl) Glycotargeting therapeutics
US11793882B2 (en) 2014-02-21 2023-10-24 École Polytechnique Fédérale De Lausanne (Epfl) Glycotargeting therapeutics
US11654188B2 (en) 2014-02-21 2023-05-23 Ecole Polytechnique Federale De Lausanne (Epfl) Glycotargeting therapeutics
US11666638B2 (en) 2014-02-21 2023-06-06 Ecole Polytechnique Federale De Lausanne (Epfl) Glycotargeting therapeutics
US11801305B2 (en) 2014-02-21 2023-10-31 École Polytechnique Fédérale De Lausanne (Epfl) Glycotargeting therapeutics
US11253579B2 (en) 2017-06-16 2022-02-22 The University Of Chicago Compositions and methods for inducing immune tolerance
WO2019191079A1 (en) * 2018-03-26 2019-10-03 The University Of Chicago Methods and compositions for targeting liver and lymph node sinusoidal endothelial cell c-type lectin (lsectin)
US12383617B2 (en) 2018-05-09 2025-08-12 The University Of Chicago Compositions and methods concerning immune tolerance
US20230183336A1 (en) * 2019-08-14 2023-06-15 Modmab Therapeutics Inc. Antibodies that bind to lrp5 proteins and methods of use
WO2022261337A3 (en) * 2021-06-11 2023-01-26 The Regents Of The University Of California Antibodies that stimulate nk cell-mediated cytotoxicity
WO2023060192A3 (en) * 2021-10-06 2023-09-07 The University Of Chicago Survivin targeting polypeptides for detection and treatment of cancer

Also Published As

Publication number Publication date
US20200399356A1 (en) 2020-12-24
US10294294B2 (en) 2019-05-21
CA2998115A1 (en) 2017-03-16
US20180251532A1 (en) 2018-09-06
US20190161537A1 (en) 2019-05-30
US10759851B2 (en) 2020-09-01
US11174308B2 (en) 2021-11-16

Similar Documents

Publication Publication Date Title
US11174308B2 (en) Synthetic antibodies to BAX and uses thereof
Uchime et al. Synthetic antibodies inhibit Bcl-2-associated X protein (BAX) through blockade of the N-terminal activation site
Mian et al. Structure, function and properties of antibody binding sites
Katschke Jr et al. Structural and functional analysis of a C3b-specific antibody that selectively inhibits the alternative pathway of complement
US20220090054A1 (en) Chimeric proteins
Ma et al. Conformational selection in amyloid-based immunotherapy: Survey of crystal structures of antibody-amyloid complexes
Van Nhieu et al. Vinculin binding in its closed conformation by a helix addition mechanism
Li et al. Engineered antibody CH2 domains binding to nucleolin: isolation, characterization and improvement of aggregation
Bauer et al. Conformational editing of intrinsically disordered protein by α-methylation
Kiehstaller et al. MMP activation–associated aminopeptidase N reveals a bivalent 14-3-3 binding motif
Boschert et al. The sclerostin-neutralizing antibody AbD09097 recognizes an epitope adjacent to sclerostin's binding site for the Wnt co-receptor LRP6
Woehl et al. The structural basis for inhibition of the classical and lectin complement pathways by S. aureus extracellular adherence protein
Simões et al. Functional modulation of RAGE activation by multimeric S100B using single-domain antibodies
CA2998115C (en) Synthetic antibodies to bax and uses thereof
Ohashi et al. Identification and characterization of the linear region of ATG3 that interacts with ATG7 in higher eukaryotes
Fittolani et al. Automated fast-flow synthesis of the immune checkpoint receptors PD-1 and PD-L1
US11760780B2 (en) Targeting dimerization of BAX to modulate BAX activity
Zhang et al. Development of a dual-functional conjugate of antigenic peptide and Fc-III mimetics (DCAF) for targeted antibody blocking
Xu et al. Two monoclonal antibodies to precisely the same epitope of type II collagen select non-crossreactive phage clones by phage display: implications for autoimmunity and molecular mimicry
CN101987866A (en) Staphylococcus aureus Efb protein C-end antigen epitope, as well as preparation method and usage thereof
Sandomenico et al. IgE-binding properties and selectivity of peptide mimics of the FcɛRI binding site
Rafalik et al. The identification of discontinuous epitope in the human cystatin C–Monoclonal antibody HCC3 complex
Li et al. Structure-based design of thioether-bridged cyclic phosphopeptides binding to Grb2-SH2 domain
Nagarajan et al. The crystal structure of the ligand‐binding region of serine‐glutamate repeat containing protein A (SgrA) of Enterococcus faecium reveals a new protein fold: functional characterization and insights into its adhesion function
Unnikrishnan et al. Structures of Fab-stabilized CHIP reveal a conformational switch important in E3 ligase and chaperone functions

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 16844882

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 15756997

Country of ref document: US

ENP Entry into the national phase

Ref document number: 2998115

Country of ref document: CA

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 16844882

Country of ref document: EP

Kind code of ref document: A1