WO2017040932A1 - Humanized anti-cd40 antibodies and uses thereof - Google Patents

Humanized anti-cd40 antibodies and uses thereof Download PDF

Info

Publication number
WO2017040932A1
WO2017040932A1 PCT/US2016/050114 US2016050114W WO2017040932A1 WO 2017040932 A1 WO2017040932 A1 WO 2017040932A1 US 2016050114 W US2016050114 W US 2016050114W WO 2017040932 A1 WO2017040932 A1 WO 2017040932A1
Authority
WO
WIPO (PCT)
Prior art keywords
antibody
antigen
chain variable
variable region
amino acid
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2016/050114
Other languages
French (fr)
Inventor
Bo Yu
Rijian Wang
Keith REIMANN
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Primatope Therapeutics Inc
Original Assignee
Primatope Therapeutics Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to KR1020247043041A priority Critical patent/KR20250007054A/en
Priority to CN201680064574.2A priority patent/CN109069621B/en
Priority to EP16843066.8A priority patent/EP3307322B1/en
Priority to CA3002789A priority patent/CA3002789A1/en
Priority to ES16843066T priority patent/ES2887602T3/en
Priority to EP21156562.7A priority patent/EP3906943A1/en
Priority to BR112018004296A priority patent/BR112018004296B1/en
Priority to PL16843066T priority patent/PL3307322T3/en
Priority to CN202211072946.XA priority patent/CN116063481A/en
Priority to JP2018512313A priority patent/JP6976931B2/en
Priority to AU2016315873A priority patent/AU2016315873B2/en
Priority to DK16843066.8T priority patent/DK3307322T3/en
Priority to KR1020187009524A priority patent/KR102779818B1/en
Priority to MX2018002708A priority patent/MX2018002708A/en
Application filed by Primatope Therapeutics Inc filed Critical Primatope Therapeutics Inc
Priority to SI201631164T priority patent/SI3307322T1/en
Publication of WO2017040932A1 publication Critical patent/WO2017040932A1/en
Priority to US15/829,352 priority patent/US9974855B2/en
Anticipated expiration legal-status Critical
Priority to US15/955,393 priority patent/US10201608B2/en
Priority to US16/234,110 priority patent/US10772958B2/en
Priority to US16/994,249 priority patent/US11439706B2/en
Priority to US17/818,188 priority patent/US12514924B2/en
Priority to AU2022241635A priority patent/AU2022241635A1/en
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/39558Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/435Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
    • A61K31/4353Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom ortho- or peri-condensed with heterocyclic ring systems
    • A61K31/436Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom ortho- or peri-condensed with heterocyclic ring systems the heterocyclic ring system containing a six-membered ring having oxygen as a ring hetero atom, e.g. rapamycin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/3955Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/06Immunosuppressants, e.g. drugs for graft rejection
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2866Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for cytokines, lymphokines, interferons
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2878Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2300/00Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/33Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/94Stability, e.g. half-life, pH, temperature or enzyme-resistance
    • YGENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02ATECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
    • Y02A50/00TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
    • Y02A50/30Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change

Definitions

  • the invention relates to humani ed anti-CD4 antibodies and uses of such antibodi es, for example, to reduce the likelihood of, ' or treat, tra s l nt rejection * to induce inutwnosappression,, or to treat an atrtoimmune disorder.
  • transplantation has emerged as a preferred method of treatment for man forms of life- threatening diseases that involve organ damage.
  • transplantation rejection may occur when an organism receiving transplanted cells or tissue mounts an undesired immune response to that tissue.
  • - Transplant rejection may be minimized by tissue-type matching, but even matched tissue ca be rejected by the donor.
  • immunosuppressive therapies are now used for virtuall all cases of tissue transplantation.
  • CD40/CDi 54 mteraction One potential target for reducing transplantation rejection is the CD40/CDi 54 mteraction.
  • CD40 is expressed primarily on ie surface of B lymphocytes and other antigen- presenting cells (APCs) such as dendritic cells and macrophages.
  • APCs antigen- presenting cells
  • CD 154 is expressed primarily on the surface of T ceils. The interaction between these two proteins is associated with B cell activat ion, whic h triggers cytokine expression as we ll as expression of cell surface markers including CD23, CP8G, and CD86.
  • Keky M > R. s CD40 ⁇ mediated signaling m B ceils.
  • the present disclosure provides for a tiimianized anti ⁇ CD40 antibody, or an antigen- binding .portion thereof, comprising a Iieavy chain variable region, wherein the heavy chain 5 variable region com rises three CDRs, CDR f , CDR2 and C.0R3, having amino acid sequences about 80% to about 100% identical to the mino acid sequences set .forth m SEQ ID NQs: 13, 1 and 5, respectively.
  • the present disclosure also provides for a humanized anti-CD4d antibody, or an antigen- binding portion thereof, comprising a light chain variable region, wherein the light chain variable 10 region comprises three CDRs.
  • CDRl, CDR2 and CDR3 having ammo acid sequences about 80% to about 100% identical to the amino acid -se ue ces ' se forth in SEQ ID Os: 16, 17 and 18, respectively.
  • a humanized auti ⁇ CD4 antibody or an antigen-binding portion ' thereof, comprising a heavy chain variable regio and a light chai
  • CDRs determining regions
  • CDRl having amino acid sequences about 80% to about 100% identical to- the .amino .acid seqaences.set forth in SEQ ID HQs: B, 14 and 15, respectively, and wherei the light chain variable region comprises three CDRs, . GD l , CD 2 and CB.R3* having amino acid sequences about 80% to about 1 0% identical to the amino acid
  • the present disclosure provides for a hnnianized anti ⁇ CD40 antibody , or an antigen- binding portion thereof, comprising a heavy chain variable regio and a light chain variable region, wherein the heavy chain variable region comprises an amino acid sequence about 80% to about. 100% identical to any one of the amino aci d, sequences set forth in SEQ ID NQs: 1 1. s 1 ,
  • the present disclosure provide for a humanized ant ⁇ CD40 antibody , or an antigen- binding portion thereof, comprising a heavy chain variable region and a light chain variable region, wherein the light chain variable region comprises an amino acid sequence about 80% to about 100% identical to any one of the- amino acid sequences set forth in SEQ ID NQs: 12, 22 ,
  • a humanized anti-GD4d antibody or an ntigen- binding portion thereof, comprising a heavy chain variable region and a light chain variable region, -wherein the heavy chain variable region comprises an ammo acid sequence about 80% to about 100% identica to any one of the amino acid sequences set forth in SEQ ID ' NOs: 11 , 19, 20 » 21 , 24, 25 and 26, and wherein the light chain variable region comprises an amino acid sequence about 80% to abo ut 100% iden tical to any one of the amino acid .sequences set forth in. SEQ ID NOs: 12, 22, 23, 27, 28 and 29.
  • the present disclosure prov ides for a humanized anti ⁇ CD40 antibody , or an aniigeii- binding portion thereof, convprisiag a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises an amino acid sequence about 80% to about 100% identical to any one of the amino acid sequences set forth in SEQ ID NOs: 19, 28 and 21 , and wherein the light chain variable region, comprises an amino acid sequence about 80% to about .100% identical to either of the amino acid sequences set forth in SEQ ID ' NOs; 22 and 23.
  • the present disclosure provides fo a umanize anii-CD40 ant-body * or an antigen- binding portion thereof, comprising a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region, comprises an amino acid sequence about 80% to about 100% identical to any one of the amino acid sequences set forth in: SEQ ID Os: 24, 25 and 26, and wherein the light chain variable region comprises an amino acid sequence about 80% to about 1 0% identical to any one of the amino acid sequences set forth in SEQ ID NOs: 27, 28 and 29.
  • the present disclosure provides for a humanized anti-CD40 antibody, o an antigen- binding portion thereof, comprising a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises an amino acid sequence about 80% to about 100% identical to the amino acid sequences set forth in SEQ ID NO: 21 , and wherein the light chain variable region comprises an amino acid sequence about t0% to about 100 identicai to the amino acid sequences set forth in SEQ ID NO: 23.
  • the dissociation c nstant . (3 ⁇ 4>) of the antibody, or aniigen-tnnding portion thereof, may be less than about 1 x 10 *9 M, or less than about 1 x. 10 "s M.
  • the present airt o . ' or.ii8 ett-;!j3 ⁇ 4!slliif portion thereof . may be: (a) a whole
  • immunoglobulin molecule (b) an scFv; (e) a Fab fragment; (d) an F( b')2; and/or (e) a disulfide linked v.
  • the present antibody or antigen-binding portion thereof may compose at least one constant domain selected from: a) an IgG constant domain; and ⁇ 3 ⁇ 4) an IgA constant domain.
  • the present antibody or antigen-binding portion thereof rnay comprise at least one human constant domain.
  • the present antibody o antigen-binding portio thereof ma bind to CD 0 extracellular domain.
  • the CD 0 may be human or rh.esns CD40.
  • the present antibody or a tigeti-binding portion thereof may ock B lymphocyte activation by CD! 54-expres$ing Jurkst cells in viim.
  • the present antibody or antigen-binding portio thereof may Inhibit B lymphocyte CD23, COW, or CD86 expression.
  • a compositio comprising the present antibody or anti geii-bindhig portio thereof, and at least one .pharmaceutically acceptable carrier.
  • the present disclosure provides for a poIyTOicIeotide encoding the present antibody o antigen-binding portion thereof
  • the present disclosure provides for a vector comprising the present polynucleotide, and a cell comprising the vector.
  • the present disclosure provides for an isolated polypeptide comprising the present antibody or antigen-binding portio thereof
  • Al so enco mpassed b t he present disclosure is a -method, of producing the present antibody or antigen-binding portio thereof
  • the method may comprise- the follo ing steps: (a) cnlturiug the present cells in cuiture medium under conditions wherein the polynucleotide encoding th present antibody or antigen-binding portio thereof is expressed, thereby producing at least one polypeptide comprising the antibody o antigen-binding portion thereof; and .(b) recoverin the polypeptide from the cells or culture medium.
  • the present disclosure also, provides for a method of suppressin the i une system in. a subject* comprising the step of administering to the subject n effective amount of the present antibody or antigen-binding portion thereof.
  • the present disclosure provides for a method of treating or treating prophyiacticaHy transplant rejection, or increasing the deration of time before transplant rejectio occurs, i a • Subject in need thereof, the Method comprising the step of administering to the subject an effective amount of the present antibody or antigen-binding portion thereof.
  • the present disclosure provides for a meth d of treating or treating prophyl acttcaliy graft-versus-host disease in subject in seed thereof, the method ' -comprising the step of adroinisterirjg to the subject an effective amount of the present antibody or antigen-binding portion thereof.
  • the present disclosure provides for a method of tre ting or treating prophyi aeiiealiy an autoinuiiiuie disorder In a subject in need thereof, the method comprising the step of
  • the subject may have received, or is in need of, an organ transplantation, and/or a tissue transplantation,.
  • the organ ma be a heart kid ey s , lung, live ;, pancreas ⁇ intestine, and thymus, or a port on thereof
  • the tissue ma be: bone, tendon, cornea, skin, heart valve, vein, or bone marrow,
  • the subject may be human or a mamma .
  • the ⁇ administration ' may be commenced prior to the transplan ation *
  • the administration may continue for at least one month following the transplantation.
  • the administration may continue for at least six mouths following the transplantation- of the graft.
  • the autoimmune disorder may be as socia ted with or caused b the presence of an autoantibody-
  • the autoimmune disorder may b systemic lupus erymeniatosus (SLE), CREST syndrome (calcinosis, Raynaud's syndrome, esophageal dysmotility, selerodaciyl and telangiectasia), opsoclonus, mfiaiiunaioiy myopathy (e.g., polymyositis, deniiatomyositis, and inclusion-body myositis), systemic scleroderma, primary biliary cirrhosis, celiac disease (e.g., gluten sensitive enteropathy), dermatitis herpetiformis, ' Miller-Fisher Syndrome, acute motor axottal neuropathy (AMAH), multifocal motor neuropathy with, conduction block., aatoiaiisiatte hepatitis, antiphospholipid syndrome, Wegener's granulomatosis, microscopic polyangiitts, €3 ⁇ 4m-
  • the autoimmune disorder may be pernicious aaernia, Addison's disease, psoriasis, inflammatory bowel disease, psoriatic arthritis, Sjogren's syndrome, lupus erythematosus (e.g., discoid lupus erythematosus, dmg-induced lupus erythematosus, and neonatal lupus
  • the autoimmune disorder ma be polymyositis, dermatanryositis, multiple, endocrine failure, Schmidt's syndrome, autoimmune uveitis, adrenalids, thyroiditis, autoiBimune thyroid disease, gastric atrophy, chronic hepatitis, lupoid hepatitis, atherosclerosis, resenile dementia,, de.niyelmatuig diseases, subacute cutaneous lupus erythematosus, hypoparathyroidism.
  • adult onset diabetes eOstus e.g., type II diabetes
  • male and female autoimmune infertility e.g., ankylosing spondo!ytis
  • ulcerative colitis
  • atopic d rmatitis atopic rhinitis, Goodpasture' s syndrome, Chagas * disease, sarcoidosis, rheumatic fever, asthma, recurrent abortion, anti- phospholipid syndrome, farmer's lung, erythema multiforme, post cardiotomy syndrome, Cushhig's syndrome, autoimmune chronic active hepatitis, bird-fancier's lung, allergic disease, allergie encephalomyelitis, toxic epidermal necrolysis, alopecia, Alport's syndrome, alveolitis, allergic alveolitis, .fibrosing alveolitis, interstitial lung disease, erythema nodosum, pyoderma .gangrenosum, tt3 ⁇ 4nsfusion reaction, leprosy, malaria, leishmaniasis, trypanosomiasis, Takayasu's arteritis, polymyalgia rheuniatica, temporal arteritis
  • the administration may ' be parenteral, intravenous, subcutaneous, intramuscular, transdermal, oral, topical, intrathecal* or local.
  • the present method may fnriher comprise administration of a -immunosuppressant within six months of the administration ' of the present antibody or antigen-binding portion thereof
  • the immunosuppressant may be a calcineurin inhibitor, tacrolimus, an niTor inhibitor, flngoi od, ittyriocin alemtu im h, ritairnab, an a «li-CD4 monoclonal antibody * an anti-LFAI • monoclonal antibody, an anti ⁇ LFA3 .monoclonal antibody, an anii-CD4S antibody, an anti-GDI 9 antibody, rnonabataeept, belatacept, indolyl-ASC; azailuoprine, lymphocyte immune globulin and -anti-thymocyte globulin [equine], mycophenolaie oretil, mycophenolate sodium, dacHzomab, basilkunab, cyclophosphamide, prednisone, prednisolone, leflunomide, FK77S, FK779, IS-deoxysperg
  • the calcineurin inhibitor may be cyclosporin A or cyclosporlne G»
  • the raTor inhibitor may be sirohmus, temsirolsmBS, zotarohmus, or everolimus.
  • the anti-C045 antibod may be an ariti «C045RB antibody.
  • the immuRosuppre3 ⁇ 4sant is belatacept
  • the present antibody or -antigen- binding portion thereof and the immunosuppressant may be administered within one month, or within one week, of each other.
  • figure I shows the variable regions from the heavy chain and the light chain of the 2CT0 antibody .
  • the nucleotide sequence shown for the heavy chain (SEQ ID ⁇ ; ⁇ ) includ s- a signal peptide (nucleotides 1-57; underlined) and the heavy chain variable sequence (nucleotides 58- 396), Th corresponding amino acid sequence is shown below (SEQ ID MO:2), where amino acids 1-19 co espondin to the signal sequence (underlined) and amino acids 20- 132 correspond to the heavy chain variable region.
  • the nucleotide sequence shown for the light chai includes a signal peptide (nucleotides 1*66- underlined) and the light chain variable sequence (nucleotides 07-3S4).
  • the corresponding amino acid sequence is shown below (SEQ ID NO:4), where amino acids 1-22 correspond to the signal peptide (underlined) id amino acids 23-128 correspond to the light chain variable region.
  • Figure 2a is a plot showing flow cytometry data confirming the binding of 2C10 to human and rhesus CD20+ B ceils.
  • f igure 2-b is a plot showing CD40 adsorption data from ELISA assays with varying
  • figure 3 is a graph showing the dose-dependent inhibition of GDI 54 binding to human B cells by 2C1 , B cells ere analyzed tor CD 154 binding by incubating with hisiidine-tagged soluble CD 154 and analyzing for histidlne expression. Results, are representative of multiple repetitions of the experiment.
  • f igure 4 is a schematic diagram and graphs showing the principle of the assay involving rhesus or human peripheral biood mononuclear cells (PBMCs) and Jurkat cells.
  • PBMCs peripheral biood mononuclear cells
  • Figure 5 is a set of graphs showing CD23 expression in CD20 " ce ls taken from co-culture of rhesus PBMCs and Jurkat cells i the presence of variable concentrations of 3A8, 5C8, or 2C10 antibodies.
  • Figure 6 is a set of graph s showing CDS expression, in CD20 ! cells taken om eo-euitures of human PBMCs d Jurkat ceils in the presence of variable ' concentrat ons of 3 8 ? SCS, or 2C10 antibodies.
  • Figure 7 is a set of graphs showing CD23 expression CD20' cells from either bamae or rhesus PBMCs cultured without jurkat cells in (he presence of either the 3 AS or the 2C10 antibody.
  • Higwre 8 is a graph snowing peripheral B eel! c3 ⁇ 4a t 3 ⁇ 4h ⁇ tt3-.niae ⁇ es--tJ3 ⁇ 4 «tedw:i ⁇ mouse- rhesus chirneric forats of 2C10 engineered to contain either rhesus IgGl (2C1.0 1) or IgG4
  • Figure 9 is a graph showing T celMepeadent -antibody responses in macaqiie moakeys treated with 2C 1 OR 1, 2C 10R4, or 3ASR1 antibody. All animals were immuni ed with 4-hydroxy-3 ⁇ nitrophenylacefyl-conjtigated keyhole limpet hemocyaam (KIM) after (he first antibody
  • Figiire 10 is & diagram showing the standard macaque mode! of allogeneic islet transplantation. Diabetes was induced in macaque monkeys using streptozotocin. Diabetic monkeys were transplanted with allogeneic islets and ininiunos ppression initiated with basilixirnab and siroSnmns. Ex erimental animals received 2C10R4 reat nt on days 0 and 7 post- transplaatation, igure 1 is is a plot showin free blood glucose levels (FBG) in macaques following slei transplantation, background immunosuppression, and treatment with 2 €iOR4. The solid line on the plot represents the level of 2C10 in the plasma.
  • FBG free blood glucose levels
  • inwn anosuppress ⁇ , l ttre 12 is agrjph showin results froth a compefitiye lockade assay usiti fiiiftmn PSMCs incubated with increasing concentrations of 2C10, 3 AS, or Chi220 antibodies and staked with m APC-conjiigated 2CI0 to assess the ability of each antibody to cross-block 2C10,
  • Figures ⁇ 3» aiui 13b show sequence alignment, of humanized ' 2C10 variable regions.
  • Figure 13a Marine 2C10 VH sequence was aligned against u a germiin VH1 ⁇ and three humanized sequences 2C10Jii, 2C10Ji2, and 2CI0Ji3.
  • Figure 13b Murine 2C10 VL sequence was aligned against tom n germiine VH3 ⁇ 11 and two humanized, sequences 2C.10 11 and 2CI.0J2. The 2C1Q CD3 ⁇ 4s are holded. The murine residues in humanized sequences are underlined,
  • Figure 14 shows amino acid changes in framework 3 betwee 2CJOH0P aad ' .2C10HBl s as well as 2C3.0HB2 constructs,.
  • Figure 15 sho ws the sequences of heavy chain and light chain variable egies for h manized 2Ci0 antibodies.
  • the heavy chain and light chain variable regions include 2CI0MT, 2 € IQHBi , 2C10HB2, aC!OBCF, 2CI0KBT and 2C10KB2.
  • Figure 16 shows binding affinity of humanized 2C10 antibody to CO40 from different prirnate species.
  • Humanized 2C10 antibodies (h2Cl0) were immobilized to the surface of CMS chi by amine -coupling.
  • Dii!eretrt concentrations of CD40-MBP fusions of human, rhesus, and baboon were analyzed for affinity on a BiACore 3000. The binding affinity was calculated with
  • FIG.1.9 Day 28 Humanized ,200 fully saturated CD40 hindlng sites oh B cells, K2CI0 administered in, vivo completely blocked the binding of fl «oresce «lly labeled 2C I 0 binding to B ! 0 ceils * Data illustrate results ftora humanized 2C I Q ⁇ treated and control monkeys 28 days after a single dose of 25 cng kg (top row), 10 mg/ ' kg (middle row) or 0 mg/kg (control; bottom row). Similar results were obtained on Pays 3, 7, 14, and 21 post infusion.
  • Figtire 20 Mean sertim concentrations of h2C 1Q for up to 28 days after treatmen of monkeys 15 with -either 1.0 or 25 mg/kg. Concentrations of 2C10 slowly decline over time, arid levels are detected over the entire duration of the study.
  • Figures 2ia and 21 b sho the IMA and amino acid sequences of the humanized 2010 h2C 10) in the stabilized lgG4 .
  • format figure 21a shows the DMA and amino acid sequences of the •20 heavy chain.
  • Figure 2.1b shows the DNA and amino acid sequences of the light chain, SEQ ID NO; 32: DNA sequence of the heavy chain; SBQ ID NO; 33: amino acid sequence of the heavy chain; $EQ ID NO: 34; DMA sequence of the light chain; SEQ ID NO; 35: amino acid sequence of the light chain.
  • the present disclosure relates to anti-CD40 antibodies and antibody fragments (e.g., antigen-binding poi iofts of the antibody) that may be used in various therapeutic, prophylactic, diagnostic and other raethods.
  • the antibodies can block the ability of CD40 to bind CD 154 and do so without activating the cell expressing €D40 (e.g., a B cell).
  • the present antibodies or fragments thereof may be used to reduce complication* associated with organ or tissue transplantation.
  • the antibodies, or antige» ⁇ binding portions the eof inclwde but are not limited to, hnniaaized antibodies, human antibodies, monoclonal antibodies, chimeric antibodies, polyclonal antibodies- recorabina ly expressed antibodies, as well as antigen -binding portions of the foregoing.
  • An antigen-binding portion of an antibody may include a porti n of an antibody that specific lly binds to C 40.
  • compositions and methods for reducing the likelihood of transplant rejection, , treat transplant rejec tion, inducing iiinntmostippression, and/o treating an au oimmune disorder contain antibodies or fragments thereo f that specifically bind CD40.
  • the present disclosure provides for a method of treating: or ameliorating graft-versus-host disease &ot transplant f ejection in a subject comprisin administering to the mammal a composition comprising m an tibody of the invention (or its fragment) in a amount sufficient to decrease one or more of the symptoms of graft ⁇ vers «s ⁇ hosf disease and or transplant rejection in the subject
  • the antibody or antigen- itidmg fragment is administered to a subject having an ⁇ inflammatory disease or an immune disorder such as an autoimmune disease.
  • the inflammatory disease or autoimmune disease may be associated with CD40- expressin cells.
  • the invention features methods of redaeing me likel h d of i ansplani rejection, treat transplant rejection, inducing imratmostippression, and/or treating an autoimmune disorder in a subject by administering to the subject the present antibody r aHtigen-binding portion thereof in an effective amount.
  • Al so encompassed by the present disclosure i s a- method of blocking- the function of CD40 in a mammal eornprising adnhnisfering to the ma mma l a composition comprising (tie present antibodies, or antigen-bkdttig portions thereof, in art amount sufficient to block a CD40- mecbated inmiitne response in the niarnmal.
  • Another method of the disclosure relates to inhibiting the growth and/or differentiation of cells expressing CD40, comprising administering the present antibody or antigen-binding
  • the present disclosure provides for a method of treating a subject ha ving a C 40- associated disorder, comprising administering to the subject the presen antibody or an igen* binding f agment, wherein the binding of the antibody or antigen-binding fragment, to CD4Q inhibits the growth and/or differentiation of cells of the CD40-asseciated disorder.
  • the cells may be, but are not limited to, B lymphoblastoid cells, pancreatic, lung cells, breast cells, ovaria cells, colon cells, prostate cells, skin cells, head and neck cells., bladder ceils, bone cells or kidney cells.
  • the present method ma be used to treat chronic lymphocytic leafeemia, Biitkiit3 ⁇ 4 lymphoma, multiple myeloma, a T cell lymphoma, Mon-Hodgkin's Lymphoma, Hodgkm's Disease , Waldenst om 's aeroglobollnenria or Kaposi's sarcoma,
  • Additional methods of the present disclosure include inhibiting antibody production by B cells i a subject comprising administering, to the subject an effective amount of an anti-CD40 antibody or its fragment of the present disclosure, in one embodiment, the antibody is
  • the antibody is administered in an amount effective to inhibit B cell differentiation and antibody isotype switching in the subject, in another embodiment, the antibody is administered in an amount effective to inhibit cytokine and chemokine production, and/or inhibit up-regnlation of adhesion molecrues in T-celis and macrophages in the sobject, in a third embodiment, the antibody is administered in an amount effective to inhibit activation of dendritic cells in the subject.
  • the present methods may farther comprise administering a second therapeutic agent such as an tmmunosiippressant, a tumor .necrosis factor antagonist (a TNF-antagonist), a CTLA4-antagoni.st, an aeii-iL-6 receptor antibody, an anti-CD20 antibody, or a combination thereof.
  • a second therapeutic agent such as an tmmunosiippressant, a tumor .necrosis factor antagonist (a TNF-antagonist), a CTLA4-antagoni.st, an aeii-iL-6 receptor antibody, an anti-CD20 antibody, or a combination thereof.
  • the present antibodies, of antigen-binding portions thereof* may specifically bind t hiunan CD40 aad r rhesus CD40, iftqiad g recoihfeiaaiii and native human. CD C).
  • a cell that expresses CD40 is any cell characterized by the surface expression of €D4i ⁇ including, bat not limited to, normal and neoplastic B cells, interdlgi rating ceils, basal epithelial ceils, carcinoma cells, macrophages, endothelial, cells, follicular dendritic cells, tonsil cells, arid hone marrow-derived plasma cells.
  • the humanized antibody of the preseM disclosure is an antibody f m a non-imrnan species where the amino acid .sequences in the non-antigen binding regions (and/or the antigen- binding regions) ha ve bee altered so that the antibody more closely resembles a human
  • An antibody light or heavy chain variable region consists of three hypervariable regions, referred to as complementarity determining regions (CDRs). CDRs are supported within the variable regions by framework regions (FRs).
  • the heavy chain variable region (or light chain variable region) contains three CDRs and four framework regions (FRs), arranged froni mino-temnnns to earboxyi-tenniuns in the following. order: PR!, CDRI, FR2, CDR2, FR3, CDR3, FR4. Kabaf E. A., et a!. Sequences of Proteins of Immunological Interest, Fifth Edition, IIS, Department of Health and Hmna Services, M1H Publication o. 91-3242, 1991 CkotMa, C. ef /., f. Mol. Biol, 196:901-917, 1987.
  • humanized antibodies are antibody molecules from non-human species having one, two, three or .all CDRs from the non-human species, and one* two, three, four or all framework regions from a human immunoglobulin .molecule.
  • the CDRs of the present antibodies or antigen-binding portions thereof can be from a fton-hunian or human source.
  • the framework of the present antibodies or antigen-binding portions thereof can be human, humanized, non*frurnan (e g,, a murine framework modified to- decrease antigenicity in humans), or a synthetic framework (e.g., a consensus setpence), hi one embodiment, the present antibodies, or antigen-binding portions thereof contain at least one heavy chain variable region and/or at least one light chain variable region.
  • humanized antibodies of the present disclosure can be produced by methods known in the art
  • a humanized antibody can have one or more amnio acid residues introduced, into It from a sonrce which is non-imtnan.
  • These .non-human amino acid residues ate often referred to as "import" residues, which are typically taken from an iaaporT variable domain.
  • Hnmanimtion can be performe .following the method, of W3 ⁇ 4ater aad co-workers (Jones et al. ? Nature 321 :522-5 5 . 1986; Riechmai et al, Nature 332:323-7, 1988; Verboey n.
  • humanized antibodies are human antibodies in which at least so e hypervariab!e region residues as well as other variable -region residues are
  • variable domains both light and heavy, to be used in .making the humanized antibodies, may reduce antigenicity: According to the "best-fit" method, the sequence of the variable domain of non-human (e g, , rodent sncfj as mouse) antibody is screened against the entire library of known human variable domain sequences.
  • non-human antibody e g, rodent sncfj as mouse
  • Humanized antibodies can be generated, by replacing sequences of th variable region, that are not directl involved in antigen binding with equivalent sequences from human variable regions, Those methods include isolating, manipulating, and. expressing the nucleic acid sequences that encode all or part of variable regions from at least one of a hea vy o light chain . 5 Source of such nucleic acid are well known to those skilled in the art and, for example, may fee obtained from a hybridoni producing an antibody against CD40. The recombinant ON A encoding the humanized antibody, or fragment thereof, can then be cloned into an appropriate expressio vector.
  • variable 0 regions can be sequenced, and the location of the CDRs and framework residues determined.
  • the light and heavy chain variable regions can, optionally, be Hgated to corresponding constant regions.
  • CDR-grafied antibody molecules can be produc d by CPR-grafting or C.DR substitution.
  • One, two, three or ail CDRs of an immunoglobulin chain can be replace *
  • ail of the CDRs of a particular antibody may be from at least a portion of a non»human animal (e.g., mouse such- as C DRs shown in Table i ) or only some of the CDRs rosy be replaced. It is only necessary to kee the C DRs required for binding of the antibody to a predetermined ⁇ antigen (e.g., CD40), Morrison, S. L,, 198$, Science, 229; 1.202- 1207.
  • a predetermined ⁇ antigen e.g., CD40
  • humanized an tibodi es are prepared by a process of analysis of t he .parental sequences and various conceptual hnmaiiked products using three-dimensional models of the parental and humanized sequences, Three-dirnensioMl innnunoglobulin models are commonly available an are familiar to those skilled in the art. Computer programs are available which illustrate and displa probable three-dimensional conformaiional structures of selected candidate immunog obulin sequences .
  • a huma ized anti-CD40 antibody also includes at least a portio of an immunogiobulin constant region, typically that of a human immunoglobulin.
  • the antibody will contain both the light chain as well as at least the variable domain of a heavy chain.
  • the antibody also may include one or more- of the constant domain CHI , hinge, CH2, CH3, and/or CH4 of the heavy chain, as appropriate.
  • one or Bio e domains of th humanized antibodies will be reeo binanriy expressed. Such -recombinant expression may employ one or more control sequences, poiynocleotide sequences necessary for expression of an operahiy linked coding sequence in a particular host organism.
  • control sequences suitable for use in prokarv'ofic cells include, for example, promoter, .operator,, and rihosonie binding site sequences, Eukaryotie coritto! sequences iuctude s but are t l imited to, promoters, pa!yadenyiation signals, and enhancers. These control sequences can be utilized for expression and production of humanized anti-CD40 antibody in prokaiyotic and eukaryotie host cells.
  • Hmnan antibodies of the disclosure can be constructed by combining v clone variable domain sequencers) selected frarn human-derived phage displa libraries with known human constant domain sequences(s) 3 ⁇ 4ogenh»om et aS.. ⁇ J Mot Biol 227:381-8, 1992 ⁇ Marks et al., MoL Biol 222:581 -97, 1991).
  • v clone variable domain sequencers selected frarn human-derived phage displa libraries with known human constant domain sequences(s) 3 ⁇ 4ogenh»om et aS.. ⁇ J Mot Biol 227:381-8, 1992 ⁇ Marks et al., MoL Biol 222:581 -97, 1991).
  • . uman antibodies can be made by die hybodoma method.
  • transgenic animals e.g . , mice
  • Geae shuffling can also be used to derive human antibodies from non-husnan, e.g., rodent, mmbodies, where the ' human antibody has similar affinities and specificities to the starting non-human antibody.
  • whic is also called ''epitope imprinting
  • either the heavy or light chain variable region of a non-human antibody fragment obtained by phage display techniques as described herein is replaced wit a repertoire of human V domain genes, creating a population of non-huma ehain%uma» chain soFv or Pah chimeras.
  • a chimeric antibody is a molecule in which different portions are derived from different animal species.
  • an antibody may contain a variable region derived fro a murine antibod and a human, ⁇ immunoglo.btihn constant region.
  • Chimeric antibodies can be produced by recombinant DNA techniques. Morrison, et ai, Proc Natl Acad Sci, 81 :6851 -6855 (1 84).
  • a gene encoding a murine (or other species) monoclonal antibody molecule is digested with restriction eassymes to remove the region encoding the murine Fc, and the equivalent portion of a gene encoding a human Fe constant fegittii is substituted.
  • Chimeric antibodies can also be created by recombinant DM A techniques where DN A encoding murine V regions can be ligated to DMA encoding the human constant regions.
  • DN A encoding murine V regions can be ligated to DMA encoding the human constant regions.
  • Ci0j2 Light chain B1VLTQSPA1XSLSPGERATLSC 23 variable region.
  • the antibodies or anti gen-bindi ng portions thereof include a heavy chain variable-: region cofflprtsing a» araiao aci sequence at least about 70%, at least bout 75%, at least about 80%, at least, about 85%, at least about 90%, at least about 95%, at least about 99%, about 70%, about 75%, about 80%, about 81%, about 82%, abou 83%, about 84%, .
  • the antibodies or ntigen-b nding portions thereof include a. light chain variable region comprising aa aniiao acid sequenc at least about 70%, at least abou .75%, at least about 80%, at least about B 5 %, at least abou 90%, at least about 95%, at least about 99%, about 70%, about 75%, about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99% or about 300% identical to a light chain variable region mino acid sequence -as set forth in any of SEQ ID NOs: 12, 22, 23, 27, 28 and 29.
  • the antibodies or antigen4>kdrag portions thereof each include both a heavy chain variable region, com iling aa. aniiao acid sequence at least about 70%, at least about 75%,. at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 99%, about 70%, about 75%, about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99% or about 100% identical to a heavy chain variable region amino acid sequence as set forth in any of SEQ ID NOs: 11 , 1 .
  • a light chain variable region including an amino acid sequence at least about- 70%, at least about 75%, at .least about 80%, at least about 85%, at least, about 90%, at least about 95%, at least about 99%, about 70%, about 75%, about 80%,. about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 1 %, about 92%, about 93%, about 94%, about 95%, about 96%, about. 97%, about 98%, about 99% or about 100% identical to a variable light chain amino acid sequence as set forth in SEQ ID NOs; 1 , 22, 23, 27, 28 and 29.
  • a heavy chain variable region of the antibodies or antigen- binding portions thereof can £Q3 ⁇ 4p.rJse one, t o, .three o?m ' &w 6 «m ie3 ⁇ 41 ⁇ 2 «t3 ⁇ 4rit determining regions (CDRs ⁇ that are at bast about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 99%, about 70%, about 75%, about 80%, about 81 %, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93% , about 94% , about 95%, about 96%, about 97%, about 98%, about 99% or about 100% identical to the CDRs of a heavy chain variable region, of the 2C 10 antibody (CDR1, CDR2 and.CDR3 as set forth in SEQ ID NOs: 13, 14, 15, respectively).
  • a light chain variable region of the antibodies or arriigen-bindirig portions thereof can comprise one, two, three or more CDRs that are at least about 70%, at least about 75%, at least about 80%, at least about $5%, at least a out 90%, at least about 95%, at least about 99%, about 70%, about 75%, about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99% or about 100% identical to the CDRs of light chain variable region of the 2C10 antibody (CD I , CDR2 and CDR3 as set forth kt SEQ ID NOs: 1.6, 17, 18, respectively).
  • a light chai n variable region of the antibodies or antigen-binding portions thereof can comprise one, two, three or more CDRs that are at least about 70%, at least about 75%, at least about 80%, at least a ut 85%, at least about 90%, at least about 95%, at least about 99%, about 70%, about 75%, about 80%, about 81%, about 82%, about.83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99% or about 00% identical to the CDRs of a light chain variable region of the 2C 10 antibody (COR 1 , CDR2 wd CDR3 as set forth in SEQ ID NGs: 16, 17, 18 s , respectively).
  • a heavy chain variable region of the antibodies or-aatigen-bmdkg- portions thereof can include three CDRs that are at least about 70%, at least about 75%. at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 99%, about 70%, about 75%, about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99% or about ⁇ .00% identical to the CDRs of a hea vy chain variable region of the 2C 1.0 antibody (CDRl , CDR2 and CDR3 as set forth in SEQ ID NOs: 13, 14, 15, respeciwely).
  • a light chain variable region of the antibodies or antijgen-bind portions thereof includes three CDRs that are: at least about 0%, at least about 75%, at least about 80%, at least about 85%, a least about 90%, at least about 95%., at least about 99%, about 70%, about 75%, about 80%, about 81%, about 82%, about 83%, about .84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91 %, about 92%, about 93% 5 about 94%, about 95%, about 96%, about 97%, about 98%, about 99% or about 100% identical to the CDRs of a light chain variable region of the 2C10 antibod (CDiU, CDR2 and CDR3 as set forth in SEQ ID NOs; 16, 17, 18, .respectively).
  • a heavy chain variable region of the antibodies or an igeB-biridlng portions thereof includes three CDRs that are at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 99%, about 70%, about 75%, about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99% or about 100% identical to the CDRs of a heavy chain variabie region of the 2C.10 antibody (CD ' R!
  • CDR2 aud CDR3 as set forth in SEQ I NGs; S 3 , 14, 15, respectively
  • a light chain variable region of the antibodies or antigen ⁇ binding poitiOi3 ⁇ 4 theruaf includes three CDRs that are at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 99%, about 70%, about 75%, about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 1%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99% or about 100% identical to the CDRs of a. light Chain "variable, region -.of the 2C10 antibody (CDRl , CDR2 aad CDR3 as set forth it* SEQ ID NOs: 1.6, 17, 8, respectively).
  • a heavy chain variable region of the antibodies or aniigen- hroding portions thereof includes three CDRs thai are Identical to CDRs of a heavy chain variable region of the 2 10 antibody (CDRl , CDR2 and CDR3 as set forth in SEQ ID NOs: 13, 14, .1.5 » respectively), aad light chain variable region of the antibodies or airtigeri ?inding porti ons thereof includes three CDRs that axe i denti cal to CD Rs of a light chain variable region of the 2C10 antibody (CDRl , CDR2 a»dCDR3 as set fort in SEQ ID NOs: 16, 17, I S, respectively),,
  • anti- €D40 antibodies or antigen-binding portions thereof include, f r example, the CDRs of heavy chain variable regions and/or light chain variable regions of 2C 10.
  • the antibody or antigen-binding portion thereof contains a hea vy chain variable region and a light chain variable region identical to a heav chain variable region and light chain variable region of the 2C10 antibody (SEQ ID NO: 11 and SEQ ID NO: 12, respecti ely).
  • the antibodies or antigeH-bintling portions thereof specifically bind to an epitope thai overlaps with, or are at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 99%, about 70%, about 75%, about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about: 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99% or about 100%, identical to an epitope bound by the 2C 1. antibody.
  • the epitope may be present within th sequence of SEQ ID NO: 6, or may be present within the sequence of amino acids 8-40 of SEQ ID NO: 6.
  • CD ' s corresponding to the CDRs in Table I have sequence variations.
  • CDRs in which 1, 2 3, 4, 5, 6, 1 or 8 residues, or less than 20%, less tha 30%, or less than abou 40%, of total residues in the CDR, are substituted or deleted can he present m an antibody (or antigen-binding portion thereof) that binds CD40.
  • antibodies or antigen-binding portions thereof In which specific amino acids have been substituted, deleted or added. These alternations do not have substantial effect on the peptide's biol ogical properties such s biftdiftg activity.
  • antibodies ma have amino acid substitutions in tire framework .ragio.ii, such as to Improve binding to the antigen, in another example, a selected * small number of acceptor framework: residues can be replaced b the corresponding donor anii.no acids, The donor framework can he a mature or ge mline human antibody framework sequence or a consensus sequence.
  • the present peptides ma be the functionally active variant of antibodies : of antigen- binding portions thereof disclosed herein, e.g font with less than about 30%, abo ut 25 %, about 20%, about 15%, about 10%, about 5% or about 1% amino acid residues substituted or deleted but .retain essentiall the same immunological properties including, but not limited to, binding to CD40.
  • the antibodies or aaiigen-birtdirtg porti ons thereof may also include variants, analogs * ortboiogs, homo!ogs and derivatives of peptides, that exhibit a biological activi ty , e.g., binding of an antigen such as CD40,
  • the peptides niay contain one or more analogs of an amino acid (including, for example, non-naturally occurring amino acids, amino acids which only occur naturally in an unrelated biological system, modified amino acids from mammalian systems
  • the antibodies can be mil-length or can include a. fragment (or. f agments) of tire antibody having aii antigen-binding portion, including, ' bat not limited to, Fab, Ffa 'lS, Fab F(ah ⁇ ! , Fv; single chain Fv (scFv), bivalent scFv (bj-scFv), itivalent scFv (iri-scFv), fd, dAb fragment (e.g., Ward et at.
  • a. fragment (or. f agments) of tire antibody having aii antigen-binding portion including, ' bat not limited to, Fab, Ffa 'lS, Fab F(ah ⁇ ! , Fv; single chain Fv (scFv), bivalent scFv (bj-scFv), itivalent scFv (iri-scFv), fd, dAb fragment (
  • Papai digestion of antibodies produces two identical antigen-binding fragments, called "Fab” fragments, each with a single antigen-binding site* and residual "Fc" fragment, whose name reflects its ability to crystalliz readily .
  • Pepsin treatment yields an F(a ' b')2 ' fragment that has two antigen-combining sites and is still capable of cross-linking antigen.
  • Fv is the nnnininni antibody fragment which contains a complete antigen-binding site, h one embodiment a two-chain Fv species consi sts of a dimer of one heavy- and one light-chai variable domain, in tight, non-covalent association. I a single-chain.
  • one heavy- and one light-chain variable domain ca be eovalentiy linked by flexible peptide linker such that the light and heavy chains can associate in "draefie" structure analogous to that in a two-chain Fv species, it is in this configuration that the three CDRs of each variable domain interact t define an antigen-binding site on the ' surface of the VH ' -VJ Dock dime
  • the six CDRs confer antigen-binding specificity to the antibody.
  • a single variable domain or half of an F comprising only three CDRs specific for an antigen
  • the Fab fragment contains the heavy- and. light-chain, variable domains and also contains the constant domain, of the ligh c ain and the first constant domain (CM 1. ) of the- heavy chain.
  • Fab ' fragments differ from Fab fragments by the addition of a fe residues at the carboxyi terminus of the heavy chain CH I domain including one or more cysteines from the antibody hinge region, Fab'-SH is the designation for Fab' in which the cysteine residtie(s) of die constant domains bear a free thiol group.
  • F(ab') 2 antibody fr gments originally were produced as pairs of Fab' fragments which have hinge cysteines betweeii them. Other chemical conplings of antibody fragments are also known.
  • Single-chain Fv or scFv antibody fragments comprise -Hie VM and Vs.. d mains of antibody, where these domains ar present in a single polypeptide chain.
  • the scFv polypeptide further comprises a polypeptide linker betwee th V H and domains which enables the scFv to form me desired structure for antigen binding.
  • Diabodies are antibody fragments with two antigen-binding sites, which fragments comprise a heavy-chain variable domain (V») connected to a U ' g t-chain variable domain (V L ) in the same .polypeptide chain (V ' H-VL).
  • V heavy-chain variable domain
  • V L U ' g t-chain variable domain
  • V ' H-VL .polypeptide chain
  • the domains are forced to pair with the complementary domains of another chai and create two antigen-binding si tes .
  • Diabodies may be bivalent or bispecific. Diabodies are described more fully in, for example, European Patent No. 404,097; PCX Publication WO 1993/01161 ; Hudson et at, Mat Med.
  • Antibody fragments may be generated by traditional means, sneh as en3 ⁇ 4ymatic digestion, or by recombinant techniques. In certain eirenrostances there are advantages of using antibody fragments, rather than whole antibodies.
  • the smal ler size of the f agments allows for rapid clearance, and may lead to improved access to solid tumors.
  • an tibody fragments see Hudson et al Nat Med. 9:129-134, -2003»
  • Fab, Fv, and ScFv antibody fragments can all be expressed in and secreted from £ ' coll, thus allowing the f&cile production of large amounts of these fragments.
  • Antibody f gments can be isolated from the antibody phage libraries.
  • Fah'-SH fragments can be directly recovered from E. coli and chemically coupled to form F ah' ⁇ 2 fragments (Cartel * et at, Bio/Te knolagy 1.0: 163-7. ⁇ 992),.
  • F(t ? )2 fragments are isolated directly from recombinant host cell culture.
  • the present antibody or antigen ⁇ binding portion thereof may comprise at least one constant domain, such as, (a) an igG constant domain; (b) an IgA constant do alUj etc.
  • IgG jnckiding IgG (e,g., IaG- ' ⁇ isG2_ IaG3. laG4)
  • To isM
  • IgA CliiAT ie A2 IgA CliiAT ie A2
  • l «D r IgE h antibodies or antiaen-bradra-i portions thereof may be mammalian (e.g., mouse, human) aniibodi.es or antigen-binding portions thereof.
  • the light chains of the antibody may be of kappa or lambda type.
  • humanized a»ti-C 40 antibod can comprise sequences from more than one immunoglobulin class or isotype, and selecting particular constant domains to optimize desired effector functions is within the ordinary skill in the art..
  • the antibodies or antigen-binding portions thereof of The present disclosure may be monospecific, -speeiiie or mui i-speelfic, MuM ⁇ :Specific or hi ⁇ speeirle autibodies or fragments thereof may be specific for different epitopes of one target polypeptide (e.g., CD40) or may contain anti gen-binding domains specific for more tha one target polypeptide (e.g.
  • a multispecific antibody or anti en-binding portion thereof comprises a least two different variable domains, wherein each variable domain is capable of specificall binding to a separate antigen or to a different epitope on the same antigen.
  • aft antibody or fragment thereof can be functionally linked (e.g., by chemical coupling, genetic fusion, noncovalent association or otherwise) to one or more other molecular entities, such as another antibod or antibody fragment, to produce a bi- specifte or a mu spectfic antibody with a second binding specificity.
  • the present disclosure includes bi-speciSc antibodies wherein one arm of an immunoglobulin is- specific for CO40, and he oilier arm of the immunoglobulin is specific for a second therapeutic target or Is conjugated to a therapeutic moiety such as an immunosuppressant
  • the present disclosure provides for methods .for making an a tib dy or antigen-bindin portion thereof that specifically binds to CD4Q,
  • a uon-hurnan animal is immunized with a composition that includes CD 0, and then a specific antibody is isolated from the aniraal .
  • the method can further include evaluating binding of the antibody to C 40,
  • the present disclosure rovides " for a method for making a- hybridoma that expresses an antibod that specifically hinds to CD40.
  • the method contains the iollowmg steps: irnmnnixing an animal with a composition that includes CD40 or its .fragment; isolating splenocytes from the animal; generating hyhridornas from, the spienocytes; and selecting a hyhridoma that produces an antibody that specifically binds to CD4Q. ohler and ilstein,
  • C 40 is used- to immunise niiee intraperitaneally or iBiravenOnsiy, Cine o more boosts may or may not be given.
  • the titers of the antibodie s in the plasma can be monitored by, e g.., ELISA foi yme-linked iramiuiosorbent assay ) or flow cytometry. Mice with 0 sufficient titers of anti-CD40 antibodies are used for fusions. Mice ma or nay not be boosted with antigen 3 days before sacrifice and removal of the spleen * The moose splenocytes are isolated and ' fused with PEO to a mouse myeloma cell line.
  • the resulting hybridomas are then screened for the production of antigen-specific antibodies.
  • Cells are plated, and then incubated in selective medium, Supefnat nis from individual, wells are then screened by ELISA for human 5 anti»CD40 monoclonal antibodies.
  • the antibody secreting hybridomas are replat d, screened again, and if stilt positive for ai ti-C:D40 monoclonal antibodies, can. be suheloned by limiting dilution.
  • Adjuvants that may he used to increase the ifittnimogeni city of CD40 include any agent or agents that act to increase an immune response to peptides or combination of peptides.
  • Non- 0 limiting examples of adjuvants include alum, aluminum phosphate, aluminum hy droxide, F59 (4.3% w/v squa!ene, i),S% w/v pojysotbate SO (Tween. $0), 0,5% ⁇ w y sorbitan trioleate (Span.
  • PLG g!yeo!ide
  • PLG i nero tticies
  • Qui! A iiiterleiA os, Freund's, -aeeiyi-minamyl-L-iiH3 ⁇ 4oii l ⁇
  • P sogIuiainine tiir-MDP
  • N-acet l-aor ⁇ mttramyKL-alanyl-D-isoghitaraiae COP 11637, referred to as M>r ⁇ MDP
  • CGP 1 83 A almitoyl-sn-glyeero ⁇ (CGP 1 83 A, referred to. as MX:!** PE)
  • an RiB! which contains three components extracted from bacteria, moaophosphoryl lipid .A, trehalose dimycolate and cell wall skeleton (MPL D +C S) in a 2% squa!ene/T een 80 emulsion.
  • the imrnuTji ed animal car* be any animal that is capable of producing recoverable antibodies when administered art iramunogett, such as, but not Knitted to, rabbits, mice, rats, banisters, goals, horses, monkeys, baboons and humans, in one aspect, the host is transgenic and produces human antibodies, e.g., a mouse expressing the human im unogiobisJin gene segments.
  • art iramunogett such as, but not Knitted to, rabbits, mice, rats, banisters, goals, horses, monkeys, baboons and humans
  • the host is transgenic and produces human antibodies, e.g., a mouse expressing the human im unogiobisJin gene segments.
  • US. Patent No. 8,236,31 1; 7 , 625 * 559 and 5,770,429 the disclosure of each of which, is
  • the present antibodies or portions thereof can he produced by host cells transformed with D A encoding light and heav chains (or portions thereof of a desired antibody.
  • Antibodie (or portions thereof): can be isolated: and purified from these culture supernatants and/or cells using standard tectei3 ⁇ 4ae$:.
  • a hos cell may be transformed with DN A encoding the light chain, the heavy chain, or both, of an antibody.
  • Recombinant DMA technology may also be used to remove some or ail of the DMA encoding at least portio of either or both of the light and heav chains that is not necessary for binding, e.g., the constant region.
  • the tnyention also encompasses a nucleic acid or polynucleotide encoding at least one of the present antibody or antigen-binding portion thereof that specifically binds to CO40,
  • the : nucleic acid may be expressed in a cell to produce the present antibody or antigen ⁇ wttding portion thereof
  • the isolated nucleic acid or polynucleotide of the present disclosure comprises at least one sequence encoding a -peptide at least about 70%, at least about 75%, at ' least about 80%, at least about 85%, at least about 90%, .at least about 95%, at least about 99%, about 70%, about 75%, about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 1 , about 92%, about 93%, about 94%, about 95%, about 96%, .about 97%, about 98%, about 99% or about 1.00%
  • the invention also features expression, vectors -including at least one nucleic acid or polynucleotide encoding a peptide at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 99%, -about 70%, about 75%, about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 1%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99% or about 100% identical to any of SEQ l!D MOs; 1 1 - 29,
  • Nucleic acid molecules encoding a functionally active variant o the present antibody or antigen-binding portion, thereof are also encompassed by the present disclosu e. These nucleic acid molecules may hybridise with a nucleic acid encoding any of the present antibody or antigen-binding portion thereof under medium stringency, high stringency , or very high stringency conditions.
  • Guidance tor performing hybridization reactions can be found in Current Protocols in Molecular Biology, John Wiley ⁇ & Sons, N.Y. 6,3.1-6.3,6, 1989, which is incorporated herein by reference. Specific hybridization conditions referred, to herein are as follows'. (! ) medium stringency hybridization conditions; 6XSS at about 45"C, followed by one or more washes in 0,2 X SSC, 0.1 % SDS at 60°C; f2) high stringency hybridisation conditions:
  • a nucleic acid or polynucleotide encoding the present antibody or antigen-binding portion thereof may be introduced Into an expression vector that can be expressed in a suitable host cell.
  • the antibody m * ts portion prepared from the cells can be purified using, for example, hydroxylapatlte chromatography, gel electrophoresis., dialysis, -and ' affinity chromatography, -with affinity chromatography being a typical purification technique.
  • the suitability of protein A as an affinit ligarid depends cm the species and isotype of arty immunoglobulin Fc domain thai is present i die antibody.
  • Protein A can be used 10 purify antibodies that are based o human gamma! , gamnaa2, or gamraa4 heavy chains (see, e.g., Lindmark etal, 1983 J. Immunol Meifi.
  • Protein G is recommended for alt mouse isoiypes and for human gamma3 (see, e.g. * Guss et ai, 1 ' 986 EJVIBQ J. 5: 1567-1575), A matrix, to which an affinity ligand is attached is; most often agarose * hut other matrices are ⁇ available.
  • Mechanicall stable matrices such as controlled pore glass or poly(styreaediviny : i)befl ene allow for ' .fester flow rates and shorter processing times than can be achieved with agarose.
  • the antibody omprise* a C + s «b.H3 domain
  • the Bakerbofld AB .T the Bakerbofld AB .T .
  • the mixture comprising the antibody of interest and contaminants may be subjected to low pH hydrophobic interaction, chromatography • using- an etution buffer at pH between about 2.5-4.5, ypically performed.
  • concentrations e.g., from about Q-0.25 salt.
  • Hybrklomas or other cells that produce antibodies that hind, preferably with high affinity,, to C3 40 can then be subelone and further characterized.
  • Additional antibodies against the CD40 epi ope recognized by 2 ⁇ 0 can be made, e.g., using a suitable method for mak ng antibodies.
  • a coding sequence- lor an epitope recognized by the 2CI0 antibod is expressed as a C-iemimal fusion with. glutathione S-ttansferase (GST) (Smith et al,. Gem 67 31-40, 1988).
  • the fusion protein is purified on glataihione-Sephairose beads, eluied with, glutathione, cleaved with- thrombin (at an engineered cleavage site), and purified for immunization of rabbits.
  • Primary imnittttixations are carried out with Freund's complete adjuvant and -subsequent immunizations with Prennd's incomplete adjuvant.
  • Antibody titers are monitored by Western blot and immtuioprecipitatiott analyses using the thrombin- cleaved pf otein- fragment of the GST fusion protein, Immune, sera are affinity purified using CNBt-Sepharose-conpled protein. Antiserum- specificity can he deter ined: using a panel of unrelated GST proteins,
  • peptides corresponding to relatively unique immunogenic regions of a polypeptide of the invention can be generated and coupled to keyhole limpet liemocyanin (KLH) through a «: introduced C-terminal lysine.
  • KLH keyhole limpet liemocyanin
  • Antiserum to each of these peptides is similarly affinity purified on peptides conjugated to BSA, and specificity i tested by EL1S A or Western blot analysis using peptide conjugates, or b Western blot or iinniunoprecipitation using the polypeptide expressed as a GST fusion protein.
  • monoclonal antibodies that specifically bind the CD40 epitope recognised: by the 2CI9 antibody can ' .be prepared using standard hybxidorna technology (see, e.g., Kohler et al distrus Nature 256:495-7,, 1975; Kohler ei al, Ettr. J. Immunol. 6:511-9, 1976; Kohler et al, Eur, J, Immunol 6:292-5, 1 76; Hantmerhng et al, Monoefomf Antihmi s and T CeliHyhrkiomm, Elsevier. NY, 1981).
  • monoclonal antibodies can also be tested for specific .recognition b Western blot or mmaaopreci iia3 ⁇ 4(> -a!ri3 ⁇ 4! sis.,. A3 ⁇ 4e ⁇ tiyeiyv.TO «0C: ittal. ' antibodies can be prepared using the polypeptide of the kveiition described above and a phage display library (Vaughan et al, Na Bk chnol 14; 309- 14, 1996),
  • Bpiiopic fragments can be generated by standard techniques, e.g., using FCR and closing the fragment into a pGEX. expression vector. Fusion proteins are expressed in K coli and purified usin a ' glutathione agarose affinity matrix. To nunhnize potential problems of .low ' affinity or specificit of antisera, two or three such fusions are generated for each protein, and each fusion is i je ted into at least two rabbits. Antiser are raised by injections in a series, and can include, for example, at least three booster injections.
  • Polyclonal antibodies can be isolated from the milk or colostrum of, e.g., immunized, cows. Bovine colostrum contains 28 g of IgG per liter* while bovine milk contains 13 g of IgG per liter (Onisoujka et. al f J. Dairy Set. 86:2005-1 1 , 2003). Polyclonal antibodies can also be isolated from the yolk of eggs from immun zed chickens (Sarker ei at, J. Pe iatr. G iro teroL tfuir. 32:19-25, 2001).
  • Anti-CP40 antibodies can be characterized tor binding to GD4G by a variety of known techniques, For example, in an EOS A, .mic o iter plates are coated with GD40 or a fragment of CD40 in PBS, and then blocked with irrelevant proteins such as bovine serum albumin (BSA) diluted in PBS, Dilution of plasma from CD40-imni «nized mice (or solutions containing anti ⁇ CD40 antibodies) are added to each well and incubated. The plates are washed and then incubated with a secondary antibody conjugated to an, enzyme (e.g- ? alkaline),
  • BSA bovine serum albumin
  • ⁇ 1 ⁇ 2 antibody can be biotiny!ated which can then be defected with a sireptavidin labeled probe
  • Anti «C04O antibodies can be tested for reactivity with CD40 by Western.
  • Antibodies, or antigen iinding fragments, variants or derivatives thereof of fee present disclosure can also be described or specified in terms of their bindin affinity io an , antigen *
  • the affinity of an antibody for an antigen can be determined experimentally using an suitable metho (see, e.g., Berzofsky et at, " Antibod -Antigen Interactions," in Fun amental
  • the measu ed affini ty of a particular antibody-anHgen interaction can vary if measured under different conditions (e.g., salt eoncetitratiori, pB).
  • affinity and other antigen-binding ara e ers i&g * , 3 ⁇ 4, B , 3 ⁇ 4) are preferably made with standardized solutions of antibod and antigen, and a standardized buffer.
  • the present antibodies or antigen-binding portions thereof specifically bind to CD40 with a dissociation constant (KB) of less than about 10" ' M, jess than about 10 " * M, less than about W * M, less than about i0 "i() , less than about ' M, less than about W M, from about W M to about I0 ']2 M. from about 10 " " M to about J O " ' 1 M, -from about 18 " * M t about 10 * 0 M, or from about 1.0 "& M. to about I0 "iz M.
  • KB dissociation constant
  • Assays may also be used to test the ability of an antibody (or its fragment) to block CD40 bindin t ⁇ CD 154, or inhibit or decrease CD40-mediated responses.
  • nhibits binding As used herein, the terms ' nhibits binding” and “blocks binding” (eg,,
  • iuhihition btoeking of binding of CD 154 to CD40 are used interchangeably and encompass bom. partial and complete inhibition bloeking. Inhibition and blocking are also intended to include any measurable decrease in the binding of CD! 54 to CD40 when in contact with an anti-CD40 antibody or portions thereof as disc losed herein as compared, to iigand not in contact with an anti ⁇ CD40 antibody, e,g,, the Mocking of GDI 54 to CD40 by at least about 10%, 20%, 30%, 40%, 50%, 60%, 65%, 70%. 75%, 80%, ' 85%, 90%. 91%, 92%, 93%. 94%, 95% ; 96%, 97%, 98%, 99% s or 100%.
  • activation of B celts, or inhibition thereof may be determined by measuring expression of one or more markers selected from CD23, CD80, CDS6, and any additional suitable marker on CD20+ cells.
  • the present antibodies or fragments thereof ma be characterized by their effects on T eel!- ediaie antibody responses.
  • ⁇ e. antibodies, or .ftagftiesits thereof may inhibit Ig and/or IgG production m a mammal, when the antibody, or an amigeu iindi «g portion thereof;, is administered to the -mammal at a dosage ranging from about 1 mg/kg body weight to about SO rag/kg body weight, from about 2 mg kg body weight to about 40 mg/kg body weight, from about 3 mg/kg body weight to about 30 mg/kg body weight, from about 5 mg/kg body weight to about 2fi mg kg: bod weight, from about 8 nig/kg body weight t about 13 mg/kg body weight, abou 1 mg/kg body weight, about 2 mg kg body weight, about 5 mg/kg body weight, about 10 .mg/kg body weight, .about .15 mg/fcg body weight, about 20 mg/kg body weight, 'ab u .
  • the present antibodies or fragments thereof may be characterized by their effects on prolonging graft survival post transplantation.
  • the present antibodies or fragments thereof, alone or in combination with one or more other immunosuppressants, may prolong graft survival by about .30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, about 2 fold, about 5 fold, about 10 fold, about 15 fold, about 20 fold, about 25 fold, about 30 fold, about 35 ibid, about 40 fold, about 45 foki about 50 fold, bout 55 fold, greate than about 40% s greater ⁇ than about 50%, greater than about 60%, greater than about 70%, greater than about 80%, or greater than about 90%, greater tha about 2 Ibid, greater than about S fold, greater than about 10 fold, greater than about 20 fold, greater than about 30 fold, or greater than about 40 fold.
  • the present antibodies or fragments mereof may prolong islet allograft survival,
  • the present antibody, or antigen-binding fragment thereof a may block binding of CD40 to CD 154; c) may block activation of antigen presenting ceils (e.g., B cells, dendritic ceils, macrophages, etc.); d) may or may not induce depletion of B cells; e) may or ma not inhibit o decrease cytokine release from antigen presenting cells; f) may or may not induce tumor cell, apoptesis; g) may or may not inhibit ttunor ceil proliferation ⁇ -h) may or may not kills tumor cell; i) may or may not stimulate anti-tumor T cell responses; and/or j) may o may riot reduce established tumors.
  • antigen presenting ceils e.g., B cells, dendritic ceils, macrophages, etc.
  • d) may or may not induce depletion of B cells
  • e) may or ma not inhibit o decrease cytokine release from antigen presenting cells
  • the antibodies described herein may have of induce a combination of any one or more of these attributes or acti vities.- Tai, et al. Cancer Res. 2005, 1 :, 05(!3):589g ⁇ 906; Luqrnan et al, Blood 112:711-720, 2008.
  • the antibodies o portions thereof described herein may also be tested for eflec s on CD40 internalization, in. vitr and in viv efficacy, etc. Such assays may be performed using well-established protocols known to the skilled person (see e.g.. Current Protocols in Molecular Biology (Greene Pub!. Assoc. Inc.
  • antibodies or antigea ⁇ bi adi3 ⁇ 4g portions thereof have i viiro and m vim therapeutic, prophylactic, and/or diagnostic utilities,
  • cells can be cultured ift v in culture -medium and contacted by the anti-CD40 antibod or fragment thereof.
  • the antibodies or antigen-bioding portions thereof can be administered in a subject,, as part of an in vft3 ⁇ 4> (e. g., therapeutic or prophylactic) protocol.
  • the contacting ste is effected in a subject and includes administering an anti-CD40 antibody or portion thereof to the subject under conditions effective to permit binding of the antibody.
  • f portion thereof, to GD40 in. the subject The antibodies or antigen-binding portions thereof can be administered to reduce the likelihood of, or increase the duration prior to, transplant rejection, inducing
  • the antibodies or antibody fragments described herein may be used in any situation In which immunosuppression is desired (e.g., transplant rejection or autoimmune disorders). These antibodies are particularly useful for treating transplant rejection, e + g, f reducing the likelihood that a particular transplant is rejected by the host or increasing the time before rejection takes place.
  • the antibodies or antibody fragments described herein can be used in conjunction with transplantation of any organ or any tissue that is suitable for transplantation.
  • on4imiting exemplary organs include heart, kidney, lung, liver, pancreas, intestine, and thymus; non-limitin exemplary tissues include bone, tendon, .cornea , skin, heart valve, vein, and bone marrow.
  • the antibodies and antibody fragments can also be used to treat autoimmune disorders.
  • the autoiniinune disorder may be associated with or caused by the presence of an autoantibody.
  • Autoimmune diseases that ma be treated with the present antibodies or fragments thereof include, but are not limited to, systemic lupus erythematosus (SLE), CREST syndrome (calcinosis, Eaynaud' s syndrome, esophageal, dysmotility, scierodaciyl, nd telan iectasia), opsoclonus, kflammatot myopathy (e.g., -polymyositis, der ato yosttis, and inclusion-body myositis), systemic scleroderma, primary biliary cirrhosis, celiac disease (e,g,, gluten sensitive enteropathy), dermatitis herpetiformis, Miller-Fisher Syndrome, acute motor axonal neuropathy (AMAH), multifocal
  • lupus erythematosus e * g discoid lupus erythematosus, drog-induced lupus erythematosus, and neonatal lupus
  • Additional disorders that may be treated using the methods of the present disclosure include, for example, polymyositis, de-miato sitls, multiple endocrine failure, Schmidt's syridreme, autoimmune uveitis, adrenaiitis, thyroiditis, autoimmune thyroid disease, gastric atrophy, chronic hepatitis, lupoid hepatitis, atherosclerosis, presenile -dementia, demyelinatmg diseases, subacute cutaneous lupus erythematosus, hypoparathyroidism, Dressier's syndrome, autoimmune thrombocytopenia ⁇ idiopathic thror «bocytopeuic purpura, hemolytic anemia* pemphigus vulgaris, pemphigus, alopecia areata, pemphigoid., scleroderma, progressive systemic sclerosis, adult onset diabetes melMtus (e.g., type II diabetes), male
  • cryoglohulhternia Waldenstrom ⁇ macroglobulemia, Epstein-Barr virus infection, mumps, Evan's syndrome, and autoimmune gonadal failure.
  • the present antibody or its fragment can be used in the treatment of various disorders associated with the expression of GD 0.
  • a disorder may be any condition that would benefit from teeatme with the present antibody or its fragment This includes chronic and acute disorders or diseases including those
  • disorders to be treated include autoimmune diseases, immunologic disorders, inflammatory disorders, cancer, hematological malignancies, benign, and malignant tumors, ieuketmas, lymphoid malignancies, and angiogenic disorders.
  • CD4Q-assoeiated disorders include, but are noi limited to, diseases and disorders of the immune system, such as autoimmune disorders and hvrlammatory disorders. Such conditions include, but are not limited to, rheumatoid arthritis
  • RA systemic lupus erythematosus
  • Sb systemic lupus erythematosus
  • sclero rma* Sjogren's syndrome
  • multiple sclerosis! multiple sclerosis!
  • psoriasis inflammatory bows! disease (e.g.., ulcerative colitis and Crohn's disease)
  • UP idiopathic tteirahoeytopenic purara
  • cancers that demonstrate abnormal ex pression of C 0- antigen incl ude B lymphoblasioid ceils, Bnrkiifs lymphoma, multiple myeloma, T ceil lymphomas, Kaposi's sarcoma,
  • osteosarcoma epidermal and endothelial tumors, pancreatic, lung, breast, ovarian, colon, prostate, head and neck, skin (melanoma), bladder, and kidney cancers.
  • disorders also include, but are not limited to, leukemias, lymphomas, including B cell lymphoma and non- Hodgkin's lymphoma, multiple myeloma, Waldenstrom's macroglobulinemia; solid tumors, Including sarcomas, such as osteosarcoma, Ewing's sarcoma, ma!ignant me!anQnM,
  • adenocarcinoma including ovarian adenocarcinoma * Kaposi's sarcoma/ aposi's tumo and squamous eel! carcinoma.
  • CD40-espressing cancers thai can be treated o prevented by the present antibodies Of fragments thereof also include, for example, leukemia, such as acute leukemia, acute
  • lymphocytic leukemia acute myelocytic leukemia (e.g., trryeloblastic, promyelocytic, myelomonocyttc, monocytic, or eryihroleukemia), chronic leukemia, chmnic myelocytic leukemia, acute myelocytic leukemia (e.g., trryeloblastic, promyelocytic, myelomonocyttc, monocytic, or eryihroleukemia), chronic leukemia, chmnic myelocytic
  • lymphocytic leukemia granulocytic. leukemia, or chronic lymphocytic leukemia
  • Polycythemia vera Polycythemia vera
  • Lymphoma e.g., Hodgkin's disease or HoivHodgkifi's disease
  • multiple myeloma Waldenstrom's
  • sarcomas and carcinomas e.g., fi fosarccirtta, myxosarcoma, lipossrcoma. ; chondrosarcoma, osteogenic sarcoma* 08teos& eo .aj chordoma, angiosarcoma, endotheliosarcoma, lymphangiosarcoma,
  • lymphangioendoiheliosarcoma synovioma, mesothelioma, Ewing's tumor, leiomyosarcoma, rhabdomyosarcoma, colon carcinoma, colorectal carcinoma, pancreatic cancer, breast cancer, ovarian cancer, prostate cancer, squamous cell carcinoma, basal cell carcinoma, adenocarcinoma, sweat gland carcinoma, .sebaceous gland carcinoma, papillary carcinoma, papillary
  • adenocarcinomas cystadenocarcmoma, medullar)- carcinoma, bronchogenic carcinoma, renal cell carcinoma, hepat&ma, bile duct carcinoma, choriocarcinoma, seminoma, embryonal carcinoma, Wilms' tumor, cervical cancer, uterine cancer, testicular tumor, lun carcinoma, small cell lung carcinoma, non-small cell lung carcinoma, bladder carcinoma, epithelial cUfcinoma, glioma, astrocytoma, meduUohlastoraa, craniopharyngioma, ependymoma, pinealoma, hentani3 ⁇ 4ohlastoraa, acoustic neuroma. oiiaodendroghomav renimsiOiBa, melanoma,
  • Also encompassed are methods of treating disorders of B lymphocytes e.g. , systemic lupus erythematosus, Goodpasture's syndrome, rheumatoid arthritis, and type I diabetes
  • Thl- lymphocytes e.g., rheumatoid arthritis, multiple sclerosis, psoriasis, Sjorgren's syndrome, Hashimoto's thyroiditis, Grave's disease,, primary biliary cirrhosis, e ener's granulom osis, tuberculosis, or graft versus host disease
  • h2-lymphocytes e.g., atopic dermatitis, systemic lupus erythematosus, atopic asthma, rhiuocotijuiic ivitis, allergic rhinitis, Omenn's syndrome, .systemic sclerosis,, or chronic graft versos host disease.
  • the immunological disorder is a T cell-mediated immunological disorder, such as a T cell disorder in which activated T cells associated with the disorder express CD40.
  • a «ti ⁇ CD40 antibodies of agents can be administered to deplete -such CD40-expressing acti ted T cells.
  • admioistfatiori of anti-CD4 antibodies or agents can deplete CD40-expres$ing activated T cells, while resting T cells are not substantially depleted by the anti ⁇ CD40 or agent, i this context, "not substantially depleted” means that less than about 60%, or less than about 70% o less than about 80% of resting T cells are not depleted.
  • the present antibody or antigen-binding portion thereof can be administered alone or in combination with one or more other therapeutic agents (e.g., a second therapeutic agent), in some embodiments, the pharmaceotieal compositions comprising the anti-CD40 antibody or its fragment can further comprise a second therapeutic- agent, either conjugated or unconjugated t the antibody or its fragment.
  • the second agent is another monoclonal or polyclonal antibody or antigen-binding portion thereof
  • the second agent i s an inimuaosnppressaat
  • the second agent is a cytotoxic or cytostatic agent.
  • the second agent may target a receptor o recepto complex other than CD40 on the surface of activated lymphocytes, dendritic cells or CD40- expressin cancer cells.
  • Such combination therapy can have an additive or synergistic effect on condition parameters (e ⁇ g. s severity of a symptom, the number of symptoms, of frequency- of relapse).
  • assays may also be used, for exa ie, a tni xed lymphocyte reaction ( MLR) assay (see, e.g. , Fathman et al, J Immunol. 3 18:1232-8, 1977); a CD3 assay (specific activation of immune cells via an ami-CD3 antibody (e.g., 0&T3)) (see, e.g handed Khanna ei al.,
  • Cyclosporine A (CsA; CAS No. 59865-13-3; U.S. Patent No. 3,737,433) and its analogs m y be used as an. immunosuppressant
  • CsA Cyclosporine A
  • CAS No. 59865-13-3 CAS No. 59865-13-3
  • U.S. Patent No. 3,737,433 Cyclosporine A
  • m y be used as an. immunosuppressant
  • a number of other cycloserines and their derivatives and analogs that exhibit iiBmisnosiippressive activity are .known.
  • C closporines and their formulations are desctihed, for example, in 2004 Physicians' Desk Reference* (2003) Thomson Healthcare, 58th ed.,amd US, Patent Nos. 5,766,629; 5,827,822; 4,220,641; 4,639,434;
  • Tacrolimus is a m crolide which, exerts effects largely .similar to CsA, both wit regard to i ts ⁇ molecular mode of action and its clinical efficacy (Li% Immimol Toda 1 -290 ⁇ 5 ; , 1993 ; Schrelbef et al . , Immun i. Today, 1 ; 136-42. 992); however, these effects are exhibited, at doses that are 20 to 1 0 times lower than CsA (Peters et al, Drugs 46:746-94, 1993).
  • Tacrolimus and its forftiularions are described, for example, in 2004 Physicians 5 Desk Reference* (2003) Thomson Healthcare, 58th ed., and U.S. Patent Nos. 4,894,366; 4,929, 1 ; :3 ⁇ 4rd 5,164,495,
  • Sirolimus is a imniunosnppressive lactam macrolide produeeabie, for example, by Sirept myees hygmscopictts.
  • Numerous derivatives of si.ro limes and its analogs and their i3 ⁇ 4imdSatiiMis are known and described, for ex mple, in 2004 Physicians' Desk Reference* (2003) Thomson Healthcare, 58th ed., Europea Patent EP 0467606; PCT Publication Nos. WO 94/02136, WO 94/9903 , WO 92/05179, WO 93/ .11 0, WO 94/02385, WO 95/14023, and W 94/02136, and U.S. Patent Nos. 5,023,262; 5,120,725; 5, 1 0,727; 5,177,203; 5,258,389;
  • the second agent is a cytotoxic agent, which may be a conventional chemotherapeutic such as, for example, doxorubicin, paelitaxei, melphalan, v ca alkaloids, .methotrexate, mitomycin C or etoposide.
  • cytotoxic agent such as, for example, doxorubicin, paelitaxei, melphalan, v ca alkaloids, .methotrexate, mitomycin C or etoposide.
  • potent agents such as CC- 065 analogues, calicheamicitt, aytansirie, -analogaes of doiastatin 10, rbteoxin, and pafytoxirt can h linked to the a»ti-CD40 antibodies or agents thereof.
  • the second a ent is a hitinanizetl anti-HER.2 monoclonal antibody; RITUXAN (rituximab; Genenteeh, Inc., South Sao Fraeeiseo, Cali ); a chimeric anti- CD20 monoclonal antibody); QVAREX (AltaRex Corporation, MA); PANORE (Glaxo Wellcorne, HC; a murine lgG2a antibody); ERBtTU (cetuxi ab) (imciane Sysi iss Inc., NY; an anti-EGFR IgG chimeric antibody); V ' LIAXt ' N (Medlninmne, inc., MD); CAMPATH 1/H (Leukosis,.
  • MA a hnnimiized IgGl antibody
  • Smart M1 5 Protein Design Labs, Inc., CA; a humaxazed anti-CD33 IgG antibody
  • LymphoCide imrouttoraedics, inc., J; a humanized aiiti- CD22 IgG antibody
  • Smart ID1 ⁇ Protein Design Labs, inc., CA; humanized anti-HLA-DR antibody
  • .suitable antibodies thai may be used as the second agent include, but are not limited to* antibodies against the following antigens: CA.125* €A15 ⁇ 3, CA19-9, L6, Lewis Lewis X, alpha fetoprotein, CA 242, placental alkaline phosphatase., prostate specific antigen., prostatic acid ⁇ phosphatase, epidermal growth factor. MAGE-1, MAGE-2, MAGE-3, MAGE-4, anti-iEmsferfiM receptor, p97, MUC1 CLB. CEA, gpl 00, MARTI , Prostate Specific Antigen, lL-2 receptor, CD20, CD52, CD33. CD22, human chorionic gonadotropin, CD38, mucin, P21. MPG S and Neit oncogene product. nii-Therapeutic Uses
  • the antibodies described herein are useful as affinity; purificatio agents, in this process, the antibodies or fragments thereof are Immobilized on a soli d phase such a Protein A resin, using methods well known in the art.
  • the immobilized antibody or its fragment is contacted with a sample containing the CD40 protein (or fragment thereof) to be purified, and thereafter the support is washed with a suitable solvent th t will remove substantially all the material in. the sample except the CD40 protein, which is bound to the immobilized antibody. Finally, the Support is washed with another suitable solvent dtat will release the CD40 protein from the antibody.
  • the resent anti-CD40 antibodies are also useful i diagnostic assays to detect and/or quantify CD40 protein, for example, detecting CD40 expressio in specific cells, tissues, or serum
  • the antibodies described hereto may be ernpioye in any known assay method, such as competitive binding assays, direct and indirect sandwich assays, and immuaoprecipitatton assays. See, e,g., Zola, Monoclonal Antibodies: A Manual of Techniques, pp. 147-158 (CRC Press, Inc. 1987),
  • the present disclosure provides a eompos on, e.g,, a pharmaceutical composition, containing an antibody, or anilgen-bmdmg .poi ioii(s) diereof, of The present disclosure, formulated together with a pharmaceutically acceptable carrier.
  • a pharmaceutical composition may contain an isolated nucleic acid encoding the present antibody or antigen- binding portion thereof, and a pharmaceutically acceptable carrier.
  • the composition may be effective to reduce the likelihood of, or increase the duration prior to, transplant rejection, to induce: iinnnrnosuppressiGn, or to treat an autoimmune disorder in a subject.
  • the present composition may be effective in any of the methods described herein.
  • Pharmaceutically acceptable carriers include any and all suitable solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the Kke that are physiologicall compatible,.
  • the present antibodies (or antigen-binding portionis) th reof) may be coated in a tnaterial to protect the antibodies (or antigen-binding portiort(s) thereof) front the action of acids and other natsral conditions that may inactivate the antibodies (or antigen-binding portion(s) thereof;!.
  • the carrier can be a Solvent or dispersion medium, containing, tor example, water, ethanoi, polyol (for ex m le, glycerol, -prop lene -glycol, and liquid polyethylene glycol, and the like), and suitable mixtures thereof.
  • the proper fluidity can be maintained, for example, by th use of a coating such as lecith in, by the maintenance of the required particle size in the case of dispersion and by the use of stnfactants.
  • the present composition may include isotonic agents, for example, sugars, polyalcohols such as manuito!, sorbitol or sodium chloride in the composition.
  • Prolonged absorption of the injectable compositions ca be brought about by including in ⁇ he composition an agent that delays absorption, for example, monostearate Salts and gelatin.
  • Pharmaceutical cojspositions of the invention may contain the present antibody or its fragment, and the second therapeutic agent as described herein (e.g., one or more
  • the composition may be in the fomi of a solution, suspension, an emulsion, an infusion device, of a delivery device for implantation, or it ma be presented as a solid form (e.g. , a dry powder) to be reconstituted with water or another su ta le vehicle before use.
  • the compositions may be in the form of an oil emulsion, waier1 ⁇ 2 «oil emulsion, water-in-oiHn-water emulsion, site-specific emulsion, long-residence emulsion, siteskyemuision, microemulsion, nanoeimdsion, liposome, mietoparticle, microsphere, nanosphere, nanopai kle and.
  • nonresorbab!e impermeable polymers such as etayleueviftyl acetate copolymers and HytrelD copolymers, swellable polymers stich as hydragels, or resorbabl polymers such as collagen and certain, polyacids or polyester s such as those used to make resorbable sutures, that alow for sustained release of the vaccine.
  • composition can be in the form of a pill, tablet, capsule, liquid, or sustained release tablet for oral administration; or a liquid for intravenous, intrathecal, subcutaneous or parenteral administration; or a polymer or other sustained release vehicle for local administration.
  • a solution of the compositi on is dissolved in, a phannaeeuticafly acceptable carrier;, .eg. 5 an aqueous carrier if the composition is wafer-soluble.
  • aqueous solutions include, e.g., water, saline, phosphate buffered, saline. Hank's solution. Ringer's solution, dextrose/saline, glucose solutions and the like.
  • the formulations can contain pharmaceutically acceptable auxiliary substances as required to approximate physiological conditions, such as buffering agents, tonicity adjusting agents, wetting agents, detergents and the like. Additives can also include additional active ingredients such as bactericidal agents, or stabilizers.
  • the solution can contain sodium acetate, sodium lactate, sodium chloride, potassium chloride, calcium chloride, sorbitan monolaurate or tnethanclamine oleate.
  • Solid formulations can be used in The present disclosure. They can be formulated as, e.g., pills, tablets, powders or capsules, f or solid compositions, conventional solid carders can be used which include, e r g,,- e annitol, lactose, starch, magnesium stearate, sodium saccharin, talcum, cellulose, glucose, sucrose, magnesium carbonate, and the like, .
  • suitable pharmaceutical exeipients include g., starch, cellulose, talc, glucose, lactose, sucrose, gelatin, malt, rice, .flour, chalk, silica gel, magnesium stearaie, sodiiun stearate, glycerol . o.n0siearate 5 sodium c3 ⁇ 4lo3 ⁇
  • the phannacentieal fomra!aiions comprising compositions or nucleic acids,, polypeptides, or antibodies of the invention are incorporated in lipid monolayers or biiayets, e.g., liposomes, U,S, Patent Mos. 6,110,490; 6,096,716; 5,283,185 and 5,279,833.
  • lipid monolayers or biiayets e.g., liposomes, U,S, Patent Mos. 6,110,490; 6,096,716; 5,283,185 and 5,279,833.
  • aspects of the ipverttiort also provid formulations in which water soluble nucleic acids,, peptides or
  • peptides cap be attached tO ' hydfa3 ⁇ 4ide-PE0 diStear6ylpho$phatidyl ⁇ ethanohMime- ccmiaining liposomes (see, Zalipsky,, ioconjug, Cheni. 6: 705-708, 1995).
  • Liposomes or any form of lipid membrane such as planar lipid membranes or the cell membrane of an intact cell, e t g. a red blood cell, can be used.
  • Liposomal formulations can be by any means, including administration intravenously, transdeftnally (see., e.g. , Vutta, J, Pharm. Sea. 85; 5-8, 1996), transmucosaUy, or orally.
  • the invention also provides pharmaceutical preparations in which the nucleic 3 ⁇ 4l , peptides aud/or polypeptides of the in vention, are incorporated within micelles and Or liposomes (see, e.g., Stmtres, L Pharm. Pharmacol. 46: 23-28, 1994; Woodle, Pharm Res. 9: 260-265, 1 92).
  • Liposomes and liposomal formulations can be prepared according to standard methods and are also well known in the art Akimaru, Cytokines MoL T ier. 1 ; 197-21 , 1995. Alviiig. Immunol, Rev. 145; 5-31, 1995. Szoka, Ann. Rev * Blophys, Bloeng, 9: 467, 1.980. U.S. Patent Nos., 4, 235,871 ; 4,501,728 and 4,837,028.
  • compositions are prepared with carriers that will protect the peptide against rapid elimination from the body, such as a controlled release formulation, including implants and microencapsulated, delivery systems.
  • a controlled release formulation such as a controlled release formulation, including implants and microencapsulated, delivery systems.
  • Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, olyanhydrides, polygiycolic acid, collagen,
  • compositions of The present disclosure cart be administered by a variety of methods known in the art. As will be appreciated by the skilled artisan, the route and/or mode of administration will vary depending pon the desired ' results.
  • Administration may be parenteral, intravenous, intrathecal, subcutaneous, oral, topical, local, intramuscular, intradermal, transdermal, subderrnal, rectal, spinal, or .epidermal * intravenous delivery by continuous iniusidn is one exemplary method ib administering the present antibodies.
  • the agent may be administered to a subject in m appropriat earner, tor example, liposomes, or a diluent.
  • Pharrnaeeiitically acceptable diluents include saline and aqueous buffer solutions.
  • Liposomes include water-in-oil-in-water CG emulsions as well as conventional liposomes (Sfrejau et al., J N& iimmwnol. 7:27-41, 1984),
  • Parenteral administration can include modes of administration other tha enteral and topical administration, usually by injection, and include, without: limitation, intravenous, intramuscular., intraarterial * intrathecal., intracapsular * intraorbital, Intracardiac, intradermal, intraperitoneal, transtracheal, subcutaneous, subcuticular, ktraarticular, subcapsular,
  • aqueous and nonaqueous carriers which may be employed in the pharmaceutical compositions of the invention include water, ethanol, polyols (such as glycerol, propylene glycol polyethylene glycol, and the like), and suitable mixtures thereof, vegetable oils, such as olive oil, and injectable organic esters, such as eihyl oleate.
  • polyols such as glycerol, propylene glycol polyethylene glycol, and the like
  • vegetable oils such as olive oil
  • injectable organic esters such as eihyl oleate.
  • Proper fluidity can be .maintained, fo example, by the use of coating materials, such as lecithin, by the mainte nce' of the required particle skein the case of dispersions, and by the use of surfactants.
  • Formulations for parenteral administration may, for example, contain excipients, sterile water, saline, polyalkylene glycols such as polyethylene glycol, oils of vegetable origin, or
  • Biocompatible, biodegradable lactide polymer, ' lacttde glycolide copolymer, or polyoxye hylene-polyoxypropylene copolymers may be used to control the release of the present agent.
  • Nanapartieulaie fbrinulatioos e ⁇ g. ⁇ biodegradable nanopartieles, solid lipid .nanoparticies, liposomes
  • Nanapartieulaie fbrinulatioos e ⁇ g. ⁇ biodegradable nanopartieles, solid lipid .nanoparticies, liposomes
  • deli .very systems include ethyl ens-vinyl acetate copolymer particles, osmotic pumps, intrathecal um s, implantable infusion systems, and liposomes.
  • concentration of the agent in the formulation varies depending upon a number of factors, including the dosage of die drug to he administered, and die route .of adin istratior
  • Sterile injectable solutions can be prepared by incorporating the present agent in the required amount in an appropriate solvent wit one or combination of ingredients enumerated above, as required, followed by sterilization microfiltration.
  • dispersions are prepared by incorporating the present agen into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above.
  • the methods of preparation include vacuum drying and freeze-drying (lyophilizatioti ⁇ that yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof. Dosage regimens are adjusted to provide the optimum desired response (e.g., therapeutic response).
  • a single bolus may be administered, several divided doses may fee administered over time or the dose may be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation.
  • the antibodies of the invention ma be administered once or twice weekly b subcutaneous injection or once or twice monthly by subcutaneous infection.
  • Parenteral compositions may be formulated in dosage unit form for ease of administration and uniformit of dosage.
  • Dosage Unit form refers to physically discrete units suited as unita y dosages for the subjects to be treated; each unit contains a predetermined quantity of active agent calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier.
  • the present compositions When administered orally, the present compositions may be protected from digestion. This can fee accomplished either by completing the antibody or antigen-binding portion thereof with a composition to render it resistant to acidic and enzymatic hydrolysis or by packaging the ant ibody or antigen-hindittg portion thereof in an appropriately resistant carrier such as a liposome. Means of protecting agents front digestion are well known in the art. Fix, P arm Res. 13: 1760-1764, 1996, Sarnanen. J. Pharm. PharaiacoL 48 1 19-135, 1996. U.S. Patent No,
  • penetrants appropriate to the battier to be permeated can be used in. the formula o .
  • penetrants are generall known in the art, and include, . . , tor transonic osal administration, bile salts and fusidic acid derivatives. addition, detergents ca be used to facilitate permeation.
  • Transruueosal administration can be through nasal sprays or risin suppositories, Sayarii, Crit. Rev. Ther. Drug Carrier Syst. 13: 85-184, 1996,
  • the agents are formulated into ointments* creams, salves, powders and gels.
  • Transdermal delivery systems can also include, e.g., patches.
  • compositions can also be administered, in sustained delivery or sustained release mechanisms.
  • biodegradeable polymer confi gyrations capable of sustained delivery of a peptide can be included in the formulations of the invention (see, e.g.. Putney, ' Nat. Blotechno!, 16: 153-157, 1998).
  • the preseu compositions can be delivere using any system known in the art, including dry powde aerosols, liquids delivery systems, air jet osh lkers, prope!knt systems, and the like. Patton, Biotechniques 16 141-143, 199$, Also can be used in The present disclosure are product and inhalation, delivery systems for polypeptide maeromolecules by, ⁇ 3 ⁇ 4. , Dura Pharmaceuticals (San Diego, Calif), Aradigm (liayward, Calif), Aerogen (Santa Clara, Calif ), Inhale Therapeutic S stems (San Carlos, Calif), and the like, For example, the
  • .pharmaceutical formulation can be administered in. the form of an aerosol or mist.
  • the formulation can be supplied in finely divided form along with a. surfactant and propellant.
  • the device for delivering the formulation t respiratory tissue is an inhaler in which the formulation vaporizes.
  • Other li id deli very systems include, f?. ⁇ , air jet nebulizers.
  • compositions can be administered in a singl dose - ' treatment or in multiple dose treatments on a schedule and over a time period appropriate to the age, weight and condition of the subject, the particular composition used, and the route of administration.
  • the frequency of adniroistralion can var depending on any of a variety of ' i3 ⁇ 4ct»rs, 6, ⁇ ., severity of the symptoms, degree of t naitnoprotectiorj desired, whether the composition is used or prophylactic or curative purposes, etc.
  • the composition according to the invention is administered once per month, twice per month, three times per month, every other week (qow), once per week (qw), twice pe week (bi w) , three times ' per week (ti w), four times per week, fi ve times per week, six times per week, every other day (qod), daily (qd ⁇ ⁇ twice a da (qid), or three times a day (tid).
  • the period of time over which the composition is ⁇ administered can vary, depending on any of a variety of factors, e.g., subject response, etc *
  • the composition can be administered over a period of time ranging from about one day to about one week, from about two weeks to about four weeks, from about one month to about two months, from about two months to about foot months, from about four months to about: six months, from about si months to about eight months, from about eight months to about 1 year, from about 1 year to about 2 years, or from about 2 years to about 4 years, or more.
  • Dosage unit form refers to physically discrete units suited as unitary dosages for the subject; to be treated; each unit containing a predetermined quantity of active agent calculated to produce the desired therapeutic effect in association with the required phamiaceuticai carrier.
  • Actual dosage levels of the active ingredients in the pharmaceutical compositions of The present disclosure may be varied so as to obtain an amount of the active ingredient which is effective to achieve the desired therapeutic response for a. particular patient, composition, and mode of administration, without being toxic to the patient.
  • The- selected dosa e level will depend upon a variety of pfearaiacokinefic factors including the activity of the particular compositions of The present disclosure employed, or the ester, salt or ami de thereof the route of administration, th time of administration, the rate of excretion of the particular agent bein employed, the duration of th e treatment, other drugs , agents and/or material s used in combi nati on with the particular compositions employed, the age, sex, weight, condition, general health and prior medical ' history of the patient being treated, and like factors well known in the medical arts.
  • a physician 0*" veterinarian aving ordinary skill in the art can readily determine and prescribe the effective amo unt of the phannaceutical composition required
  • the physician or veterinarian can start, doses of the agents of the invention employed in the pharmaceutical composition at levels lower than that required in order to achieve the desired therapeutic effec and graduall increase the dosage until the desired effect is achieved.
  • a suitable daily dose of a composition of the invention will be that amount of the agent which i the lowest dose effective to produce a iherapeuiic effect.
  • the effective daily dose of a therapeutic composition may be .adm issered as two, three, four, s x or more sub-doses adni istered separately at appropriate intervals throughout the day, optionally., in unit dosage forms.
  • the dosage of such agents lies within a range of circulating concentrations that include the BD 3 ⁇ 4 » with little or no toxicity.
  • the dosage can vary within this range depending upon the dosage form employed and the route of administration utilized, in anothe embodiment, the therapeutically effective dose can he estimated initially from cell culture assays, A dose can be formulated in animal models to achieve a circulating plasma concentration range that includes the IC $ o (i- & . the concentration, of th test agent which achieves a half-maximal inhibition of symptoms) as determined in cell culture.
  • Sottderstrop Springer, Sem, Immnnopathol, 25: 35-45, 2003, Nikuia i «/,, Ihhal Toxicol, 4(12 : 123-53, 2000.
  • An exemplary, non-limiiirig range for a therapeutically or prophylactieally effective anioinn of an antibody or antigen-binding portion of the in vention is from about 0.001 to about 100 mg/kg body weight or more, about 0.
  • a dose is about 0.5 mg/kg, about I mgkg, about 2 mg/kg, about 3 mg kg, about 4 mg kg, about 5 mg kg, about 6 tug/kg, about 7 mg kg, about 8 rug/kg., about 9 mg/kg,. about 10 mg/kg, about 11 mg/kg, about 12 mg k , about 13 mg kg, about: 14 mg/kg, about 15 mg/kg or about 16 mg kg of the subject's body weight.
  • the composition is formulated to contain effective amount of the present antibody or antigen-biudiug portion thereof, wherein the amount: depends on. the animal to be treated and die condition to be treated, in one erohodsmeut, the present antibody or antigen-binding portion, thereof is administered at dose ranging from about 0.01 mg to about 10 g, from about 0, 1 mg to about 9 g, from about 1 mg to about 8 g, from about ⁇ mg to about 7 g, from about 5 mg to about 6 g, from about 10 mg to about 5 g, from about 20 mg to about 1 g, from about 50 mg to about 800 mg, frorn about 1 0 rug to about 500 mg, fr m about 0.0kag to about 10 ' .g s from, about 0.05 fig to about 1.5 mg, from about 10 jig to about 1 mg protein, from about 30 ⁇ to about 500 ' jig, : ⁇ f om about 40 pg to about 300 pg, from about 0
  • the specific dose level for any particular ' subject depends upon a variety of factors including the activity of the specific peptide, the age, body weight, general health, sex, diet, time of administration, route of administration, and rate of excretion, drug combiuatiou and the severity of the particular disease undergoing therapy.
  • art article of manufacture containing materials useful for the treatment of the conditions or disorders described herein is included.
  • the arti cle of manuiucture comprises a container and a lafe l.
  • Saii feie co itainers include, tor example, bottles, vials, syringes, and test tubes.
  • the containers may be formed from a variety of materials such as glass or plastic.
  • the container holds a composition that is effective ' for treating the condition and may have a sterile access port.
  • the container may be an intravenous solution bag or a vial having a stopper pierceabie by hypodermic injection needle.
  • the acti ve agent in the composition may be die humanized a»ti ⁇ CD40 antibody Or its iragi3 ⁇ 4e i 5 or any other antibod o its fragment as described herein.
  • the label on or associated with the container indicates that the coraposition is used for treating the condition of choice.
  • the article of ianufaciiire may fdrihe comprise a second container comprising a phari»acet!tically-a ceptabie butler, such as phosphate-btrffered line, Ringer's solution, and dextrose solution, It may farther include other materials desirable from a commercial and user standpoint, including other buffers, diluents, filters, needles, syringes, and package inserts with jiistrirc iois for use,
  • kits containing an anti ⁇ D4 antibody or antigen-binding portion thereof Additional components of the kits may include one or more of the following: instructions for rise; other reagents, a therapeutic agent, or an agent useful .for coupling a antibody to label or therapeutic agent, or other materials for preparing the antibody for administration; pharrnaceutically acceptable carriers; and devices or other materials for administration: to a subject.
  • the kit may or may not contain the second therapeutic agent as described herein.
  • the agents can be mixed together, or packaged separately within the kit
  • the kit may or may not contain at least, one nucleic acid encoding anti ⁇ CD40 antibodies or ftagraent thereof and instructions for expression of the nucleic acids.
  • Other possible components of the kit include expression vectors and cells.
  • the present antibody or its -fragment can be used in a diagnostic kit Le a packaged combination of reagents in predetermined amounts with instructions for performing the diagnostic assay.
  • the kit may include substrates and cefaclors required by the enzyme such as a substrate precursor that provides the detectable chraftiophore or fluorophore.
  • substrates and cefaclors required by the enzyme such as a substrate precursor that provides the detectable chraftiophore or fluorophore.
  • other additives may be included such as stabilizers, buffers (for example a block buffer or lysis buffer), and the like.
  • the relative amounts of the various reagents may be varied widely to provi de for concentrations in solution of the reagents ' that 1 ⁇ 2bsia8iially : -0 ti»ji3Be-rte sensitivity of the assay,
  • the reagents ma fee provided as dry powders, usually lyop ' hiii'zed, including excipients that on dissolution will provide a reagent solution having the appropriate- eventration, Epito e mapping
  • Standard techniques include peptide scanning, in which overlapping, short peptides (for example, 10-30 amino acids, e.g.., 20, in length) derived from the full length protein to which the antibody binds are individually tested lor their abilit to. bind the antibody:. From such experiments* the region of the protein to which the antibod binds can the be determined.
  • Site-directed mutagenesis can also be used to identi fy the antigenic region(s) of a particular protein *
  • point mutations ' are .systematically introduced into die target polypeptide and the abilit of the antibody to bind the peptide with mutations at. various positions is used to determine whether a particular regi on of that protein contains the epi tope to which the antibody binds.
  • Antibody epitopes can also be identified usin high-throughput mutagenesis techniques, such as Shotgun Mutagenesis ⁇ Integral Molecular, Inc., Philadelphia, Pa.), which can be used to generate large .numbers of mutations within the target protein. Such methodologies permit efficient identification of epitopes within the protein.
  • m m yitrv competitive blockade assay may be performed, In am embodiment, the antibodies 2C10., 3AS aid €hi220, a chimeric IgGl CP40-specIfie antibody, were used in the assay . 2C1 Q was conjugated, to allopbycocyaniH (APC) using the Lightning Link antibody labeling kit (Novas Biologies, ' Littleton, CO).
  • Human PB Qs were incubated with escalating concentrations ⁇ of 2C1 , 3A8, or Chi220, and then, stained witb ihe APT-coiijugated 2C10 to assess tie abilit of eae antibody to cross-block 2C10.
  • Binding of APC-conjiigated 2C10 decreased with increasing concentrations of 2C10 but not; Chi220 or 3 AS as shown- in Figure 12, The result indicates that 2C 10 binds a unique epitope distinct from either Chi 220 or 3A8.
  • the invention also features fragments f CP40 that include the epitope that is specifically bound by the 2C30 antibody.
  • the 2C3 ⁇ antibody was raised against the extracellular portion of th CD40 polypeptide.
  • the 2C 10 antibody reacts with a portion of this sequence (SEQ ID MOs:S and 6),
  • the disclosure therefore features CD40 fragments (e.g., fewer than ISO, 120, 100, 80, 70, 60j 50, 40, 30, 0, i 15, 12, 11, ⁇ 0, % 8 S or 7) amin acida in. length, that are specifically bmrod by the 2CI0 antibody,
  • the fragment is 8-1 , 8-12, 8-15, 8-20, 8-30, 8- 40, 8-50, 8-60, 8-70, 8-80, or 8-100 amino acids in length.
  • the fragment is 7-10, 7-12, 7-35, 7-20, 7-30, 7-40, 7-50, 7-60, 7-70, 7-g0 5 or 7-100 in length.
  • the 2C10 antibody binds to a epi tope present within the sequence of amino acid 8-10, 8-12* 8- 15, 8-20, 8-30, 8-40, 8-50, 8-60, 8-70, 8-80, 8-100, 7-10, 7-12, 7-15, 7-20, 7-30, 7-40, 7-50, 7- 60, 7-70, 7-80, or 7- 100, of SEQ ID ' NO; 6.
  • the tnveatioh also features fusion protein that includes fragmen described herein and a heterologous sequence, lit certain embodiments, one of the fusion partners is the Fc protei (e.g., mouse Fc or hitman Fc). Th fusion amy also be a sequence iisefhl for antibody production, e.g., a maltose bindi g protein or GST, to other embodiments, the fas ion protein is.
  • Fc protei e.g., mouse Fc or hitman Fc
  • Th fusion amy also be a sequence iisefhl for antibody production, e.g., a maltose bindi g protein or GST, to other embodiments, the fas ion protein is.
  • a purification or detection tag for example, proteins that may be detected, directly or indirectly such as green fluorescent protein, hemagglutinin, or alkaline phosphatase), DNA binding domains (for example, GAL4 or Lex A), gene activation domain (for example, GAL4 or VP 16), purification tags, of secretiorrsignai peptides (e.g-., preproiyrypsin signal sequence).
  • the fusion partner may be a tag, such as c-myc, poly histidine, or FLAG.
  • Each fusion partner ma contain one or more domains, e.g. * a reproirypsm signal sequence and FLAG tag.
  • CD40 fragments and fusion proteins described herein may be produced by 5 transforma on of a sui table host ceil with a polynucleotide molecule encoding the pol ypeptide fragment or .fusion protein in a suitable expression v ehicle.
  • .s stems- include prokaryotic hosts (e.g.. E. coil) and eukaryoiic hosts (e,g, s 5. cerevisiae * insect ceils, e.g. s Sf21 cells, or maniroa!ian cells, e.g., NIB 311, HeLa, or preferably COS cells), Such prokaryotic hosts (e.g.. E. coil) and eukaryoiic hosts (e,g, s 5. cerevisiae * insect ceils, e.g. s Sf21 cells, or maniroa!ian cells, e.g., NIB 311, HeLa, or preferably COS cells), Such prokaryotic hosts (e.g.. E. coil) and eukaryoiic hosts (e,g, s 5. cerevisiae * insect ceils, e.g. s Sf21 cells, or maniroa!ian cells, e.g., NI
  • 1,5 vehicles may be chosen from those provided, e.g., in Vectors: Expresston Systems: Essentia! Techniques (ed. > Jones, Wiley &. Sons Ltd., 1998).
  • the recombinant C040 polypeptide frag erit or fusion protein can be isolated, e.g., using affinit chromatography .
  • an -antibody specific to GD40 e.g., an antibody or its fragment as described herein
  • Lysis and fractionation of fragment- or fusion protein-harboring cells prior to affinity chromatography may be performed, by standard methods (see,, e,g. ; Methods in Btizymology, volume 1.82, eds., Abe!son, Simon, and Deutsche*, Elsevier, 1990).
  • the CD 0 polypeptide fragment or fttsion protein can, if desired, be further purified, e.g., by high performance liquid chromatography (see e.g., Fisher,. L-ebamtory
  • CD40 polypeptide fragments or fusion proteins can also be prodace by chemical synthesis (e.g., by the methods described in Solid Phase Peptide Synthesis, 2nd e&, 1984, The
  • the present antibodies s antige « iifiding portions thereof, compositions and methods ca be used in all. vertebrates, .g., mammals and non-mammals, including human mice, rats, guinea pigs, hamsters, dogs, cats, cows, horses, goats, shee , pigs, monkeys,, apes, gorillas,
  • mice (strain A!) were immunized with a fusi on protein consisting of the extraeel&lar domain, of rhesus macaque ( mulaiia) CD40 (amino acid sequence;
  • CD t ⁇ MBF maltose binding protein
  • CD4Q ⁇ MBP was administered to mice multiple times with complete Freui f adjuvant and incomplete Freund's adjuvant Splenocytes from, imimniized mice were fused wit the mouse myeloma cell lin SP2/0 and hybrids selected using standard hyhrkioraa technology.
  • Antibodies were selected tor reacti vity to a second fusion protein consisting of the same rhesus CD40 domain fused to gluiamine synthetase (CD4 -GST), Antibodies reactive to CD40- GST by ELISA were fin her tested for reactivity to native CD40 expressed oft rhesus macaque blood & cells, human blood B cells and rhesus macaque B-iytnphoblastoid cell lines by flow cytometry.
  • antibodies were tested in an in vitro assay for their ability to inhibit human or rhesus rnacaque B cell activation:- alter co-eutture CD 154-expre8Si:ng Jitrkat D 1,1 cells.
  • a stable subclone of anti ⁇ CD40 antibody 2CI0 was obtained by limiting, dilution.
  • the antibody is a mous IgG l -kappa.
  • the immunoglobulin variable region genes were cloned from, the hybr osnas secreting asti ⁇ C 40 antibody clone 2C 10 and from antiAuman CD40 clone 3 AS (Rwekkeboom et ai, Immunology 79:439-44, 1993) (obtained from the American Type Culture Collection, ATCC, Vienna, VA) using 5 s rapid amplification of cDNA e is-poiy erase chain reaction.
  • immunoglobulin heavy and light chain variable regions were subc ned into expression vectors containing rhesus IgGl or rhesus IgG4 heavy chain and rhesus kappa light chain constant region se ue c s
  • Recombinant heavy and Sight chains were subclened into expression vectors and packaged m retroviral vectors used to transduce Chinese hamster ovary cells us n the GPE *** expression technology (Caialent . Pharma Solutions, Midcileion, Wt).
  • a poo! of transduced cells was grown in seruro-iree medium and secreted antibody was purified by protein A affinity chromatography.
  • the purified chimerit rhesus IgG 1 (2C10RI, 3A8RI) and lgG4 (2C1GR4) antibodies were diafMtered into phosphate buffer; endotoxin levels were confirmed to be less than I endotoxin nit/rng.. iO Aplibo d;y c har ctgri atioft
  • the anil ⁇ €D40 antibody 2C10 was characterized with respect to its ability to affect B cell activation both ris ng rhesus monkey and human peripheral blood mononuclear ceils (PBMGs).
  • CD20 expression was chosen as being an indicator of B cells, a d expression of €023, CD80, and CD86 is associated with B ceil activation, 2C1.0 was first assessed for its ability to bind to CD20, Rhesus or human PBMCs were incubated with fluorocbrome-coryiigated 2C10 and an. mii ⁇ CB20 antibody.
  • PBMCs from either rhesus monkey or humans were cultured eithe in the presence or absence of CD 154 * Jurkat DU ceils, an immortalized T lyiiiopliocyte cell Hue.
  • Activation of B cells was determined by measuring expression of three markers (CD23, CD80, and P86) in CD20+ cells present in the PBMCs.
  • the general scheme of ibis assay is shown in Figure 4. As shown; in Figure 4, e lturmg PBM Cs in die presence of Jurkat celts resul ted in increased expression of all three markers, indicating that B cells are activated by the CD 154' " Jurkat cells.
  • PBMCs and Jurkat cells were co-cul tured in the presence or absence of one of three antibodies: 3 AS, 5C8, and 200.
  • the 3 AS antibody is a mouse anti-human CD40 antibody (ATCC Deposit No. HB-12Q24), and SC8 is an anti-CDi 54 antibody (ATCC Deposit No. C L- 1.0915).
  • 3 AS antibody is a mouse anti-human CD40 antibody (ATCC Deposit No. HB-12Q24)
  • SC8 is an anti-CDi 54 antibody (ATCC Deposit No. C L- 1.0915).
  • Co-cultures were conducted over a range of five orders of raag tude of antibody eOBcentratioB (0.001 ,ug to 10 ⁇ ).
  • 3A8 did not block B cell activation in rhesus PBMCs, as measured by CD23 expression, whereas both 2C10 and 5C8 were able to block activation with, similar efficiency. Corres onding changes were also observed with CDSO and CDS6 expression. These results indicate that 2C10 binds to a different epitope o CD40 than 3 AS. These results also indicate that 2C10 acts primarily as a CD40 antagonist in contrast t& .3 A8 which has previously been shown to act as partial agonists with weak stimulator potential (Adams efaJ., J ImmMtmi. 174:542-50, :2005 f Badell er l,. Mm. J. ⁇ ⁇ .
  • 2C1.0 binds to a unique epitope o CD40, inhibits B cell acti vation similarly to an anti-CD 1.54 antibody, and lacks agonistic properties
  • 2C 10 i vivo.
  • Recombinant mouse-rhesus chimeric forms of 2C 10 were generated using either rhesus IgGI ' (2C10 1) or IgG4 (2CI 0R4) heavy chain and rhesus kappa light chain constant region sequences.
  • a chimeric rhesus IgG I form of 3A8 (3A8R1 w s also generated for use as a control.
  • T cell-dependent antibody response to KLH-MP were tested by ELIS A. Plates were coated with KLB (0.01. tng mi, Sigma, St. Louis, MO) and blocked with ' Super Block (Thermo - Scientific, Woodstock, GA), Pre- and post-ireatment plasma samples were serially diluted, plated for 1 hr, and washed with phosphate-buffered saline/0.05% 1 ween. Anti- LH antibodies were detected by incubating for ⁇ hr with monoclonal anti-rhesus fgG-horseradish peroxidase (clone I B3, NHF Reagent Resource, Boston ⁇ MA).
  • pancreas was isolated and placed o ice after the animals were terminally exsanguinated. Islet isolatio , was performed using Goliagenase/Neutnd protease (950 Wunsefc Units and 63 units, respectively; Serva, Heidelberg, Germany). The digested pancreas was purified on a four layer, discontinuous Euro&oll gradient ( fediatech, Manassas, VA) and Co e 29 1 blood cell processor (CaridiaflBCT. Lakewood, GO). Samples of the final islet preparation were counted and expressed as islet equivalents (iBQ) ⁇ isolated islets were cultured overnight., counted and suspended in Transplant Media (Mediatecb).
  • Blood glucose levels were measured twice daily by earstiek; NPB (Movoiin; Novo ordisk, PriBcetO , NJ) and glargirse (Laiitos Sanofi-Aventis, Bridgewaier, NJ) insulin, were .administered to maintain fasting blood glucose (PEG) less than 300 t»g/dL pre-iransplaat and 5 following graft rejection.
  • iVGTT was performed periodically post-transplant to monitor graf function.
  • Transplant .recipients underwent weekly ft w ' cytometric analysis to monitor T cell (CD3 V450, CD4 PerCP-CyS.S, CDS PerCp: BD Bioscience) and B cell (CD20 PE, BD
  • 2C10R4 50 mg fcg was administered intravenously on post-operative day (POD) 0 and 7.
  • Bas iiximab 0.3 nig/kg was administered itt iavenonsly on POD 0 and 3.
  • SiroUmus was administered intramuscularly dally to achieve trough levels of 5-15 ng rnl through POD 120. Ail three animals receiving
  • mice receiving 2C10-R4 is 280 days compared to 8 days for control animals (p-O. l 0 ⁇ Table 3).
  • Pharmacokinetic data predict tha plasma 2G10R4 levels would be les than 1 gg/ml by POD 100.
  • sirolimus was discontinued at POD 120, the recipient with the longest survival (304 days) received no imniunosuppression for approximately 24 weeks prior to rejection. No 5 animals treated with 2C 10R4 developed clinically relevant infectious complications or weight loss.
  • Blockade of the CD40/CDI54 pathway may prove 3 ⁇ 4se. i « conjiaictlon with other costimolation blockade agents * Belaiacept. a high affinit version of €TLA4-ig designed to block the CD28/B7 cosdniuiatory pathways . , as shown efficacy in non amats primate models of renal and islet transplantation and I phase II and III clinical trials in renal transplantation
  • thai (liiiBi nized 2C10 antibody) thai was selected as a full functional antagonist of CD40.
  • the binding, epitopes were carefully designed to confer unique binding properties thai distinguish it from competitor molecules that either acti vate or deplete B ceils or acts as partial agonists.
  • the early m use primate chimeric version of the antibody has been invest! gated in relevant pre raieal in xifw and in vhv studies, including multi l studies in nonfuunan primates that demonstrate promising efficacy against preventing transplant rejectio and prolonging both alio- and xenograft survival, and a favorable nonclinical safety profile.
  • variable region sequences of the murine antibody 2C30 were used to search the human antibody database.
  • the V was found to be mostly related to gerarlke antibody sequences VH1-46, VHi-69, and VHl-3 (SEQ ID HO:
  • the human YH 1-3 and VK3-11 were chosen to be the acceptor framework tor CDR. grafting because of relative high usage m human, repertoire and good conservation at the critical framework positions. 3 D models were built with both variable regions after grafting the CDRs from the murine 2C 10 antibody into the human acceptor frameworks. Six murine YH framework. residues that are different from the human counterparts were identified to be potentially in contact of the CDRs; M4S, A67, L ⁇ 69. A71 , K.73, and N76. After modelling, three humanized VH sequences 2CJ0JJI, 2C10 Ji2 s and 2CT0 jh3 were designed to contain 0, 2, arid 6.
  • the parental murine 2C10 antibody was humanized by CDR grafting.
  • the human antibod VHl-3 and V 3-1 1 germUne frameworks were chosen to be the acceptor.
  • Three VH and two VL sequences were -designed ant! all 6 humanized antibodies were produced and tested for human CD40 binding.
  • the 2C10-fi3 ⁇ 4avy-3 (2C10 h3) and 2C10-light-2 CI O 12) constructs- were found to produce the best antibody with CD40 binding affinity of 0.39 n , within 2-fold of thai of the .marine 2C10 (0,22 iiM) (Table 2),
  • the humanized variable regions were used to construct the clinical candidate human zed antibod as an IgG4 or a stabilized IgG , which was cloned into the SwiMR expression system.
  • High producing stable CHO cell lines were isolated by FAGS and screened by three rounds of ELI ⁇ A and one round of fed-batch . culture. Seven clones were isolated thai produced more than 0.8 g L of Ituinauked . 2CI0 in a fed ⁇ bateh culture. The best clone 3C9-M produced. ⁇ L2 g/L under n n-opi ui ⁇ ed conditions.
  • the humanized VI sequences were gene synthesized and cloned into vector pFOSE- Cffig-hG2a (invtvogen) containing the constant region of .human IgG2 heavy chai to make expression vector LB30O-302.
  • the humanized VK sequences were gene synthesized and cloned Into an. expression vector containing the constant regi on of human kappa light chain to make expression vector LB3O3 ⁇ 304.
  • the heavy and light chains were downstream of human E ta promoter for strong and constitutive mammalian cell expression.
  • the chimeric 2C 1.0 antibody was also constructed similarly by using murine VH aid VL to make expression vector L8305 and 1 0 , respectively.
  • the antibody expression vectors were summarise , in Table 4.
  • Each vector in Table 4 contains a heavy chain or light chain expression cassette under the control of hirm&ii BF I a. promoter.
  • Vectors LB300 ⁇ 302 ! LB 305 contain. the constant region of human lgG2 heavy chain.
  • Vectors LB308-3 9 contain the constant region of human IgG4 heavy chain.
  • Vectors 13303-304, LB306 contain the constant region of human Kappa light chain.
  • the huxnanized antibody with the best binding activity (l l ' OJiS and 2C10J2) was concerted into: human lgG or stabilized homan IgG4 (S 1 ),
  • the heavy chain variable region 2C 10 3 ⁇ 43 was first cloned into vector pFUSB-CHlg-3 ⁇ 4G4 (Envivogen) containing the constant region of human %G4 heav chain, before the stabilizing mutation S241.P was introduced (Table 4),
  • the humanized IgG4 and igG4(S24iP) were purified from 293F cells after transient itansfection.
  • the production yield was 25-35 mg L, 2-fold higher than that of the jgG2 antibodies.
  • the IgG4 antibody appeared to have small amount of half moleenle* which was significantly reduced in the stabilized IgG antibody.
  • the DNA and amino acid sequence of the stabilized lgG4 antibody is sho n: in Figure 2L
  • SwiM expression w s developed for facile development of antibody production cell lines, utilizing a switchabie nierabrane reporter to facilitate isolation of highly productive cells via Fluorescence- ctivated cell sorting (FACS).
  • FACS Fluorescence- ctivated cell sorting
  • An OtES-nmhated bicistronic expression cassette of membrane-anchored GFF was placed downstream of the gene of interest (G OI) , The IRES-OFP cassette was flanked by LoxP sites fo later removal from the chromosome. " The GFP expression level was used to mark the expression level of the GO! .
  • Highly productive cells were isolated by FACS and then treated with. Cre tecombiiiase to reraoye the GFP cassette.
  • the humanized 2C10 in the stabilised J.gG4 format was closed the S-wi R expression system to make vector LB31 .
  • the heavy and light chains were cloned in two separate expression cassettes under control of human EFl promoters.
  • the IRES-GFP cassette was placed downstream of the heavy chain sequence and was flanked by two Lox sites.
  • the plasm! d carries a Poromycin resistant gene for mammalian cell selection aed a p ⁇ Iactama$e gen for bacterial propagation.
  • Hnn anized antibodies were- also generated using, two CDR grafted VH and: -two CDR grafted VL sequences cloned into a ViTl. ⁇ £i9 and a VLl-39 hrrmM!. getmlifte fr rnework..
  • an anti-CD40 antibody may include any of the following 2C10H-K combinations;
  • dy were par fied after transient transfection of 100 or 200 ml of 293F cells.
  • the antibodies were purified with a Protein A column from the conditioned media harvested 4 days after fransfection.
  • CD40 binding -kinetics was detennlned on Forte Bio (contracted to Afagen Bioscience). The purified CD40 was biotinylate and im obilized on Streptavidin biosensors.
  • the antibod was purified b Protein A column, and followed by buffer exchange (2 mM Sodhiin Citrate, 50 mM NaCI, 5% Maltose, pH 6.0) and 0.2 ⁇ filtration.
  • the Pool #1 was used to setup 25L wave bag culture in CD FortiCHQ media (Invitrogen). The culture was fed three times on day 3, 5 3 ⁇ 4 and 7 with 10% CD Efficient Feed C ⁇ invitrogen).
  • the final yield of purified antibody was 1.6 g in total The antibody as characterized by SDS-PAGE and SBC-HPLC analysis, and was 99,4 ⁇ % pure as monomelic antibody. Cell line .development
  • the single cell colonies were screened by 3 rounds of ELISA and 1 round of i3 ⁇ 4ti ⁇ a eti productka*.
  • the cells were kept in CD ForiiCHO media throughout the- screening process. All colonies from 384- we it plates were picked into 96-weil plates. 1.2 ⁇ of culture media from each well were used to screen for antibody in ELISA plates coated with anii-huniari Fc antibody.
  • the top 240 clones were expanded into 10 24- well plates. After cultaring for 5 days, 1.2 ⁇
  • the 6-well plates were duplicated by passaging the ceils t;I0 into a new set of 6 ⁇ well plates.
  • the cultures i the original set of the 6-well plates were allowed to gro to extinction, followed by detennination of antibody level by ELISA.
  • the top 24 clones in the duplicated set of 6-wel.l plates were expanded into 30 ml cnlture i 125 ml shake flasks. The clones were subjecte t 30 ml fed-batch production.
  • the feeding strategy w s 7.5% of Ex-Cell Advanced CHO Feed I (Sigma) on day 3 , 5, 7, , and 1 L
  • the top clon 3C9-I6 exhibited production titer of - 1.2 g/L.
  • High affinity antagonist of CD40 e.g., Ka ' is about i *i -or lower, about t0 0 M, to about 10 " Al, or as described herein
  • Ka ' is about i *i -or lower, about t0 0 M, to about 10 " Al, or as described herein
  • the 2 I0 rnAb was humanized by CUR grafting into a human heavy and light chain -frameworks.
  • the huni mzed 2Cf 0 constructs e e screened fey Biacore for Adjusti y to lunmn CD4CL
  • All three top Iiuraa zed 2C10 antibodies exhibited only slight reduction in affinity by approximately wo-fold, relative to the parent 2C10 mAb (Table 5). Most importantly they all maintained, the exceptional slow off rate of the parent 2C10 mAb.
  • Clone 2. ⁇ 89.2 which exhibited the ⁇ ⁇ ' highest affinity at 390p was selected as the lead harnanized mAb (h2Cl 0).
  • CD40 antibody As goals in the development of an antagonist CD40 antibody include ed .&*»im3 ⁇ 4ifig. the depletion of targeted, CD4tH- cells, we analyze effects on iym iiocyte s ibpopuiaiions, especially the effect on B cells.
  • lymphocyte subsets ( Figure I S), These restdts demonstrate that injection with a dose as low as 10 mg/kg 2C 10 can persistently bind CD40, its therapeutic target on 8 ceils (and presumably monocytes and other antigen presenting cells) without causin midesired depletion of B cells in monkeys.
  • CD40 target engagement and occupancy by the primate chimeric and humanized versions of 2C i ' O was determined by measuring ifae available binding sites fo.r 2C10 to CD40 on CD21K
  • B cells by flow cytometry using f oreseen Jy labeled 2C10 and a labeled., non-competing anti- CB40 antibody. Blood samples were collected on multiple days from control monkeys aad monkeys treated wit either primate ehimerie lgG4 or humanized 2C10 and analysed by FACS.
  • the degree of target engagement was calculated directly from the mean fluorescent intensity recordings.
  • Humanized 2C10 antibodies were administered intravenousl at single doses of 10 and 25 mg kg. Surface CD40 on B cells was completely saturated by Day 3, and the effect persisted. until die last day measured (Day 28 ⁇ in all monkeys that received either dose of 3 ⁇ 42C10 i

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Immunology (AREA)
  • General Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Epidemiology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biophysics (AREA)
  • Molecular Biology (AREA)
  • Biochemistry (AREA)
  • Genetics & Genomics (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Endocrinology (AREA)
  • Transplantation (AREA)
  • Biomedical Technology (AREA)
  • Oncology (AREA)
  • Pain & Pain Management (AREA)
  • Rheumatology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Medicinal Preparation (AREA)

Abstract

The present disclosure relates to anti-CD40 antibodies, such as humanized anti-CD-40 antibodies, that may be used in various therapeutic, prophylactic and diagnostic methods. The antibodies generally block the ability of CD40 to bind CD154 and do so without activating the cell expressing CD40 (e.g., a B cell). The present antibodies or fragments thereof may be used to reduce complications associated with organ or tissue transplantation.

Description

HUM ANIZED ANTI-CP40 ANTIBODIES AND USES THEREOF
Cross Reference to- Related Applteiion
This application claims priority to U.S. .Provisional Application. No, 62 214 411 filed, n
September 4, 2(315, the disclosure of which is incorporated herein by refer enee in its entiret *
Sequence Listing
This application contains a Sequence Listing which has been ftied electronically in ASCII format arid is hereby incorporated fey re&reoe m Us entirety . Said A SC II copy, create on September \ , 20 , is named M2I ~0§521 l-WO0J3L«i aiid is 33,948 b tes n size.
Field
The invention relates to humani ed anti-CD4 antibodies and uses of such antibodi es, for example, to reduce the likelihood of, 'or treat, tra s l nt rejection* to induce inutwnosappression,, or to treat an atrtoimmune disorder.
Backgroun of the Invention
Suppression of the immune system, particularly the humoral immune system, is beneficial in organ transplantation and treatment of autoimmune disorders. Organ
transplantation has emerged as a preferred method of treatment for man forms of life- threatening diseases that involve organ damage. However, transplantation rejection may occur when an organism receiving transplanted cells or tissue mounts an undesired immune response to that tissue.- Transplant rejection may be minimized by tissue-type matching, but even matched tissue ca be rejected by the donor. Thus, immunosuppressive therapies are now used for virtuall all cases of tissue transplantation.
improved resnits in clinical, 'transplantation have been achieved primarily through the development of increasingly potent non-specific immuaosuppxessrve drugs to inhibit rejection responses. While short-term results have improved, Jong-term outcome remain inadequate-. Life-long imniimosuppressive agents may be required to combat chronic re jection of the traBSp!anied: orgaR, and the use of these agents dramatically Increases the risks of cardiovascular disease, infections, and malignancies.
One potential target for reducing transplantation rejection is the CD40/CDi 54 mteraction. CD40 is expressed primarily on ie surface of B lymphocytes and other antigen- presenting cells (APCs) such as dendritic cells and macrophages. CD 154 is expressed primarily on the surface of T ceils. The interaction between these two proteins is associated with B cell activat ion, whic h triggers cytokine expression as we ll as expression of cell surface markers including CD23, CP8G, and CD86. Keky M> R.s CD40~mediated signaling m B ceils.
Balancing cel l survival, growth, and death, J. inrmonoL 1996; 156: 234S»2348... Blockade of this interaction using anti-CD 154 antibodies has been shown to reduce or eliminate rejection of transplanted tissues in. non-human primates.
For any type of ninr nosuppxessitwi (e.g+! in transpiairt tion procedure), a balance between efficacy and toxicity is a key factor for its clinical acceptance. Thus, there is a need for therapies that specificall target the tnrmonologicat pathways involved in, for example, transplant rejection and autoimmune -disorders-.
Summary
The present disclosure provides for a tiimianized anti~CD40 antibody, or an antigen- binding .portion thereof, comprising a Iieavy chain variable region, wherein the heavy chain 5 variable region com rises three CDRs, CDR f , CDR2 and C.0R3, having amino acid sequences about 80% to about 100% identical to the mino acid sequences set .forth m SEQ ID NQs: 13, 1 and 5, respectively.
The present disclosure also provides for a humanized anti-CD4d antibody, or an antigen- binding portion thereof, comprising a light chain variable region, wherein the light chain variable 10 region comprises three CDRs. CDRl, CDR2 and CDR3, having ammo acid sequences about 80% to about 100% identical to the amino acid -se ue ces' se forth in SEQ ID Os: 16, 17 and 18, respectively.
Also encompassed by the present disclosure is a humanized auti~CD4 antibody, or an antigen-binding portion' thereof, comprising a heavy chain variable regio and a light chai
1,5 variable region, wherein the heavy chain variable region comprises three compleinentar Sty
determining regions (CDRs), CDRl, CDR2 and CDR3, having amino acid sequences about 80% to about 100% identical to- the .amino .acid seqaences.set forth in SEQ ID HQs: B, 14 and 15, respectively, and wherei the light chain variable region comprises three CDRs,. GD l , CD 2 and CB.R3* having amino acid sequences about 80% to about 1 0% identical to the amino acid
-20 sequences set forth in SEQ ID MOs: 16, 17 and respectively.
The present disclosure provides for a hnnianized anti~CD40 antibody , or an antigen- binding portion thereof, comprising a heavy chain variable regio and a light chain variable region, wherein the heavy chain variable region comprises an amino acid sequence about 80% to about. 100% identical to any one of the amino aci d, sequences set forth in SEQ ID NQs: 1 1.s 1 ,
25 20, 21, 24, 5 and 26.
The present disclosure provide for a humanized ant^CD40 antibody , or an antigen- binding portion thereof, comprising a heavy chain variable region and a light chain variable region, wherein the light chain variable region comprises an amino acid sequence about 80% to about 100% identical to any one of the- amino acid sequences set forth in SEQ ID NQs: 12, 22 ,
30 23, 27, 2-8 and 29, 1¾e present disclosure provides for a humanized anti-GD4d antibody, or an ntigen- binding portion thereof, comprising a heavy chain variable region and a light chain variable region, -wherein the heavy chain variable region comprises an ammo acid sequence about 80% to about 100% identica to any one of the amino acid sequences set forth in SEQ ID 'NOs: 11 , 19, 20» 21 , 24, 25 and 26, and wherein the light chain variable region comprises an amino acid sequence about 80% to abo ut 100% iden tical to any one of the amino acid .sequences set forth in. SEQ ID NOs: 12, 22, 23, 27, 28 and 29.
The present disclosure prov ides for a humanized anti~CD40 antibody , or an aniigeii- binding portion thereof, convprisiag a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises an amino acid sequence about 80% to about 100% identical to any one of the amino acid sequences set forth in SEQ ID NOs: 19, 28 and 21 , and wherein the light chain variable region, comprises an amino acid sequence about 80% to about .100% identical to either of the amino acid sequences set forth in SEQ ID 'NOs; 22 and 23.
The present disclosure provides fo a umanize anii-CD40 ant-body* or an antigen- binding portion thereof, comprising a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region, comprises an amino acid sequence about 80% to about 100% identical to any one of the amino acid sequences set forth in: SEQ ID Os: 24, 25 and 26, and wherein the light chain variable region comprises an amino acid sequence about 80% to about 1 0% identical to any one of the amino acid sequences set forth in SEQ ID NOs: 27, 28 and 29.
The present disclosure provides for a humanized anti-CD40 antibody, o an antigen- binding portion thereof, comprising a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises an amino acid sequence about 80% to about 100% identical to the amino acid sequences set forth in SEQ ID NO: 21 , and wherein the light chain variable region comprises an amino acid sequence about t0% to about 100 identicai to the amino acid sequences set forth in SEQ ID NO: 23.
The dissociation c nstant .(¾>) of the antibody, or aniigen-tnnding portion thereof, may be less than about 1 x 10*9 M, or less than about 1 x. 10"s M. The present airt o .'or.ii8 ett-;!j¾!slliif portion thereof .may be: (a) a whole
immunoglobulin molecule; (b) an scFv; (e) a Fab fragment; (d) an F( b')2; and/or (e) a disulfide linked v.
The present antibody or antigen-binding portion thereof may compose at least one constant domain selected from: a) an IgG constant domain; and {¾) an IgA constant domain.
The present antibody or antigen-binding portion thereof rnay comprise at least one human constant domain.
The present antibody o antigen-binding portio thereof ma bind to CD 0 extracellular domain.
The CD 0 may be human or rh.esns CD40.
The present antibody or a tigeti-binding portion thereof may ock B lymphocyte activation by CD! 54-expres$ing Jurkst cells in viim.
The present antibody or antigen-binding portio thereof may Inhibit B lymphocyte CD23, COW, or CD86 expression.
Also encompassed by the present disclosure i s a compositio comprising the present antibody or anti geii-bindhig portio thereof, and at least one .pharmaceutically acceptable carrier.
The present disclosure provides for a poIyTOicIeotide encoding the present antibody o antigen-binding portion thereof The present disclosure provides for a vector comprising the present polynucleotide, and a cell comprising the vector.
The present disclosure provides for an isolated polypeptide comprising the present antibody or antigen-binding portio thereof
Al so enco mpassed b t he present disclosure is a -method, of producing the present antibody or antigen-binding portio thereof The method may comprise- the follo ing steps: (a) cnlturiug the present cells in cuiture medium under conditions wherein the polynucleotide encoding th present antibody or antigen-binding portio thereof is expressed, thereby producing at least one polypeptide comprising the antibody o antigen-binding portion thereof; and .(b) recoverin the polypeptide from the cells or culture medium. The present disclosure also, provides for a method of suppressin the i une system in. a subject* comprising the step of administering to the subject n effective amount of the present antibody or antigen-binding portion thereof.
The present disclosure provides for a method of treating or treating prophyiacticaHy transplant rejection, or increasing the deration of time before transplant rejectio occurs, i a Subject in need thereof, the Method comprising the step of administering to the subject an effective amount of the present antibody or antigen-binding portion thereof.
The present disclosure provides for a meth d of treating or treating prophyl acttcaliy graft-versus-host disease in subject in seed thereof, the method' -comprising the step of adroinisterirjg to the subject an effective amount of the present antibody or antigen-binding portion thereof.
The present disclosure provides for a method of tre ting or treating prophyi aeiiealiy an autoinuiiiuie disorder In a subject in need thereof, the method comprising the step of
administering to the subject a effective amount of the present antibody or antigen-binding portion thereof
The subject may have received, or is in need of, an organ transplantation, and/or a tissue transplantation,. The organ ma be a heart kid eys, lung, live ;, pancreas^ intestine, and thymus, or a port on thereof The tissue ma be: bone, tendon, cornea, skin, heart valve, vein, or bone marrow,
The subject may be human or a mamma .
Theadministration' may be commenced prior to the transplan ation* The administration may continue for at least one month following the transplantation. The administration, may continue for at least six mouths following the transplantation- of the graft.
The autoimmune disorder may be as socia ted with or caused b the presence of an autoantibody-
The autoimmune disorder may b systemic lupus erymeniatosus (SLE), CREST syndrome (calcinosis, Raynaud's syndrome, esophageal dysmotility, selerodaciyl and telangiectasia), opsoclonus, mfiaiiunaioiy myopathy (e.g., polymyositis, deniiatomyositis, and inclusion-body myositis), systemic scleroderma, primary biliary cirrhosis, celiac disease (e.g., gluten sensitive enteropathy), dermatitis herpetiformis, 'Miller-Fisher Syndrome, acute motor axottal neuropathy (AMAH), multifocal motor neuropathy with, conduction block., aatoiaiisiatte hepatitis, antiphospholipid syndrome, Wegener's granulomatosis, microscopic polyangiitts, €¾m-g-Strauss syndrome, rheumatoid arthritis, chronic autoimmune hepatitis, sc!erorayosids, myasthenia gravis, Lambert - Eaton myasthenic syndrome, Hashimoto' s thyroiditis,. Graves* disease. Paraneoplastic cerebellar degeneration, Stiff person syndrome, limbic encephalitis,
Isaacs Syndrome, Sydenham's chorea, pediatric aittoimimioe neuropsyc airiC disease associated, with Streptococcus (PANDAS), encephalitis, diabetes mellitus type i, and or Neuromyelitis optica.
The autoimmune disorder may be pernicious aaernia, Addison's disease, psoriasis, inflammatory bowel disease, psoriatic arthritis, Sjogren's syndrome, lupus erythematosus (e.g., discoid lupus erythematosus, dmg-induced lupus erythematosus, and neonatal lupus
erythematosus)* multiple sclerosis, -and/or reactive arthritis.
The autoimmune disorder ma be polymyositis, dermatanryositis, multiple, endocrine failure, Schmidt's syndrome, autoimmune uveitis, adrenalids, thyroiditis, autoiBimune thyroid disease, gastric atrophy, chronic hepatitis, lupoid hepatitis, atherosclerosis, resenile dementia,, de.niyelmatuig diseases, subacute cutaneous lupus erythematosus, hypoparathyroidism.
Dressier' s syndrome* autoi imuie ftxombocytopenia, idiopathic thrombocytopenic u ura^, hemolytic anemia, pemphigus vulgaris, pemphigus, alopecia areata, pemphigoid, scleroderma, progressive systemic sclerosis, adult onset diabetes eOstus (e.g., type II diabetes), male and female autoimmune infertility, ankylosing spondo!ytis, ulcerative colitis, Crohn's disease, mixed connective tissue disease, polyarteritis nedosa, systemic necrotizing vascnlitis Juvenile onset rheumatoid arthritis, glomerutonephr tis;! atopic d rmatitis, atopic rhinitis, Goodpasture' s syndrome, Chagas* disease, sarcoidosis, rheumatic fever, asthma, recurrent abortion, anti- phospholipid syndrome, farmer's lung, erythema multiforme, post cardiotomy syndrome, Cushhig's syndrome, autoimmune chronic active hepatitis, bird-fancier's lung, allergic disease, allergie encephalomyelitis, toxic epidermal necrolysis, alopecia, Alport's syndrome, alveolitis, allergic alveolitis, .fibrosing alveolitis, interstitial lung disease, erythema nodosum, pyoderma .gangrenosum, tt¾nsfusion reaction, leprosy, malaria, leishmaniasis, trypanosomiasis, Takayasu's arteritis, polymyalgia rheuniatica, temporal arteritis, schistosomiasis, giant cell arteritis, ascaria-sis, aspergiilosis, Sanipter's syndrome, eczema, lymphomatoid granulomatosis, Behcet's disease, Caplasi's syndrooiej Kawasaki's disease, dengue*- endocarditis, .endomyocardial. 'S rdsis, endopkhahiiitis, eryihenta elevatum et diuthrctrn, erythroblastosis fetalis, eosinophilic faeiibs, Shtslrnan's syndrome, Felly's syndrome, filariasis, eyelids, chronic - cycliiis, heierochronic cycliiis, Ftich's cycliiis, IgA nephropathy, Henoch-Sc onleta purpura, : raft versus host disease:, transplantation rejection, human immiuiodeficienc virus infection, echovirus infection, cardiomyopathy, Ala&eirneir's disease, parvovirus- infection, rubella virus infection, post vaccination syndromes, congenital rubella infection, Hodgkin's and non-Hodgkin's lymphoma, renal cell carcinoma, multiple myeloma, Eaton-Lambert, syndrome, relapsing polychondritis, malignant melanoma, cryogiobiilirjeniia, aldenstrom's macrog!qb lemia, 'Epstein-Batr virus infection-, nnuttps, Evan's syndrome, and/or autoimmune gonadal failure*
The administration may 'be parenteral, intravenous, subcutaneous, intramuscular, transdermal, oral, topical, intrathecal* or local.
The present method may fnriher comprise administration of a -immunosuppressant within six months of the administration' of the present antibody or antigen-binding portion thereof
The immunosuppressant may be a calcineurin inhibitor, tacrolimus, an niTor inhibitor, flngoi od, ittyriocin alemtu im h, ritairnab, an a«li-CD4 monoclonal antibody* an anti-LFAI monoclonal antibody, an anti~LFA3 .monoclonal antibody, an anii-CD4S antibody, an anti-GDI 9 antibody, rnonabataeept, belatacept, indolyl-ASC; azailuoprine, lymphocyte immune globulin and -anti-thymocyte globulin [equine], mycophenolaie oretil, mycophenolate sodium, dacHzomab, basilkunab, cyclophosphamide, prednisone, prednisolone, leflunomide, FK77S, FK779, IS-deoxyspergimiin, busulfau, fludara'bine, methotrexate, 6-mercaptopurine, IS- deoxyspergualin, LF'l.5-0195, bredinin, brequinar, and/or muromonab--CD3. The calcineurin inhibitor may be cyclosporin A or cyclosporlne G» The raTor inhibitor may be sirohmus, temsirolsmBS, zotarohmus, or everolimus. The anti-C045 antibod may be an ariti«C045RB antibody. In one embodiment, the immuRosuppre¾sant is belatacept
The present antibody or -antigen- binding portion thereof and the immunosuppressant may be administered within one month, or within one week, of each other. Brief Description of the Dr wings
figure I shows the variable regions from the heavy chain and the light chain of the 2CT0 antibody . The nucleotide sequence shown for the heavy chain (SEQ ID ΜΌ;Ι) includ s- a signal peptide (nucleotides 1-57; underlined) and the heavy chain variable sequence (nucleotides 58- 396), Th corresponding amino acid sequence is shown below (SEQ ID MO:2), where amino acids 1-19 co espondin to the signal sequence (underlined) and amino acids 20- 132 correspond to the heavy chain variable region.
The nucleotide sequence shown for the light chai (SEQ ID NQ;3) includes a signal peptide (nucleotides 1*66- underlined) and the light chain variable sequence (nucleotides 07-3S4). The corresponding amino acid sequence is shown below (SEQ ID NO:4), where amino acids 1-22 correspond to the signal peptide (underlined) id amino acids 23-128 correspond to the light chain variable region.
Figure 2a is a plot showing flow cytometry data confirming the binding of 2C10 to human and rhesus CD20+ B ceils.
f igure 2-b is a plot showing CD40 adsorption data from ELISA assays with varying
concentrations of 2-CtO to confirin the binding of 2C10 to hmnan and rhesus CD40 as detected rising goat anti-mouse IgCS-BRP. figure 3 is a graph showing the dose-dependent inhibition of GDI 54 binding to human B cells by 2C1 , B cells ere analyzed tor CD 154 binding by incubating with hisiidine-tagged soluble CD 154 and analyzing for histidlne expression. Results, are representative of multiple repetitions of the experiment. f igure 4 is a schematic diagram and graphs showing the principle of the assay involving rhesus or human peripheral biood mononuclear cells (PBMCs) and Jurkat cells.
Figure 5 is a set of graphs showing CD23 expression in CD20" ce ls taken from co-culture of rhesus PBMCs and Jurkat cells i the presence of variable concentrations of 3A8, 5C8, or 2C10 antibodies. Figure 6 is a set of graph s showing CDS expression, in CD20 ! cells taken om eo-euitures of human PBMCs d Jurkat ceils in the presence of variable ' concentrat ons of 3 8? SCS, or 2C10 antibodies.
Figure 7 is a set of graphs showing CD23 expression CD20' cells from either bamae or rhesus PBMCs cultured without jurkat cells in (he presence of either the 3 AS or the 2C10 antibody.
Higwre 8 is a graph snowing peripheral B eel! c¾a t ¾h^tt3-.niae < es--tJ¾«tedw:i^ mouse- rhesus chirneric forats of 2C10 engineered to contain either rhesus IgGl (2C1.0 1) or IgG4
(2C 1.0R4) heavy chain, constant regions, and chimeric IgG I fo ms of anti-CD 0 3 A8 (3A8R I) or anti~C04O CM220 (Chl220),
Figure 9 is a graph showing T celMepeadent -antibody responses in macaqiie moakeys treated with 2C 1 OR 1, 2C 10R4, or 3ASR1 antibody. All animals were immuni ed with 4-hydroxy-3~ nitrophenylacefyl-conjtigated keyhole limpet hemocyaam (KIM) after (he first antibody
treatment
Figiire 10 is & diagram showing the standard macaque mode! of allogeneic islet transplantation. Diabetes was induced in macaque monkeys using streptozotocin. Diabetic monkeys were transplanted with allogeneic islets and ininiunos ppression initiated with basilixirnab and siroSnmns. Ex erimental animals received 2C10R4 reat nt on days 0 and 7 post- transplaatation, igure 1 is is a plot showin free blood glucose levels (FBG) in macaques following slei transplantation, background immunosuppression, and treatment with 2€iOR4. The solid line on the plot represents the level of 2C10 in the plasma.
Figure lib is a plot sh win FBG in macaques thai received only background
inwn anosuppress ίοη , l ttre 12 is agrjph showin results froth a compefitiye lockade assay usiti fiiiftmn PSMCs incubated with increasing concentrations of 2C10, 3 AS, or Chi220 antibodies and staked with m APC-conjiigated 2CI0 to assess the ability of each antibody to cross-block 2C10, Figures Ϊ3» aiui 13b show sequence alignment, of humanized' 2C10 variable regions. Figure 13a: Marine 2C10 VH sequence was aligned against u a germiin VH1~ and three humanized sequences 2C10Jii, 2C10Ji2, and 2CI0Ji3. Figure 13b: Murine 2C10 VL sequence was aligned against tom n germiine VH3~11 and two humanized, sequences 2C.10 11 and 2CI.0J2. The 2C1Q CD¾s are holded. The murine residues in humanized sequences are underlined,
Figure 14 shows amino acid changes in framework 3 betwee 2CJOH0P aad'.2C10HBls as well as 2C3.0HB2 constructs,. Figure 15 sho ws the sequences of heavy chain and light chain variable egies for h manized 2Ci0 antibodies. The heavy chain and light chain variable regions include 2CI0MT, 2€ IQHBi , 2C10HB2, aC!OBCF, 2CI0KBT and 2C10KB2.
Figure 16 shows binding affinity of humanized 2C10 antibody to CO40 from different prirnate species. Humanized 2C10 antibodies (h2Cl0) were immobilized to the surface of CMS chi by amine -coupling.. Dii!eretrt concentrations of CD40-MBP fusions of human, rhesus, and baboon were analyzed for affinity on a BiACore 3000. The binding affinity was calculated with
BlAeva! nation software version 4, 1.1. Figure 1? shows that induction of anti- LH antibody response (IgM and IgG) was determined in monkeys tomonized with KIM 3 hrs after recei ving either saline, 10 or 25 ffig kg h2C10, All control animals exhibited IgG or IgM antibody responses to the KLE antigen. Individual Monkeys reated with 10 nig/kg, but no animals treated with 25 mg/kg 2C1.0 developed either an IgG or Ig ' antibody respon ses to LH. lgttre IS. Whole blood was used tot phenotyping B and T lymphocyte subsets after treatment with 25 ing kg ¾2C 10 (Top row) or 10 nig kg h2ClO (Middle row), or control animals (Bottom Row). Neither dose of h2G10 had any apparent effect on the lymphocyte populations.
The absence of appreciable B cell depleti on was also evident in the earlier, dose-response 5 evaluation of the primate chimeric form that included, a detailed analysis of mature and immature B eel! po ulations',.
Figure .1.9. Day 28 Humanized ,200 fully saturated CD40 hindlng sites oh B cells, K2CI0 administered in, vivo completely blocked the binding of fl«oresce«lly labeled 2C I 0 binding to B ! 0 ceils* Data illustrate results ftora humanized 2C I Q~ treated and control monkeys 28 days after a single dose of 25 cng kg (top row), 10 mg/'kg (middle row) or 0 mg/kg (control; bottom row). Similar results were obtained on Pays 3, 7, 14, and 21 post infusion.
Figtire 20, Mean sertim concentrations of h2C 1Q for up to 28 days after treatmen of monkeys 15 with -either 1.0 or 25 mg/kg. Concentrations of 2C10 slowly decline over time, arid levels are detected over the entire duration of the study.
Figures 2ia and 21 b sho the IMA and amino acid sequences of the humanized 2010 h2C 10) in the stabilized lgG4 .format figure 21a shows the DMA and amino acid sequences of the •20 heavy chain. Figure 2.1b shows the DNA and amino acid sequences of the light chain, SEQ ID NO; 32: DNA sequence of the heavy chain; SBQ ID NO; 33: amino acid sequence of the heavy chain; $EQ ID NO: 34; DMA sequence of the light chain; SEQ ID NO; 35: amino acid sequence of the light chain.
Detailed Bescri tloii
The present disclosure relates to anti-CD40 antibodies and antibody fragments (e.g., antigen-binding poi iofts of the antibody) that may be used in various therapeutic, prophylactic, diagnostic and other raethods. The antibodies can block the ability of CD40 to bind CD 154 and do so without activating the cell expressing€D40 (e.g., a B cell). The present antibodies or fragments thereof may be used to reduce complication* associated with organ or tissue transplantation.
The antibodies, or antige»~binding portions the eof inclwde, but are not limited to, hnniaaized antibodies, human antibodies, monoclonal antibodies, chimeric antibodies, polyclonal antibodies- recorabina ly expressed antibodies, as well as antigen -binding portions of the foregoing. An antigen-binding portion of an antibody may include a porti n of an antibody that specific lly binds to C 40.
The present disclosure also provides for compositions and methods for reducing the likelihood of transplant rejection,, treat transplant rejec tion, inducing iiinntmostippression, and/o treating an au oimmune disorder. The compositions contain antibodies or fragments thereo f that specifically bind CD40.
in one embodiment, the present disclosure provides for a method of treating: or ameliorating graft-versus-host disease &ot transplant f ejection in a subject comprisin administering to the mammal a composition comprising m an tibody of the invention (or its fragment) in a amount sufficient to decrease one or more of the symptoms of graft~vers«s~hosf disease and or transplant rejection in the subject
In another embodiment, the antibody or antigen- itidmg fragment is administered to a subject having an■ inflammatory disease or an immune disorder such as an autoimmune disease. The inflammatory disease or autoimmune disease may be associated with CD40- expressin cells.
The invention features methods of redaeing me likel h d of i ansplani rejection, treat transplant rejection, inducing imratmostippression, and/or treating an autoimmune disorder in a subject by administering to the subject the present antibody r aHtigen-binding portion thereof in an effective amount.
Al so encompassed by the present disclosure i s a- method of blocking- the function of CD40 in a mammal eornprising adnhnisfering to the ma mma l a composition comprising (tie present antibodies, or antigen-bkdttig portions thereof, in art amount sufficient to block a CD40- mecbated inmiitne response in the niarnmal.
Another method of the disclosure relates to inhibiting the growth and/or differentiation of cells expressing CD40, comprising administering the present antibody or antigen-binding
.fragment to the colls, wherein the binding of the antibody or antigen bindiug'fr tgtmnt to CD4Q inhibits the growth and or differentiation of the cells.
The present disclosure provides for a method of treating a subject ha ving a C 40- associated disorder, comprising administering to the subject the presen antibody or an igen* binding f agment, wherein the binding of the antibody or antigen-binding fragment, to CD4Q inhibits the growth and/or differentiation of cells of the CD40-asseciated disorder. The cells may be, but are not limited to, B lymphoblastoid cells, pancreatic, lung cells, breast cells, ovaria cells, colon cells, prostate cells, skin cells, head and neck cells., bladder ceils, bone cells or kidney cells.
The present method ma be used to treat chronic lymphocytic leafeemia, Biitkiit¾ lymphoma, multiple myeloma, a T cell lymphoma, Mon-Hodgkin's Lymphoma, Hodgkm's Disease , Waldenst om 's aeroglobollnenria or Kaposi's sarcoma,
Additional methods of the present disclosure include inhibiting antibody production by B cells i a subject comprising administering, to the subject an effective amount of an anti-CD40 antibody or its fragment of the present disclosure, in one embodiment, the antibody is
administered in an amount effective to inhibit B cell differentiation and antibody isotype switching in the subject, in another embodiment, the antibody is administered in an amount effective to inhibit cytokine and chemokine production, and/or inhibit up-regnlation of adhesion molecrues in T-celis and macrophages in the sobject, In a third embodiment, the antibody is administered in an amount effective to inhibit activation of dendritic cells in the subject.
in addition to the present antibody or its fragment, the present methods may farther comprise administering a second therapeutic agent such as an tmmunosiippressant, a tumor .necrosis factor antagonist (a TNF-antagonist), a CTLA4-antagoni.st, an aeii-iL-6 receptor antibody, an anti-CD20 antibody, or a combination thereof.
The present antibodies, of antigen-binding portions thereof* may specifically bind t hiunan CD40 aad r rhesus CD40, iftqiad g recoihfeiaaiii and native human. CD C).
As used herein, a cell that expresses CD40 is any cell characterized by the surface expression of€D4i\ including, bat not limited to, normal and neoplastic B cells, interdlgi rating ceils, basal epithelial ceils, carcinoma cells, macrophages, endothelial, cells, follicular dendritic cells, tonsil cells, arid hone marrow-derived plasma cells.
Hiiiftantz d antibodies
The humanized antibody of the preseM disclosure is an antibody f m a non-imrnan species where the amino acid .sequences in the non-antigen binding regions (and/or the antigen- binding regions) ha ve bee altered so that the antibody more closely resembles a human
antibody, and still retains its original binding ability.
An antibody light or heavy chain variable region, consists of three hypervariable regions, referred to as complementarity determining regions (CDRs). CDRs are supported within the variable regions by framework regions (FRs). In one embodiment, the heavy chain variable region (or light chain variable region) contains three CDRs and four framework regions (FRs), arranged froni mino-temnnns to earboxyi-tenniuns in the following. order: PR!, CDRI, FR2, CDR2, FR3, CDR3, FR4. Kabaf E. A., et a!. Sequences of Proteins of Immunological Interest, Fifth Edition, IIS, Department of Health and Hmna Services, M1H Publication o. 91-3242, 1991 CkotMa, C. ef /., f. Mol. Biol, 196:901-917, 1987.
In certain embodiments, humanized antibodies are antibody molecules from non-human species having one, two, three or .all CDRs from the non-human species, and one* two, three, four or all framework regions from a human immunoglobulin .molecule.
The CDRs of the present antibodies or antigen-binding portions thereof can be from a fton-hunian or human source. The framework of the present antibodies or antigen-binding portions thereof can be human, humanized, non*frurnan (e g,, a murine framework modified to- decrease antigenicity in humans), or a synthetic framework (e.g., a consensus setpence), hi one embodiment, the present antibodies, or antigen-binding portions thereof contain at least one heavy chain variable region and/or at least one light chain variable region.
The humanized antibodies of the present disclosure can be produced by methods known in the art Fo example, a humanized antibody can have one or more amnio acid residues introduced, into It from a sonrce which is non-imtnan.. These .non-human amino acid residues ate often referred to as "import" residues, which are typically taken from an iaaporT variable domain. Hnmanimtion can be performe .following the method, of W¾ater aad co-workers (Jones et al.? Nature 321 :522-55. 1986; Riechmai et al, Nature 332:323-7, 1988; Verboey n. et ah, 5 Science 239: 1534-6, 1988), by substituting hypervariabie region sequences for the tOrresponding sequences of a imau antibody, Accordingly; in such humanized antibodies, substantially less than an intact human variable domain has been substituted by the corresponding sequence from a non-hiinian species, in certain embodiments, humanized antibodies are human antibodies in which at least so e hypervariab!e region residues as well as other variable -region residues are
! 0 'substitute by residues front analogous sites in non-human antibodies .
The choice of human variable domains, both light and heavy, to be used in .making the humanized antibodies, may reduce antigenicity: According to the "best-fit" method, the sequence of the variable domain of non-human (e g, , rodent sncfj as mouse) antibody is screened against the entire library of known human variable domain sequences. The 'human
1,5 sequence which is closest to thai of the non-human is then accepted as the human framework for the humanized antibody. See. e.g.. Sims et l., ./. Immunol 151:2296-308, 1993; Chothia et aLJ Mat Hioi. 196;9 f ~ 17, 1987. Another method uses a. particular .framework derived iiont the consensus sequence of a II human a tibodi es of a particul ar subgroup of light or heavy chains . The same f amework may be used for several different humanized antibodies. See* e<g.s Carter et 0 al, Proc. Natl. Acad. Set USA 89:4285-9, 1 92; Presta et al.; J. Immunol. 151 :2623-32, 1993.
Humanized antibodies can be generated, by replacing sequences of th variable region, that are not directl involved in antigen binding with equivalent sequences from human variable regions, Those methods include isolating, manipulating, and. expressing the nucleic acid sequences that encode all or part of variable regions from at least one of a hea vy o light chain . 5 Source of such nucleic acid are well known to those skilled in the art and, for example, may fee obtained from a hybridoni producing an antibody against CD40. The recombinant ON A encoding the humanized antibody, or fragment thereof, can then be cloned into an appropriate expressio vector.
In another example, once iiou-hu an (e.g., .murine) antibodies are obtained, variable 0 regions can be sequenced, and the location of the CDRs and framework residues determined. Ka at E, At, -gi iil, (1991) Sequences of Proteins .o tottuao gjcai fttetests Fifth Edition, IIS. Department of Health and Human Services, ΝΪΗ Publication No. 91-3242. Chothia, C. ei ai. (1987) J. Mot Biol,, 196:901-917. The light and heavy chain variable regions can, optionally, be Hgated to corresponding constant regions. CDR-grafied antibody molecules can be produc d by CPR-grafting or C.DR substitution. One, two, three or ail CDRs of an immunoglobulin chain can be replace * For example, ail of the CDRs of a particular antibody may be from at least a portion of a non»human animal (e.g., mouse such- as C DRs shown in Table i ) or only some of the CDRs rosy be replaced. It is only necessary to kee the C DRs required for binding of the antibody to a predetermined antigen (e.g., CD40), Morrison, S. L,, 198$, Science, 229; 1.202- 1207. Oi ei&l, 1986, BioTeehfiiques, 4:214 U.S. Patent Nos, 5,585,089; 5,225,539; 5,693,761 and 5,693,762. BP 51 596. Son&s etaL, 1986, ature, 321:552-525. Ver oeyan etaL, 1988, Science, 239:1534. Beidler ei at, .1988, J. Immunol., 141 :4053-4060.
it may be desirable that antibodies be hunmnized with retention of high affinity for the antigen and other favorable biological properties. To achieve this goal, according to one method, humanized an tibodi es are prepared by a process of analysis of t he .parental sequences and various conceptual hnmaiiked products using three-dimensional models of the parental and humanized sequences, Three-dirnensioMl innnunoglobulin models are commonly available an are familiar to those skilled in the art. Computer programs are available which illustrate and displa probable three-dimensional conformaiional structures of selected candidate immunog obulin sequences . Inspection of these displays permits analysis of the likely role of the residues in the functi oning of the candidate immunoglobulin seqtsence, i.e., the analysis of residues that influence the ability of the candidate immunoglobulin to bind its antigen. In this way, FR resi dues can be selected and combined from the recipient and import sequences so that the desired antibody
characteristic, such as increased affinity for the target antigen(s), is achieved.
In some embodiments, a huma ized anti-CD40 antibody also includes at least a portio of an immunogiobulin constant region, typically that of a human immunoglobulin. In one embodiment, the antibody will contain both the light chain as well as at least the variable domain of a heavy chain. The antibody also may include one or more- of the constant domain CHI , hinge, CH2, CH3, and/or CH4 of the heavy chain, as appropriate. In some aspects of the present disclosure, one or Bio e domains of th humanized antibodies will be reeo binanriy expressed. Such -recombinant expression may employ one or more control sequences, poiynocleotide sequences necessary for expression of an operahiy linked coding sequence in a particular host organism. The control sequences suitable for use in prokarv'ofic cells include, for example, promoter, .operator,, and rihosonie binding site sequences, Eukaryotie coritto! sequences iuctudes but are t l imited to, promoters, pa!yadenyiation signals, and enhancers. These control sequences can be utilized for expression and production of humanized anti-CD40 antibody in prokaiyotic and eukaryotie host cells.
Also encompassed b the present disclosure are antibodies, or antigembinding portions tbereo!l containing one, two, or all CDRs as disclosed, herein, with the othe region replaced by sequences front at least one different, species inclmding, but not limited to, hitman, rabbits, sheep, dogs, eats, cows, horses, goats* pigs, monkeys, apes, gorillas* chimpanzees, dacks, geese, chickens, amphibians, reptiles and other animals. fi«i»aii ant boi ies
Hmnan antibodies of the disclosure can be constructed by combining v clone variable domain sequencers) selected frarn human-derived phage displa libraries with known human constant domain sequences(s) ¾ogenh»om et aS..}J Mot Biol 227:381-8, 1992· Marks et al., MoL Biol 222:581 -97, 1991). Alternatively, . uman antibodies can be made by die hybodoma method. Human myeloma and mouse-human heteromye!oma cell lines for the production of human monoclonal antibodies have been described, for example, by fcozbor, «Λ- Immunol 1.33:3001-5, 1.984; Brodenr et at, Monoclonal Antibody Production Techniques and
Applications, pp. 51-63 (Marcel Dekker, inc.. New York, 1987); and Boeraer et al., J..Immunol 147: 86-95, 1991.
It is possible to produce transgenic animals (e.g . , mice) that are capable, upon
Ininiunaation, of producing a foil repertoire of human antibodies in the absence of endog no s immunoglobulin production. For example, it has been described that the homozygous deletion of the antibody heavy-chain joining region (JH) gene in chimeric and germ-line mutant mice results in complete inhibition of endogenous antibody production. Transfer of the human germ-line immunoglobulin gene array in such germ-tine mutant' mice will result in the production of human antibodies. upOR antigeR. ©hal!eiige. See, e.g., jakooovits et ah, Proc, Nati A &d. Scl USA 90:2351-5, 1 93; Jakobovits et at, N tom 362:255-8, 1 93; Bruggemann et aL Year Immunol, 7:33-40, 1993,
Geae shuffling can also be used to derive human antibodies from non-husnan, e.g., rodent, mmbodies, where the 'human antibody has similar affinities and specificities to the starting non-human antibody. According to th s method,, whic is also called ''epitope imprinting," either the heavy or light chain variable region of a non-human antibody fragment obtained by phage display techniques as described herein is replaced wit a repertoire of human V domain genes, creating a population of non-huma ehain%uma» chain soFv or Pah chimeras. Selection with antigen results in isolation of a non-hum n chain/huma chain chimeric seF or Fab where the human chain restores the antigen binding site•destroyed upon removal of th corresponding non-human chain in he primary phage display done* i.e., the epitope governs (imprints) the choice of the human chain partner. When the process is repeated in order to replace the remaining non-human chain, a human antibody is obtained (see PCX Publication WO 93/0621.3), Unlike traditional humanization of non-human antibodies b CD grafting, this technique provides completely human antibodies, which have no FR or CDR residues of non- human origin,.
Chimenc Antibodies'
A chimeric antibody is a molecule in which different portions are derived from different animal species. For example, an antibody may contain a variable region derived fro a murine antibod and a human,immunoglo.btihn constant region. Chimeric antibodies can be produced by recombinant DNA techniques. Morrison, et ai, Proc Natl Acad Sci, 81 :6851 -6855 (1 84). For example, a gene encoding a murine (or other species) monoclonal antibody molecule is digested with restriction eassymes to remove the region encoding the murine Fc, and the equivalent portion of a gene encoding a human Fe constant fegittii is substituted. Chimeric antibodies can also be created by recombinant DM A techniques where DN A encoding murine V regions can be ligated to DMA encoding the human constant regions. Better et !., Science. 1988, 240:1041- 1043, Lin et ai. PNAS, 198? 84:3439-3443. Uu et al, J. immunoL, 1987, 139:3521 -3526. San et ai. PNAS, 1987, 84:214-218. Nishimnra et ai? Cane. Res., 1987, 47:999-1005. Wood etal Mature, |9¾ 314:446-449. S aw et a!., J. Natl Cancer InsL, i 988:I 80:1553-155:9. Inteniaiiona! Patent Publication 'Nos. WO 1987002671 aad WO $6/01533. European Patent Application Nos. 184,. 187- 171,496; 125,023: md 173,494. US. Patent No. 4,816,567.
¥ariaMe Regions and CDRs
The heavy chain variable regions, tight chai variable regions aad CDRs of the
2C10 antibody and certain humanized, anti-€D40 antibodies, are shown in Table 1. table I SEQ ID Hos. II - 3Ϊ
Figure imgf000022_0001
Heavy ch . QVQLVQSGAEYKKPGASVKVSCKASGYTFT 1 variable reg on MYWMHWVR0APGORLE MGYIHPSNDYTK
YNO Et DRVT rRDI'SASTAYMELSSLRSEDT AVYYCA OGFPYWGOGTLVTVSS
Cri0ji2 Heavy 'chain, QVQ'LVQSGAEVKKPGASVKVSC ASG 20 variable region: YTFTNYWMH WVROAPGGRLEWMG
YWSNDYTKYMQKFKD RVTiTADKSASTAYMELSSLRSEDTA¥YYCA R OGFPY WGOGTLVTVSS
ClOJh3 Heavy chain, QYQLYQSGAEV KPGASVKVSCKASG 21 variable region YTFT YWMH WVROAPGORLEWIG
YiMPSNDYTKYNOKFKD
RATLTAD SA TAYM ELSSLRSEDT VYYCAR OGFPY GQGTLVTVSS
C10J1 Light chain, EiVLTOSPATLSLSPGERAtLSC SASSSVS 22 variable region YMH YQOKPG0APRLL1Y DTSKLAS
GIPARFSGSGSGTDFTLTISSLEPEDFAVYYC
eOLSSDPFT FGGGTKVEIK
Ci0j2 Light chain,, B1VLTQSPA1XSLSPGERATLSC 23 variable region. SASSSVSYMH WYOOKPGOAPR WiY
DTSKLAS
eVPA FSGSGSGTDYTLTiSSLEPEDFAVYYC HOLSSDPFT FGGGTKVEiK
C10BP Heavy chain, OVOLVQSGAEYKKPGAS'VKVSCKASGiYTFT 24 variable region NYWMH VROAPGORLEWIGY!NPSMDYTKY
OKFKDRATLTADKSANTAYMELSSLRSEDT AVYYCAROGFPYWGOGTLVTVSS
Ci0HBi Heavy chain. QVQLVQSGAEVKKPGASVKVSCKASGYTFT 25
Figure imgf000024_0001
in certain embodiments, the antibodies or anti gen-bindi ng portions thereof include a heavy chain variable-: region cofflprtsing a» araiao aci sequence at least about 70%, at least bout 75%, at least about 80%, at least, about 85%, at least about 90%, at least about 95%, at least about 99%, about 70%, about 75%, about 80%, about 81%, about 82%, abou 83%, about 84%,. about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about '93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99% or about 100% identical to a lieavy chain variable region amino acid sequence as set forth, n any of SEQ ID HQs: 11, 19, 20, 21, 24, 25 and 26,
in certain embodiments, the antibodies or ntigen-b nding portions thereof include a. light chain variable region comprising aa aniiao acid sequenc at least about 70%, at least abou .75%, at least about 80%, at least about B 5 %, at least abou 90%, at least about 95%, at least about 99%, about 70%, about 75%, about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99% or about 300% identical to a light chain variable region mino acid sequence -as set forth in any of SEQ ID NOs: 12, 22, 23, 27, 28 and 29.
In certain embodiments, the antibodies or antigen4>kdrag portions thereof each include both a heavy chain variable region, com iling aa. aniiao acid sequence at least about 70%, at least about 75%,. at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 99%, about 70%, about 75%, about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99% or about 100% identical to a heavy chain variable region amino acid sequence as set forth in any of SEQ ID NOs: 11 , 1 . 20, 23 , 24, 25 and 26, and a light chain variable region including an amino acid sequence at least about- 70%, at least about 75%, at .least about 80%, at least about 85%, at least, about 90%, at least about 95%, at least about 99%, about 70%, about 75%, about 80%,. about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 1 %, about 92%, about 93%, about 94%, about 95%, about 96%, about. 97%, about 98%, about 99% or about 100% identical to a variable light chain amino acid sequence as set forth in SEQ ID NOs; 1 , 22, 23, 27, 28 and 29.
A heavy chain variable region of the antibodies or antigen- binding portions thereof can £Q¾p.rJse one, t o, .three o?m ' &w 6«m ie¾½«t¾rit determining regions (CDRs} that are at bast about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 99%, about 70%, about 75%, about 80%, about 81 %, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93% , about 94% , about 95%, about 96%, about 97%, about 98%, about 99% or about 100% identical to the CDRs of a heavy chain variable region, of the 2C 10 antibody (CDR1, CDR2 and.CDR3 as set forth in SEQ ID NOs: 13, 14, 15, respectively).
A light chain variable region of the antibodies or arriigen-bindirig portions thereof can comprise one, two, three or more CDRs that are at least about 70%, at least about 75%, at least about 80%, at least about $5%, at least a out 90%, at least about 95%, at least about 99%, about 70%, about 75%, about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99% or about 100% identical to the CDRs of light chain variable region of the 2C10 antibody (CD I , CDR2 and CDR3 as set forth kt SEQ ID NOs: 1.6, 17, 18, respectively).
A heavy chain variable region of the present antibodies, -or antigen-binding portions thereof, c n: comprise one, two, three or more corapieniettiarrty detettPirtiag region (CDRs) that ate at least about 70%, at least about 75%, at least abou 8( %, at feast about 85%, at least about 90%, at least about 95%, at least about 99%, about 70%, about 75%, about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 6 , about 97%, about 98%, about 99% ot about .100%•■■identical to the CDRs of a heavy chain variable region- of the 2C10 antibody (CD I, CDR2 and CDR3 as set forth in SEQ ID NOs: 13, 14, 15,
.respecti ely), and a light chai n variable region of the antibodies or antigen-binding portions thereof can comprise one, two, three or more CDRs that are at least about 70%, at least about 75%, at least about 80%, at least a ut 85%, at least about 90%, at least about 95%, at least about 99%, about 70%, about 75%, about 80%, about 81%, about 82%, about.83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99% or about 00% identical to the CDRs of a light chain variable region of the 2C 10 antibody (COR 1 , CDR2 wd CDR3 as set forth in SEQ ID NGs: 16, 17, 18s , respectively).
A heavy chain variable region of the antibodies or-aatigen-bmdkg- portions thereof can include three CDRs that are at least about 70%, at least about 75%. at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 99%, about 70%, about 75%, about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99% or about ί.00% identical to the CDRs of a hea vy chain variable region of the 2C 1.0 antibody (CDRl , CDR2 and CDR3 as set forth in SEQ ID NOs: 13, 14, 15, respeciwely).
In one embodiment, a light chain variable region of the antibodies or antijgen-bind portions thereof includes three CDRs that are: at least about 0%, at least about 75%, at least about 80%, at least about 85%, a least about 90%, at least about 95%., at least about 99%, about 70%, about 75%, about 80%, about 81%, about 82%, about 83%, about .84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91 %, about 92%, about 93%5 about 94%, about 95%, about 96%, about 97%, about 98%, about 99% or about 100% identical to the CDRs of a light chain variable region of the 2C10 antibod (CDiU, CDR2 and CDR3 as set forth in SEQ ID NOs; 16, 17, 18, .respectively).
In one embodiment, a heavy chain variable region of the antibodies or an igeB-biridlng portions thereof includes three CDRs that are at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 99%, about 70%, about 75%, about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99% or about 100% identical to the CDRs of a heavy chain variabie region of the 2C.10 antibody (CD'R! , CDR2 aud CDR3 as set forth in SEQ I NGs; S 3 , 14, 15, respectively), and a light chain variable region of the antibodies or antigen^binding poitiOi¾ theruaf includes three CDRs that are at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 99%, about 70%, about 75%, about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 1%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99% or about 100% identical to the CDRs of a. light Chain "variable, region -.of the 2C10 antibody (CDRl , CDR2 aad CDR3 as set forth it* SEQ ID NOs: 1.6, 17, 8, respectively).
in certain embodiments, a heavy chain variable region of the antibodies or aniigen- hroding portions thereof includes three CDRs thai are Identical to CDRs of a heavy chain variable region of the 2 10 antibody (CDRl , CDR2 and CDR3 as set forth in SEQ ID NOs: 13, 14, .1.5» respectively), aad light chain variable region of the antibodies or airtigeri ?inding porti ons thereof includes three CDRs that axe i denti cal to CD Rs of a light chain variable region of the 2C10 antibody (CDRl , CDR2 a»dCDR3 as set fort in SEQ ID NOs: 16, 17, I S, respectively),,
Encompassed by the present disclosure are antibodies "with a heavy chain variable jregioft
and a light chain variable region having amin -acid sequences at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about" 95%, at least afeotit 99%, about 70%, about 75%, about 80%, about 81 %, about 82%, about 83%, about 84%, about 85%, abo t-86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99%, or about 100%, identical to the heavy chain variable region (SEQ ID NO: 1 1) and light chain variable region (SEQ ID NO; 12) of the antibod 200, respectively .
In related embodiments, anti-€D40 antibodies or antigen-binding portions thereof include, f r example, the CDRs of heavy chain variable regions and/or light chain variable regions of 2C 10.
in one embodiment, the antibody or antigen-binding portion thereof contains a hea vy chain variable region and a light chain variable region identical to a heav chain variable region and light chain variable region of the 2C10 antibody (SEQ ID NO: 11 and SEQ ID NO: 12, respecti ely).
la various embodiments, the antibodies or antigeH-bintling portions thereof specifically bind to an epitope thai overlaps with, or are at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 99%, about 70%, about 75%, about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about: 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99% or about 100%, identical to an epitope bound by the 2C 1. antibody. The epitope may be present within th sequence of SEQ ID NO: 6, or may be present within the sequence of amino acids 8-40 of SEQ ID NO: 6.
In certain embodiments, CD' s corresponding to the CDRs in Table I have sequence variations. For example, CDRs, in which 1, 2 3, 4, 5, 6, 1 or 8 residues, or less than 20%, less tha 30%, or less than abou 40%, of total residues in the CDR, are substituted or deleted can he present m an antibody (or antigen-binding portion thereof) that binds CD40.
Also within the scope of the disclosure are antibodies or antigen-binding portions thereof In which specific amino acids have been substituted, deleted or added. These alternations do not have substantial effect on the peptide's biol ogical properties such s biftdiftg activity. For example, antibodies ma have amino acid substitutions in tire framework .ragio.ii, such as to Improve binding to the antigen, in another example, a selected* small number of acceptor framework: residues can be replaced b the corresponding donor anii.no acids, The donor framework can he a mature or ge mline human antibody framework sequence or a consensus sequence. Guidance concerning how to make pbenoiyplcaily silent amino acid substitutions is provided in Bowie etal, Science, 247: 1306-1310 (1.5)90). Cuiininghara eia , Science, 244: 1081 -108S ( J 989), Ausuhel (ed.), Current Protocols in. Molecula Biology,. John. Wiley and Sous, Inc. ( 1994), T. aniatis, E, F. Ftitsch and J. Sanibrook, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor laboratory, Cold Spring Harbor, RY÷ (1989),. Pearson, Methods Mol Biol, 243:307-31 (1994). Gomiet eial, Science 256:1443-45 (1992).
The present peptides ma be the functionally active variant of antibodies : of antigen- binding portions thereof disclosed herein, e.g„ with less than about 30%, abo ut 25 %, about 20%, about 15%, about 10%, about 5% or about 1% amino acid residues substituted or deleted but .retain essentiall the same immunological properties including, but not limited to, binding to CD40.
The antibodies or aaiigen-birtdirtg porti ons thereof may also include variants, analogs* ortboiogs, homo!ogs and derivatives of peptides, that exhibit a biological activi ty , e.g., binding of an antigen such as CD40, The peptides niay contain one or more analogs of an amino acid (including, for example, non-naturally occurring amino acids, amino acids which only occur naturally in an unrelated biological system, modified amino acids from mammalian systems
Figure imgf000030_0001
unlabeled and detected with a labeled antibody that binds the humanized antl-CD40 antibody or its fragment. Antibody fi"agfn«eiiis
The antibodies can be mil-length or can include a. fragment (or. f agments) of tire antibody having aii antigen-binding portion, including, 'bat not limited to, Fab, Ffa 'lS, Fab F(ah}!, Fv; single chain Fv (scFv), bivalent scFv (bj-scFv), itivalent scFv (iri-scFv), fd, dAb fragment (e.g., Ward et at. Nature, 341 : 544-546 (1989)), an isolated GD „ diafaodies, triabodies, ietrabodies, linear antibodies^ single-chain antibody molecules, and nii dspecifie antibodies formed from antibody fragments. Single chain antibodies produced by joining antibody fragments using recombinant methods, or a synthetic tinker, are also encompassed by The present disclosure. Bird et t Science, 1.988, .242 -.423.42 Huston et aL J*roe. Natl Acad. Sci . CMA? 1 88, 85:5879-5883.
Papai digestion of antibodies produces two identical antigen-binding fragments, called "Fab" fragments, each with a single antigen-binding site* and residual "Fc" fragment, whose name reflects its ability to crystalliz readily . Pepsin treatment yields an F(a'b')2 'fragment that has two antigen-combining sites and is still capable of cross-linking antigen.
Fv is the nnnininni antibody fragment which contains a complete antigen-binding site, h one embodiment a two-chain Fv species consi sts of a dimer of one heavy- and one light-chai variable domain, in tight, non-covalent association. I a single-chain. Fv (scFv) species, one heavy- and one light-chain variable domain ca be eovalentiy linked by flexible peptide linker such that the light and heavy chains can associate in "draefie" structure analogous to that in a two-chain Fv species, it is in this configuration that the three CDRs of each variable domain interact t define an antigen-binding site on the 'surface of the VH'-VJ„ dime Collectively, the six CDRs confer antigen-binding specificity to the antibody. However, even a single variable domain (or half of an F comprising only three CDRs specific for an antigen) has the ability to recognize and bind antigen, although' at a lower affinity than the entire binding site.
The Fab fragment contains the heavy- and. light-chain, variable domains and also contains the constant domain, of the ligh c ain and the first constant domain (CM 1. ) of the- heavy chain. Fab ' fragments differ from Fab fragments by the addition of a fe residues at the carboxyi terminus of the heavy chain CH I domain including one or more cysteines from the antibody hinge region, Fab'-SH is the designation for Fab' in which the cysteine residtie(s) of die constant domains bear a free thiol group. F(ab') 2 antibody fr gments originally were produced as pairs of Fab' fragments which have hinge cysteines betweeii them. Other chemical conplings of antibody fragments are also known.
Single-chain Fv or scFv antibody fragments comprise -Hie VM and Vs.. d mains of antibody, where these domains ar present in a single polypeptide chain. Generally, the scFv polypeptide further comprises a polypeptide linker betwee th VH and domains which enables the scFv to form me desired structure for antigen binding. For a review of scF v, see, e.g., Piack hito, m h Pharmacology of 'Monoclonal Antibodies, vol 113, Rosenbnrg and
Moots eds., (Sprfnger-Vertag, Mew York, 1 94), pp. 269-315.
Diabodies are antibody fragments with two antigen-binding sites, which fragments comprise a heavy-chain variable domain (V») connected to a U'g t-chain variable domain (VL) in the same .polypeptide chain (V'H-VL). By using a linker that is too short to allow pairing between the two domains on the same chain, the domains are forced to pair with the complementary domains of another chai and create two antigen-binding si tes . Diabodies may be bivalent or bispecific. Diabodies are described more fully in, for example, European Patent No. 404,097; PCX Publication WO 1993/01161 ; Hudson et at, Mat Med. 9:129-34, 003; and Bollinger et aL Proa Nail. Acad, S t USA 90:6444*8, 1993. Triabodies and tetrabodies are also described in. Hudson et at. Nut Med. 9: 129-34, 2003,.
Antibody fragments may be generated by traditional means, sneh as en¾ymatic digestion, or by recombinant techniques. In certain eirenrostances there are advantages of using antibody fragments, rather than whole antibodies. The smal ler size of the f agments allows for rapid clearance, and may lead to improved access to solid tumors. For a review of certain, an tibody fragments, see Hudson et al Nat Med. 9:129-134, -2003»
Various techniques have been developed for the production of antibody fragments.
Traditionally, these fragments were derived v ia proteolytic digestion of intact antibodies (see^ e,g.., M orimoto ei-ai, J Mockem. loph Met ods 24: 107-17, 1992; and Brennan et at, S fmce 229:81 -3, 1985),. However, these fragments can now be produced directly by
recombinant host cells. Fab, Fv, and ScFv antibody fragments can all be expressed in and secreted from £ 'coll, thus allowing the f&cile production of large amounts of these fragments. Antibody f gments can be isolated from the antibody phage libraries. Alternatively, Fah'-SH fragments can be directly recovered from E. coli and chemically coupled to form F ah'}2 fragments (Cartel* et at, Bio/Te knolagy 1.0: 163-7. ί 992),. In another appHMcfi, F(t ?)2 fragments are isolated directly from recombinant host cell culture. Fab and F(ab¾ fragment with increased in vi vo half- life comprising salvage receptor binding epitope residues are described it* U.S. Patent Mo, 5,869,046. Other techniques for the production of antibody fragments will be apparent to the skilled practitioner.
The present antibody or antigen~binding portion thereof may comprise at least one constant domain, such as, (a) an igG constant domain; (b) an IgA constant do alUj etc.
All antibody isotypes are encompassed by the present disclosure, jnckiding IgG (e,g., IaG-'Ι isG2_ IaG3. laG4)„ isM, IgA CliiAT ie A2), l«D r IgE, h antibodies or antiaen-bradra-i portions thereof may be mammalian (e.g., mouse, human) aniibodi.es or antigen-binding portions thereof. The light chains of the antibody may be of kappa or lambda type. An alternative
humanized a»ti-C 40 antibod can comprise sequences from more than one immunoglobulin class or isotype, and selecting particular constant domains to optimize desired effector functions is within the ordinary skill in the art..
The antibodies or antigen-binding portions thereof of The present disclosure may be monospecific, -speeiiie or mui i-speelfic, MuM~:Specific or hi~speeirle autibodies or fragments thereof may be specific for different epitopes of one target polypeptide (e.g., CD40) or may contain anti gen-binding domains specific for more tha one target polypeptide (e.g. , antigen- binding domains specific for CD40 and other antigen relating to transplant rejection or aintniraimne disease), in one embodiment, a multispecific antibody or anti en-binding portion thereof comprises a least two different variable domains, wherein each variable domain is capable of specificall binding to a separate antigen or to a different epitope on the same antigen. Tuft et al, 1991, J. Immunol, 147:60-69. Kwfet et al, 2t)0 Trends Bioteclinol, 22:238-244, The present antibodies can be linked to or co-expressed with another functional molecule, e.g., another peptide ox protein. For example, aft antibody or fragment thereof cart be functionally linked (e.g., by chemical coupling, genetic fusion, noncovalent association or otherwise) to one or more other molecular entities, such as another antibod or antibody fragment, to produce a bi- specifte or a mu spectfic antibody with a second binding specificity. For example, the present disclosure- includes bi-speciSc antibodies wherein one arm of an immunoglobulin is- specific for CO40, and he oilier arm of the immunoglobulin is specific for a second therapeutic target or Is conjugated to a therapeutic moiety such as an immunosuppressant
F rod iiCtioft of An t mdi
5 The present disclosure provides for methods .for making an a tib dy or antigen-bindin portion thereof that specifically binds to CD4Q,
For example, a uon-hurnan animal is immunized with a composition that includes CD 0, and then a specific antibody is isolated from the aniraal . The method can further include evaluating binding of the antibody to C 40,
! 0 In one embodiment, the present disclosure rovides "for a method for making a- hybridoma that expresses an antibod that specifically hinds to CD40. The method contains the iollowmg steps: irnmnnixing an animal with a composition that includes CD40 or its .fragment; isolating splenocytes from the animal; generating hyhridornas from, the spienocytes; and selecting a hyhridoma that produces an antibody that specifically binds to CD4Q. ohler and ilstein,
1,5 Nature, 256; 495, 1975. Harlow., E, and Lane, D, Antibodies: A Laboratory Manual Cold Spring Harbor Laboratory Press, Cold Sprin Harbor, N.Y., 1988.
in one embodiment, C 40 is used- to immunise niiee intraperitaneally or iBiravenOnsiy, Cine o more boosts may or may not be given. The titers of the antibodie s in the plasma can be monitored by, e g.., ELISA feu yme-linked iramiuiosorbent assay ) or flow cytometry. Mice with 0 sufficient titers of anti-CD40 antibodies are used for fusions. Mice ma or nay not be boosted with antigen 3 days before sacrifice and removal of the spleen* The moose splenocytes are isolated and 'fused with PEO to a mouse myeloma cell line. The resulting hybridomas are then screened for the production of antigen-specific antibodies. Cells are plated, and then incubated in selective medium, Supefnat nis from individual, wells are then screened by ELISA for human 5 anti»CD40 monoclonal antibodies. The antibody secreting hybridomas are replat d, screened again, and if stilt positive for ai ti-C:D40 monoclonal antibodies, can. be suheloned by limiting dilution.
Adjuvants that may he used to increase the ifittnimogeni city of CD40 include any agent or agents that act to increase an immune response to peptides or combination of peptides. Non- 0 limiting examples of adjuvants include alum, aluminum phosphate, aluminum hy droxide, F59 (4.3% w/v squa!ene, i),S% w/v pojysotbate SO (Tween. $0), 0,5% w y sorbitan trioleate (Span. 85)), CpG-containing nucleic acid, QS21 (saponin adjuvant^ MPL (Monopfeosphoryl Lipid A), 3DMPL (3-O-deacyiaied MPL}» extracts from Aquil!a, ISCOMS (see, e.g., Sjolander ei at.
(1998) J. Leukocyte Biol. 64:713; WO 0/0 1.84; 096/11 11; WO 00/48630; W098/36772; WOOO/41720; WO06/134423 and WO07/0261 0), LT/CT mutaais, fK>ly(D,L actkfe-c
g!yeo!ide) (PLG) i nero tticies, Qui! A, iiiterleiA os, Freund's, -aeeiyi-minamyl-L-iiH¾oii l~ P sogIuiainine (tiir-MDP), N-acet l-aor^mttramyKL-alanyl-D-isoghitaraiae (COP 11637, referred to as M>r~MDP), M-aeetyinnrranryl-L-^^^
almitoyl-sn-glyeero^ (CGP 1 83 A, referred to. as MX:!** PE), an RiB!, which contains three components extracted from bacteria, moaophosphoryl lipid .A, trehalose dimycolate and cell wall skeleton (MPL D +C S) in a 2% squa!ene/T een 80 emulsion.
The imrnuTji ed animal car* be any animal that is capable of producing recoverable antibodies when administered art iramunogett, such as, but not Knitted to, rabbits, mice, rats, banisters, goals, horses, monkeys, baboons and humans, in one aspect, the host is transgenic and produces human antibodies, e.g., a mouse expressing the human im unogiobisJin gene segments. US. Patent No. 8,236,31 1; 7,625*559 and 5,770,429, the disclosure of each of which, is
Incorporated herein by reference in its entirety.■Lonberg it &ls Nature 368(6474): 856-859, 94, Lonberg, N*,. Handbook of Experimental Pharmacology 113:49-101 , 1 94, Lonberg, N. and Huszar, p., Intern. Rev. Immunol, 13: 65-93, 1995. Harding, F. and Lonberg, M., Ann. .Y. Acad. Sci, 764:536-546, 1995.
The present antibodies or portions thereof can he produced by host cells transformed with D A encoding light and heav chains (or portions thereof of a desired antibody. Antibodie (or portions thereof): can be isolated: and purified from these culture supernatants and/or cells using standard tectei¾ae$:. For exarnpie, a hos cell may be transformed with DN A encoding the light chain, the heavy chain, or both, of an antibody. Recombinant DMA technology may also be used to remove some or ail of the DMA encoding at least portio of either or both of the light and heav chains that is not necessary for binding, e.g., the constant region.
The tnyention also encompasses a nucleic acid or polynucleotide encoding at least one of the present antibody or antigen-binding portion thereof that specifically binds to CO40, The: nucleic acid may be expressed in a cell to produce the present antibody or antigen^wttding portion thereof The isolated nucleic acid or polynucleotide of the present disclosure comprises at least one sequence encoding a -peptide at least about 70%, at least about 75%, at 'least about 80%, at least about 85%, at least about 90%, .at least about 95%, at least about 99%, about 70%, about 75%, about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 1 , about 92%, about 93%, about 94%, about 95%, about 96%, .about 97%, about 98%, about 99% or about 1.00% identical to. any of SEQ ID HQs; I I - 29.
The invention also features expression, vectors -including at least one nucleic acid or polynucleotide encoding a peptide at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 99%, -about 70%, about 75%, about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 1%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99% or about 100% identical to any of SEQ l!D MOs; 1 1 - 29,
Nucleic acid molecules encoding a functionally active variant o the present antibody or antigen-binding portion, thereof are also encompassed by the present disclosu e. These nucleic acid molecules may hybridise with a nucleic acid encoding any of the present antibody or antigen-binding portion thereof under medium stringency, high stringency , or very high stringency conditions. Guidance tor performing hybridization reactions can be found in Current Protocols in Molecular Biology, John Wiley <& Sons, N.Y. 6,3.1-6.3,6, 1989, which is incorporated herein by reference. Specific hybridization conditions referred, to herein are as follows'. (! ) medium stringency hybridization conditions; 6XSS at about 45"C, followed by one or more washes in 0,2 X SSC, 0.1 % SDS at 60°C; f2) high stringency hybridisation conditions:
6XS G at about.45"C¾ followed by one or more washes hi 0.2XSSG.0.1% SOS at 65"C; and (3) very high stringency hybridization conditions; 0.5 M sodium phosphate, 7% SDS at 6$°C, followed by one of more washes at 0.2XSSC, 1% SOS at 65°C.
A nucleic acid or polynucleotide encoding the present antibody or antigen-binding portion thereof may be introduced Into an expression vector that can be expressed in a suitable
Figure imgf000037_0001
host cell.
The antibody m *ts portion prepared from the cells can be purified using, for example, hydroxylapatlte chromatography, gel electrophoresis., dialysis, -and' affinity chromatography, -with affinity chromatography being a typical purification technique. The suitability of protein A as an affinit ligarid depends cm the species and isotype of arty immunoglobulin Fc domain thai is present i die antibody. Protein A can be used 10 purify antibodies that are based o human gamma! , gamnaa2, or gamraa4 heavy chains (see, e.g., Lindmark etal, 1983 J. Immunol Meifi. 62:1-13), Protein G is recommended for alt mouse isoiypes and for human gamma3 (see, e.g.* Guss et ai, 1 '986 EJVIBQ J. 5: 1567-1575), A matrix, to which an affinity ligand is attached is; most often agarose* hut other matrices are available. Mechanicall stable matrices such as controlled pore glass or poly(styreaediviny:i)befl ene allow for '.fester flow rates and shorter processing times than can be achieved with agarose. Where the antibody omprise* a C+s«b.H3 domain, the Bakerbofld AB .T . resin (J. T. Baker, Phillipsburg, N.J.) is useful for purification. Other techniques for protein purification such as fractionation on an ion-exchange column, cthanol precipitation, reverse phase BPLC, chromatography on silica, chromatography on heparin
'SEPHAROSE.TM. chromatography on an anion or cation exchange resin (such as a polyaspartic acid colunift), chroffiatoi etising, SDS-PAGE4 and ammonium, sulfate precipi tation are also available depending on the antibody to he reco vered..
Following any preliminary purificatio step(s), the mixture comprising the antibody of interest and contaminants may be subjected to low pH hydrophobic interaction, chromatography using- an etution buffer at pH between about 2.5-4.5, ypically performed. t low salt
concentrations (e.g., from about Q-0.25 salt).
Hybrklomas or other cells that produce antibodies that hind, preferably with high affinity,, to C3 40 can then be subelone and further characterized. One clone from eac hybridoma or cell s whi ch retains the reacti vity of the parent cells (by ELIS A), can the be chosen for making a cell bank, and for antibody purification.
Alternatively, the present antibody or an tlgeri- binding portion thereof eati fee syntfiesiz b solid phase procedures well known in the art. Solid Phase Peptide Synthesis: A Practical Approach bv E. Alherton and R. C. Sbeppard, published by !KL at Oxford. Universit Press (.19%$% M^sthods ftMo!ecalas o ^ 'Vol.35: Peptide nihesis Protocols (ed. M.
'W.Penningion and B. M. Dunn), chapter 7, Solid Phase Peptide Synthesis, 2nd Ed., Pierce Chernical Co., Rockfot * IL (1 84). G. Baraoy and . B. Merrifield, The Peptides: Analysis, Synthesis, Biology, editors E. Gross and J. Meienhofer Vol. 1 and Vol. 2,. Academic Press, Ne York, (1980), pp. 3-254, M, Bodansky, Principles of Peptide Synthesis, Springer- Verlag, Berlin (.1984),
Additional antibodies (e,g., mo oclo l polyclonal, poiy-spedi e, or mono-specific antibodies) against the CD40 epi ope recognized by 2Ω0 can be made, e.g., using a suitable method for mak ng antibodies.. In an example, a coding sequence- lor an epitope recognized by the 2CI0 antibod is expressed as a C-iemimal fusion with. glutathione S-ttansferase (GST) (Smith et al,. Gem 67 31-40, 1988). The fusion protein is purified on glataihione-Sephairose beads, eluied with, glutathione, cleaved with- thrombin (at an engineered cleavage site), and purified for immunization of rabbits. Primary imnittttixations are carried out with Freund's complete adjuvant and -subsequent immunizations with Prennd's incomplete adjuvant. Antibody titers are monitored by Western blot and immtuioprecipitatiott analyses using the thrombin- cleaved pf otein- fragment of the GST fusion protein, Immune, sera are affinity purified using CNBt-Sepharose-conpled protein. Antiserum- specificity can he deter ined: using a panel of unrelated GST proteins,
As an alternate or adjunct immunogen to GST iksion proteins, peptides corresponding to relatively unique immunogenic regions of a polypeptide of the invention can be generated and coupled to keyhole limpet liemocyanin (KLH) through a«: introduced C-terminal lysine.
Antiserum to each of these peptides is similarly affinity purified on peptides conjugated to BSA, and specificity i tested by EL1S A or Western blot analysis using peptide conjugates, or b Western blot or iinniunoprecipitation using the polypeptide expressed as a GST fusion protein.
Alternatively, monoclonal antibodies that specifically bind the CD40 epitope recognised: by the 2CI9 antibody can '.be prepared using standard hybxidorna technology (see, e.g., Kohler et al„ Nature 256:495-7,, 1975; Kohler ei al, Ettr. J. Immunol. 6:511-9, 1976; Kohler et al, Eur, J, Immunol 6:292-5, 1 76; Hantmerhng et al, Monoefomf Antihmi s and T CeliHyhrkiomm, Elsevier. NY, 1981). Once produced, monoclonal antibodies can also be tested for specific .recognition b Western blot or mmaaopreci iia¾(> -a!ri¾! sis.,. A¾e^tiyeiyv.TO«0C: ittal.' antibodies can be prepared using the polypeptide of the kveiition described above and a phage display library (Vaughan et al, Na Bk chnol 14; 309- 14, 1996),
Bpiiopic fragments can be generated by standard techniques, e.g., using FCR and closing the fragment into a pGEX. expression vector. Fusion proteins are expressed in K coli and purified usin a 'glutathione agarose affinity matrix. To nunhnize potential problems of .low' affinity or specificit of antisera, two or three such fusions are generated for each protein, and each fusion is i je ted into at least two rabbits. Antiser are raised by injections in a series, and can include, for example, at least three booster injections.
In order to generate polyclonal, antibodie on a large scale and at low cost, an
appropriate animal species can be chosen. Polyclonal antibodies can be isolated from the milk or colostrum of, e.g., immunized, cows. Bovine colostrum contains 28 g of IgG per liter* while bovine milk contains 13 g of IgG per liter (Onisoujka et. alf J. Dairy Set. 86:2005-1 1 , 2003). Polyclonal antibodies can also be isolated from the yolk of eggs from immun zed chickens (Sarker ei at, J. Pe iatr. G iro teroL tfuir. 32:19-25, 2001).
Assays
Various methods can be used to assay the antibodies or antigen-binding portions thereof to confirm their specificity for the antigen of interest and/of to study their properties. One method of conducting such assays is a ser screen assay as described in U.S. Patent Puhlkatlo No. 2004/0126829. Anti-CP40 antibodies can be characterized tor binding to GD4G by a variety of known techniques, For example, in an EOS A,, .mic o iter plates are coated with GD40 or a fragment of CD40 in PBS, and then blocked with irrelevant proteins such as bovine serum albumin (BSA) diluted in PBS, Dilution of plasma from CD40-imni«nized mice (or solutions containing anti~CD40 antibodies) are added to each well and incubated. The plates are washed and then incubated with a secondary antibody conjugated to an, enzyme (e.g-? alkaline
phosphatase). After washing, the plates are developed with the enzyme's substrate (e.g., ABTS), and analyzed at a specific OD , In other em odiments, to determine if the selected, monoclonal antibodies bind to unique epitopes, ·ί½ antibody can be biotiny!ated which can then be defected with a sireptavidin labeled probe, Anti«C04O antibodies can be tested for reactivity with CD40 by Western. Mottimg,
Antibodies, or antigen iinding fragments, variants or derivatives thereof of fee present disclosure can also be described or specified in terms of their bindin affinity io an , antigen* The affinity of an antibody for an antigen can be determined experimentally using an suitable metho (see, e.g., Berzofsky et at, " Antibod -Antigen Interactions," in Fun amental
linnmnol.ogy, Paul, W, E,., Ed., Raven Press; New York, 1SLY, (1984); Kuhy, Janis immuaology, W. H Freeman and Company: Hew York, N.Y. (1 92); and methods described herein). The measu ed affini ty of a particular antibody-anHgen interaction can vary if measured under different conditions (e.g., salt eoncetitratiori, pB). Thus, measurements of affinity and other antigen-binding ara e ers i&g*, ¾, B, ¾) are preferably made with standardized solutions of antibod and antigen, and a standardized buffer.
The present antibodies or antigen-binding portions thereof specifically bind to CD40 with a dissociation constant (KB) of less than about 10"' M, jess than about 10"* M, less than about W * M, less than about i0"i() , less than about ' M, less than about W M, from about W M to about I0']2 M. from about 10"" M to about J O" ' 1 M, -from about 18"* M t about 10* 0 M, or from about 1.0"& M. to about I0"iz M.
Assays may also be used to test the ability of an antibody (or its fragment) to block CD40 bindin t© CD 154, or inhibit or decrease CD40-mediated responses.
As used herein, the terms ' nhibits binding" and "blocks binding" (eg,,
iuhihition btoeking of binding of CD 154 to CD40) are used interchangeably and encompass bom. partial and complete inhibition bloeking. Inhibition and blocking are also intended to include any measurable decrease in the binding of CD! 54 to CD40 when in contact with an anti-CD40 antibody or portions thereof as disc losed herein as compared, to iigand not in contact with an anti~CD40 antibody, e,g,, the Mocking of GDI 54 to CD40 by at least about 10%, 20%, 30%, 40%, 50%, 60%, 65%, 70%. 75%, 80%, '85%, 90%. 91%, 92%, 93%. 94%, 95%; 96%, 97%, 98%, 99%s or 100%.
in one embodiment activation of B celts, or inhibition thereof, may be determined by measuring expression of one or more markers selected from CD23, CD80, CDS6, and any additional suitable marker on CD20+ cells.
The present antibodies or fragments thereof ma be characterized by their effects on T eel!- ediaie antibody responses. For example,† e. antibodies, or .ftagftiesits thereof may inhibit Ig and/or IgG production m a mammal, when the antibody, or an amigeu iindi«g portion thereof;, is administered to the -mammal at a dosage ranging from about 1 mg/kg body weight to about SO rag/kg body weight, from about 2 mg kg body weight to about 40 mg/kg body weight, from about 3 mg/kg body weight to about 30 mg/kg body weight, from about 5 mg/kg body weight to about 2fi mg kg: bod weight, from about 8 nig/kg body weight t about 13 mg/kg body weight, abou 1 mg/kg body weight, about 2 mg kg body weight, about 5 mg/kg body weight, about 10 .mg/kg body weight, .about .15 mg/fcg body weight, about 20 mg/kg body weight, 'ab u .25 mg/kg body weight, about 30 mg/kg body eight, .a out 35 mg/kg body weight, about 40 n>g/¾g body weighty about 50 mg/kg body weight, about 60 mg kg body weight* about 70 mg kg body weight, or about 80 mg/kg bod weight.
The present antibodies or fragments thereof may be characterized by their effects on prolonging graft survival post transplantation. The present antibodies or fragments thereof, alone or in combination with one or more other immunosuppressants, may prolong graft survival by about .30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, about 2 fold, about 5 fold, about 10 fold, about 15 fold, about 20 fold, about 25 fold, about 30 fold, about 35 ibid, about 40 fold, about 45 foki about 50 fold, bout 55 fold, greate than about 40%s greater than about 50%, greater than about 60%, greater than about 70%, greater than about 80%, or greater than about 90%, greater tha about 2 Ibid, greater than about S fold, greater than about 10 fold, greater than about 20 fold, greater than about 30 fold, or greater than about 40 fold. For exam le* the present antibodies or fragments mereof may prolong islet allograft survival,
ί» certain embodiments, the present antibody, or antigen-binding fragment thereof: a may block binding of CD40 to CD 154; c) may block activation of antigen presenting ceils (e.g., B cells, dendritic ceils, macrophages, etc.); d) may or may not induce depletion of B cells; e) may or ma not inhibit o decrease cytokine release from antigen presenting cells; f) may or may not induce tumor cell, apoptesis; g) may or may not inhibit ttunor ceil proliferation^ -h) may or may not kills tumor cell; i) may or may not stimulate anti-tumor T cell responses; and/or j) may o may riot reduce established tumors. The antibodies described herein may have of induce a combination of any one or more of these attributes or acti vities.- Tai, et al. Cancer Res. 2005, 1 :, 05(!3):589g~906; Luqrnan et al, Blood 112:711-720, 2008. The antibodies o portions thereof described herein may also be tested for eflec s on CD40 internalization, in. vitr and in viv efficacy, etc. Such assays may be performed using well-established protocols known to the skilled person (see e.g.. Current Protocols in Molecular Biology (Greene Pub!. Assoc. Inc. & John Wiley & Sons, Inc., ' Y, M.Y.); Current Protocols in Immunolog (Edited by John Έ, CoBgan, Ada M, Kryisheek, David R, Marguli.es, Ethan M Shevach, Warren Strober 2001 John W ley &. Sons, NY, N.Y.); or commercially available kits. ondi ions to be treated
The present: antibodies or antigea~bi adi¾g portions: thereof have i viiro and m vim therapeutic, prophylactic, and/or diagnostic utilities, For example, cells can be cultured ift v in culture -medium and contacted by the anti-CD40 antibod or fragment thereof. The antibodies or antigen-bioding portions thereof can be administered in a subject,, as part of an in vft¾> (e. g., therapeutic or prophylactic) protocol. For in vivo embodiments^ the contacting ste is effected in a subject and includes administering an anti-CD40 antibody or portion thereof to the subject under conditions effective to permit binding of the antibody. f portion thereof, to GD40 in. the subject. The antibodies or antigen-binding portions thereof can be administered to reduce the likelihood of, or increase the duration prior to, transplant rejection, inducing
iiffinunosiippression, or treating an autoim u e disorder.
The antibodies or antibody fragments described herein may be used in any situation In which immunosuppression is desired (e.g., transplant rejection or autoimmune disorders). These antibodies are particularly useful for treating transplant rejection, e+g,f reducing the likelihood that a particular transplant is rejected by the host or increasing the time before rejection takes place. The antibodies or antibody fragments described herein can be used in conjunction with transplantation of any organ or any tissue that is suitable for transplantation. on4imiting exemplary organs include heart, kidney, lung, liver, pancreas, intestine, and thymus; non-limitin exemplary tissues include bone, tendon, .cornea , skin, heart valve, vein, and bone marrow.
The antibodies and antibody fragments can also be used to treat autoimmune disorders. In one embodiment, the autoiniinune disorder may be associated with or caused by the presence of an autoantibody. Autoimmune diseases that ma be treated with the present antibodies or fragments thereof include, but are not limited to, systemic lupus erythematosus (SLE), CREST syndrome (calcinosis, Eaynaud' s syndrome, esophageal, dysmotility, scierodaciyl, nd telan iectasia), opsoclonus, kflammatot myopathy (e.g., -polymyositis, der ato yosttis, and inclusion-body myositis), systemic scleroderma, primary biliary cirrhosis, celiac disease (e,g,, gluten sensitive enteropathy), dermatitis herpetiformis, Miller-Fisher Syndrome, acute motor axonal neuropathy (AMAH), multifocal; motor neuropath wit conduction block, autoimmune hepatitis,- amiphospholipid 'Syndrome, Wegener's gfaniiSoniaiosis, microscopic polya giitis, Churg- Straus syndrome, rheumatoid artliriiis, chronic autoimmune hepatitis, scleromyosatis, myasthenia grayisv Lamfaert-Ba-ton myasthenic syndrome, Hashimoto's thyroiditis, Graves' disease, Parausop I ast e cerebellar degeneration, Stiff person syndrome, limbic encephalitis, Isaacs
Syndrome* Sydenham's chorea, pediatric- autoimmune ueuropsychiairic disease associated with Streptococcus (PANDAS), encephalitis, diabetes meiiiuas type 1 , and Neuromyelitis optica. Other autoimmune disorders include pernicious anemia, Addison's disease, psoriasis*
-mHammatory bowel disease, psoriatic armriti's, Sjogren's syndrome, lupus erythematosus (e*g discoid lupus erythematosus, drog-induced lupus erythematosus, and neonatal lupus
-erythematosus), multiple sclerosis., and reactive arthritis.
Additional disorders that may be treated using the methods of the present disclosure include, for example, polymyositis, de-miato sitls, multiple endocrine failure, Schmidt's syridreme, autoimmune uveitis, adrenaiitis, thyroiditis, autoimmune thyroid disease, gastric atrophy, chronic hepatitis, lupoid hepatitis, atherosclerosis, presenile -dementia, demyelinatmg diseases, subacute cutaneous lupus erythematosus, hypoparathyroidism, Dressier's syndrome, autoimmune thrombocytopenia^ idiopathic thror«bocytopeuic purpura, hemolytic anemia* pemphigus vulgaris, pemphigus, alopecia areata, pemphigoid., scleroderma, progressive systemic sclerosis, adult onset diabetes melMtus (e.g., type II diabetes), male and female autoimmune infertility, ankylosing spondolylis, ulcerative colitis, Crohn's disease, mixed connective tissue disease, polyarteritis nedosa, systemic necrotizing vasculitis, juvenile onset rheumatoid arthritis, glometu uephritis, atopic dermatitis, atopic rhinitis, Goodpasture's syndrome, Chagas* disease, sarcoidosis, rheumatic fever, asthma, recurrent abortion, autt-phosp olipid syndrome, fanner's lung, erythema u tiforme^ post caxdiotomy syndrome, Cushiirg's syndrome, antoininiune chronic active hepatitis, bird-fancier 's l ag, allergic disease, allergic encephalomyelitis, toxic epidermal necrolysis, alopecia, Alport's syndrome, alveolitis, allergic alveolitis, fibrosing
Figure imgf000045_0001
cryoglohulhternia, Waldenstrom^ macroglobulemia, Epstein-Barr virus infection, mumps, Evan's syndrome, and autoimmune gonadal failure.
I S
in another embodiment- the present antibody or its fragment can be used in the treatment of various disorders associated with the expression of GD 0.
A disorder may be any condition that would benefit from teeatme with the present antibody or its fragment This includes chronic and acute disorders or diseases including those
-20 pathological conditions that predispose the mammal to the disorder m question. Nb.n imiting examples of disorders to be treated, herein include autoimmune diseases, immunologic disorders, inflammatory disorders, cancer, hematological malignancies, benign, and malignant tumors, ieuketmas, lymphoid malignancies, and angiogenic disorders.
As used herein, the term "'CD40-associated disorder" or "CD40-associated disease" refers
25 to a condition in which modification or eliniinaiion of cells expressing CD 0 is i ndi cated. These include€D4 i~expressi«g ceils demonstrating abnormal proliferation or CD40~expresslng cells that are associated with cancerous or malignant growth, CD4Q-assoeiated disorders include, but are noi limited to, diseases and disorders of the immune system, such as autoimmune disorders and hvrlammatory disorders. Such conditions include, but are not limited to, rheumatoid arthritis
30 (RA), systemic lupus erythematosus (SUB), sclero rma* Sjogren's syndrome, multiple sclerosis!, psoriasis, inflammatory bows! disease (e.g.., ulcerative colitis and Crohn's disease), pulmonary inflam ation, asthma, and idiopathic tteirahoeytopenic purara (UP). More particular examples of cancers that demonstrate abnormal ex pression of C 0- antigen incl ude B lymphoblasioid ceils, Bnrkiifs lymphoma, multiple myeloma, T ceil lymphomas, Kaposi's sarcoma,
osteosarcoma, epidermal and endothelial tumors, pancreatic, lung, breast, ovarian, colon, prostate, head and neck, skin (melanoma), bladder, and kidney cancers. Such disorders also include, but are not limited to, leukemias, lymphomas, including B cell lymphoma and non- Hodgkin's lymphoma, multiple myeloma, Waldenstrom's macroglobulinemia; solid tumors, Including sarcomas, such as osteosarcoma, Ewing's sarcoma, ma!ignant me!anQnM,
adenocarcinoma, including ovarian adenocarcinoma* Kaposi's sarcoma/ aposi's tumo and squamous eel! carcinoma. U.S. Patent No. 9,090,696.
CD40-espressing cancers thai can be treated o prevented by the present antibodies Of fragments thereof also include, for example, leukemia, such as acute leukemia, acute
lymphocytic leukemia, acute myelocytic leukemia (e.g., trryeloblastic, promyelocytic, myelomonocyttc, monocytic, or eryihroleukemia), chronic leukemia, chmnic myelocytic
(granulocytic.) leukemia, or chronic lymphocytic leukemia; Polycythemia vera; Lymphoma (e.g., Hodgkin's disease or HoivHodgkifi's disease) multiple myeloma, Waldenstrom's
macroglobttliuernia; heavy chain disease; solid tumors such sarcomas and carcinomas (e.g., fi fosarccirtta, myxosarcoma, lipossrcoma.; chondrosarcoma, osteogenic sarcoma* 08teos& eo .aj chordoma, angiosarcoma, endotheliosarcoma, lymphangiosarcoma,
lymphangioendoiheliosarcoma, synovioma, mesothelioma, Ewing's tumor, leiomyosarcoma, rhabdomyosarcoma, colon carcinoma, colorectal carcinoma, pancreatic cancer, breast cancer, ovarian cancer, prostate cancer, squamous cell carcinoma, basal cell carcinoma, adenocarcinoma, sweat gland carcinoma, .sebaceous gland carcinoma, papillary carcinoma, papillary
adenocarcinomas, cystadenocarcmoma, medullar)- carcinoma, bronchogenic carcinoma, renal cell carcinoma, hepat&ma, bile duct carcinoma, choriocarcinoma, seminoma, embryonal carcinoma, Wilms' tumor, cervical cancer, uterine cancer, testicular tumor, lun carcinoma, small cell lung carcinoma, non-small cell lung carcinoma, bladder carcinoma, epithelial cUfcinoma, glioma, astrocytoma, meduUohlastoraa, craniopharyngioma, ependymoma, pinealoma, hentani¾ohlastoraa, acoustic neuroma. oiiaodendroghomav renimsiOiBa, melanoma,
.neuroblastoma mkobl-astonia* nasopharyngeal carcinoma, or esophageal carcinoma).
Also encompassed are methods of treating disorders of B lymphocytes (e.g. , systemic lupus erythematosus, Goodpasture's syndrome, rheumatoid arthritis, and type I diabetes), of Thl- lymphocytes (e.g., rheumatoid arthritis, multiple sclerosis, psoriasis, Sjorgren's syndrome, Hashimoto's thyroiditis, Grave's disease,, primary biliary cirrhosis, e ener's granulom osis, tuberculosis, or graft versus host disease), or of h2-lymphocytes (e.g., atopic dermatitis, systemic lupus erythematosus, atopic asthma, rhiuocotijuiic ivitis, allergic rhinitis, Omenn's syndrome, .systemic sclerosis,, or chronic graft versos host disease).
in some emb diment the immunological disorder is a T cell-mediated immunological disorder, such as a T cell disorder in which activated T cells associated with the disorder express CD40. A«ti~CD40 antibodies of agents can be administered to deplete -such CD40-expressing acti ted T cells. In a specific embodiment, admioistfatiori of anti-CD4 antibodies or agents can deplete CD40-expres$ing activated T cells, while resting T cells are not substantially depleted by the anti~CD40 or agent, i this context, "not substantially depleted" means that less than about 60%, or less than about 70% o less than about 80% of resting T cells are not depleted..
Combination Therapy
The present antibody or antigen-binding portion thereof can be administered alone or in combination with one or more other therapeutic agents (e.g., a second therapeutic agent), in some embodiments, the pharmaceotieal compositions comprising the anti-CD40 antibody or its fragment can further comprise a second therapeutic- agent, either conjugated or unconjugated t the antibody or its fragment. In one embodiment the second agent is another monoclonal or polyclonal antibody or antigen-binding portion thereof In another e bodiments the second agent i s an inimuaosnppressaat In a third embodiment, the second agent is a cytotoxic or cytostatic agent. In a. fourth, -embodiment, the second agent may target a receptor o recepto complex other than CD40 on the surface of activated lymphocytes, dendritic cells or CD40- expressin cancer cells.
Such combination therapy can have an additive or synergistic effect on condition parameters (e<g.s severity of a symptom, the number of symptoms, of frequency- of relapse).
Figure imgf000048_0001
pharmacological intervention serves as a quan titative measure for the siippf essio of the iminnne response. In -vitro, assays : may also be used, for exa ie, a tni xed lymphocyte reaction ( MLR) assay (see, e.g. , Fathman et al, J Immunol. 3 18:1232-8, 1977); a CD3 assay (specific activation of immune cells via an ami-CD3 antibody (e.g., 0&T3)) (see, e.g„ Khanna ei al.,
Transplantation 67:882-9, 1999; hanaa et al. (.1999) Transplantation 67:S58); and an 1L-2R assay (specific activation, of immune cells with the exogeaopsiy added cytokine iL-2) (see, e..g., Farrar et at, J. Immunol 126:1120-5, 1981}.
Cyclosporine A (CsA; CAS No. 59865-13-3; U.S. Patent No. 3,737,433) and its analogs m y be used as an. immunosuppressant, A number of other cycloserines and their derivatives and analogs that exhibit iiBmisnosiippressive activity are .known. C closporines and their formulations are desctihed, for example, in 2004 Physicians' Desk Reference* (2003) Thomson Healthcare, 58th ed.,amd US, Patent Nos. 5,766,629; 5,827,822; 4,220,641; 4,639,434;
4,289,851 ; 4,384,996; 5,047,396; 4,388,30?; 4,970,076; 4,990,337; 4,822,618; 4,576,284;
5,120,710; and 4,894,235.
Tacrolimus (FKS06) is a m crolide which, exerts effects largely .similar to CsA, both wit regard to i ts■ molecular mode of action and its clinical efficacy (Li% Immimol Toda 1 -290~5;, 1993 ; Schrelbef et al . , Immun i. Today, 1 ; 136-42. 992); however, these effects are exhibited, at doses that are 20 to 1 0 times lower than CsA (Peters et al, Drugs 46:746-94, 1993). Tacrolimus and its forftiularions are described, for example, in 2004 Physicians5 Desk Reference* (2003) Thomson Healthcare, 58th ed., and U.S. Patent Nos. 4,894,366; 4,929, 1 ; :¾rd 5,164,495,
Sirolimus (rapamycin) is a imniunosnppressive lactam macrolide produeeabie, for example, by Sirept myees hygmscopictts.. Numerous derivatives of si.ro limes and its analogs and their i¾imdSatiiMis are known and described, for ex mple, in 2004 Physicians' Desk Reference* (2003) Thomson Healthcare, 58th ed., Europea Patent EP 0467606; PCT Publication Nos. WO 94/02136, WO 94/9903 , WO 92/05179, WO 93/ .11 0, WO 94/02385, WO 95/14023, and W 94/02136, and U.S. Patent Nos. 5,023,262; 5,120,725; 5, 1 0,727; 5,177,203; 5,258,389;
•5,1.18,6??; 5,118,678; 5,100,883; 5,151,413; 5,120,842: and 5,256,790,
in some embodiments, the second agent is a cytotoxic agent, which may be a conventional chemotherapeutic such as, for example, doxorubicin, paelitaxei, melphalan, v ca alkaloids, .methotrexate, mitomycin C or etoposide. In addition, potent agents such as CC- 065 analogues, calicheamicitt, aytansirie, -analogaes of doiastatin 10, rbteoxin, and pafytoxirt can h linked to the a»ti-CD40 antibodies or agents thereof.
In additional enmodimefits, the second a ent is a hitinanizetl anti-HER.2 monoclonal antibody; RITUXAN (rituximab; Genenteeh, Inc., South Sao Fraeeiseo, Cali ); a chimeric anti- CD20 monoclonal antibody); QVAREX (AltaRex Corporation, MA); PANORE (Glaxo Wellcorne, HC; a murine lgG2a antibody); ERBtTU (cetuxi ab) (imciane Sysi iss Inc., NY; an anti-EGFR IgG chimeric antibody); V'LIAXt'N (Medlninmne, inc., MD); CAMPATH 1/H (Leukosis,. MA; a hnnimiized IgGl antibody); Smart M1 5 (Protein Design Labs, Inc., CA; a humaxazed anti-CD33 IgG antibody); LymphoCide (imrouttoraedics, inc., J; a humanized aiiti- CD22 IgG antibody); Smart ID1 · (Protein Design Labs, inc., CA; humanized anti-HLA-DR antibody); Oncoiym Techniclone, Inc.* CA; radiola eled murine anti-BLA-D lO antibody); ALLOMUNE (BioTraiisplani, CA; a humanized anti-CD2 mAb); AVAST1N (Genentech, inc., CA; an anti-VEGF hum ni ed antibody); Epratiizamah (hnmunomedies, inc.,. W and Amgea, CA; an anti*€022 antibody); and CEAcide (Immnnomedics, HJ; a humanized anti-CE antibody).
Other .suitable antibodies thai may be used as the second agent include, but are not limited to* antibodies against the following antigens: CA.125*€A15~3, CA19-9, L6, Lewis Lewis X, alpha fetoprotein, CA 242, placental alkaline phosphatase., prostate specific antigen., prostatic acid■■phosphatase, epidermal growth factor. MAGE-1, MAGE-2, MAGE-3, MAGE-4, anti-iEmsferfiM receptor, p97, MUC1 CLB. CEA, gpl 00, MARTI , Prostate Specific Antigen, lL-2 receptor, CD20, CD52, CD33. CD22, human chorionic gonadotropin, CD38, mucin, P21. MPGS and Neit oncogene product. nii-Therapeutic Uses
The antibodies described herein are useful as affinity; purificatio agents, in this process, the antibodies or fragments thereof are Immobilized on a soli d phase such a Protein A resin, using methods well known in the art. The immobilized antibody or its fragment is contacted with a sample containing the CD40 protein (or fragment thereof) to be purified, and thereafter the support is washed with a suitable solvent th t will remove substantially all the material in. the sample except the CD40 protein, which is bound to the immobilized antibody. Finally, the Support is washed with another suitable solvent dtat will release the CD40 protein from the antibody.
The resent anti-CD40 antibodies are also useful i diagnostic assays to detect and/or quantify CD40 protein, for example, detecting CD40 expressio in specific cells, tissues, or serum The antibodies described hereto may be ernpioye in any known assay method, such as competitive binding assays, direct and indirect sandwich assays, and immuaoprecipitatton assays. See, e,g., Zola, Monoclonal Antibodies: A Manual of Techniques, pp. 147-158 (CRC Press, Inc. 1987),
Pharmaceutica compositions
The present disclosure provides a eompos on, e.g,, a pharmaceutical composition, containing an antibody, or anilgen-bmdmg .poi ioii(s) diereof, of The present disclosure, formulated together with a pharmaceutically acceptable carrier. In another embodiment, he composition may contain an isolated nucleic acid encoding the present antibody or antigen- binding portion thereof, and a pharmaceutically acceptable carrier. The composition may be effective to reduce the likelihood of, or increase the duration prior to, transplant rejection, to induce: iinnnrnosuppressiGn, or to treat an autoimmune disorder in a subject. The present composition may be effective in any of the methods described herein.
Pharmaceutically acceptable carriers include any and all suitable solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the Kke that are physiologicall compatible,. Depending o the route of administration, the present antibodies (or antigen-binding portionis) th reof) may be coated in a tnaterial to protect the antibodies (or antigen-binding portiort(s) thereof) front the action of acids and other natsral conditions that may inactivate the antibodies (or antigen-binding portion(s) thereof;!. The carrier can be a Solvent or dispersion medium, containing, tor example, water, ethanoi, polyol (for ex m le, glycerol, -prop lene -glycol, and liquid polyethylene glycol, and the like), and suitable mixtures thereof. The proper fluidity can be maintained, for example, by th use of a coating such as lecith in, by the maintenance of the required particle size in the case of dispersion and by the use of stnfactants. In certain embodiments, the present composition may include isotonic agents, for example, sugars, polyalcohols such as manuito!, sorbitol or sodium chloride in the composition. Prolonged absorption of the injectable compositions ca be brought about by including in {he composition an agent that delays absorption, for example, monostearate Salts and gelatin. Pharmaceutical cojspositions of the invention may contain the present antibody or its fragment, and the second therapeutic agent as described herein (e.g., one or more
immunosuppressants).
The composition may be in the fomi of a solution, suspension, an emulsion, an infusion device, of a delivery device for implantation, or it ma be presented as a solid form (e.g. , a dry powder) to be reconstituted with water or another su ta le vehicle before use. The compositions may be in the form of an oil emulsion, waier½«oil emulsion, water-in-oiHn-water emulsion, site-specific emulsion, long-residence emulsion, stiekyemuision, microemulsion, nanoeimdsion, liposome, mietoparticle, microsphere, nanosphere, nanopai kle and. various natural or synthetic polymers, such as nonresorbab!e impermeable polymers such as etayleueviftyl acetate copolymers and HytrelD copolymers, swellable polymers stich as hydragels, or resorbabl polymers such as collagen and certain, polyacids or polyester s such as those used to make resorbable sutures, that alow for sustained release of the vaccine.
The composition can be in the form of a pill, tablet, capsule, liquid, or sustained release tablet for oral administration; or a liquid for intravenous, intrathecal, subcutaneous or parenteral administration; or a polymer or other sustained release vehicle for local administration.
in one aspect, a solution of the compositi on is dissolved in, a phannaeeuticafly acceptable carrier;, .eg.5 an aqueous carrier if the composition is wafer-soluble. Examples of aqueous solutions include, e.g., water, saline, phosphate buffered, saline. Hank's solution. Ringer's solution, dextrose/saline, glucose solutions and the like. The formulations can contain pharmaceutically acceptable auxiliary substances as required to approximate physiological conditions, such as buffering agents, tonicity adjusting agents, wetting agents, detergents and the like. Additives can also include additional active ingredients such as bactericidal agents, or stabilizers. For example, the solution can contain sodium acetate, sodium lactate, sodium chloride, potassium chloride, calcium chloride, sorbitan monolaurate or tnethanclamine oleate. Solid formulations can be used in The present disclosure. They can be formulated as, e.g., pills, tablets, powders or capsules, f or solid compositions, conventional solid carders can be used which include, erg,,- e annitol, lactose, starch, magnesium stearate, sodium saccharin, talcum, cellulose, glucose, sucrose, magnesium carbonate, and the like, .Suitable pharmaceutical exeipients include g., starch, cellulose, talc, glucose, lactose, sucrose, gelatin, malt, rice, .flour, chalk, silica gel, magnesium stearaie, sodiiun stearate, glycerol . o.n0siearate5 sodium c¾lo¾idef dried skim milk, glycerol, r pylene glycol, water, ethanol.
Methods well known in the art for making formulations are found, fo example, in ''Remington: The Science and Practice of Pharmacy*' (20th ed, ed. A.R. Gennaro AR., 2000, Lippiricoit Williams & Wtfl ins, Philadelphia, PA),
In one aspect; the phannacentieal fomra!aiions comprising compositions or nucleic acids,, polypeptides, or antibodies of the invention are incorporated in lipid monolayers or biiayets, e.g., liposomes, U,S, Patent Mos. 6,110,490; 6,096,716; 5,283,185 and 5,279,833. Aspects of the ipverttiort also provid formulations in which water soluble nucleic acids,, peptides or
polypeptides of the tByemtott ha ve been attached to the surface of the monolayer or bilayet. For example, peptides cap be attached tO'hydfa¾ide-PE0 diStear6ylpho$phatidyl} ethanohMime- ccmiaining liposomes (see, Zalipsky,, ioconjug, Cheni. 6: 705-708, 1995). Liposomes or any form of lipid membrane, such as planar lipid membranes or the cell membrane of an intact cell, etg. a red blood cell, can be used. Liposomal formulations can be by any means, including administration intravenously, transdeftnally (see., e.g. , Vutta, J, Pharm. Sea. 85; 5-8, 1996), transmucosaUy, or orally. The invention also provides pharmaceutical preparations in which the nucleic ¾l , peptides aud/or polypeptides of the in vention, are incorporated within micelles and Or liposomes (see, e.g., Stmtres, L Pharm. Pharmacol. 46: 23-28, 1994; Woodle, Pharm Res. 9: 260-265, 1 92). Liposomes and liposomal formulations can be prepared according to standard methods and are also well known in the art Akimaru, Cytokines MoL T ier. 1 ; 197-21 , 1995. Alviiig. Immunol, Rev. 145; 5-31, 1995. Szoka, Ann. Rev* Blophys, Bloeng, 9: 467, 1.980. U.S. Patent Nos., 4, 235,871 ; 4,501,728 and 4,837,028.
In one aspect, the compositions are prepared with carriers that will protect the peptide against rapid elimination from the body, such as a controlled release formulation,, including implants and microencapsulated, delivery systems. Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, olyanhydrides, polygiycolic acid, collagen,
polyorthoesters, and .poly lactic acid. Methods for preparation of such fomiulations will be apparent to those skilled in the art Liposomal suspensions can als be used as pharmaceutical !y acceptable carriers. LIS, Patent No. 4,522,811. A composition of The present disclosure cart be administered by a variety of methods known in the art. As will be appreciated by the skilled artisan, the route and/or mode of administration will vary depending pon the desired 'results. Administration may be parenteral, intravenous, intrathecal, subcutaneous, oral, topical, local, intramuscular, intradermal, transdermal, subderrnal, rectal, spinal, or .epidermal* intravenous delivery by continuous iniusidn is one exemplary method ib administering the present antibodies.
To administer the present agen by certain routes of administration, it may be necessary t coat the agent with, or coadminister the agent with., a material to prevent its inaedvatioii. For example, the agent may be administered to a subject in m appropriat earner, tor example, liposomes, or a diluent. Pharrnaeeiitically acceptable diluents include saline and aqueous buffer solutions. Liposomes include water-in-oil-in-water CG emulsions as well as conventional liposomes (Sfrejau et al., J N& iimmwnol. 7:27-41, 1984),
Parenteral administration can include modes of administration other tha enteral and topical administration, usually by injection, and include, without: limitation, intravenous, intramuscular., intraarterial* intrathecal., intracapsular* intraorbital, Intracardiac, intradermal, intraperitoneal, transtracheal, subcutaneous, subcuticular, ktraarticular, subcapsular,
subarachnoid, intraspinal, epidural 'and intrasternal injection and. infusion. 'Examples of suitable aqueous and nonaqueous carriers which may be employed in the pharmaceutical compositions of the invention include water, ethanol, polyols (such as glycerol, propylene glycol polyethylene glycol, and the like), and suitable mixtures thereof, vegetable oils, such as olive oil, and injectable organic esters, such as eihyl oleate. Proper fluidity can be .maintained, fo example, by the use of coating materials, such as lecithin, by the mainte nce' of the required particle skein the case of dispersions, and by the use of surfactants.
Methods for preparing parenierally a ministTable compositions will be known o apparent to those skilled in the art and are described in detail. Bai, J. HeuxoiramunoL. SO: .65-73 s 1997. Warren, J. Neurol. Sci. 152: 31-38, 1997, Tonega a, J. Exp. Med. 186: 507-515, 1997. Formulations for parenteral administration may, for example, contain excipients, sterile water, saline, polyalkylene glycols such as polyethylene glycol, oils of vegetable origin, or
hydrogenafed napthalenes. Biocompatible, biodegradable lactide polymer, 'lacttde glycolide copolymer, or polyoxye hylene-polyoxypropylene copolymers may be used to control the release of the present agent. Nanapartieulaie fbrinulatioos (e÷g.¥ biodegradable nanopartieles, solid lipid .nanoparticies, liposomes) may fee used tocontrol tlie biodistribution of the present agent. Other potentially useful deli .very systems include ethyl ens-vinyl acetate copolymer particles, osmotic pumps, intrathecal um s, implantable infusion systems, and liposomes. The concentration of the agent in the formulation varies depending upon a number of factors, including the dosage of die drug to he administered, and die route .of adin istratior
Sterile injectable solutions can be prepared by incorporating the present agent in the required amount in an appropriate solvent wit one or combination of ingredients enumerated above, as required, followed by sterilization microfiltration. Generally, dispersions are prepared by incorporating the present agen into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above. In the case of sterile powders f r the preparation of sterile injectable solutions* the methods of preparation include vacuum drying and freeze-drying (lyophilizatioti} that yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof. Dosage regimens are adjusted to provide the optimum desired response (e.g., therapeutic response). For example, a single bolus may be administered, several divided doses may fee administered over time or the dose may be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation. For example, the antibodies of the invention ma be administered once or twice weekly b subcutaneous injection or once or twice monthly by subcutaneous infection. Parenteral compositions may be formulated in dosage unit form for ease of administration and uniformit of dosage. Dosage Unit form as used herein refers to physically discrete units suited as unita y dosages for the subjects to be treated; each unit contains a predetermined quantity of active agent calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier. The specification for the dosage unit forms of the invention are dictated by and directly dependent on (a) the unique characteristics of die acti ve agent and the partic ular therapeutic effect to be achieved, and (b) the limitations inherent in the art of agenting such an active agent for die treatment of sensitivity in individuals.
When administered orally, the present compositions may be protected from digestion. This can fee accomplished either by completing the antibody or antigen-binding portion thereof with a composition to render it resistant to acidic and enzymatic hydrolysis or by packaging the ant ibody or antigen-hindittg portion thereof in an appropriately resistant carrier such as a liposome. Means of protecting agents front digestion are well known in the art. Fix, P arm Res. 13: 1760-1764, 1996, Sarnanen. J. Pharm. PharaiacoL 48 1 19-135, 1996. U.S. Patent No,
.5,3.91,377,.
For t a smural or- transdermal- adn itisimtion, penetrants appropriate to the battier to be permeated can be used in. the formula o . Such penetrants are generall known in the art, and include, . . , tor transonic osal administration, bile salts and fusidic acid derivatives. addition, detergents ca be used to facilitate permeation. Transruueosal administration can be through nasal sprays or risin suppositories, Sayarii, Crit. Rev. Ther. Drug Carrier Syst. 13: 85-184, 1996, For topical, transdermal administration., the agents are formulated into ointments* creams, salves, powders and gels. Transdermal delivery systems can also include, e.g., patches.
The present compositions can also be administered, in sustained delivery or sustained release mechanisms. Par example, biodegradeable microspheres or capsules or other
biodegradeable polymer confi gyrations capable of sustained delivery of a peptide can be included in the formulations of the invention (see, e.g.. Putney, 'Nat. Blotechno!, 16: 153-157, 1998).
For iuhaiatlon, the preseu compositions can be delivere using any system known in the art, including dry powde aerosols, liquids delivery systems, air jet osh lkers, prope!knt systems, and the like. Patton, Biotechniques 16 141-143, 199$, Also can be used in The present disclosure are product and inhalation, delivery systems for polypeptide maeromolecules by, <¾. , Dura Pharmaceuticals (San Diego, Calif), Aradigm (liayward, Calif), Aerogen (Santa Clara, Calif ), Inhale Therapeutic S stems (San Carlos, Calif), and the like, For example, the
.pharmaceutical formulation cart be administered in. the form of an aerosol or mist. For aerosol administration, the formulation can be supplied in finely divided form along with a. surfactant and propellant. In another aspect, the device for delivering the formulation t respiratory tissue is an inhaler in which the formulation vaporizes. Other li id deli very systems include, f?.^, air jet nebulizers.
Compositions can be administered in a singl dose -'treatment or in multiple dose treatments on a schedule and over a time period appropriate to the age, weight and condition of the subject, the particular composition used, and the route of administration. The frequency of adniroistralion can var depending on any of a variety of 'i¾ct»rs, 6,§., severity of the symptoms, degree of t naitnoprotectiorj desired, whether the composition is used or prophylactic or curative purposes, etc. For e ample;, in one embodiment, the composition according to the invention is administered once per month, twice per month, three times per month, every other week (qow), once per week (qw), twice pe week (bi w) , three times' per week (ti w), four times per week, fi ve times per week, six times per week, every other day (qod), daily (qd}} twice a da (qid), or three times a day (tid).
The d ation of administration Of a polypeptide according to the invention, e.g., the period of time over which the composition is■ administered can vary, depending on any of a variety of factors, e.g., subject response, etc* For example, the composition can be administered over a period of time ranging from about one day to about one week, from about two weeks to about four weeks, from about one month to about two months, from about two months to about foot months, from about four months to about: six months, from about si months to about eight months, from about eight months to about 1 year, from about 1 year to about 2 years, or from about 2 years to about 4 years, or more.
It is advantageous to formulate oral or parenteral composi ions in dosage unit form for ease of administration and uniformity of dosage. Dosage unit form as used herein refers to physically discrete units suited as unitary dosages for the subject; to be treated; each unit containing a predetermined quantity of active agent calculated to produce the desired therapeutic effect in association with the required phamiaceuticai carrier.
Actual dosage levels of the active ingredients in the pharmaceutical compositions of The present disclosure ma be varied so as to obtain an amount of the active ingredient which is effective to achieve the desired therapeutic response for a. particular patient, composition, and mode of administration, without being toxic to the patient. 'The- selected dosa e level will depend upon a variety of pfearaiacokinefic factors including the activity of the particular compositions of The present disclosure employed, or the ester, salt or ami de thereof the route of administration, th time of administration, the rate of excretion of the particular agent bein employed, the duration of th e treatment, other drugs , agents and/or material s used in combi nati on with the particular compositions employed, the age, sex, weight, condition, general health and prior medical 'history of the patient being treated, and like factors well known in the medical arts. A physician 0*" veterinarian aving ordinary skill in the art can readily determine and prescribe the effective amo unt of the phannaceutical composition required For example, the physician or veterinarian can start, doses of the agents of the invention employed in the pharmaceutical composition at levels lower than that required in order to achieve the desired therapeutic effec and graduall increase the dosage until the desired effect is achieved. In eneral, a suitable daily dose of a composition of the invention will be that amount of the agent which i the lowest dose effective to produce a iherapeuiic effect. Such an effective dose will generally depend upon the factors described above, if desired, the effective daily dose of a therapeutic composition may be .adm nistered as two, three, four, s x or more sub-doses adni istered separately at appropriate intervals throughout the day, optionally., in unit dosage forms.
The data obtained from the cell culture assays and animal studies can be used in formulating a range of dosage for us in humans. I one embodiment, the dosage of such agents lies within a range of circulating concentrations that include the BD¾» with little or no toxicity. The dosage can vary within this range depending upon the dosage form employed and the route of administration utilized, in anothe embodiment, the therapeutically effective dose can he estimated initially from cell culture assays, A dose can be formulated in animal models to achieve a circulating plasma concentration range that includes the IC$o (i- & . the concentration, of th test agent which achieves a half-maximal inhibition of symptoms) as determined in cell culture. Sottderstrop; Springer, Sem, Immnnopathol, 25: 35-45, 2003, Nikuia i «/,, Ihhal Toxicol, 4(12 : 123-53, 2000.
An exemplary, non-limiiirig range for a therapeutically or prophylactieally effective anioinn of an antibody or antigen-binding portion of the in vention is from about 0.001 to about 100 mg/kg body weight or more, about 0. i to about 100 mg kg body weight, about 0.01 to about 80 mg/kg bod weight, about -0,001 to about 60 mg kg body weight, about 0.01 to about 30 mg/kg body weight, about 0, 1 to about 2.5 mg/kg body weight, about.0.5 to about 25 mg/kg body weight, about 0, 1 t about iS'mg kg body weight, about 0.1 to about 20 mg kg body weight, about 1 to about 20 mg/kg body weight, about 0.75 to about 10 mg/kg bod weight, about 1 to about 10 mg/kg body weight, about 2 to about 9 mg/kg bod weight, about 1 to about 2 mg/kg body weigh t,about 3 to about 8 mg/kg bod weight, about to about 7 .mg/kg body weight, about 5 to about 6 mg/kg body weight, about 8 to about 13 mg/kg body weight, about 8.3 to about 12.5 i«¾/k¾ bodv wekfet about 4 to about 6 ro¾/fc¾ body weight, about 4.2 t about 63 mg kg body weight, about 1,6 to about 2.5 mg/kg body weight, about 2 to about.3 mg/kg bod weight, or about 10 mg/kg body weight The dosage administered to a subject may also be about 0.1 mg kg to about 50 mg/kg, about i mg/kg -to about 30 mg/kg, about 1 rag/kg to about 20 mg/kg, about 1 nig/kg to about 1 mg kg, or about 1 mg kg to about 10 mg/kg of the subject's body weigh t Exemplary doses include, but are not limited to, from 1 ng/fcg to 100 trig/kg. In. some embodiments, a dose is about 0.5 mg/kg, about I mgkg, about 2 mg/kg, about 3 mg kg, about 4 mg kg, about 5 mg kg, about 6 tug/kg, about 7 mg kg, about 8 rug/kg., about 9 mg/kg,. about 10 mg/kg, about 11 mg/kg, about 12 mg k , about 13 mg kg, about: 14 mg/kg, about 15 mg/kg or about 16 mg kg of the subject's body weight. WO 94/041 &$÷
The composition is formulated to contain effective amount of the present antibody or antigen-biudiug portion thereof, wherein the amount: depends on. the animal to be treated and die condition to be treated, in one erohodsmeut, the present antibody or antigen-binding portion, thereof is administered at dose ranging from about 0.01 mg to about 10 g, from about 0, 1 mg to about 9 g, from about 1 mg to about 8 g, from about Ϊ mg to about 7 g, from about 5 mg to about 6 g, from about 10 mg to about 5 g, from about 20 mg to about 1 g, from about 50 mg to about 800 mg, frorn about 1 0 rug to about 500 mg, fr m about 0.0kag to about 10'.gs from, about 0.05 fig to about 1.5 mg, from about 10 jig to about 1 mg protein, from about 30 § to about 500 ' jig,: f om about 40 pg to about 300 pg, from about 0* 1 pg to about 200 mg, from abou 0,1 pg to about 5 pg, from about 5 pg to about 10 pg, from about 10 g to about 25 pg, from about 25 to about 50 g, from about 50 g to about 100 pg, from about 100 g to about 500 pg, from about 500 p to about I mg, from about 1 mg to about 2 mg. The specific dose level for any particular' subject depends upon a variety of factors including the activity of the specific peptide, the age, body weight, general health, sex, diet, time of administration, route of administration, and rate of excretion, drug combiuatiou and the severity of the particular disease undergoing therapy.
Articles of Manufacture
in another aspect, art article of manufacture containing materials useful for the treatment of the conditions or disorders described herein is included. The arti cle of manuiucture comprises a container and a lafe l. Saii feie co itainers include, tor example, bottles, vials, syringes, and test tubes. The containers may be formed from a variety of materials such as glass or plastic. The container holds a composition that is effective 'for treating the condition and may have a sterile access port. For example, the container may be an intravenous solution bag or a vial having a stopper pierceabie by hypodermic injection needle. The acti ve agent in the composition may be die humanized a»ti~CD40 antibody Or its iragi¾e i5 or any other antibod o its fragment as described herein. The label on or associated with the container indicates that the coraposition is used for treating the condition of choice. The article of ianufaciiire may fdrihe comprise a second container comprising a phari»acet!tically-a ceptabie butler, such as phosphate-btrffered line, Ringer's solution, and dextrose solution, It may farther include other materials desirable from a commercial and user standpoint, including other buffers, diluents, filters, needles, syringes, and package inserts with jiistrirc iois for use,
In one embodiment, the invention provides for a kit containing an anti~ D4 antibody or antigen-binding portion thereof Additional components of the kits may include one or more of the following: instructions for rise; other reagents, a therapeutic agent, or an agent useful .for coupling a antibody to label or therapeutic agent, or other materials for preparing the antibody for administration; pharrnaceutically acceptable carriers; and devices or other materials for administration: to a subject.
The kit may or may not contain the second therapeutic agent as described herein. The agents can be mixed together, or packaged separately within the kit
The kit may or may not contain at least, one nucleic acid encoding anti~CD40 antibodies or ftagraent thereof and instructions for expression of the nucleic acids. Other possible components of the kit include expression vectors and cells.
The present antibody or its -fragment can be used in a diagnostic kit Le a packaged combination of reagents in predetermined amounts with instructions for performing the diagnostic assay. Where the antibod is labeled with, an enzyme, the kit may include substrates and cefaclors required by the enzyme such as a substrate precursor that provides the detectable chraftiophore or fluorophore. I» addition, other additives may be included such as stabilizers, buffers (for example a block buffer or lysis buffer), and the like. The relative amounts of the various reagents may be varied widely to provi de for concentrations in solution of the reagents 'that ½bsia8iially:-0 ti»ji3Be-rte sensitivity of the assay, The reagents ma fee provided as dry powders, usually lyop'hiii'zed, including excipients that on dissolution will provide a reagent solution having the appropriate- eventration, Epito e mapping
Methods for identifying the particttlar epitope to which an antibody hinds are nowtt to those skilled tn the art. Standard techniques include peptide scanning, in which overlapping, short peptides (for example, 10-30 amino acids, e.g.., 20, in length) derived from the full length protein to which the antibody binds are individually tested lor their abilit to. bind the antibody:. From such experiments* the region of the protein to which the antibod binds can the be determined.
Site-directed mutagenesis can also be used to identi fy the antigenic region(s) of a particular protein* In this approach, point mutations' are .systematically introduced into die target polypeptide and the abilit of the antibody to bind the peptide with mutations at. various positions is used to determine whether a particular regi on of that protein contains the epi tope to which the antibody binds.
Antibody epitopes can also be identified usin high-throughput mutagenesis techniques, such as Shotgun Mutagenesis■{Integral Molecular, Inc., Philadelphia, Pa.), which can be used to generate large .numbers of mutations within the target protein. Such methodologies permit efficient identification of epitopes within the protein.
To determine if various aiiti bodies to CD40 bind similar epitopes, m m yitrv competitive blockade assay may be performed, In am embodiment, the antibodies 2C10., 3AS aid€hi220, a chimeric IgGl CP40-specIfie antibody, were used in the assay . 2C1Q was conjugated, to allopbycocyaniH (APC) using the Lightning Link antibody labeling kit (Novas Biologies, 'Littleton, CO). Human PB Qs were incubated with escalating concentrations · of 2C1 , 3A8, or Chi220, and then, stained witb ihe APT-coiijugated 2C10 to assess tie abilit of eae antibody to cross-block 2C10. Binding of APC-conjiigated 2C10 decreased with increasing concentrations of 2C10 but not; Chi220 or 3 AS as shown- in Figure 12, The result indicates that 2C 10 binds a unique epitope distinct from either Chi 220 or 3A8.
Cl>40 frag ents
The invention also features fragments f CP40 that include the epitope that is specifically bound by the 2C30 antibody. The 2C3 ø antibody was raised against the extracellular portion of th CD40 polypeptide. The 2C 10 antibody reacts with a portion of this sequence (SEQ ID MOs:S and 6),
The disclosure therefore features CD40 fragments (e.g., fewer than ISO, 120, 100, 80, 70, 60j 50, 40, 30, 0, i 15, 12, 11, } 0, % 8S or 7) amin acida in. length, that are specifically bmrod by the 2CI0 antibody,, in certain embodiments, the fragment is 8-1 , 8-12, 8-15, 8-20, 8-30, 8- 40, 8-50, 8-60, 8-70, 8-80, or 8-100 amino acids in length. In other embodiments, the fragment is 7-10, 7-12, 7-35, 7-20, 7-30, 7-40, 7-50, 7-60, 7-70, 7-g05 or 7-100 in length.
The 2C10 antibody binds to a epi tope present within the sequence of amino acid 8-10, 8-12* 8- 15, 8-20, 8-30, 8-40, 8-50, 8-60, 8-70, 8-80, 8-100, 7-10, 7-12, 7-15, 7-20, 7-30, 7-40, 7-50, 7- 60, 7-70, 7-80, or 7- 100, of SEQ ID 'NO; 6.
The tnveatioh also features fusion protein that includes fragmen described herein and a heterologous sequence, lit certain embodiments, one of the fusion partners is the Fc protei (e.g., mouse Fc or hitman Fc). Th fusion amy also be a sequence iisefhl for antibody production, e.g., a maltose bindi g protein or GST, to other embodiments, the fas ion protein is. a purification or detection tag, for example, proteins that may be detected, directly or indirectly such as green fluorescent protein, hemagglutinin, or alkaline phosphatase), DNA binding domains (for example, GAL4 or Lex A), gene activation domain (for example, GAL4 or VP 16), purification tags, of secretiorrsignai peptides (e.g-., preproiyrypsin signal sequence). In oiber em pdiiBeri s, the fusion partner may be a tag, such as c-myc, poly histidine, or FLAG. Each fusion partner ma contain one or more domains, e.g.* a reproirypsm signal sequence and FLAG tag.
The CD40 fragments and fusion proteins described herein may be produced by 5 transforma on of a sui table host ceil with a polynucleotide molecule encoding the pol ypeptide fragment or .fusion protein in a suitable expression v ehicle.
Any of a wide variety of expression systems may be used. Exemplary expressio
.s stems- include prokaryotic hosts (e.g.. E. coil) and eukaryoiic hosts (e,g,s 5. cerevisiae* insect ceils, e.g. s Sf21 cells, or maniroa!ian cells,, e.g., NIB 311, HeLa, or preferably COS cells), Such
! 0 cells are available ftoro a wide range of sources ( . ., the American Type Culture Collection, Manassas, VA), The method of transformation or tra sactio and the choice of expression vehicle will depend on the host system selected. Transformation and transfectiOB methods are described, e.g., in Kneherlapati et al. {CMC Crit. Rev. wchem. 16;349~3?9, 1 82) and in DNA Transfer (Mimed Ceih (eds., Ravid and resfiiiey, Wiley-Oss, 1998); and expressio
1,5 vehicles may be chosen from those provided, e.g., in Vectors: Expresston Systems: Essentia! Techniques (ed.> Jones, Wiley &. Sons Ltd., 1998).
Once the recombinant C040 polypeptide frag erit or fusion protein is expressed, it can be isolated, e.g., using affinit chromatography , In one example, an -antibody specific to GD40 (e.g., an antibody or its fragment as described herein) ma be attached to eolam and used to 0 isolate the polypeptide fragment or fusio protein. Lysis and fractionation of fragment- or fusion protein-harboring cells prior to affinity chromatography may be performed, by standard methods (see,, e,g. ; Methods in Btizymology, volume 1.82, eds., Abe!son, Simon, and Deutsche*, Elsevier, 1990). Once isolated, the CD 0 polypeptide fragment or fttsion protein can, if desired, be further purified, e.g., by high performance liquid chromatography (see e.g., Fisher,. L-ebamtory
5 Techniques in Biochemistry ndMakcuktr Biologic eds,. Work and Burden, Elsevier, 1980: and Scopes, Pratem PmifieatwtK Pnncipies arid Practice,. Third Edition, ed>. Cantor, Springer, 1994).
The CD40 polypeptide fragments or fusion proteins can also be prodace by chemical synthesis (e.g., by the methods described in Solid Phase Peptide Synthesis, 2nd e&, 1984, The
Figure imgf000064_0001
The present antibodies s antige« iifiding portions thereof, compositions and methods ca be used in all. vertebrates, .g., mammals and non-mammals, including human mice, rats, guinea pigs, hamsters, dogs, cats, cows, horses, goats, shee , pigs, monkeys,, apes, gorillas,
chimpanzees, rabbits, ducks, geese, chickens, amphibians, reptiles and. other animals. lie follo wing examples of specific aspects for carrying out the present disclosure ate offered for illustrative purposes only, and are not intended to limit the scope of The present disclosure in any way. i¾»«iple ! Production and !deii iileation of A«ti~ )4§ Murine Antibodies
Mice (strain A!) were immunized with a fusi on protein consisting of the extraeel&lar domain, of rhesus macaque ( mulaiia) CD40 (amino acid sequence;
EPPTACREKQYLtKSQCC^
KYC PHLGLRVQQ GXSB-TDTICTCEE(3LHCMSESCESCV; SEQ iD NO;S) fused to maltose binding protein (CD t ~MBF). The amino acid sequence in this region of the rhesus .macaque CD40 protein differs from human GD40 protein at five- amino acid positions (human amino acid sequence:
EPPIACRBKQYLrNSQCCSi QPGQ
KYCDPNLGLRVQQK-GTSETD TiCTCEEG HCTSEACBSCV SEQ ID!NO†©). CD4Q~MBP was administered to mice multiple times with complete Freui f adjuvant and incomplete Freund's adju vant Splenocytes from, imimniized mice were fused wit the mouse myeloma cell lin SP2/0 and hybrids selected using standard hyhrkioraa technology.
Antibodies were selected tor reacti vity to a second fusion protein consisting of the same rhesus CD40 domain fused to gluiamine synthetase (CD4 -GST), Antibodies reactive to CD40- GST by ELISA were fin her tested for reactivity to native CD40 expressed oft rhesus macaque blood & cells, human blood B cells and rhesus macaque B-iytnphoblastoid cell lines by flow cytometry. As a final level of selection, antibodies were tested in an in vitro assay for their ability to inhibit human or rhesus rnacaque B cell activation:- alter co-eutture CD 154-expre8Si:ng Jitrkat D 1,1 cells. A stable subclone of anti~CD40 antibody 2CI0 was obtained by limiting, dilution. The antibody is a mous IgG l -kappa.
Lowe at, A wove! monoclonal antibody to CD40 prolongs islet .allograft survival, Am. J. Transplant (2012) 12(8}:2079-S7.
Antibody cloning
Variable regions of monoclonal, antibodies can be cloned using any method known in the art,
Figure imgf000065_0001
Mouse kappa forward; 5' ~ OCT GAT GOT GCA CCA ACT GTA TCC - 3' (SEQ ID NO; 8) Mouse IgGl reverse: 5* ··· GGC AAC GTT GCA GGT CTC GC ··· 3 > (SEQ ID NO:9)
Mouse IgGl forward: 5* - CTG GAT CTG CTG CCC AAA CTA ACT CC - 3> (SEQ ID NO; 1.0)
PCR products were cloned into a commercial cloning vector and were sequenced using standard sequencing techniques. The resulting sequences are provided in Figure 1.
The immunoglobulin variable region genes were cloned from, the hybr osnas secreting asti~C 40 antibody clone 2C 10 and from antiAuman CD40 clone 3 AS (Rwekkeboom et ai, Immunology 79:439-44, 1993) (obtained from the American Type Culture Collection, ATCC, Vienna, VA) using 5 s rapid amplification of cDNA e is-poiy erase chain reaction. The immunoglobulin heavy and light chain variable regions were subc ned into expression vectors containing rhesus IgGl or rhesus IgG4 heavy chain and rhesus kappa light chain constant region se ue c s
Recombinant heavy and Sight chains were subclened into expression vectors and packaged m retroviral vectors used to transduce Chinese hamster ovary cells us n the GPE *** expression technology (Caialent . Pharma Solutions, Midcileion, Wt). A poo! of transduced cells was grown in seruro-iree medium and secreted antibody was purified by protein A affinity chromatography. The purified chimerit rhesus IgG 1 (2C10RI, 3A8RI) and lgG4 (2C1GR4) antibodies were diafMtered into phosphate buffer; endotoxin levels were confirmed to be less than I endotoxin nnit/rng.. iO Aplibo d;y c har ctgri atioft
C 10 hinds io CD40 amipremtits binding of CD] 54
To assess, the ability of 2010 to bind to bot rhesus and human C.P46, teeostthinantly expressed human or .rhesus C 40 were adsorbed to ELISA. plates and reacted with varying concentrations o 2Cl0. Binding of 2C 10 to CD40 was detected using goat anti-mouse lg(j~
1,5 HRP in an ELISA.. The tesults in Figure 2B show that 2C10 has similar binding affinities to rhesus and human CD40, which is important for clinical 'translation of 2C10. To confirm the abili ty of 2€ 0 to block binding of its cognate ligand, 01315 * rhesus and human B cells were incabated with escalating concentrations of 2C10 or an isotype control and then intubated with histidine- agged soluble GDI 54 (R&D Systems, Minneapolis* MN) and analyzed for histidrae
•20 expression. 2C ί 0 blocked the binding of CDl 54 in dose-dependent manner (Figure 3),
Indicating that .2G.1O can-effectively block: the interaction of T ceiJ-hound CDl 54 wit CD40 on B cells and antigen-presenting cells.
Table 2 C 4S Receptor inding Kinetics of 2C16
25
Figure imgf000066_0001
2C1Q bktcks B ii activation m rkesm monkey and human peripkemi ' M& d ommmfmr eetts
The anil~€D40 antibody 2C10 was characterized with respect to its ability to affect B cell activation both ris ng rhesus monkey and human peripheral blood mononuclear ceils (PBMGs). CD20 expression was chosen as being an indicator of B cells, a d expression of€023, CD80, and CD86 is associated with B ceil activation, 2C1.0 was first assessed for its ability to bind to CD20, Rhesus or human PBMCs were incubated with fluorocbrome-coryiigated 2C10 and an. mii~CB20 antibody. Flow cytometric analysis was used to confirm the binding of 2 30 to human and rhesus C02O+ B cells (Figure 2 A}., in another set of experiments, PBMCs from either rhesus monkey or humans were cultured eithe in the presence or absence of CD 154 * Jurkat DU ceils, an immortalized T lyiiiopliocyte cell Hue. Activation of B cells was determined by measuring expression of three markers (CD23, CD80, and P86) in CD20+ cells present in the PBMCs. The general scheme of ibis assay is shown in Figure 4. As shown; in Figure 4, e lturmg PBM Cs in die presence of Jurkat celts resul ted in increased expression of all three markers, indicating that B cells are activated by the CD 154'" Jurkat cells.
To test die ability of antibodies to block B cell activation, PBMCs and Jurkat cells were co-cul tured in the presence or absence of one of three antibodies: 3 AS, 5C8, and 200. The 3 AS antibody is a mouse anti-human CD40 antibody (ATCC Deposit No. HB-12Q24), and SC8 is an anti-CDi 54 antibody (ATCC Deposit No. C L- 1.0915). Each was used as a positive control Co-cultures were conducted over a range of five orders of raag tude of antibody eOBcentratioB (0.001 ,ug to 10 μ§). As shown in Figure 5, 3A8 did not block B cell activation in rhesus PBMCs, as measured by CD23 expression, whereas both 2C10 and 5C8 were able to block activation with, similar efficiency. Corres onding changes were also observed with CDSO and CDS6 expression. These results indicate that 2C10 binds to a different epitope o CD40 than 3 AS. These results also indicate that 2C10 acts primarily as a CD40 antagonist in contrast t& .3 A8 which has previously been shown to act as partial agonists with weak stimulator potential (Adams efaJ., J ImmMtmi. 174:542-50, :2005f Badell er l,. Mm. J. Ι ηφΐαηί. accepted for publication, 201 1 ), When a similar experiment was performed using human, rather than rhesus, PBMCs, both. 2C10 and 5C8 were again observed to block B cell activation, as m asured by CD86 expression, with similar efficiency. Here, the 3 AS antibody, unlike with the rhesus PBMCs, blocked B cell activation (Figure 6).
Figure imgf000068_0001
2C.10 prevents a T ceM-dependent awj ody r sfmnse
Having established that 2C1.0 binds to a unique epitope o CD40, inhibits B cell acti vation similarly to an anti-CD 1.54 antibody, and lacks agonistic properties, we then characterized the effects of 2C 10 i vivo. Recombinant mouse-rhesus chimeric forms of 2C 10 were generated using either rhesus IgGI '(2C10 1) or IgG4 (2CI 0R4) heavy chain and rhesus kappa light chain constant region sequences. A chimeric rhesus IgG I form of 3A8 (3A8R1 w s also generated for use as a control.
Rhesus macaques were .immum¾ed. once ø.» day ¾ero with 4 *ydroxy-3~
nitraphe ryiacetyl-conjugaied keyhole limpet hernocyanin '( M, 10 nrg ΪΜ) andgen (Biosearcl Tec hnolog ies. Novate, CA). Prior to ininmnization md at one week, cohorts of three animal s received an. intravenous dose (50 mg kg) of 2C10RI , 2C10R4, 3A8iJ , or saline. All animals were observed for 70 days, and flow cytometry was performed weekly. Treatment with either recombinant 2C10 isotypes resulted in modest change in peripheral B cell counts -(Figure 8) compared to the previously reported significant and prolonged depletio of peripheral B cells occurring in animals receiving either 3A8R1 (BadeH et al,, AM, J. Transplant. 1.0:21.4, 2010) or Chi220 (Adams et al, J, JmmufmL 174;542-50, 2005),
T cell-dependent antibody response to KLH-MP were tested by ELIS A. Plates were coated with KLB (0.01. tng mi, Sigma, St. Louis, MO) and blocked with 'Super Block (Thermo - Scientific, Woodstock, GA), Pre- and post-ireatment plasma samples were serially diluted, plated for 1 hr, and washed with phosphate-buffered saline/0.05% 1 ween. Anti- LH antibodies were detected by incubating for ί hr with monoclonal anti-rhesus fgG-horseradish peroxidase (clone I B3, NHF Reagent Resource, Boston^ MA). Plates : were then incubated with Peroxidase Substrate Solution (KPL), Stop solution (KPL) was then added, and optical density was read on an ELISA plate .reader at 450 ran. A sample was considered positi ve at a given dilution.: f the optical density reading of the post-treatment plasma exceeded the optical density- of the pre- treatment plasma at the same dilution by 2-fold. Following KLM immunization, control animals developed higfe-titer KLM-specific igG (Figure 9)t Animals thai received 3ASR1 also develo ed anti-KLH responses, but titers were approximately 10-fold lower than controls despite significant depletion of B ceils, in contrast, the generation of IgG antl-K.LH antib dies was neatly completely blocked through day 56 in all animals that received eithe 2 i0iJ or 2C10R4.
2C10 significantly prolongs iski allograft survival m macaque mode! of allogeneic isl&t transplantation
We further tested 2C10K.4, the CD4 purified chimeric thesis IgG4 antibody, in a nonluinian primate allogenic islet transplant model (Figure' 10). Rhesus macaques weighing 10- 20 kg underwent donor pancreatectomy one day prior to transplantation via a midline
laparotomy. The pancreas was isolated and placed o ice after the animals were terminally exsanguinated. Islet isolatio , was performed using Goliagenase/Neutnd protease (950 Wunsefc Units and 63 units, respectively; Serva, Heidelberg, Germany). The digested pancreas was purified on a four layer, discontinuous Euro&oll gradient ( fediatech, Manassas, VA) and Co e 29 1 blood cell processor (CaridiaflBCT. Lakewood, GO). Samples of the final islet preparation were counted and expressed as islet equivalents (iBQ)÷ isolated islets were cultured overnight., counted and suspended in Transplant Media (Mediatecb).
Rhesus macaques weighing 3-5 kg were rendered diabetic nsing streptozotocin (1250 mg rn" IV; Zanosar, leva Parenteral Medicines, Irvine, GA) four weeks prior to transplantation, Diabetes was confirmed by .intravenous glucose tolerance test (IVGTT) with a 500 mg/kg bolus of dextrose and measurement of primate C-peptie , Gi ucose levels were tnonitored and C- peptide was measured at baselin and 10, 30, 40 and 90 after injection of dextrose. Diabetes was confirmed by measurement of elevate blood glucose levels in the absence of detectable serum C-pepttde. Diabetic recipients underwent HC-mismatched islet allotransplantation. A mean of 15.745 (± 4*063) IBQ were infused via a. small midline laparotomy and cannulation of a mesenteric vehr
Blood glucose levels were measured twice daily by earstiek; NPB (Movoiin; Novo ordisk, PriBcetO , NJ) and glargirse (Laiitos Sanofi-Aventis, Bridgewaier, NJ) insulin, were .administered to maintain fasting blood glucose (PEG) less than 300 t»g/dL pre-iransplaat and 5 following graft rejection. iVGTT was performed periodically post-transplant to monitor graf function. Transplant .recipients underwent weekly ft w' cytometric analysis to monitor T cell (CD3 V450, CD4 PerCP-CyS.S, CDS PerCp: BD Bioscience) and B cell (CD20 PE, BD
Bioscience) populations. After islet eagrateenl rejection was defined as FBG greater than 130 g/dL on two consecutive days. Primary endpoinf was rejection-free islet graft survival
I 0 Transplant recipients received either 2C10R4, basili imab fSitnuiect, Hovartis, Basel,
Switzerland) and slrolirrrns, or .basiliximab and siro!irnus atone. 2C10R4 (50 mg fcg) was administered intravenously on post-operative day (POD) 0 and 7. Bas iiximab (0.3 nig/kg) was administered itt iavenonsly on POD 0 and 3. SiroUmus was administered intramuscularly dally to achieve trough levels of 5-15 ng rnl through POD 120. Ail three animals receiving
1,5 basi!i ifflab and sirolimus atone are historic controls (Badell et al.s J. dm. invest, 120:4520-312, 2010). Two of these historic controls (RQ¾6 and Rlb7 underwent diabetes induction by pancreatectom and. eceived oral siroiimus..
Treatment with the regimens described above resulted in significantly: prolonged islet graft survival (Figure 1 A) compared to controls receiving only basi!ixmnab inductio and 0 slrolimus maintenance therapy {Figure I IB). Median rejection-free graft survival time for
animals receiving 2C10-R4 is 280 days compared to 8 days for control animals (p-O. l 0^ Table 3). Pharmacokinetic data predict tha plasma 2G10R4 levels would be les than 1 gg/ml by POD 100. 'Because sirolimus was discontinued at POD 120, the recipient with the longest survival (304 days) received no imniunosuppression for approximately 24 weeks prior to rejection. No 5 animals treated with 2C 10R4 developed clinically relevant infectious complications or weight loss. These results reflect asiimals thai received the Ig<34 isotype of 2CK), Two additional animals that received the IgGI isotype of 2C10 (2 CI ORi ) in combination with basi!ixiniab and siroliiiios achieved similarly prolonged -graft survival of 220 and 162 days. Given the positive results with 2C10 used as induction therapy, the next step is to assess the effects on graft snrvival 0 by administering 2C 10 as maintenance thera .
Table 3
Figure imgf000071_0001
Bhckctde of the CD40/CDI 54 pathwa in CiMfw timi "with ih& CD2S/S 7 pathway
Blockade of the CD40/CDI54 pathway may prove ¾se. i« conjiaictlon with other costimolation blockade agents* Belaiacept. a high affinit version of€TLA4-ig designed to block the CD28/B7 cosdniuiatory pathways., as shown efficacy in non amats primate models of renal and islet transplantation and I phase II and III clinical trials in renal transplantation
(Larseo et a!., Tramptantatmn 90:1528*35, 2010, Vincent! ei zl.Jnt J Transplant. 10:535-46, 2010, Adams et al,J. Immunol. 174:542-50, 2005. Adams et al. Diabetes 5 I ;265-70, 2002, Larse ei aL Am. J. Transplant. 5:443-53,. 2005, Vincent? et al,, tf. Engl J. Med. 358:770-81, 2005). The BENEFIT trial revealed superior renal fonction in patients treated with belaiacept; howe er* these patients bad: a higher incidence and mom severe grade of opsy-prove acute rejection■(Larsen ei a!., Transplantation 90:1528-35, 2010, Vtncentt et ai. Am* J Transplant 10:535-46, 2010), in light of this increased rate of acute rejection and the synergy between CP 0 and B7 blockade (Larsen et l , Nmiiw l -434-8, 1996), we next will test the efficacy of conihiaed 2O0 and helataeept therapy in minhiraian primate 'kidney transplantation.
Example 2 ll mmmM .Att£i»CD40 Antibodies
We have developed and characterized a novel humanized Ah to CO40 called 2 I 0
(liiiBi nized 2C10 antibody) thai was selected as a full functional antagonist of CD40. The binding, epitopes were carefully designed to confer unique binding properties thai distinguish it from competitor molecules that either acti vate or deplete B ceils or acts as partial agonists. The early m use primate chimeric version of the antibody has been invest! gated in relevant pre raieal in xifw and in vhv studies, including multi l studies in nonfuunan primates that demonstrate promising efficacy against preventing transplant rejectio and prolonging both alio- and xenograft survival, and a favorable nonclinical safety profile. We have also- completed the iramanizatlon of 2C10 (h2C10), which exhibits excellent eharacieri sties.
To produce the humanized aiiti-€P4Q antibodies,, the variable region sequences of the murine antibody 2C30 were used to search the human antibody database. The V was found to be mostly related to gerarlke antibody sequences VH1-46, VHi-69, and VHl-3 (SEQ ID HO:
30) , whereas the Yh was mostly related to gerrnllne antibod sequences 'YK3- 11 (SEQ ID NO:
31) , VKl-39, and VK6-2L The human YH 1-3 and VK3-11 were chosen to be the acceptor framework tor CDR. grafting because of relative high usage m human, repertoire and good conservation at the critical framework positions. 3 D models were built with both variable regions after grafting the CDRs from the murine 2C 10 antibody into the human acceptor frameworks. Six murine YH framework. residues that are different from the human counterparts were identified to be potentially in contact of the CDRs; M4S, A67, L<69. A71 , K.73, and N76. After modelling, three humanized VH sequences 2CJ0JJI, 2C10 Ji2s and 2CT0 jh3 were designed to contain 0, 2, arid 6. murine framework residues, respecti vely (Figure 13a). Similarly, five murine YK framework residues were identified to be potentially n contact of the CDRs: Ql ; R46$ W'47, V'58, and Y7L After modeling, two humanized VL sequences 2C.10_ll and 2C10J2 were designed to contain 0 and 4 marine framework residues, respectively (Figure 13b).
The parental murine 2C10 antibody was humanized by CDR grafting. The human antibod VHl-3 and V 3-1 1 germUne frameworks were chosen to be the acceptor. Three VH and two VL sequences were -designed ant! all 6 humanized antibodies were produced and tested for human CD40 binding.
The 2C10-fi¾avy-3 (2C10 h3) and 2C10-light-2 CI O 12) constructs- were found to produce the best antibody with CD40 binding affinity of 0.39 n , within 2-fold of thai of the .marine 2C10 (0,22 iiM) (Table 2), The humanized variable regions were used to construct the clinical candidate human zed antibod as an IgG4 or a stabilized IgG , which was cloned into the SwiMR expression system.
High producing stable CHO cell lines were isolated by FAGS and screened by three rounds of ELI § A and one round of fed-batch . culture. Seven clones were isolated thai produced more than 0.8 g L of Ituinauked . 2CI0 in a fed~bateh culture. The best clone 3C9-M produced. ~ L2 g/L under n n-opi ui^ed conditions.
Constroctso of antibody expres sion vectors
The humanized VI sequences were gene synthesized and cloned into vector pFOSE- Cffig-hG2a (invtvogen) containing the constant region of .human IgG2 heavy chai to make expression vector LB30O-302. The humanized VK sequences were gene synthesized and cloned Into an. expression vector containing the constant regi on of human kappa light chain to make expression vector LB3O3~304. The heavy and light chains were downstream of human E ta promoter for strong and constitutive mammalian cell expression. The chimeric 2C 1.0 antibody was also constructed similarly by using murine VH aid VL to make expression vector L8305 and 1 0 , respectively. The antibody expression vectors were summarise , in Table 4.
Table 4 Antibody expressioii vectors
Figure imgf000073_0001
LB305 2Ciovn MgG¾ CM J: hEFjfc.: £eoei» j
LB306 2CW VK hCK I hEFja Neomycin 1
LB308 MgGi CH hEFi : Zeoein
LB309 2C10ji3 hluG.- CM ! fa Es a Zeock
(S2 IP)
Each vector in Table 4 contains a heavy chain or light chain expression cassette under the control of hirm&ii BF I a. promoter. Vectors LB300~302! LB 305 contain. the constant region of human lgG2 heavy chain. Vectors LB308-3 9 contain the constant region of human IgG4 heavy chain. Vectors 13303-304, LB306 contain the constant region of human Kappa light chain.
Production of the humanized IgG4. antibody
In order to ftrther minimize the potential effector firaction, the huxnanized antibody with the best binding activity (l l'OJiS and 2C10J2) was concerted into: human lgG or stabilized homan IgG4 (S 1 ), The heavy chain variable region 2C 10 ¾3 was first cloned into vector pFUSB-CHlg-¾G4 (Envivogen) containing the constant region of human %G4 heav chain, before the stabilizing mutation S241.P was introduced (Table 4), The humanized IgG4 and igG4(S24iP) were purified from 293F cells after transient itansfection. The production yield was 25-35 mg L, 2-fold higher than that of the jgG2 antibodies. The IgG4 antibody appeared to have small amount of half moleenle* which was significantly reduced in the stabilized IgG antibody. The DNA and amino acid sequence of the stabilized lgG4 antibody is sho n: in Figure 2L
Cloning of the humanized igG4 ($24 IP) antibody in SwiMR expression vector
SwiM expression w s developed for facile development of antibody production cell lines, utilizing a switchabie nierabrane reporter to facilitate isolation of highly productive cells via Fluorescence- ctivated cell sorting (FACS). An OtES-nmhated bicistronic expression cassette of membrane-anchored GFF was placed downstream of the gene of interest (G OI) , The IRES-OFP cassette was flanked by LoxP sites fo later removal from the chromosome. "The GFP expression level was used to mark the expression level of the GO! . Highly productive cells were isolated by FACS and then treated with. Cre tecombiiiase to reraoye the GFP cassette. The humanized 2C10 in the stabilised J.gG4 format was closed the S-wi R expression system to make vector LB31 . The heavy and light chains were cloned in two separate expression cassettes under control of human EFl promoters. The IRES-GFP cassette was placed downstream of the heavy chain sequence and was flanked by two Lox sites. The plasm! d carries a Poromycin resistant gene for mammalian cell selection aed a p~Iactama$e gen for bacterial propagation.
Stable, selection of the CHQ cells and i solation o the high -producing cells
100 ml of CHOS cells (1 x 10* cells/ml,, invitrogen) were txaosfected with 12.0 ug of
LB312 linearized by restriction digestion of Asc I and 120 ul of Freestyle Max regent (Invitfogen)* The cells were selected with 10 - 20 ug/ral of Puromyein for 2 weeks. The GFP expression profile of the stable pool was characterized by flo cytometry. The top I % of the cells with the highest GFP signal wa sorted out as Pool #1 containing 100,000 cells. After enlinring for 2 weeks, the Pool #1 was analyzed again for GFP expression by flow cytometry. The top 1% of the cells with the highest GFP signal was sorted out again as Pool #2 containing ! 00,000 cells, After oultufing for 2 days, the Pool #2 was treated with 2 uM of recombinant membrane permeable DMA: reeofnhlnase Cre ( AT-NLS-Ore, Exeeifgen). The GFP expression profil was analyzed' after 1 wee of ctdtuiiiig. ~10% of the cells completely lost the GFP expression indicating successful removal o the GFP expression cassette from the chromosome. The GFP negative cells were sorted out as single cells in 384-weU plates. After 2 weeks, -800 colonies grew out. f m 10 x 384-w plates.
Additional , hnman i ed antibodies
Hnn anized antibodies were- also generated using, two CDR grafted VH and: -two CDR grafted VL sequences cloned into a ViTl.~£i9 and a VLl-39 hrrmM!. getmlifte fr rnework..
We made two heavy (HB1 & H.B2) and two light (KB I & KB2) chains in these additional experiments. The heavy and light chain setjoenees HP + P serves as the positive control. Th combination of these constructs was transiently expressed in ME0 3 cells, antibod purified b protein- A chromat gr hy and tested for hCD40 binding. Figure 14 shows amino acid -changes in fianiework 3 between .2C10HP and 2G10HB1, as well as 2C 0HB2 constructs. Figure 15 shows the sequences of heavy chain, and light chain variable regions for hraianized 2C10 antibodies. The .heavy chain and light; chain variable reg ons include 2C10BP, 2C10HB1, 2O0HB2, 2CS0KP, 2Q0KBI , and 2CI0KB2. Therefore, in certain embodiments, an anti-CD40 antibody may include any of the following 2C10H-K combinations;
!, 2C10BP + 2C10 .P
2, 2C10HB1 + 2C10KB1
3, 2C10BB1 + 2C10KB2
4,. 2C10HB1 + 2C10KP
5. 2CI0BB2 * 2C10 B2
6. 2C10H&2 + 2C10 B1
7. 2ClOH&2-+ 2C10K
8. 2C10eF + 2CI0KBi
9 2C10HP + 2C10KB2
Figure imgf000076_0001
dy were par fied after transient transfection of 100 or 200 ml of 293F cells. The antibodies were purified with a Protein A column from the conditioned media harvested 4 days after fransfection.
Determination of CD40 binding kinetics
CD40 binding -kinetics was detennlned on Forte Bio (contracted to Afagen Bioscience).. The purified CD40 was biotinylate and im obilized on Streptavidin biosensors.
Bioproduction. for m vim study
After ransiectian of CHO cells and selection of stably iransfected cells, the antibod was purified b Protein A column, and followed by buffer exchange (2 mM Sodhiin Citrate, 50 mM NaCI, 5% Maltose, pH 6.0) and 0.2 η filtration. The Pool #1 was used to setup 25L wave bag culture in CD FortiCHQ media (Invitrogen). The culture was fed three times on day 3, 5¾ and 7 with 10% CD Efficient Feed C {invitrogen). The final yield of purified antibody was 1.6 g in total The antibody as characterized by SDS-PAGE and SBC-HPLC analysis, and was 99,4·% pure as monomelic antibody. Cell line .development
The single cell colonies were screened by 3 rounds of ELISA and 1 round of i¾ti~ a eti productka*. The cells were kept in CD ForiiCHO media throughout the- screening process. All colonies from 384- we it plates were picked into 96-weil plates. 1.2 μΐ of culture media from each well were used to screen for antibody in ELISA plates coated with anii-huniari Fc antibody. The top 240 clones were expanded into 10 24- well plates. After cultaring for 5 days, 1.2 μ| of culture media was screened again for antibody level the top 60 clones were expanded into 10 x 6~weil plates and cultured in shaking incubator. After cnlturing for 5 days, the 6-well plates were duplicated by passaging the ceils t;I0 into a new set of 6~well plates. The cultures i the original set of the 6-well plates were allowed to gro to extinction, followed by detennination of antibody level by ELISA. The top 24 clones in the duplicated set of 6-wel.l plates were expanded into 30 ml cnlture i 125 ml shake flasks. The clones were subjecte t 30 ml fed-batch production. The feeding strategy w s 7.5% of Ex-Cell Advanced CHO Feed I (Sigma) on day 3 , 5, 7, , and 1 L The top clon 3C9-I6 exhibited production titer of - 1.2 g/L.
I Vhro Phatniacology o Prirnate Clnnierie 10 and Hitnianized 2CJ 0
We identified the following important if? vitro pharmacological attributes for our lead candidate:
* Suppression of B-cell activation induced by CD 154-CD4Q engagement
* No direct activation of B cells
* High affinity antagonist of CD40 (e.g., Ka'is about i *i -or lower, about t0 0M, to about 10" Al, or as described herein)
Through novel immunization approach .arid an extensive in vitro screening approach, we have identified an anti~CD40 antibody that meets these criteria and represents a non- depleting/non-activating antagonist antibody to human CD40.
la vitro and in vivo studies have confirmed that the h nianized form retains exc llent properties,
As described in the previous section, the 2 I0 rnAb was humanized by CUR grafting into a human heavy and light chain -frameworks. To maintain the properties of th original 2C.10 Ab, the huni mzed 2Cf 0 constructs e e screened fey Biacore for afini y to lunmn CD4CL All three top Iiuraa zed 2C10 antibodies exhibited only slight reduction in affinity by approximately wo-fold, relative to the parent 2C10 mAb (Table 5). Most importantly they all maintained, the exceptional slow off rate of the parent 2C10 mAb. Among these antibodies. Clone 2. \ 89.2 which exhibited the'highest affinity at 390p , was selected as the lead harnanized mAb (h2Cl 0).
Tshle S:€040 Receptor inding Kinetics of nraanwed Versions of 2C19
Figure imgf000078_0001
Comparing the Mnding kinetics of hur«ani¾ed 2G10 to competitors, the overall affinity of h;2€U) remains substantially better than the competitors that have affinities in the nanomolar range. We also compared binding affinity of h2€ 10 betwee human CD40 and CO40 from those of noahiiman primate species used m preclinical evaluations. As shown in Figure 16% ttlClQ has comparable affinity for' CD4Q acros these primate species.
The in vivo phannacodyriarnics, pharmacokinetics and explorator sa ety assessments of 2C1Q were, conducted in rhesus monkeys using the primate chitneric. construct of 2C10 and the clinical candidate humanized h2Cl0 antibody. After selection of the lead humanized version of 2C10 (mA'b 2,189,2 ; h2C10) based on viiro binding kinetics,, we advanced h2Cl0 into a PK PD study in rhesus monkeys to characterise its additional properties. The data generated in these studies, which .cover a broad range of critical experimental endpoints, clearly establish the excellent properties of H2C1.0:( Studies have been completed in rhesus monkeys examining PD , PK, and safe endpoints,- ritical elemeots of the study designs ineliiding key endpoints and objectives are summa ized in Table 6 (Pharmacodynarrjic (PD), Pharmacokinetic (PK) and Safety Studies of 2CI0 i Rhesus Monkeys). The key outcomes and relevant comparative assessments on the key experimental endpomts included;
« Effect on B and T ly rnphoc y te number in blood
* Effect on humoral immune response to the T -cell-dependent antigen Keyhole -Limpet Hemocya in (KLH)
* CD 0 receptor occupancy on blood B cells (PD)
* Pharmacokinetics (PK)
» Immunogenicity as assessed b formation' of anti-drug antibodies (ADA)
9 Exploratory toxicology include CBC, serum chemistry and complete necrops
Table 6. P PK a d Safety Studies of 2Cie in Rftestis Monkeys
Figure imgf000079_0001
Figure imgf000080_0001
The study results are summarized in. the following see tion, h2€i0 ma be used fo treatment of conditions in which selective biockade of CD40 receptor activation in the absence of B cell depletion, is expected to provide therapeutic■ benefit
E fleets on T Cet ^Mediated I mmunity
'To prove, is vivo thai h2C 10 blocks Ik-ell dependent antibody responses (TDAR) in vivo, monkeys were immunized with KLH 6 hours after the adMinistration of h2C10. Antibody titers against KLU were measured weekly thereafter.
Doses of 10 and 25 mg kg h2Cl 0 were gi ven to monkeys followed by a KLH challenge. Both tgG and g anti-KLH titers were determined weekly out to Day 28 aftetreatment Figure 17 shows that the humanized version of 2C10 achieved complete inhibition of the KLH antibody response at the highest test dose, and M ost cases at the 10 mg/kg dose level. Both: IgM and IgG responses were prevented.
Non-Depleting Effects on B Cells
As goals in the development of an antagonist CD40 antibody inclu ed .&*»im¾ifig. the depletion of targeted, CD4tH- cells, we analyze effects on iym iiocyte s ibpopuiaiions, especially the effect on B cells.
The tre tment of monkeys with 10 or 25 rag/kg of the humanized, form of 2C10 (li2C1 ) also had no appreciable depletin effect on B cells even though the C 4 target is ly saturated by the antibody at these concentrations (see subsequent Section Receptor Occupancy)*
Despite satination of 2CiO binding sites on B cells lasting until the last day measured (Day 28), all monkeys that received either dose of h2C 10 maintained normal B and T
lymphocyte subsets (Figure I S), These restdts demonstrate that injection with a dose as low as 10 mg/kg 2C 10 can persistently bind CD40, its therapeutic target on 8 ceils (and presumably monocytes and other antigen presenting cells) without causin midesired depletion of B cells in monkeys.
The demonstration that 2C10 does not deplete B cells suggests a clear advantage over competitors In addition to 3 AS and Chi220.
CD46 Receptor Occupancy
CD40 target engagement and occupancy by the primate chimeric and humanized versions of 2C i'O was determined by measuring ifae available binding sites fo.r 2C10 to CD40 on CD21K
B cells by flow cytometry using f oreseen Jy labeled 2C10 and a labeled., non-competing anti- CB40 antibody. Blood samples were collected on multiple days from control monkeys aad monkeys treated wit either primate ehimerie lgG4 or humanized 2C10 and analysed by FACS.
The degree of target engagement (% receptor occupancy ) was calculated directly from the mean fluorescent intensity recordings.
Humanized 2C10 antibodies were administered intravenousl at single doses of 10 and 25 mg kg. Surface CD40 on B cells was completely saturated by Day 3, and the effect persisted. until die last day measured (Day 28} in all monkeys that received either dose of ¾2C10i
Representative data from the flow cytometry analysis of blood collecte from monkeys 28 days after treatment with humanized 2C10 is shown Figure 19,
These results demonstrate that a single injection of h2€.10 at a dose as low as 10 g/kg. can fully satorafe CD40 receptors on B cells for at least 28 days.
Pharmacokinetics and Anti-Drug Antibody Response
To establish a clear link betwee the h rmacod amic effeels of 2£!0 based on CD40 receptor occupancy and the plrarraaeokioetics of 2C I 0, piasnia concentrations of the 2Q0 were measured i plasma from the same blood samples in. whic receptor occupancy had been determined. The plasma concentration analysis also enabled characterization of tire
p armacokirietic profile of 2CJ0, most importantly its persistence In plasma as determined b its half-life. This deteniinaiioti provides guidance for the frequency of dosing that will be needed to maintain effective therapeutic concentrations.
The mem serum concentrations determined i monkey?; treated with either 10 or 25 mg kg humanized 2C1Q are plotted in. Figure 20. These data demonstrate that die animals were exposed to 2C 10 for the entire duration of the study, and that humanl-sed 2C 16 has a haif'-bfe in monkeys of approximately 15 days (ranging- from days). This half-life is in die range of that expected for a therapeutic antibody in primates* and should support a relatively infrequent dosing schedule in clinical investigations (e.g., no more than once every two weeks). Further modeling of the complete dataset will enable a robust estimate of the dose and f equency required to •Sustain effective antibody concentrations in initial clinical studies of h2C10.
Another assessment, of humanized 2C10 was the potential development of antibodies against h2C10 (ADA). This can occur when biologies of epitopes from one species is administered to a different species (eg. Humanized A to primates) resulting .in rapid clearance of the drug from -plasma. In this study there was no evidence from the time course profile that antibodies against h2C 10 were generated, as no animal exhibited measurable- anti.-2C10 titers during the study.
Figure imgf000083_0001
CD40 receptors, and therefore approach the dose levels that will be. tested In pivotal toxicology studies conducted during the D-enabling phase. These preliminary safety evatetions show absence of any safety concerns tor h2C.|0÷
•20 These combined data demonstrate in a relevant primate model that h2€ 10 has the
desirable pharmacodynamic, phaonacokinetic and s fety attributes tor a monoclonal antibody intended to treat patients, where specific inhibition of CD 0 activation Is desired without causing unwanted activation or depletion of CD40+ targets cells and without evidence of off-target toxicity.
25
While specific aspects of the invention have been described and illustrated, such aspects should be considered illustrati ve pfthe invention, onl and not as limiting the invention as 30 constmed in accordance with the accompanying claims. All publications and patent applicati ns cited in this specification are herein incorporated by reference in their entirety for all purposes as if each i!jdividi?ai publication or patent application were specifieaily and individually Indicated to be incorporated by reference for all purposes. Aithough the foregoing raveation has been described in some detail by way of illustration and. example for purposes of clarity of understanding, it will be readily apparent to one of ordinary skill in the art in light of the teachings of this invention that certain changes and modifications can be made thereto without departing from the spirit, or scope of the appended claims .

Claims

'What is e aliTsect is:
3. A inmiaTiked aati~C.D4Q antibody or asi awdgea-b ridi ig portion he of^ eom rism a heav chain variable region a d a light chain variable region, wherein the heavy chain variable region comprises three compienientafity deteiininirig regions (CDR$)S€DR1S CDR2 and CDR3, having amino acid sequences about 80% to about 100% identical to the annu acid sequences set forth in SEQ ID NOs: .|3S 14 and 15, respectively,, and wherein the light chain variable region comprises three CDRs, CD 3, CDR2 and CO , having annuo acid sequences about 80% to about 100% identical to the amino acid sequences set forth in SEQ ID NOs; 16, 17 nd 18, respectively.
2. A humani¾ed anti-CI O antibody, or an ugen-birididg portion thereof comprising a. heav chain variable region, wherein the heavy chain variable region comprises three CDRs..
CDRl, CDR2 and CDR3, having amino acid sequences about 80% to about 100% identical to the amino acid sequences set forth m SEQ 3D NOs: 13, 34 and 15. respectively.
3. A hursianized anti-CB40 antibody, or m mm geu-binding portion thereof, compri si ng a tight" chain variable region, wherein the light chain variable region comprises three CDRs, CD l, CDR2 and CDR3, having amino acid sequences about 80% to about 100% identical to the amino acid .sequences set f rth in SEQ 10 NOs: 16. 17 and 18, respectively.
4. The antibody or antigen-binding portion thereof of any of claims 1-3, wherein the
dissociation constant ( ¾) of the antibody , or aniigee-bindiog portion thereof, is 3e§s than about 1 x W9 M.
5. The antibody or antigen-binding portion thereof otm of claims 1-3, wherein the heav
chain variable region comprises an amino acid sequence 'about 80% t about 1.00% ea&a! to ny one of the amino acid sequences set forth m SEQ 3D NOs: 1 1, 1 , 20,.21, 24, 25 and 26, and . wherein the light chain variable region comprises an amino acid sequence about 80% to about ! .00% identical to any one of the amino acid sequences set forth in SEQ ID NOs: 12, 22, 3, -27, 2S and 29,
6. The antibody or a« en*bmdittg portion thereof of any of claims 3-3, wherein the-heavy- chain variable region comprises an ammo acid sequence aboirt 80% to aboirt 100% identical to the amino acid sequences set forth hi SEQ ID NO: 21 , and wherein the light drain variable region comprises an amino acid sequence about 80% to about 100%' identical to the amino acid sequences set forth in SEQ ID NO; .23.
7. The antibody or antigen-binding portion thereof of an of claims 3 -3, w3i.erein the heavy chain variable region comprises an amino acid sequence about §0% to about 100% identical to any one of the amino acid sequences set forth in SEQ 3D NOs: 1 1, 1 , 0, 2 L 24, 25 and 26.
8. The aniibod or antigen-binding portion thereof of any of claims 1-3 , wherein th light chain variable region comprises an amino acid sequence about.80% to about I (30% identical to any one of the amino acid sequences set forth in SEQ ID NOs; 32, 22, 23, 27, 28 and 29.
9. The antibody or antigen-binding portion thereof of any of claims 1-3, w erein the heavy chain variable region comprises an amino acid sequence aboirt 80% to about 100% ideBtical to any one of the ammo acid sequences set forth in SEQ 3D NOs : 1.9, 20 and 2.1, aad- wherein the light chain variable region comprises an. amino acid sequence about 80% to about 100% identical to either of the amino acid sequences set forth in S EQ ID J iGs: 22 and 23.
30. The antibody or antigen-binding portion thereof of any of claims 3*3, wlierein the heavy chain variable region comprises an am o acid sequence about 80% to about 100% ideBtical to any one of the ammo acid sequences set forth in SEQ 3D NOs : 24, 2S and 26, and wherein the light chain variable regio comprises an amino acid sequence about 80% to abou 100% Identical to an one of the amino acid sequences set: forth in SEQ D NOs: 27, 28 and 29.
1 3. The antibody or antigen-binding portion thereof of any of claims 3-3, wher ein t antibody or antigen-binding portion thereof is selected from the group consisting of: (a) a whole immuno lobulin, molecule; (b) an scFv; (c) a Fab fragment; (d) an F(ab')2; and (e) a disulfide linked Fv.
12. The antibody or antigen-binding portion thereof of any of claims 1^3? wherein the antibody or aufigen n«ding portion thereof comprises at least one constant domain sel cted from the group consisting of: a) an IgG constant domain; and (b) an IgA constant domain,
13 , The anti body or antigen-binding portion thereo f of any of claims I -3, where in the antibody or antigen-binding; portion, thereof com ises at least one human co sist domain.
14, The antibody or antigen-binding portion thereof of any of claims 1-3, wherein the antibod or an tigen-bindin porti on thereof Mads to CD40 extracellular domain,
15, A bomanked anti-CD40 antibod or an antigen-binding portion thereof, comprising a heavy chain variable region, wherein the heav chain variable region comprises an amino acid sequence about 80% to about 100% identical to the ammo aeid sequence set forth in SEQ ID NOs; 11 , 19, 20, 21 , 24, 25 or 26.
16, A humanized anti-Cf)40 antibody, or an aritigen-binding portion thereof, comprising light chain variable region, wherei the light chain variable region comprises a amino acid sequence about 80% to about 00% identical to the amino acid sequence set forth in SEQ ID NOs; 12, 22, 23, 27, 28 or 29.
1 ? A humanized anti-CD40 antibod s or an antige i-bisding portion thefeoij eom msiog a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises an amino acid sequence bout 80% to about 100% identical to airy one of the amino acid sequences set forth in SEQ ID NOs; 1.1, 1 , 20, 21, 24, 25 and 26, and wherein the light chain variable region comprises aft amino acid sequence about 80% to about 1 0% identical to any one of the amino aeid sequences set forth in SEQ ID NOs: 12, 22, 23, 27, 28 and 29.
18; A. hornauiKed or ctsirneric a«ti-CD40 antibody, o an antigen-binding portion ihefeo .
comprising a heav chain variable region and a light chain variable region, wherein the heavy chain variable region comprises an amino acid sequence about 80% to about 100% identical to the .amino acid s uences set fbrtl in SEQ ID NO; 21 , aod wherein the light chain variable region comprises an amino acid sequence about 80% to about 100% identical to the amino rid sequence set forth in SEQ ID NO: 23.
19. The antibody or antigen-binding portion thereof of any of claims 1 -1 8, wherein Ihe CD40 is human or rhesos CD40,
20. The antibody or antige«-bradiBg portion thereof of aw of claims wherein the antibody or antigen-binding portion thereof blocks B lymphocyte activation by CD! 54-expresshig jyrkai cells m vitro.
21. The at ibody or antigen-binding portion thereof of any of claims 1-18, whereiR the antibody or antigeii ¾i«diiig portion thereof inhibits B lymphocyte CD23, CD80, or CD86 expression.
22. A composition comprising the antibody or ant.igen~b.iBd.mg portion thereof of any of claims 1-21 , and at least one pharmaceutically acceptable carrier.
23. A polynucleotide encoding the asriihody or antigen-binding portion thereof of any of claims 1-21.
24 A sector comprising: the: poiyntieieotide of claim 23.
25. A. cell comprising the vector of claim 24.,.
26, A method of suppressing the immune system ½ a subject, comprising the step of
administering to the subject an effective amount of the antibody or antigen-binding portion thereof of any of claims 1-21.
, A method of treating, or treating prophyladieally transplant rejection, or increasing the duration, of time before transplant rejection ©tears, in a subject, in need thereof, the method comprising the step ofadmiioisieriftg to the sabject art elfeciive amonhtof the antibody or •an en-bindtng portion thereof of any of c laims 1-2 L
28. The method of claim 26 or 27, wherein the subject has .received, or is In need of, an organ transplantation.
29. The method of claim 28 , wherein the organ is selected, from the group consisting of heart, kidney, lung, liv r, pancreasi intestine, anci thymus, or a portion thereof
30. The method of clai 26 or 27, wherein the sabjee-t has received, or s in need of, a tissue transplantation.
31. The method of claim 30, wherei i the tissne is bone, tendon, cor ea, skin, heart valve, vein, or bone marrow.
32. The method of any of claims 26* 31, wherein the amiunistmtion is commenced prior to the tauisplantatioii.
33. The method of any of claims 26-31, wherein the administration continues for at least one month following the transplantation.
34f The method of claim 33 , wherein the adffiinistration eottiinnes for at least sk tminths
following said transplantation of said graft.
35. A method of treating or 'treating rophylacticaliy graft-versus-host disease i a subject in need thereof, the method comprising the ste of administering to die subj ct an ef¾ctive •amount of the antibody or antigen-binding portion thereof of any of c laims 1-21.
Figure imgf000090_0001
37. The method of claim 3"6S -wKerein, ihje- ·:8«½ί ι«ιη8ή¾' disorder is associated with or caused by the presence of an autoantibody.
3St The method of claim 36, wherein the autoimmune disorder is selected from the group
consistin of systemic lupus erythematosus ($LE), C REST syndrome (calcinosis, -Rayuaucfs syndrome, esophageal. dysuiotiKty, sci.eroda.ctyi, and telangiectasia), . opsoclonia,
inflammatory myopathy (e.g., -polymyositis, demiatomyositis, and mciusion-body myositis), systemic■ scleroderma, primary biliary cirrhosis, celiac disease (e<g., gluten sensitive enteropathy), dermatitis herpetiformis, Milier-Fisher Syndrotne, acute motor axonal neuropathy (AMANj, multifocal motor neuropathy with conduction block, autoimmune hepatitis, antiphospho lipid syndrome, Wegener's .granulomatosis, microscopic poiyaftgiitls, Churg-Straass syndrome, rheumatoid arthritis, chronic autoimmune hepatitis, sderonryositis, jrjyasthenia gravis,. Larahert-Eatorj myasthenic syndrome, Hashimoto's teroiditis. Graves' disease, Paraneoplastic cerebellar degeneration. Stiff person syndrome, limbic encephalitis, Isaacs Syndrome, Sydenham's chorea, pediatric autoimmune neiuopsyc atiic disease associated with Streptococcus (PANDAS), encephalitis, diabetes melMtus type 1, and Neuromyelitis optica,.
39. The method of claim 36, wherein the autoimmune disorder is selected from the group
cQftsi ting of pernicious anemia. Addison's disease, psoriasis, inflammatory bowel disease, psoriatic arthritis, Sjogren's syndrome, lupus- erythematosus (e.g., discoid lupus
erythematosus, drug-ind iced lupus .erythematosus, and neonatal lupus erythematosus), multiple sclerosis, and reactive arthritis,
40. The method of claim 3 wherein the aiiioiMrauns disorder Is selected from the group
consisting of polymyositis, dermatomyositis, multiple endocrine failure, Schmidt's ■syndrome, autoimmune, uveitis* adrenaiitls, tiny rpi itiss autoim ne thyroid disease, gastric atrophy, cnronic hepatitis, lupoid hepatitis, atherosclerosis, presenile dementia,
demyelinatmg diseases, subacute cutaneous lap as erythematosus, hypoparathyroidism. Dressie 's syndrome, autoimmune tbtotnbocytopenia, idiopathic thrombocytopenic purpura, hemolytic- anemia, pemphigus vulgaris, pemphigus, alopecia areata, pemphigoid, scleroderma, progressive- systemic sclerosis, adult onset diabetes mellftus (e.g,, type II diabetes), male and female autoimmune infertility, ankylosing spondolytis, ulcerative colitis, Crohn's disease, mixed connective tissue disease, polyarteritis nedosa* systemic necrotizing vasculitis, juvenile onset rheumatoid anhritis, gkmierulpnephritis, ..atopic dermatitis, atopic rhinitis, Goodpasture's syndrome, Chagas* disease, sarcoidosis, rheumatic fever* asthma-, recurrent abortion. anti-phospholtpid syndrome, farme *s long, erythema multiforme, post cardiotomy syndrome. Cusbing's syndrome, autoimmune chronic active hepatitis, bird- fancier's lung, allergic disease, -allergic encephalomyelitis,, toxic epidermal necrolysis, alopecia, Alport's syndrome, alveolitis, allergic alveolitis, fibrosing alveolitis, interstitial lung disease, erythema nodosum, pyoderma .gangreuosum, transfusion' reaction, leprosy, malaria, leishmaniasis, trypanosomiasis, Takayasu's arteritis, polymyalgia rheuraatiea, temporal, arteritis, schistosomiasis, giant cell arteritis* ascsriasis* aspergillosis, Sampler's syndrome, eczema, lymph matoid- gf anuloinatosis, Behcet's disease, Capian's syndrome, Kawasaki's disease, dengtie, endocarditis, endomyocardial fibrosis,, endophthalmitis, erythema e!evatom et diutinum, erythroblastosis fetalis, eosinophilic faciitis, Shulmaa*s syndrome. Pett 's syndrome, filaoasis, cyclitis, chrome cyclitts* heterochronic cyclitis, Fueh's cyclitis, IgA nephropathy, Henoeh-Sclionleirs purpura, graft versus host disease, transplantation rejection, human immunodeficiency virus infection, echovirus infection, cardiomyopathy, Alzheimer's disease, parvovirus infection, rubella, virus infection, post vaccination syndromes, congenita! rubella infection, Hodgfetn's- and non-fiodgkin's lymphoma, renal cell carcinoma, multiple myeloma, Eaton-Lambert syndrome, relapsing polychondritis, malignant melanoma, cryoglohultnemia, Waldenstrom's macroglobulemia, Epstein-Barr virus infection, mumps, Evan's syndrome, and autoimmune gonadal failure.
41. The method of any of claims 26-40, .wherela the subject is a human.
42. The -method -of my of claims 26-40. wherein the admmtstratio» is parenteral, kttaveaous, snbcwaiieous, n ra uscular, transdermal, oral, topical, intrathecal,, or local
43. The method of any of claims 26-40, wherein t e method further comprises adMinistratio of ari iiffiniraosuppressarit within six rnOJiths of ihe admifflstTadon of the antibody or antigen- bind ng portion thereof.
Figure imgf000092_0001
1 S-deoxysperguaiin, I F .15-01 5, hred iri, hrequiriar, an mnfOffionah-CDS,
45. The method of claim 44, wherein the calcmeutis inhibitor is cyclospori A or oyclosporine G.
4(\ The- method of claim 44, wherein the to Tor -inhibitor -is shoKmu j temsitoiiffius, ^oiarolimas. or evero!inuis.
47. The method of claim 44, wherein the anii-€D45 antibody is an anti»CD4SRB antibody,
48. The m ethod of claim 44, wherein the hmmiaosuppressant is belataeept
49. The method of claim 44, wherein the-aritibody or antigen-bindiog portio thereof and the inn nossp resis f are administered within one mont h of each other;
50. The met od of claim 49, wherein the antibody or an:»fen-b ndmg portion thereof and th immunosuppressant are administered within one week of each other.
51 , An isolated polypeptide c ompr ising the antibody or antigen-bindirrg portion thereof of any of claims 1- 1,
52 f A met hod of producing the antibody or antigen-binding portion, thereof of any of c laims 1~ 2J, the method comprising the steps of:
(a) ciilturirsg the cells of claim 25 In culture meditwn under conditions wherein the polynucleotide is expressed, thereby producing at least one polypeptide comprising the antibody or antigen-binding. ortion thereof; and
(b) recovering the polypeptide from the cells or culture medium.
PCT/US2016/050114 2015-09-04 2016-09-02 Humanized anti-cd40 antibodies and uses thereof Ceased WO2017040932A1 (en)

Priority Applications (21)

Application Number Priority Date Filing Date Title
KR1020187009524A KR102779818B1 (en) 2015-09-04 2016-09-02 Humanized anti-CD40 antibodies and uses thereof
EP16843066.8A EP3307322B1 (en) 2015-09-04 2016-09-02 Humanized anti-cd40 antibodies and uses thereof
CA3002789A CA3002789A1 (en) 2015-09-04 2016-09-02 Humanized anti-cd40 antibodies and uses thereof
ES16843066T ES2887602T3 (en) 2015-09-04 2016-09-02 Humanized anti-CD40 antibodies and uses thereof
EP21156562.7A EP3906943A1 (en) 2015-09-04 2016-09-02 Humanized anti-cd40 antibodies and uses thereof
BR112018004296A BR112018004296B1 (en) 2015-09-04 2016-09-02 humanized anti-cd40 antibodies and their uses
PL16843066T PL3307322T3 (en) 2015-09-04 2016-09-02 HUMANIZED ANTI-CD40 ANTIBODIES AND THEIR APPLICATIONS
CN202211072946.XA CN116063481A (en) 2015-09-04 2016-09-02 Humanized anti-CD40 antibodies and uses thereof
JP2018512313A JP6976931B2 (en) 2015-09-04 2016-09-02 Humanized anti-CD40 antibody and its use
AU2016315873A AU2016315873B2 (en) 2015-09-04 2016-09-02 Humanized anti-CD40 antibodies and uses thereof
CN201680064574.2A CN109069621B (en) 2015-09-04 2016-09-02 Humanized anti-CD 40 antibodies and uses thereof
KR1020247043041A KR20250007054A (en) 2015-09-04 2016-09-02 Humanized anti-cd40 antibodies and uses thereof
DK16843066.8T DK3307322T3 (en) 2015-09-04 2016-09-02 Humanized anti-cd40 antibodies and uses thereof
MX2018002708A MX2018002708A (en) 2015-09-04 2016-09-02 ANTI-BODIES ANTI-CD40 HUMANIZED AND USES OF THE SAME.
SI201631164T SI3307322T1 (en) 2015-09-04 2016-09-02 Humanized antibodies to CD40 and their uses
US15/829,352 US9974855B2 (en) 2015-09-04 2017-12-01 Humanized anti-CD40 antibodies and methods of administering thereof
US15/955,393 US10201608B2 (en) 2015-09-04 2018-04-17 Polynucleotides encoding humanized anti-CD40 antibodies
US16/234,110 US10772958B2 (en) 2015-09-04 2018-12-27 Humanized anti-CD40 antibodies and methods of administering thereof
US16/994,249 US11439706B2 (en) 2015-09-04 2020-08-14 Polynucleotides encoding a humanized anti-CD40 antibody
US17/818,188 US12514924B2 (en) 2015-09-04 2022-08-08 Humanized anti-CD40 antibodies and uses thereof
AU2022241635A AU2022241635A1 (en) 2015-09-04 2022-10-04 Humanized anti-cd40 antibodies and uses thereof

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201562214411P 2015-09-04 2015-09-04
US62/214,411 2015-09-04

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US15/829,352 Continuation US9974855B2 (en) 2015-09-04 2017-12-01 Humanized anti-CD40 antibodies and methods of administering thereof

Publications (1)

Publication Number Publication Date
WO2017040932A1 true WO2017040932A1 (en) 2017-03-09

Family

ID=58188471

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2016/050114 Ceased WO2017040932A1 (en) 2015-09-04 2016-09-02 Humanized anti-cd40 antibodies and uses thereof

Country Status (16)

Country Link
US (5) US9974855B2 (en)
EP (2) EP3307322B1 (en)
JP (3) JP6976931B2 (en)
KR (2) KR102779818B1 (en)
CN (2) CN116063481A (en)
AU (2) AU2016315873B2 (en)
BR (1) BR112018004296B1 (en)
CA (1) CA3002789A1 (en)
DK (1) DK3307322T3 (en)
ES (1) ES2887602T3 (en)
HU (1) HUE056769T2 (en)
MX (2) MX2018002708A (en)
PL (1) PL3307322T3 (en)
PT (1) PT3307322T (en)
SI (1) SI3307322T1 (en)
WO (1) WO2017040932A1 (en)

Cited By (16)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2017220990A1 (en) 2016-06-20 2017-12-28 Kymab Limited Anti-pd-l1 antibodies
US9888673B2 (en) 2014-12-10 2018-02-13 Regents Of The University Of Minnesota Genetically modified cells, tissues, and organs for treating disease
WO2018115003A2 (en) 2016-12-19 2018-06-28 Glenmark Pharmaceuticals S.A. Novel tnfr agonists and uses thereof
WO2018219327A1 (en) 2017-06-01 2018-12-06 江苏恒瑞医药股份有限公司 Anti-cd40 antibody, antigen binding fragment thereof and medical use thereof
WO2020014974A1 (en) 2018-07-20 2020-01-23 Eucure (Beijing) Biopharma Co., Ltd Anti-cd40 antibodies and uses thereof
WO2020108611A1 (en) 2018-11-30 2020-06-04 江苏恒瑞医药股份有限公司 Anti-cd40 antibody, antigen binding fragment and pharmaceutical use thereof
WO2020108621A1 (en) 2018-11-30 2020-06-04 江苏恒瑞医药股份有限公司 Cd40 antibody pharmaceutical composition and use thereof
WO2021048595A1 (en) * 2019-09-11 2021-03-18 Novartis Ag A method for preventing human virus associated disorders in patients
WO2021236546A1 (en) * 2020-05-18 2021-11-25 Bristol-Myers Squibb Company Antibody variants with improved pharmacokinetic properties
WO2023081641A1 (en) * 2021-11-05 2023-05-11 Kiniksa Pharmaceuticals, Ltd. Pharmaceutical compositions of humanized anti-cd40 antibodies and uses thereof
US12234294B2 (en) * 2021-11-05 2025-02-25 Kiniksa Pharmaceuticals, Gmbh Pharmaceutical composition of a humanized anti-CD40 antibody
WO2025045766A1 (en) 2023-08-25 2025-03-06 Kiniksa Pharmaceuticals, Gmbh Compositions comprising humanized anti-cd40 antibodies and methods for treating rheumatoid arthritis using the same
WO2025147500A1 (en) 2024-01-03 2025-07-10 Kiniksa Pharmaceuticals, Gmbh Method of reducing aggregation in the virus-inactivated preparation of anti-cd40 antibodies
WO2025169146A1 (en) 2024-02-09 2025-08-14 Kiniksa Pharmaceuticals, Gmbh Cd40 antagonist or cd154 antagonist for use in mitigating immune responses in protein and gene therapies
EP4426744A4 (en) * 2021-11-05 2025-10-22 Kiniksa Pharmaceuticals Gmbh Pharmaceutical compositions of humanized anti-CD40 antibodies
US12514924B2 (en) 2015-09-04 2026-01-06 Primatope Therapeutics Inc. Humanized anti-CD40 antibodies and uses thereof

Families Citing this family (22)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
TR201909840T4 (en) 2011-03-11 2019-07-22 Beth Israel Deaconess Medical Ct Inc Anti-CD40 antibodies and their uses.
JP2021513367A (en) 2018-02-12 2021-05-27 ダイアベーツ−フリー, インコーポレイテッド Improved antagonistic anti-human CD40 monoclonal antibody
CN113474012B (en) * 2019-01-25 2023-09-08 湖南远泰生物技术有限公司 EPCAM antibodies and EPCAM-CAR-T cells
US12365740B2 (en) 2019-04-10 2025-07-22 Nankai University Anti-CD40 antibodies and uses thereof
TWI875757B (en) * 2019-05-08 2025-03-11 瑞士商諾華公司 Anti-cd40 antibodies for use in treatment of t1dm and insulitis
WO2020232247A1 (en) 2019-05-14 2020-11-19 Provention Bio, Inc. Methods and compositions for preventing type 1 diabetes
WO2020253722A1 (en) * 2019-06-17 2020-12-24 Eucure (Beijing) Biopharma Co., Ltd Anti-cd40 antibodies and uses thereof
WO2021213245A1 (en) * 2020-04-20 2021-10-28 上海翰森生物医药科技有限公司 Antibody or antigen-binding fragment, preparation method and pharmaceutical uses therefor
IL298999A (en) 2020-06-11 2023-02-01 Provention Bio Inc Methods and compositions for preventing type 1 diabetes
JP2024520444A (en) 2021-05-24 2024-05-24 プロヴェンション・バイオ・インコーポレイテッド Methods for Treating Type 1 Diabetes
JP2024523514A (en) * 2021-06-28 2024-06-28 江蘇恒瑞医薬股▲ふん▼有限公司 Anti-CD40 antibodies, antigen-binding fragments thereof, and medical uses
WO2023274007A1 (en) * 2021-06-29 2023-01-05 舒泰神(北京)生物制药股份有限公司 Antibody for specific recognition of cd40 and application thereof
US20240343817A1 (en) * 2021-07-14 2024-10-17 Staidson (Beijing) Biopharmaceuticals Co., Ltd. Antibody that specifically recognizes cd40 and application thereof
JP7732843B2 (en) * 2021-10-14 2025-09-02 株式会社三共 gaming machines
JP7732840B2 (en) * 2021-10-14 2025-09-02 株式会社三共 gaming machines
JP7732841B2 (en) * 2021-10-14 2025-09-02 株式会社三共 gaming machines
JP7732842B2 (en) * 2021-10-14 2025-09-02 株式会社三共 gaming machines
JP7732839B2 (en) * 2021-10-14 2025-09-02 株式会社三共 gaming machines
AU2023205152A1 (en) * 2022-01-10 2024-07-18 Kiniksa Pharmaceuticals, Gmbh Methods of treating or reducing risk of transplant rejection
US20240190978A1 (en) 2022-11-15 2024-06-13 CSBioAsset LLC Compositions and methods for immunomodulatory bifunctional fusion molecules
US20250276092A1 (en) 2024-03-01 2025-09-04 Regeneron Pharmaceuticals, Inc. Methods and compositions for re-dosing aav using anti-cd40 antagonistic antibody to suppress host anti-aav antibody response
WO2025184603A2 (en) 2024-03-01 2025-09-04 Regeneron Pharmaceuticals, Inc. The use of cd40 inhibitors for inhibiting an immune response and enabling immunogen administration and re-administration

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20030211100A1 (en) * 2001-11-09 2003-11-13 Vahe Bedian Antibodies to CD40
US20110243932A1 (en) * 2010-03-31 2011-10-06 Boehringer Ingelheim International Gmbh Anti-cd40 antibodies
US20140093497A1 (en) * 2011-03-11 2014-04-03 Emory University Anti-cd40 antibodies and uses thereof

Family Cites Families (128)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3737433A (en) 1964-09-05 1973-06-05 Albert Ag Chem Werke Certain oxoalkyldimethylxanthines
DE2819094A1 (en) 1977-05-10 1978-11-23 Sandoz Ag CYCLOSPORIN DERIVATIVES, THEIR USE AND MANUFACTURING
US4235871A (en) 1978-02-24 1980-11-25 Papahadjopoulos Demetrios P Method of encapsulating biologically active materials in lipid vesicles
DE2907460A1 (en) 1978-03-07 1979-09-13 Sandoz Ag NEW RESORBABLE GALENIC COMPOSITIONS
US4384996A (en) 1981-01-09 1983-05-24 Sandoz Ltd. Novel cyclosporins
US4522811A (en) 1982-07-08 1985-06-11 Syntex (U.S.A.) Inc. Serial injection of muramyldipeptides and liposomes enhances the anti-infective activity of muramyldipeptides
US4501728A (en) 1983-01-06 1985-02-26 Technology Unlimited, Inc. Masking of liposomes from RES recognition
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US4576284A (en) 1983-12-02 1986-03-18 Warner-Lambert Company Closing of filled capsules
US4894366A (en) 1984-12-03 1990-01-16 Fujisawa Pharmaceutical Company, Ltd. Tricyclo compounds, a process for their production and a pharmaceutical composition containing the same
CH667274A5 (en) 1984-03-23 1988-09-30 Sandoz Ag CYCLOSPORINE, THEIR PRODUCTION AND PHARMACEUTICAL COMPOSITIONS CONTAINING THEM.
JPS6147500A (en) 1984-08-15 1986-03-07 Res Dev Corp Of Japan Chimera monoclonal antibody and its preparation
EP0173494A3 (en) 1984-08-27 1987-11-25 The Board Of Trustees Of The Leland Stanford Junior University Chimeric receptors by dna splicing and expression
GB8422238D0 (en) 1984-09-03 1984-10-10 Neuberger M S Chimeric proteins
DE3438830A1 (en) 1984-10-23 1986-04-30 Rentschler Arzneimittel PHARMACEUTICAL FORM CONTAINING NIFEDIPIN AND METHOD FOR THE PRODUCTION THEREOF
JPS61134325A (en) 1984-12-04 1986-06-21 Teijin Ltd Expression of hybrid antibody gene
DE3689123T2 (en) 1985-11-01 1994-03-03 Xoma Corp MODULAR UNIT OF ANTIBODY GENES, ANTIBODIES MADE THEREOF AND USE.
US5225539A (en) 1986-03-27 1993-07-06 Medical Research Council Recombinant altered antibodies and methods of making altered antibodies
GB8611905D0 (en) 1986-05-15 1986-06-25 Lilly Industries Ltd Capsules
US4837028A (en) 1986-12-24 1989-06-06 Liposome Technology, Inc. Liposomes with enhanced circulation time
GB8729153D0 (en) 1987-12-14 1988-01-27 Efamol Ltd Fatty acid compositions
ES2033086T3 (en) 1988-01-29 1993-03-01 Sankyo Company Limited A PROCEDURE FOR THE PREPARATION OF A PHARMACEUTICAL COMPOSITION.
HU201567B (en) 1988-07-21 1990-11-28 Gyogyszerkutato Intezet Process for production of intravenous medical compositions containing cyclosphorin
NZ230747A (en) 1988-09-30 1992-05-26 Bror Morein Immunomodulating matrix comprising a complex of at least one lipid and at least one saponin; certain glycosylated triterpenoid saponins derived from quillaja saponaria molina
US5530101A (en) 1988-12-28 1996-06-25 Protein Design Labs, Inc. Humanized immunoglobulins
DE3919982A1 (en) 1989-06-19 1990-12-20 Liedtke Pharmed Gmbh ORAL LIPID MEDICINE FORM
DE3920358A1 (en) 1989-06-22 1991-01-17 Behringwerke Ag BISPECIFIC AND OLIGO-SPECIFIC, MONO- AND OLIGOVALENT ANTI-BODY CONSTRUCTS, THEIR PRODUCTION AND USE
US5859205A (en) 1989-12-21 1999-01-12 Celltech Limited Humanised antibodies
US5279833A (en) 1990-04-04 1994-01-18 Yale University Liposomal transfection of nucleic acids into animal cells
JPH04230389A (en) 1990-07-16 1992-08-19 American Home Prod Corp Rapamycin derivative
US5023262A (en) 1990-08-14 1991-06-11 American Home Products Corporation Hydrogenated rapamycin derivatives
US5770429A (en) 1990-08-29 1998-06-23 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
PT98990A (en) 1990-09-19 1992-08-31 American Home Prod PROCESS FOR THE PREPARATION OF CARBOXYLIC ACID ESTERS OF RAPAMICIN
GB9022788D0 (en) 1990-10-19 1990-12-05 Cortecs Ltd Pharmaceutical formulations
US5120842A (en) 1991-04-01 1992-06-09 American Home Products Corporation Silyl ethers of rapamycin
US5100883A (en) 1991-04-08 1992-03-31 American Home Products Corporation Fluorinated esters of rapamycin
US5118678A (en) 1991-04-17 1992-06-02 American Home Products Corporation Carbamates of rapamycin
EP0519596B1 (en) 1991-05-17 2005-02-23 Merck & Co. Inc. A method for reducing the immunogenicity of antibody variable domains
US5118677A (en) 1991-05-20 1992-06-02 American Home Products Corporation Amide esters of rapamycin
US5120725A (en) 1991-05-29 1992-06-09 American Home Products Corporation Bicyclic rapamycins
US5120727A (en) 1991-05-29 1992-06-09 American Home Products Corporation Rapamycin dimers
WO1994004679A1 (en) 1991-06-14 1994-03-03 Genentech, Inc. Method for making humanized antibodies
GB9114948D0 (en) 1991-07-11 1991-08-28 Pfizer Ltd Process for preparing sertraline intermediates
US5283185A (en) 1991-08-28 1994-02-01 University Of Tennessee Research Corporation Method for delivering nucleic acids into cells
US5164495A (en) 1991-09-18 1992-11-17 Abbott Laboratories Method for preparing a dicarboxylic acid half-acid ester of FK506
EP0605522B1 (en) 1991-09-23 1999-06-23 Medical Research Council Methods for the production of humanized antibodies
US5151413A (en) 1991-11-06 1992-09-29 American Home Products Corporation Rapamycin acetals as immunosuppressant and antifungal agents
GB9125660D0 (en) 1991-12-03 1992-01-29 Smithkline Beecham Plc Novel compound
US5177203A (en) 1992-03-05 1993-01-05 American Home Products Corporation Rapamycin 42-sulfonates and 42-(N-carboalkoxy) sulfamates useful as immunosuppressive agents
US5397703A (en) 1992-07-09 1995-03-14 Cetus Oncology Corporation Method for generation of antibodies to cell surface molecules
US5874082A (en) 1992-07-09 1999-02-23 Chiron Corporation Humanized anti-CD40 monoclonal antibodies and fragments capable of blocking B cell proliferation
ZA935112B (en) 1992-07-17 1994-02-08 Smithkline Beecham Corp Rapamycin derivatives
US5234140A (en) 1992-07-28 1993-08-10 S. C. Johnson & Son, Inc. Re-useable aerosol container
US5256790A (en) 1992-08-13 1993-10-26 American Home Products Corporation 27-hydroxyrapamycin and derivatives thereof
AU687755B2 (en) 1992-08-21 1998-03-05 Genentech Inc. Method for treating an LFA-1-mediated disorder
GB9221220D0 (en) 1992-10-09 1992-11-25 Sandoz Ag Organic componds
US5258389A (en) 1992-11-09 1993-11-02 Merck & Co., Inc. O-aryl, O-alkyl, O-alkenyl and O-alkynylrapamycin derivatives
NZ273504A (en) 1993-10-01 1997-12-19 Immunex Corp Monoclonal antibodies (moabs) that specifically bind human cd40 molecules and cd40 ligand binding
CA2175215C (en) 1993-11-19 2008-06-03 Yat Sun Or Semisynthetic analogs of rapamycin (macrolides) being immunomodulators
US5908635A (en) 1994-08-05 1999-06-01 The United States Of America As Represented By The Department Of Health And Human Services Method for the liposomal delivery of nucleic acids
AUPM873294A0 (en) 1994-10-12 1994-11-03 Csl Limited Saponin preparations and use thereof in iscoms
US6096716A (en) 1994-12-12 2000-08-01 The Board Of Regents, The University Of Texas System Liposome-mediated transfection of central nervous system cells
US5869046A (en) 1995-04-14 1999-02-09 Genentech, Inc. Altered polypeptides with increased half-life
US5766629A (en) 1995-08-25 1998-06-16 Sangstat Medical Corporation Oral cyclosporin formulations
US5827822A (en) 1996-03-25 1998-10-27 Sangstat Medical Corporation Cyclosporin a formulations as nanoparticles
US20030099642A1 (en) 1996-04-22 2003-05-29 Michael J. Yellin Therapeutic applications for the anti-t-bam (cd40l) monoclonal antibody 5c8 in the treatment of vasculitis
US6132978A (en) 1995-12-19 2000-10-17 National Jewish Medical And Research Center Method to regulate CD40 signaling
AUPO517897A0 (en) 1997-02-19 1997-04-11 Csl Limited Chelating immunostimulating complexes
AU748443B2 (en) 1998-02-04 2002-06-06 General Hospital Corporation, The Costimulatory blockade and mixed chimerism in transplantation
US6051228A (en) 1998-02-19 2000-04-18 Bristol-Myers Squibb Co. Antibodies against human CD40
AUPP807399A0 (en) 1999-01-08 1999-02-04 Csl Limited Improved immunogenic lhrh composition and methods relating thereto
ES2572834T3 (en) 1999-02-17 2016-06-02 Csl Limited Immunogenic complexes and related methods
US6946129B1 (en) 1999-06-08 2005-09-20 Seattle Genetics, Inc. Recombinant anti-CD40 antibody and uses thereof
WO2001056603A1 (en) 2000-02-01 2001-08-09 Tanox, Inc. Cd40-binding apc-activating molecules
WO2002011763A1 (en) 2000-04-19 2002-02-14 Tanox, Inc. Cd40 antagonists for use in treating psoriasis and other inflammatory skin conditions
US7063845B2 (en) 2000-04-28 2006-06-20 Gemini Science, Inc. Human anti-CD40 antibodies
JP5184732B2 (en) 2000-06-19 2013-04-17 ベス イスラエル デアコネス メディカル センター Compositions and methods of use of monoclonal and polyclonal antibodies specific for T cell subpopulations
EP1322383B9 (en) 2000-10-02 2006-09-06 Chiron Corporation Methods of therapy for b-cell malignancies using antagonist anti-cd40 antibodies
CA2658221C (en) 2001-04-27 2012-11-27 Kyowa Kirin Co., Ltd. Anti-cd40 monoclonal antibody
US20040126829A1 (en) 2001-12-18 2004-07-01 Hildebrand William H. Anti-HLA assay and methods
AU2003217912A1 (en) 2002-03-01 2003-09-16 Xencor Antibody optimization
US8277810B2 (en) 2003-11-04 2012-10-02 Novartis Vaccines & Diagnostics, Inc. Antagonist anti-CD40 antibodies
WO2005044307A2 (en) 2003-11-04 2005-05-19 Chiron Corporation Methods of therapy for b cell-related cancers
SI1682177T1 (en) 2003-11-04 2010-12-31 Novartis Vaccines & Diagnostic Use of antagonist anti-cd40 antibodies for treatment of chronic lymphocytic leukemia
KR101128777B1 (en) 2003-11-04 2012-04-13 조마 테크놀로지 리미티드 Use of antagonist anti-cd40 monoclonal antibodies for treatment of multiple myeloma
ATE447412T1 (en) 2003-11-04 2009-11-15 Novartis Vaccines & Diagnostic ANTAGONIST ANTI-CD40 MONOCLONAL ANTIBODIES AND METHODS OF USE
CN1922316B (en) 2003-12-25 2011-03-23 协和发酵麒麟株式会社 Anti-CD40 antibody mutant
DK2270045T3 (en) 2004-02-06 2015-04-07 Univ Massachusetts ANTIBODIES AGAINST CLOSTRIDIUM DIFFICILE TOXINES AND APPLICATIONS THEREOF
WO2006073443A2 (en) * 2004-04-27 2006-07-13 Novartis Vaccines And Diagnostics, Inc. Antagonist anti-cd40 monoclonal antibodies and methods for their use
SE0401601D0 (en) 2004-06-21 2004-06-21 Bioarctic Neuroscience Ab Protofibril specific antibodies and uses thereof
EP1776105A2 (en) 2004-07-18 2007-04-25 Coley Pharmaceutical Group, Ltd Methods and compositions for inducing innate immune responses
US20060287263A1 (en) 2004-07-18 2006-12-21 Csl Limited Methods and compositions for inducing antigen-specific immune responses
EP1810979B1 (en) 2004-09-22 2012-06-20 Kyowa Hakko Kirin Co., Ltd. STABILIZED HUMAN IgG4 ANTIBODIES
RS53239B (en) 2005-02-02 2014-08-29 University Of Massachusetts HUMAN ANTI-ANTIBODY ANTIBODIES AND THEIR USES
US8303955B2 (en) 2005-05-26 2012-11-06 Seattle Genetics, Inc. Humanized anti-CD40 antibodies and their methods of use
JP2008546647A (en) 2005-06-08 2008-12-25 デューク ユニバーシティ Anti-CD19 antibody treatment for transplantation
ES2400660T3 (en) 2005-11-01 2013-04-11 Novartis Ag Uses of anti-CD40 antibodies
WO2007053661A2 (en) 2005-11-01 2007-05-10 Novartis Ag Uses of anti-cd40 antibodies
US20090304687A1 (en) * 2005-12-09 2009-12-10 Seattle Genetics , Inc. Methods of using cd40 binding agents
AR060487A1 (en) 2006-04-21 2008-06-18 Xoma Technology Ltd PHARMACEUTICAL COMPOSITIONS OF ANTI-BODY ANTAGONISTS ANTI-CD40
EP1854810A1 (en) 2006-05-09 2007-11-14 PanGenetics B.V. Deimmunized antagonistic anti-human CD40 monoclonal antibody from the ch5D12 antibody
CA2664326C (en) 2006-09-29 2016-01-19 Union Carbide Chemicals & Plastics Technology Corporation Quaternized cellulose ethers for personal care products
ME00832B (en) 2007-03-22 2012-03-20 Ucb Biopharma Sprl Binding proteins, including antibodies, antibody derivatives and antibody fragments, that specifically bind cd154 and uses thereof
MX2010005099A (en) 2007-11-09 2010-05-27 Novartis Ag Uses of anti-cd40 antibodies.
CA2712989C (en) 2008-01-23 2015-10-27 Xencor, Inc. Optimized cd40 antibodies and methods of using the same
EP2367849B1 (en) 2008-12-05 2017-11-01 ALS Therapy Development Institute Method for the treatment of neurodegenerative diseases
AU2010222942B2 (en) 2009-03-10 2013-01-10 Baylor Research Institute Anti-CD40 antibodies and uses thereof
AR083847A1 (en) 2010-11-15 2013-03-27 Novartis Ag FC VARIANTS (CONSTANT FRAGMENT) SILENCERS OF ANTI-CD40 ANTIBODIES
JP5458188B2 (en) 2011-02-17 2014-04-02 協和発酵キリン株式会社 High concentration formulation of anti-CD40 antibody
HUE038848T2 (en) 2011-04-21 2018-11-28 Bristol Myers Squibb Co Antibody polypeptides that antagonize cd40
US20140004131A1 (en) 2012-05-04 2014-01-02 Novartis Ag Antibody formulation
WO2014121099A1 (en) 2013-01-31 2014-08-07 Thomas Jefferson University Agonist fusion protein for cd40 ox40 and uses thereof
CN112245586A (en) 2013-03-15 2021-01-22 小利兰·斯坦福大学托管委员会 Methods for achieving therapeutically effective doses of anti-CD 47 agents
GB201501613D0 (en) 2015-01-30 2015-03-18 Ucb Biopharma Sprl Treatment of autoimmune disorders with CD154 antibodies
MA41459A (en) 2015-02-03 2017-12-12 Als Therapy Development Inst ANTI-CD40L ANTIBODIES AND METHODS FOR TREATING CD40L ILLNESSES OR DISORDERS
US10682396B2 (en) 2015-06-09 2020-06-16 B.G. Negev Technologies And Applications Ltd Controlled release system for pulmonary delivery of surfactant protein D
BR112017027549A2 (en) 2015-06-29 2018-09-11 Bristol-Myers Squibb Company cd40 antibody
BR112018004296B1 (en) * 2015-09-04 2020-05-05 Primatope Therapeutics Inc humanized anti-cd40 antibodies and their uses
EP3867280A4 (en) 2018-10-18 2022-11-09 Sinomab Bioscience Limited METHODS OF TREATING RHEUMATOID ARTHRITIS
EP4213939A1 (en) 2020-09-21 2023-07-26 Boehringer Ingelheim International GmbH Use of anti-cd40 antibodies for treatment of inflammatory conditions
US20230203176A1 (en) 2021-09-17 2023-06-29 Novartis Ag Methods For Prevention Of Graft Rejection In Xenotransplantation
WO2023081831A2 (en) 2021-11-05 2023-05-11 Diabetes-Free, Inc. Methods and compositions for immune tolerance to aav antigens and transgene products in gene therapy
US20230279135A1 (en) 2021-11-05 2023-09-07 Kiniksa Pharmaceuticals, Ltd. Pharmaceutical compositions of humanized anti-cd40 antibodies
AU2022381723A1 (en) 2021-11-05 2024-05-16 Kiniksa Pharmaceuticals, Gmbh Pharmaceutical compositions of humanized anti-cd40 antibodies and uses thereof
US12234294B2 (en) 2021-11-05 2025-02-25 Kiniksa Pharmaceuticals, Gmbh Pharmaceutical composition of a humanized anti-CD40 antibody
AU2023205152A1 (en) 2022-01-10 2024-07-18 Kiniksa Pharmaceuticals, Gmbh Methods of treating or reducing risk of transplant rejection
WO2025045766A1 (en) 2023-08-25 2025-03-06 Kiniksa Pharmaceuticals, Gmbh Compositions comprising humanized anti-cd40 antibodies and methods for treating rheumatoid arthritis using the same
WO2025169146A1 (en) 2024-02-09 2025-08-14 Kiniksa Pharmaceuticals, Gmbh Cd40 antagonist or cd154 antagonist for use in mitigating immune responses in protein and gene therapies

Patent Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20030211100A1 (en) * 2001-11-09 2003-11-13 Vahe Bedian Antibodies to CD40
US20070190051A1 (en) * 2001-11-09 2007-08-16 Abgenix, Inc. Antibodies to CD40
US20110243932A1 (en) * 2010-03-31 2011-10-06 Boehringer Ingelheim International Gmbh Anti-cd40 antibodies
US20140093497A1 (en) * 2011-03-11 2014-04-03 Emory University Anti-cd40 antibodies and uses thereof

Cited By (25)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10993419B2 (en) 2014-12-10 2021-05-04 Regents Of The University Of Minnesota Genetically modified cells, tissues, and organs for treating disease
US9888673B2 (en) 2014-12-10 2018-02-13 Regents Of The University Of Minnesota Genetically modified cells, tissues, and organs for treating disease
US12465029B2 (en) 2014-12-10 2025-11-11 Regents Of The University Of Minnesota Genetically modified cells, tissues, and organs for treating disease
US10278372B2 (en) 2014-12-10 2019-05-07 Regents Of The University Of Minnesota Genetically modified cells, tissues, and organs for treating disease
US11234418B2 (en) 2014-12-10 2022-02-01 Regents Of The University Of Minnesota Genetically modified cells, tissues, and organs for treating disease
US12514924B2 (en) 2015-09-04 2026-01-06 Primatope Therapeutics Inc. Humanized anti-CD40 antibodies and uses thereof
WO2017220989A1 (en) 2016-06-20 2017-12-28 Kymab Limited Anti-pd-l1 and il-2 cytokines
WO2017220988A1 (en) 2016-06-20 2017-12-28 Kymab Limited Multispecific antibodies for immuno-oncology
WO2017220990A1 (en) 2016-06-20 2017-12-28 Kymab Limited Anti-pd-l1 antibodies
WO2018115003A2 (en) 2016-12-19 2018-06-28 Glenmark Pharmaceuticals S.A. Novel tnfr agonists and uses thereof
US11525005B2 (en) 2017-06-01 2022-12-13 Jiangsu Hengrui Medicine Co., Ltd. Anti-CD40 antibody, antigen binding fragment thereof and medical use thereof
WO2018219327A1 (en) 2017-06-01 2018-12-06 江苏恒瑞医药股份有限公司 Anti-cd40 antibody, antigen binding fragment thereof and medical use thereof
WO2020014974A1 (en) 2018-07-20 2020-01-23 Eucure (Beijing) Biopharma Co., Ltd Anti-cd40 antibodies and uses thereof
EP3823987A4 (en) * 2018-07-20 2022-03-02 Eucure (Beijing) Biopharma Co., Ltd ANTI-CD40 ANTIBODIES AND THEIR USES
US12134653B2 (en) 2018-07-20 2024-11-05 Eucure (Beijing) Biopharma Co., Ltd Anti-CD40 antibodies and uses thereof
WO2020108621A1 (en) 2018-11-30 2020-06-04 江苏恒瑞医药股份有限公司 Cd40 antibody pharmaceutical composition and use thereof
WO2020108611A1 (en) 2018-11-30 2020-06-04 江苏恒瑞医药股份有限公司 Anti-cd40 antibody, antigen binding fragment and pharmaceutical use thereof
WO2021048595A1 (en) * 2019-09-11 2021-03-18 Novartis Ag A method for preventing human virus associated disorders in patients
WO2021236546A1 (en) * 2020-05-18 2021-11-25 Bristol-Myers Squibb Company Antibody variants with improved pharmacokinetic properties
EP4426744A4 (en) * 2021-11-05 2025-10-22 Kiniksa Pharmaceuticals Gmbh Pharmaceutical compositions of humanized anti-CD40 antibodies
US12234294B2 (en) * 2021-11-05 2025-02-25 Kiniksa Pharmaceuticals, Gmbh Pharmaceutical composition of a humanized anti-CD40 antibody
WO2023081641A1 (en) * 2021-11-05 2023-05-11 Kiniksa Pharmaceuticals, Ltd. Pharmaceutical compositions of humanized anti-cd40 antibodies and uses thereof
WO2025045766A1 (en) 2023-08-25 2025-03-06 Kiniksa Pharmaceuticals, Gmbh Compositions comprising humanized anti-cd40 antibodies and methods for treating rheumatoid arthritis using the same
WO2025147500A1 (en) 2024-01-03 2025-07-10 Kiniksa Pharmaceuticals, Gmbh Method of reducing aggregation in the virus-inactivated preparation of anti-cd40 antibodies
WO2025169146A1 (en) 2024-02-09 2025-08-14 Kiniksa Pharmaceuticals, Gmbh Cd40 antagonist or cd154 antagonist for use in mitigating immune responses in protein and gene therapies

Also Published As

Publication number Publication date
MX2018002708A (en) 2018-08-01
CN109069621B (en) 2022-09-06
US11439706B2 (en) 2022-09-13
US20190117771A1 (en) 2019-04-25
KR20180044422A (en) 2018-05-02
EP3307322A1 (en) 2018-04-18
BR112018004296B1 (en) 2020-05-05
EP3307322A4 (en) 2018-05-30
HUE056769T2 (en) 2022-03-28
SI3307322T1 (en) 2021-08-31
JP7763612B2 (en) 2025-11-04
US9974855B2 (en) 2018-05-22
KR20250007054A (en) 2025-01-13
EP3307322B1 (en) 2021-02-17
CN116063481A (en) 2023-05-05
JP2018531591A (en) 2018-11-01
PL3307322T3 (en) 2021-07-05
AU2016315873B2 (en) 2022-08-18
US10201608B2 (en) 2019-02-12
US20180078640A1 (en) 2018-03-22
US20180280507A1 (en) 2018-10-04
MX2022015631A (en) 2023-01-11
US20200384107A1 (en) 2020-12-10
CA3002789A1 (en) 2017-03-09
CN109069621A (en) 2018-12-21
JP6976931B2 (en) 2021-12-08
EP3906943A1 (en) 2021-11-10
AU2016315873A1 (en) 2018-04-12
PT3307322T (en) 2021-04-23
DK3307322T3 (en) 2021-04-19
JP2023103460A (en) 2023-07-26
US10772958B2 (en) 2020-09-15
KR102779818B1 (en) 2025-03-11
US12514924B2 (en) 2026-01-06
AU2022241635A1 (en) 2022-11-03
US20220387587A1 (en) 2022-12-08
JP2021168685A (en) 2021-10-28
ES2887602T3 (en) 2021-12-23
HK1251974A1 (en) 2019-05-10

Similar Documents

Publication Publication Date Title
US12514924B2 (en) Humanized anti-CD40 antibodies and uses thereof
US20220133887A1 (en) Anti-cd40 antibodies and uses thereof
HK40064042A (en) Humanized anti-cd40 antibodies and uses thereof
HK40109404A (en) Anti-cd40 antibodies and uses thereof
HK40016286A (en) Anti-cd40 antibodies and uses thereof
HK1251974B (en) Humanized anti-cd40 antibodies and uses thereof
HK40016286B (en) Anti-cd40 antibodies and uses thereof
HK1193347B (en) Anti-cd40 antibodies and uses thereof
HK1193347A (en) Anti-cd40 antibodies and uses thereof

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 16843066

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 2016843066

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2018512313

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: MX/A/2018/002708

Country of ref document: MX

NENP Non-entry into the national phase

Ref country code: DE

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112018004296

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 20187009524

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2016315873

Country of ref document: AU

Date of ref document: 20160902

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 3002789

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 112018004296

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20180302