WO2017020009A1 - Regulation of mesodermal specification - Google Patents
Regulation of mesodermal specification Download PDFInfo
- Publication number
- WO2017020009A1 WO2017020009A1 PCT/US2016/044859 US2016044859W WO2017020009A1 WO 2017020009 A1 WO2017020009 A1 WO 2017020009A1 US 2016044859 W US2016044859 W US 2016044859W WO 2017020009 A1 WO2017020009 A1 WO 2017020009A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- cells
- mir
- endothelial
- stem
- pdgfra
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0603—Embryonic cells ; Embryoid bodies
- C12N5/0606—Pluripotent embryonic cells, e.g. embryonic stem cells [ES]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0634—Cells from the blood or the immune system
- C12N5/0647—Haematopoietic stem cells; Uncommitted or multipotent progenitors
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K67/00—Rearing or breeding animals, not otherwise provided for; New or modified breeds of animals
- A01K67/027—New or modified breeds of vertebrates
- A01K67/0275—Genetically modified vertebrates, e.g. transgenic
- A01K67/0276—Knock-out vertebrates
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
- A61P17/02—Drugs for dermatological disorders for treating wounds, ulcers, burns, scars, keloids, or the like
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/069—Vascular Endothelial cells
- C12N5/0692—Stem cells; Progenitor cells; Precursor cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0696—Artificially induced pluripotent stem cells, e.g. iPS
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/12—Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
- A61K35/44—Vessels; Vascular smooth muscle cells; Endothelial cells; Endothelial progenitor cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/10—Type of nucleic acid
- C12N2310/14—Type of nucleic acid interfering nucleic acids [NA]
- C12N2310/141—MicroRNAs, miRNAs
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2501/00—Active agents used in cell culture processes, e.g. differentation
- C12N2501/65—MicroRNA
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2506/00—Differentiation of animal cells from one lineage to another; Differentiation of pluripotent cells
- C12N2506/02—Differentiation of animal cells from one lineage to another; Differentiation of pluripotent cells from embryonic cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2506/00—Differentiation of animal cells from one lineage to another; Differentiation of pluripotent cells
- C12N2506/45—Differentiation of animal cells from one lineage to another; Differentiation of pluripotent cells from artificially induced pluripotent stem cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/0018—Culture media for cell or tissue culture
Definitions
- mesodermal progenitors During embryogenesis mesodermal progenitors give rise to multiple lineages including hemato-endothelial and cardiac lineages. Precise control of the specification of these lineages are necessary for proper development and embryogenesis, although the transcriptional regulators and signaling pathways that govern mesodermal progenitors are incompletely defined (Kattman et al., 2006; Loebel et al., 2003).
- Etv2 activates downstream targets including Tie2 and Lmo2 and interacts with Gata2 and FoxC2 to regulate the hemato-endothelial program (De Val et al., 2008; Rasmussen et al, 2011 ; Koyano-Nakagawa et al., 2012).
- Described herein is a novel Etv2-miR- 130a-Pdgfra network that directs stem cells, such as hemato-endothelial progenitors, towards the endothelial fate without affecting the hematopoietic lineage.
- stem cells such as hemato-endothelial progenitors
- This is the first report that defines a factor that directs endothelial development without affecting the hematopoietic lineage (directs cell fate to endothelium without effecting blood).
- One embodiment provides a method to differentiate ceils comprising contacting (in vitro and/or in vivo) stem, progenitor or precursor cells with miR- OOa, or nucleic acid, such as, RNA having at least 95% identity thereto, so as to yield cells of endothelial lineage.
- the stem, progenitor or precursor cells are embryonic stem cells, adult stem cells, induce pluripotent stem cells, and/or multipotent stem cells, such as multipotent mesodermal precursors.
- the stem, progenitor or precursor cells are mammalian cells.
- the progenitor cells are hemato- endothelial progenitors.
- the precursor cells are mesodermal precursor cells expressing FlkTVPdgfra*
- One embodiment provides for admixing the endothelial lineage cells produced by the methods described herein with a pharmaceutically acceptable carrier.
- One embodiment provides a method treat cardiovascular disease, a wound, and/or repopulate vasculature in a subject in need thereof comprising administering an effective amount of the endothelial lineage cells produced by the methods described herein so as to treat cardiovascular disease, a wound, and/or repopulate vasculature in said subject.
- the administered cells are autologous or allogeneic.
- the cells are mammalian.
- One embodiment provides a composition comprising the endothelial lineage cells obtained by the methods described herein and a cell culture media or a pharmaceutically acceptable carrier.
- One embodiment provides a method to differentiate stem, progenitor and/or precursor cells comprising contacting said stem, progenitor and/or precursor cells with Etv2, so as to increase expression of Flkl and decrease expression of Pdgfra relative to the initial cell population and contacting said cells with increased expression Flkl and decreased expression of Pdgfra with miR- OOa so to generate cells predominately of endothelial lineages, while not generating a significant population of cells of the hematopoietic lineage.
- Another embodiment provides a method to differentiate cells comprising contacting stem, progenitor and/or precursor cells with Etv2 and miR- OOa so as to yield cells predominantly of endothelial lineages, while not yielding a significant population of cells of the hematopoietic lineage.
- Another embodiment provides a method to differentiate cells comprising contacting stem, progenitor and/or precursor cells with miR- 130a so as to yield cells predominantly of endothelial lineages, while not yielding a significant population of cells of the hematopoietic lineage.
- the stem, progenitor or precursor cells are embryonic stem cells, adult stem cells, induced pluripotent stem cells, and/or multipotent stem cells (such as multipotent mesodermal precursors). In one embodiment, the stem, progenitor or precursor cells are mammalian ceils.
- One embodiment provides for the admixing of the endothelial lineage cells described/prepared herein with a pharmaceutically acceptable carrier.
- the endothelial lineage cells described/prepared herein are administered to a subject.
- One embodiment provides a composition of miR- 130a and stem, progenitor and/or precursor cells.
- the ceils are mammalian.
- compositions comprising the endothelial lineage cells obtained by the methods described herein and a cell culture media or a pharmaceutically acceptable carrier.
- FIGS. IA-L demonstrate that Etv2 modulates miR- 130a expression in endothelial progenitors.
- A-F FACS profile (A, D) and quantification (B, C, E, F) of mesodermal populations in Etv2-EYFP::Etv2 CtE + ;Dicer L L embryos at E7.5 from EYFP + and EYFP " compartments.
- G qPCR analysis of miR- 130a in CD31 + cells sorted from Dicer 1 ⁇ and Eiv2' : " : ⁇ : ⁇ ! ⁇ ! 1 embryos at E9.5.
- H Evolutionary conservation of the 5.0 kb upstream fragment of the miR- 130a gene.
- FIGS 2A-L show miR- 130a promotes the endothelial lineage.
- A Left panels: phase contrast images of wild-type E 14 (ES cells) and Dox- inducible miR- 130a ES cell (miR- 130a iES) colonies.
- Right panel qPCR analysis of miR- 130a in the absence (-Dox) and presence of Dox (+Dox).
- B qPCR analyses for endothelial and hematopoietic markers using -Dox and ⁇ Dox EBs at d6 of differentiation (ratio shown as +Dox/-Dox).
- C-F FACS profiles (C, E) and quantitication (D, F) of endothelial (Tie2 and CD31 (C, Dj); and hematopoietic (CD41 and CD45 (E, F)) markers in -Dox and +Dox conditions.
- G Schematic representation of the miR- 130a knockdown approach in the ES/EB system.
- H qPCR analysis of Meox2 using RNA isolated from controi and miR-130a antagomir transfected cells.
- FIGS 3A-0 show miR- 130a targets Pdgfra and miR-130a-Pdgfra pathway modulates mesodermal progenitors.
- A ClustalW multiple sequence alignment of Pdgfra 3' UTR and miR- 130a.
- B Luciferase activity of Luc- Pdgfra- 3 '-UTR reporter constructs in the presence of miR- 130a mimic and miR- 130a inhibitor.
- C Whole-mount in situ hybridization images of control and miR- 1 30a morphants using Pdgfra probes at 48 hpf.
- FIGS 4 A-J show miR- 130a targets Pdgfra in vivo and promotes lateral plate mesodermal lineage.
- A-C FACS profile (A) and quantification (B, C) of mesodermal populations in miR- 130a iES/EB differentiation in -Dox and +Dox conditions.
- D qPCR analysis of Pdgfra in -Dox and +Dox conditions using d4 EBs.
- E FACS profile of endothelial (Fikl and CD31) markers during miR- 130a iES/EB differentiation in -Dox and +Dox conditions.
- F Schematic of the experiment to determine the ability of miR- 1.30a to re-specify mesoderm.
- G, H FACS profiles (G) and quantification (H) of endothelial (Fikl and CD31) markers at d6.
- FIGS 5 A-E are related to Figure 1 ; miR- 130a is highly enriched in endothelial progenitors.
- A qRT-PCR analysis for Mes l, Fikl and Etv2 transcripts using RN A isolated from differentiating EBs. Expression was normalized to Gapdh levels.
- B qRTPCR for Dicer using primers directed to the RNase III domain. Mesp I and Fikl expressing ceils were sorted using ROR2 (Drukker et al, 2012) and Fikl antibodies, respectively. Etv2 expressing cells were sorted using EYFP fluorescence obtained from Etv2 Crc/+ ;Dicer L + and Etv2- EYFP;Dicer L/L crosses at E8.5.
- Figures 6A-H are related to Figure 2; miR -130a induces the endothelial program and suppresses the cardiogenic program without impacting
- A qPCR analyses of mature miR- 130a during ES/EB differentiation.
- B FACS profile (B) and quantification (C) of endothelial lineages ( VE-Cadherin and CD31) markers in the presence of Dox (+Dox) as compared to no Dox (-Dox).
- D Hematopoietic colony forming cell (CFC) assays from induced (+Dox) and uninduced (-Dox) miR- 130a iES/EBs,
- E Hematopoietic colony forming cell
- FIGS 7A-E are related to Figure 4; miR- 130a modulates the endothelial program via Pdgfra signaling.
- A linages of differentiating EBs obtained from miR- 130a+Pdgfra; IRES-GFP inducible ES cell lines in the absence (-Dox) and presence of Dox (+Dox).
- B-E FACS profiles (B, D) and quantification (C, E) of endothelial lineages (Tie2 and CD31 (B, C)) and hematopoietic lineages (CD41 and CD45 (D, E)) during d6 of miR-130a+Pdgfra iES/EB differentiation. Error bars indicate SEM (n - 3 : *p ⁇ 0.05 ).
- FIG. 8 depicts Etv2-miR- 130a- Pdgfra network regulates endothelial development.
- a model summarizing the involvement of Etv2-miR- 130a network in the regulation of hemato-endothelial development.
- Flkl and Pdgfra are highly expressed in early multipotent mesodermal precursors (unpatterned mesoderm).
- Etv2 serves as a key mediator in the derivation of hemato-endothelial progenitors (Flkl + /Pdgfralow) from mesodermal precursors by down-regulating Pdgfra.
- Figure 9 provides a graphical presentation of the Etv2-miR- 130a network.
- MicroRNAs small non-coding RNAs
- MicroRNAs govern the molecular switch by suppressing gene expression, thereby modulating and fine- tuning cell fate decisions (I ey and Srivastava, 2010).
- miRNA processing enzyme results in embryonic lethality (Bernstein et al., 2003; Yang et al., 2005), it is unclear whether miRNAs play any role in the hemato-endothelial segregation and vascular development.
- Etv2-miR-130a cascade that regulates mesodermal specification and determination.
- Ablation of Dicer in the Etv2- expressing precursors resulted in altered mesodermal lineages and embryonic lethality by E12.5.
- miR-130a was identified as a direct target of Etv2 and demonstrated its role in the segregation of bipotent hemato-endothelial progenitors towards the endothelial lineage.
- Loss- and gain-of-function experiments demonstrated that miR-130a is a regulator of the endothelial program at the expense of cardiac program without impacting the hematopoietic lineages.
- miR- 130a directly suppresses expression level of Pdgfra and promotes the endothelial program by blocking Pdgfra signaling. Inhibition or activation of Pdgfra signaling phenocopied the miR-130a over- expression and knockdown, respectively.
- the term "about” means plus or minus 10% of the indicated value. For example, about 100 means from 90 to 1 10.
- isolated refers to a cell or cells which are not associated with one or more cells or one or more cellular components that are associated with the cell or cells in vivo.
- a “subject” is a vertebrate, such as a mammal, including a human. Mammals include, but are not limited to, humans, farm animals, sport animals and companion animals. Included in the term “animal” is dog, cat, fish, gerbil, guinea pig, hamster, horse, rabbit, swine, mouse, monkey (e.g., ape, gorilla, chimpanzee, and orangutan) rat, sheep, goat, cow and bird.
- Subjects that can benefit from the cells and methods of the invention include, but are not limited to, those suffering from a loss of function of endodermal cells, including, but not limited to, liver or pancreatic cells, as a result of physical or disease related damage.
- Totipotent (a.k.a. omnipotent) stem cells can differentiate into embryonic and extraembryonic cell types. Such cells can construct a complete, viable organism. These cells are produced from the fusion of an egg and sperm cell. Cells produced by the first few divisions of the fertilized egg are also totipotent. Pluripotent stem ceils are the descendants of totipotent ceils and can differentiate into nearly all cells, i.e. cells derived from any of the three germ layers.
- Multipotent stem cells can differentiate into a number of cell types, but only those of a closely related family of cells. Oligopotent stem cells can differentiate into only a few cell types, such as lymphoid or myeloid stem cells. Unipotent cells can produce only one cell type, their own, [4] but have the property of self- renewal, which distinguishes them from non-stem cells (e.g. progenitor cells, muscle stem cells).
- non-stem cells e.g. progenitor cells, muscle stem cells.
- Progenitor cells are cells produced during differentiation of a stem cell that have some, but not all, of the characteristics of their terminally- differentiated progeny. Defined progenitor cells are committed to a lineage, but not to a specific or terminally-differentiated cell type.
- endothelial cells encompasses not only terminally-differentiated cells types, but also cells that are committed to an endothelial lineage, but are not terminally- differentiated.
- “Differentiation factors” refer to cellular factors, preferably growth factors or angiogenic factors that induce lineage commitment.
- Self-renewal refers to the ability to produce replicate daughter cells having differentiation potential that is identical to those from which they arose. A similar term used in this context is "proliferation.”
- an “effective amount” generally means an amount which provides the desired local or systemic effect and/or performance, particularly for treating a condition of interest.
- Siem/Precursor/Progenitor cells are undifferentiated biological cells that can differentiate into specialized cells and can divide (through mitosis) to produce more stem cells. They are found in multicellular organisms. In adult organisms, stem ceils and progenitor cells act as a repair system for the body, replenishing adult tissues. In a developing embryo, stem cells can differentiate into all the specialized cells-ectoderm, endoderm and mesoderm (see induced pluripotent stem cells)-but also maintain the normal turnover of regenerative organs, such as blood, skin, or intestinal tissues.
- Autologous adult stem cells can be obtained from many sources in humans, such as bone marrow (which requires extraction by harvesting that is, drilling into bone (typically the femur or iliac crest); adipose tissue (lipid cells; which requires extraction, such as by liposuction); and/or blood (which requires extraction through apheresis, wherein blood is drawn from the donor (similai- to a blood donation), and passed through a machine that extracts the stem cells and returns other portions of the blood to the donor).
- Heterologous and xenogeneic cells can also be used in methods of the invention.
- Stem ceils can also be taken from umbilical cord blood just after birth.
- autologous cells are obtained from one's own body, just as one may bank his or her own blood for elective surgical procedures.
- the precursor cells are multipotent mesodermal precursor cells expressing Flkl + /Pdgfra + .
- Stem and/or progenitor and/or precursor cells can also be isolated in the presence of various factors such as LIF (e.g., at a concentration of about 5,000 U/ml to about 50,000 U/ml, such as about 10,000 U/ml), EGF (e.g., at a concentration of about 5 ng/ml to about 50 ng/ml, such as about 10 ng ml), basic FGF (e.g., at a concentration of about 5 ng ml to about 50 ng/ml, such as about 10 ng/ml) or PDGF (e.g., at a concentration of about 5 ng/ml to about 50 ng/ml, such as about 10 ng/ml).
- LIF e.g., at a concentration of about 5,000 U/ml to about 50,000 U/ml, such as about 10,000 U/ml
- EGF e.g., at a concentration of about 5 ng/ml to about 50 ng/ml,
- stem and/or progenitor and/or precursor cells can be cultured in culture medium that is well established in the art and commercially available from the American Type Culture Collection (ATCC).
- Such media include, but are not limited to, Dulbecco's Modified Eagle' s Medium (DMEM), DMEM F12 medium. Eagle's Minimum Essential Medium, F-12K medium, Iscove's Modified Dulbecco' s Medium, or RPMI-1640 medium. It is within the skill of one in the art to modify or modulate concentrations of media and/or media supplements as needed for the cells used. It will also be apparent that many media are available as low-glucose formulations, with or without sodium pyruvate.
- Sera often contain cellular factors and components that are necessary for viability and expansion. Examples of sera include fetal bovine serum (FBS), bovine serum (BS), calf serum (CS), fetal calf serum (FCS), newborn calf serum (NCS), goat serum (GS), horse serum (HS), human serum, chicken serum, porcine serum, sheep serum, rabbit serum, rat serum (RS), serum replacements, and bovine embryonic fluid.
- FBS fetal bovine serum
- BS bovine serum
- CS calf serum
- FCS fetal calf serum
- NCS newborn calf serum
- GS goat serum
- HS horse serum
- human serum chicken serum
- porcine serum sheep serum
- RS rabbit serum replacements
- bovine embryonic fluid bovine embryonic fluid
- the endodermal progenitor cells are cultured in the presence of FBS /or serum specific for the species cell type.
- FBS total serum
- endodermal progenitor cells can be isolated and/or expanded with total serum (e.g., FBS) concentrations of about 0.5% to about 5% or greater including about 5%> to about 15%. Concentrations of serum can be determined empirically.
- Additional supplements can also be used to supply the cells with trace elements for optimal growth and expansion.
- Such supplements include insulin, transferrin, sodium selenium, and combinations thereof.
- These components can be included in a salt solution such as, but not limited to, Hanks' Balanced Salt Solution (HBSS), Earle's Salt Solution, antioxidant supplements, MCDB-201 supplements, phosphate buffered saline (PBS), N-2-hydroxyethylpiperazine-N' - ethanesulfonic acid (HEPES), nicotinamide, ascorbic acid and/or ascorbic acid- 2 -phosphate, as well as additional amino acids.
- HBSS Hanks' Balanced Salt Solution
- EHEPES N-2-hydroxyethylpiperazine-N' - ethanesulfonic acid
- nicotinamide ascorbic acid and/or ascorbic acid- 2 -phosphate, as well as additional amino acids.
- Many cell culture media already contain amino acids; however some
- Such amino acids include, but are not limited to, L-alanine, L-arginine, L- aspartic acid, L-asparagine, L-cysteine, L-cystine, L-glutamic acid, L-glutamine, L-glycine, L-histidine, L-inositol, L-isoleucine, L-leucine, L-lysine, L- methionine, L-phenylalanine, L-proline, L-serine, L-threonine, L-tryptophan, L- tyrosine, and L-valine.
- Antibiotics are also typically used in cell culture to mitigate bacterial, mycoplasmal, and fungal contamination.
- antibiotics or anti-mycotic compounds used are mixtures of penicillin/streptomycin, but can also include, but are not limited to, amphotericin (Fungizone), ampicillin, gentamicin, bleomycin, hygromycin, kanamycin, mitomycin, mycophenolic acid, nalidixic acid, neomycin, nystatin, paromomycin, polymyxin, puromyein, rifampicin, spectinomycin, tetracycline, tylosin, and zeocin.
- Hormones can also be advantageously used in cell culture and include, but are not limited to, D-aldosterone, diethylstilbestrol (DES), dexamethasone, ⁇ -estradiol, hydrocortisone, insulin, prolactin, progesterone, somatostatin/human growth hormone (HGH), thyrotropin, thyroxine, and L-thyronine.
- DES diethylstilbestrol
- dexamethasone ⁇ -estradiol
- hydrocortisone insulin
- prolactin progesterone
- HGH somatostatin/human growth hormone
- thyrotropin thyroxine
- L-thyronine L-thyronine.
- ⁇ - mercaptoethanol can also be supplemented in cell culture media.
- Lipids and lipid carriers can also be used to supplement cell culture media, depending on the type of cell and the fate of the differentiated cell.
- Such lipids and carriers can include, but are not limited to cyclodextrin,, cholesterol, linoleic acid conjugated to albumin, linoleic acid and oleic acid conjugated to albumin, unconjugated linoleic acid, linoleic-oleic-arachidonic acid conjugated to albumin, oleic acid unconjugated and conjugated to albumin, among others.
- Albumin can similarly be used in fatty-acid free formulation.
- Feeder cells can be used to support the growth of cultured cells, including, stem and/or progenitor and/or precursor ceils. Feeder cells are normal cells that have been inactivated by y -irradiation. In culture, the feeder layer serves as a basal layer for other cells and supplies cellular factors without further growth or division of their own (Lim and Bodnar 2002). Examples of feeder layer cells typically used with liver cell cultures are hepatocytes and embryonic fibroblasts (Suzuki, A. et al.
- LIF leukemia inhibitory factor
- Ceils in culture can be maintained either in suspension or attached to a solid support, such as extracellular matrix components and synthetic or biopolymers.
- Cells often require additional factors that encourage their attachment to a solid support (e.g., attachment factors) such as type I, type II, and type IV collagen, cone ana val in A, chondroitin sulfate, fibronectin,
- fibronectin and/or fibronectin-like polymers, gelatin, laminin, poly-D and poly-L-lysine, Matrigel, thrombospondin, and/or vitronectin.
- the maintenance conditions of cells can also contain cellular factors that allow ceils, such as stem and/or progenitor and/or precursor cells, to remain in an undifferentiated form. It may be advantageous under conditions where the cell must remain in an undifferentiated state of self-renewal for the medium to contain epidermal growth factor (EGF), platelet derived growth factor (PDGF), leukemia inhibitory factor (LIF), basic fibroblast growth factor (bFGF) and combinations thereof.
- EGF epidermal growth factor
- PDGF platelet derived growth factor
- LIF leukemia inhibitory factor
- bFGF basic fibroblast growth factor
- Stem and/or progenitor and/or precursor cells can be selected based on the markers (gene and/or protein) described herein. Accordingly, positive selection methods can be used, either alone or together with the methods described above, to identify and/or isolate the cells of the invention. Methods of positive selection can include visual selection, using microscopy and/or other means of detection, including, but not limited to, immunoblotting,
- immunofluorescence, and/or enzyme-linked immunosorbent assay can also include, but are not limited to, additional selective culture techniques (e.g., variable cell densities or amounts of C ⁇ 3 ⁇ 4), flow cytometry, RT-PCR, and/or microchip-based methods of ceil separation.
- the endothelium is the thin layer of simple squamous cells that lines the interior surface of blood vessels and lymphatic vessels, forming an interface between circulating blood or lymph in the lumen and the rest of the vessel wall.
- the cells that form the endothelium are called endothelial cells.
- Endothelial cells in direct contact with blood are called vascular endothelial cells, whereas those in direct contact with lymph are known as lymphatic endothelial cells.
- Vascular endothelial ceils line the entire circulatory system, from the heart to the smallest capillaries. These cells have unique functions in vascular biology. These functions include fluid filtration, such as in the glomeruli of the kidney, blood vessel tone, hemostasis, neutrophil recruitment, and hormone trafficking. Endothelium of the interior surfaces of the heart chambers is called endocardium.
- Endothelium is mesodermal in origin. Both blood and lymphatic capillaries are composed of a single layer of endothelial cells called a monolayer. In straight sections of a blood vessel, vascular endothelial cells typically align and elongate in the direction of fluid flow.
- the foundational model of anatomy makes a distinction between endothelial cells and epithelial ceils on the basis of which tissues they develop from, and states that the presence of vimentin rather than keratin filaments separate these from epithelial cells.
- Endothelial cells are involved in many aspects of vascular biology, including: barrier function (the endothelium acts as a semi-selective barrier between the vessel lumen and surrounding tissue, controlling the passage of materials and the transit of white blood cells into and out of the blood tream; Excessive or prolonged increases in permeability of the endothelial monolayer, as in cases of chronic inflammation, may lead to tissue edema swelling); blood clotting (thrombosis & fibrinolysis; the endothelium!
- heparan sulfate which acts as a cofactor for activating antithrombio, a protease that inactivates several factors in the coagulation cascade); inflammation; formation of new blood vessels (angiogenesis); vasoconstriction and vasodilation (and hence the control of blood pressure); repair of damaged or diseased organs via an injection of blood vessel cells; and angiopoietin-2 works with VEGF to facilitate cell proliferation and migration of endothelial cells.
- Endothelial dysfunction or the loss of proper endothelial function, is a hallmark for vascular diseases, and is often regarded as a key early event in the development of atherosclerosis. Impaired endothelial function, causing hypertension and thrombosis, is often seen in patients with coronary artery disease, diabetes mellitus, hypertension, hypercholesterolemia, as well as in smokers. Endothelial dysfunction has also been shown to be predictive of future adverse cardiovascular events, and is also present in inflammatory disease such as rheumatoid arthritis and systemic lupus erythematosus.
- endothelial dysfunction One of the main mechanisms of endothelial dysfunction is the diminishing of nitric oxide, often due to high levels of asymmetric dimethylarginine, which interfere with the normal L-arginine-stimulated nitric oxide synthesis and so leads to hypertension.
- the most prevailing mechanism of endothelial dysfunction is an increase in reactive oxygen species, which can impair nitric oxide production and activity via se veral mechanisms.
- the signaling protein ERK5 plays a role in maintaining normal endothelial cell function.
- a further consequence of damage to the endothelium is the release of pathological quantities of von Willebrand factor, which promote platelet aggregation and adhesion to the sub-endothelium, and thus the formation of thrombi.
- Stem, precursor and progenitor cells can be used for the generation of endothelial cells or endotheli precursors (the term endothelial ceils refers to cells of varying degree of differentiation, some may be fully differentiated down the endothelial pathway, while others are in the early stages and can still be directed down one or endothelial lineages).
- One embodiment provides methods for providing endothelial cells comprising differentiating stem, precursor and progenitor cells in the presence of miR- 130a and optionally Etv2 (sequence information provided in Example 2 below), and isolating the endothelial cells. Differentiation can occur in vitro, in vivo or ex vivo.
- niiR- 130 micro RN A precursor is a small non-coding RNA that regulates gene expression.
- This microRNA has been identified in mouse (MI0000156 (GAGCUCUUUUCACAUUGUGCUACUGUCUAACGUGUACCGAGCAGU GCAAUGU ' UAAAAGGGCAUC; SEQ ID ⁇ : 1 ), MI0000408
- the miR-130 is as disclosed herein or 95% identical thereto.
- the mirNA-130 has at least about 85 %, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 99.5 % identity to the nucleic acid sequences disclosed herein.
- GappedBLAST programs the default parameters of the respective programs (e.g., XBLAST and NBLAST) are used to obtain nucleotide sequences homologous to a nucleic acid molecule of the in vention.
- Identity or identical means nucleic acid sequence (or amino acid sequence) similarity and has an art recognized meaning. Sequences with identity share identical or similar amino acids (or nucleic acids). Sequence identity is the percentage of amino acids identical to those in the antibody's original amino acid sequence, determined after the sequences are aligned and gaps are appropriately introduced to maximize the sequence identit as necessary. Thus, a candidate sequence sharing 85 % amino acid sequence identity with a reference sequence requires that, following alignment of the candidate sequence with the reference sequence, 85 % of the amino acids in the candidate sequence are identical to the corresponding amino acids in the reference sequence, and/or constitute conservative amino acid changes.
- miR-130 appears to be vertebrate-specific miRNA and has now been predicted or experimentally confirmed in a range of vertebrate species
- MIP0000034 Mature microRNAs are processed from the precursor stem- loop by the Dicer enzyme. In this case, the mature sequence is excised from the 3' arm of the hairpin, it has been found that miR-130 is upregulated in a type of cancer called hepatocellular carcinoma.
- Cells that have been induced to differentiate can be identified by selectively culturing cells under conditions whereby differentiated cells outnumber undifferentiated cells. These conditions include, for example, extending the amount of time that cells are grown in culture, such that survival of a desired ceil type is encouraged. Many primary cells achie ve senescence, and fail to divide, or die, after a period of time. Other conditions comprise modulating the type and concentration of serum, or cuituring the cells in the presence or absence of growth factors and/or cytokines that induce
- differentiation to another cell type. Differentiation can also be advantageously achieved by modulation of serum concentrations, or withdrawal of serum from the culture. Other methods of inducing differentiation can include, but are not limited to, modulating the acidity of the culture medium, as well as the oxygen and carbon dioxide levels during culture.
- differentiated cells can be identified by morphological changes and characteristics that are not present on their undifferentiated counterparts, such as cell size, the number of cellular processes (i.e., formation of dendrites and/or branches), and the complexity of intracellular organelle distribution. Also contemplated are methods of identifying differentiated ceils by their expression of specific cell- urface markers such as cellular receptors and transmembrane proteins. Monoclonal antibodies against these cell -surface markers can be used to identify differentiated cells. Detection of these cells can be achieved through fluorescence activated cell sorting (FACS), and/or enzyme-linked
- ELISA immunosorbent assay
- RT-PCR Reverse-transcription polymerase chain reaction
- RT-PCR Reverse-transcription polymerase chain reaction
- whole genome analysis using microarray technology can be used to identify differentiated cells.
- differentiated cells can be separated from their undifferentiated counterparts, if necessary.
- the methods of identification detailed above also provide methods of separation, such as FACS, preferential cell culture methods, ELISA, magnetic beads, and combinations thereof.
- FACS preferential cell culture methods
- ELISA ELISA
- magnetic beads and combinations thereof.
- One embodiment of the invention envisions the use of FACS to identify and separate cells based on cell-surface antigen expression.
- Endothelial cells of the invention can be used in cell replacement therapies. Endothelial cells can be administered to a tissue of interest in a subject to supplement functioning cells or replace cells, which have lost function. Alternatively, methods of providing differentiated ceils are also contemplated, wherein the endothelial cells are differentiated in the presence of differentiation factors, isolated, and administered into or upon the body of a subject.
- either autologous, allogeneic or xenogeneic cells can be administered to a patient, either in u differentiated, terminally differentiated or in a partiaily differentiated form, genetically altered or unaltered, by direct introduction to a site of interest, e.g., on or around the surface of an acceptable matrix ,or systemically, in combination with a pharmaceutically acceptable carrier so as to repair, replace or promote the growth of existing and/or new blood vessels.
- Endothelial cells and methods of the invention include, but are not limited to, cardiovascular disease, wound healing, and/or repopulation or engineering vasculature in vitro and/or in vivo.
- Exogenous factors e.g., cytokines, differentiation factors and other factors
- a form of concomitant administration would comprise combining a factor of interest in the culture media and/or pharmaceutically acceptable carrier prior to administration.
- Doses for administrations are variable, may include an initial administration followed by subsequent administrations; but nonetheless, can be ascertained by the skilled artisan, from this disclosure, the documents cited herein, and the knowledge in the art.
- Endothelial cells of the invention or their progeny can be administered via localized injection, including catheter administration, systemic injection, localized injection, parenteral administration, or intrauterine injection into an embryo.
- a method to potentially increase cell survival, when introducing the cells into a subject in need thereof, is to incorporate endothelial cells into a biopolymer or synthetic polymer.
- the site of injection might prove inhospitable for cell seeding and growth because of scarring or other impediments.
- biopolymer include, but are not limited to, cells mixed with fibronectin, fibrin, fibrinogen, thrombin, collagen, and proteoglycans. This could be constructed with or without included cytokines, growth factors, differentiation factors or nucleic acid expression constructs. Additionally, these could be in suspension, but residence time at sites subjected to flow would be nominal.
- Another alternative is a three- dimensional gel with cells entrapped within the interstices of the cell biopohmer admixture. Again, differentiation factors, growth factors or cytokines could be included within the cells. These could be deployed by injection via various routes described herein.
- a parameter involved in the therapeutic use of endothelial cells is the quantity of cells necessary to achieve an optimal effect.
- empirical doses ranging from 1 to 4 x 10 7 cells have been used with encouraging results.
- different scenarios may require optimization of the amount of cells injected into a tissue of interest.
- the quantity of cells to be administered will vary for the subject being treated. In one embodiment, between 10 4 to 10 s , more preferably lir to 10 ; , and most preferably 3 x 10 ' progenitor cells and optionally, 50 to 500 fig/kg per day of a cytokine can be administered to a human subject.
- Another parameter involved in the use of endothelial cells is the purity of the population.
- Those skilled in the art can readily determine the percentage of endothelial cells in a population using various well-known methods, such as fluorescence activated cell sorting (FACS).
- FACS fluorescence activated cell sorting
- Preferable ranges of purity in populations comprising endothelial cells are about 1 to about 5 %, about 5 to about 10%, about 10 to about 15%, about 15 to about 20%, about 20 to about 25%, about 25 to about 30%, about 30 to about 35%, about 35 to about 40%, about 40 to about 45%, about 45 to about 50%, about 50 to about 55%, about 55 to about 60%, about 60 to about 65%, about 65 to about 70%, about 70 to about 75%, about 75 to about 80%, about 80 to about 85%, about 85 to about 90%, about 90% ⁇ to about 95% or about 95 to about 100%.
- Purity of the cells can be determined according to the cell surface marker profile within a population. Dosages can
- any additives in addition to the active cell(s) and/or cytokine(s) are present in an amount of 0.001 to 50 % (weight) solution in phosphate buffered saline, and the active ingredient is present in the order of micrograms to milligrams, such as about 0.0001 to about 5 wt %, preferably about 0.0001 to about 1 wt %, most preferably about 0.0001 to about 0.05 wt % or about 0.001 to about 20 wt %, preferably about 0.01 to about 10 wt %, and most preferably about 0.05 to about 5 wt %.
- any composition to be administered to an animal or human it is preferred to determine the toxicity, such as by determining the lethal dose (LD) and LD50 in a suitable animal model e.g., rodent such as mouse; and, the dosage of the composition(s), concentration of components therein and timing of administering the composition(s), which elicit a suitable response.
- a suitable animal model e.g., rodent such as mouse
- the dosage of the composition(s), concentration of components therein and timing of administering the composition(s) which elicit a suitable response.
- Such determinations do not require undue experimentation from the knowledge of the skilled artisan, this disciosure and the documents cited herein. And, the time for sequential administrations can be ascertained without undue experimentation.
- a therapeutic composition of the present invention When administering a therapeutic composition of the present invention, it will generally be formulated in a unit dosage injectable form (solution, suspension, emulsion)
- the cells can be administered to a subject by a variety of methods available to the art, including but not limited to localized injection, catheter administration, systemic injection, intraperitoneal injection, parenteral administration, oral administration, intracranial injection, intra-arterial injection, intravenous injection, intraventricular infusion, intraplacental injection, intrauterine injection, surgical intramyocardial injection,
- transendocardial injection transvascular injection, intracoronary injection, transvascular injection, intramuscular injection, surgical injection into a tissue of interest or via direct application to tissue surfaces (e.g., during surgery or on a wound).
- the pharmaceutical formulations suitable for injection include sterile aqueous solutions and dispersions.
- the carrier can be a solvent or dispersing medium containing, for example, water, saline, phosphate buffered saline, polyol (for example, glycerol, propylene glycol, liquid polyethylene glycol, and the like) and suitable mixtures thereof.
- various additives which enhance the stability, sterility, and isotonicity of the compositions including antimicrobial preservatives, antioxidants, chelating agents, and buffers, can be added.
- Prevention of the action of microorganisms can be ensured by various antibacterial and antifungal agents, for example, parabens, chlorobutanoL, phenol, sorbic acid, and the like.
- isotonic agents for example, sugars, sodium chloride, and the like.
- Prolonged absorption of the injectable pharmaceutical form can be brought about by the use of agents delaying absorption, for example, aluminum monostearate and gelatin. According to the present invention, however, any vehicle, diluent, or additive used would have to be compatible with the cells.
- Sterile injectable solutions can be prepared by incorporating the cells utilized in practicing the present invention in the required amount of the appropriate solvent with various amounts of the other ingredients, as desired.
- compositions comprising progenitor cells of the invention include liquid preparations for administration, including suspensions; and, preparations for intramuscular or intravenou administration (e.g., injectable administration), such as sterile suspensions or emulsions.
- Such compositions may be in admixture with a suitable carrier, diluent, or excipient such as sterile water, physiological saline, glucose, dextrose, or the like.
- the compositions can also be lyophilized.
- the compositions can contain auxiliary substances such as wetting or emulsifying agents, pH buffering agents, gelling or viscosity enhancing additives, preservatives, flavoring agents, colors, and the like, depending upon the route of administration and the preparation desired.
- compositions of the invention are conveniently provided as liquid preparations, e.g., isotonic aqueous solutions, suspensions, emulsions or viscous compositions, which may be buffered to a selected pH.
- Liquid preparations are normally easier to prepare than gels, other viscous compositions, and solid compositions. Additionally, liquid compositions are somewhat more convenient to administer, especially by injection. Viscous compositions, on the other hand, can be formulated within the appropriate viscosity range to provide longer contact periods with specific tissues.
- liquid dosage form e.g., whether the composition is to be formulated into a solution, a suspension, gel or smother liquid form, such as a time release form or liquid-filled form.
- Solutions, suspensions and gels normally contain a major amount of water (e.g., purified, sterilized water) in addition to the cells. Minor amounts of other ingredients such as pH adjusters (e.g., a base such as NaOH), emulsifiers or dispersing agents, buffering agents, preservatives, wetting agents and jelling agents (e.g., methyiceliuiose), may also be present.
- pH adjusters e.g., a base such as NaOH
- emulsifiers or dispersing agents e.g., a base such as NaOH
- buffering agents e.g., a base such as NaOH
- compositions of this invention may be accomplished using sodium chloride, or other pharmaceutically acceptable agents such as dextrose, boric acid, sodium tartrate, propylene glycol or other inorganic or organic solutes.
- Viscosity of the compositions can be maintained at the selected level using a pharmaceutically acceptable thickening agent.
- Methyiceliuiose is readily and economically available and is easy to work with.
- suitable thickening agents include, for example, xanthan gum, carboxymethyl cellulose, hydroxy-propyl cellulose, carbomer, and the like.
- concentration of the thickener will depend upon the agent selected. The point is to use an amount, which will achieve the selected viscosity. Viscous compositions are normally prepared from solutions by the addition of such thickening agents.
- a pharmaceutically acceptable preservative or cell stabilizer can be employed to increase the life of the compositions. If preservatives are used, it is well within the purview of the skilled artisan to select compositions that will not affect the viability or efficacy of the endodermal progenitor cells as described herein. Those skilled in the art will recognize that the components of the compositions should be selected to be chemically inert. This will present no problem to those skilled in chemical and pharmaceutical principles, or problems can be readily avoided by reference to standard texts or by simple experiments (not involving undue experimentation), from this disclosure and the documents cited herein.
- compositions can be administered in dosages and by techniques well known to those skilled in the medical and veterinary arts taking into consideration such factors as the age, sex, weight, and condition of the particular patient, and the composition form used for administration (e.g., solid vs. liquid). Dosages for humans or other mammals can be determined without undue experimentation by the skilled artisan, from this disclosure, the documents cited herein, and the knowledge in the art.
- Suitable regimes for initial administration and further doses or for sequential administrations also are variable and may include an initial
- Endothelial cells of the invention can be used for many diverse clinical and pre-clinical applications, which can include, but are not limited to, use in toxicological or genomic screening methods, determination of levels of enzymes and coagulation factors, as well as treatment of the diseases disclosed herein.
- Endothelial cells of the invention can provide a variety of differentiated cultured cell types for high-throughput toxicological or genomic screening.
- the cells can be cultured in, for example, 96-well or other multi-well culture plates to provide a system for high-throughput screening of, for example, target cytokines, chemokines, growth factors, or pharmaceutical compositions in
- the invention also envisions a tissue-engineered organ, or portion, or specific section thereof, a tissue engineered device comprising a tissue of interest and optionally, cytokines, growth factors, or differentiation factors that induce differentiation into a desired cell type, wherein the endothelial cells are used to generate tissue/vasculature.
- tissue engineered device comprising a tissue of interest and optionally, cytokines, growth factors, or differentiation factors that induce differentiation into a desired cell type, wherein the endothelial cells are used to generate tissue/vasculature.
- Dicer L L mice (strain: B6.Cg-Dicer tmlBdh /J) (Harfe et al., 2005) were intercrossed with Mespl-Cre (Saga et al, 1999), Flkl -Cre (Shalaby et al., 1995) and Etv2-Cre (Rasmussen et al., 2011) mice to generate Mesp 1 Cre/+ ;Dicer L ' + , FM ⁇ Dicer 1 - 7 * and Etv2 Cie + ;Dicer L/+ mice and subsequently crossed with Dicer LI ice to generate conditional Dicer knockouts.
- ESC culture conditions, ES/EB differentiation and the generation of the Dox -inducible miR- 130a ESCs were performed as previously reported (Iacovino et al., 201 1 ).
- the wild-type mouse E14 ES ceil line was maintained in Knockout Medium (Invitrogen) supplemented with 15 % FBS (Benchmark), 1000 U/tnl LIF (Millipore), glutamine (Hyclone), 0.1 mM non-essential amino acids (NEAA) and 0.1 mM ⁇ -mercaptoethanol ( Sigma) in gelatin-coated tissue-culture plates.
- the ES cells were differentiated into embryoid bodies (EBs) by the hanging drop method using mesodermal differentiation media containing IMDVI (Invitrogen), 15% FBS, penicillin/streptomycin, 2 mM GlutaMAX, 50 mg ml Fe- saturated transferrin (R & D Systems), 0.1 mM monothioglycerol (Sigma), and 50 mg/ml ascorbic acid (Sigma). Cryosectioning and immunohistochemical analyses were performed using a standard protocol with anti-TnT (1 :200, Sigma) and anti- CD31 (1 :200, BD Pharrningen) sera.
- stage specific embryos were separated from yolk sacs, and digested with 0.25% trypsin (Hyclone) to obtain a single cell suspension. Cells were incubated with antibody cocktails for 30 minutes at 4°C, washed, and resuspended in PBS with 2% FBS.
- mm01246167_ml Tie2: mm01256892_ml , Tnnt2:mm00441922_ml, c-kit: mm00445212_ml, Lmo2: mm00493153_ml , CD41 :mm00439741_ml , and Dicer: Mm00521722_ml .
- the oligonucleotides harboring the Etv2 binding motif in the miR-130a promoter region were; sense strand : 5 ' - GAATATAGGCAGGAAATTGACCAGAT-3 ' (SEQ ID NO:6); and antisense strand: 5 ' - ATCTGGTC AATTTCCTGCCT ATATTC - 3 ' (SEQ ID NO:7).
- COS7 cells were transfected using Lipofectamine 2000 (Invitrogen) according to the manufacturer' s protocols.
- O.SxIO 5 cells were cultured in 24-well plates and transfected at 90% confluency with 0.25 ng well of reporter construct together with increasing amounts of Etv2 constructs.
- pRL-TK 50 ng was used as a control for transfection efficiency.
- Cells were analyzed at 24 hr posttransfection. Activities of firefly and Renilla iuciferases were measured sequentially using the Dual- Luciferase Reporter Assay system (Promega) and a luminometer (Berthold Detection Systems, Sirius).
- COS7 cells were transfected using Lipofectamine 2000 (Invitrogen) with 150 nM/well of miR- 130a mimic s/antagomir and 0.2 ⁇ of Pdgfra constructs.
- pRL-TK (20 ng) was used as a control for transfection efficiency.
- Transfected cells were harvested after 48 hr using the Dual-Luciferase Reporter Assay system
- miR- 130a iESCs were differentiated in the mesoderm-inducing condition and treated from Days 2-6 with doxycycline.
- FlkvPdgfr hemato-endothelial mesoderm
- Flk Pdgfra + unpatterned mesoderm! and prospective cardiac mesoderm
- 50,000 dissociated ceils from whole EBs or FACS sorted EBs were plated on a 35 mm culture dish with 1.5 ml of MethoCult (M3434, Stem Cell Technologies) according to the manufacturer' s instructions. Hematopoietic colonies were identified and quantified after 10 days of incubation. These assays were performed in triplicate and independently repeated three times.
- Reaggregation of the sorted cells was performed as described (Kouskoff et al., 2005). Briefly, 4x10" FACS-sorted cells were plated in a low attachment 24-well plate (Costar) containing EB differentiation media in the absence or the presence of Dox. Reaggregated EBs were FACS analyzed at day 6 as previously described (Rasmussen et al., 2011). These assays were repeated at least three times and statistical analysis was performed using Student' s t-test.
- the DNA-protein complex was immuno recipitated with anti-HA serum (Santa Cruz, sc-805) from cell lysat.es using inducible HA-Etv2 EBs at day 3 of differentiation. qPCR was performed to detect the target region using the indicated primers; Fwd: 5'-GCTTTGGGTGAGGCTAAAACG-3' (SEQ ID NO:8); Rev: 5'-CAGAAGCCCTGTTCCCAGATG-3' (SEQ ID NO:9).
- miR-130a antagomir transfection Transfection of miR-130a antagomirs were performed as previously described (Zhang et al., 2014) with minor modifications. Briefly, ES cell suspensions were treated with 150 nM of control or miR- 130a antagomirs together with RNAimax reagent (Invitrogen) in low -attachment 6 -well plates (Costar). EBs were incubated with these oligonucleotides in a shaking culture and FACS assay was performed, on d6 of EB differentiation.
- RNAimax reagent Invitrogen
- Lentiviruses expressing full-length of Pdgfra were generated and infected into A21ox as well as miR-13Ga iES clones. Viral infected cells were FACS sorted for EGFP "1" fluorescence after addition of Dox. Sorted GFP + cells were amplified and experiments were performed as described in the results section.
- Etv2-Cre-mediated Dicer deletion results in altered mesodermal lineages and embryonic lethality
- Table 1 (related to Figure 1 ). Dicer functions are needed in mesodermal progenitors. Table showing embryonic lethality at distinct developmental stages of conditional knockout embryos obtained from Mespl -Cre, Flki -Cre and Etv2- Cre mediated Dicer deletions.
- Etv2 marks the earliest hemato-endothelial progenitors (Koyano- Nakagawa et al., 2012). Previous studies have demonstrated that Etv2-mutants have altered mesodermai populations (Rasmussen et al., 2011). To evaluate whether mesodermal derivatives were affected in Etv2 Cre + ;Dicer L/L mutants, Etv2 Cre + ;Dicer u+ and Etv2-EYFP;Dicer L L lines were crossed and FACS analysis performed at E7.5. Etv2-EYFP reporter has been shown to label the hemato- endothelial lineages during embryo genesis (Rasmussen et al., 2011 ).
- Etv2-EYFP* cells from the Etv2-wildtype (Etv2 +/+ ) and null (Etv2 ";" ) embryos at E7.5 were FACS sorted.
- qPCR analysis for miR- 130a showed reduced expression of miR- 130a in Etv2 ⁇ '' ⁇ embryos compared to controls ( Figure 1L).
- miR- 130a modulates the endothelial lineage during embryogenesis
- miR- 130a targets Pdgfra expression and modulates mesodermal lineage development
- miR- 130a could target Pdgfra transcripts in vivo
- miR- 1 30a-MO mopholinos against miR- 130a
- endothelial specific transgenic reporter [Tg(flil-EGFP)] line was utilized and injected control MO or miR- 130a MO into the fertilized eggs.
- miR-130a modulates Flkl +/ Pdgfra + mesodermal progenitors towards lateral p!aie mesodermal lineage
- miR- 130a-Pdgfra network in the divergence of hemato-endotheiial progenitors.
- miR- 130a promotes endothelial lineage development by modulating Pdgfra signaling. This is the first report of a miRNA that specifically promotes the endothelial lineage without affecting the hematopoietic lineage.
- miRNAs are regulators of transcript expression, however, only a limited number of miRNAs have specific developmental roles.
- the miR- 430/427/302 family controls mesendodermal fate specification and miR- 1/miR- 133 (muscle-specific miRNAs) can promote mesodermal formation during embryogenesis (Ivey et al., 2008; Rosa et al, 2009).
- the data herein reports a novel functional role for miR- 130a that specifically promotes differentiation of the endothelial lineage.
- Etv2 plays a major role for the progression of Flkl + /Pdgfra + progenitors (primitive mesoderm) to the Flki VPdgfra " (vascular mesoderm) state (Kataoka et al., 201 1 ).
- the Etv2-miR- 130a cascade down-regulates Pdgfra expression and promotes the transition of Flkl 7Pdgfra + to the Flkl Pdgfra " .
- miR- 130a facilitates the segregation of bipotent progenitors towards the endothelial lineage without affecting the hematopoietic lineage.
- the involvement of functionally redundant miRNAs cannot be ruled out.
- Etv2-miR- 130a-Pdgfra pathway may function to stabilize this plastic intermediate state towards an endothelial fate by suppressing the fluctuating levels of Pdgfra.
- Early developmental events are regulated by multiple signaling pathways including FGF and Wnt signaling in a context-dependent manner. For example, inhibition of FGF-Erkl/2 signaling results in loss of Pdgfra' " cells (Kunath et al., 2007), whereas a Wnt signaling wave regulates cardiogenesis and hematopoiesis in a temporally distinct fashion (Naito et al., 2006).
- the data herein, together with others, illustrate the role of signaling pathways, transcription factors and miRNAs in the regulation of cell fate decisions, thereby forming an integral part of the regulatory network in the emergence of mesodermal lineages.
- miR-130a a novel role for miR-130a has been discovered in the modulation of early endothelial progenitors. While several factors including HoxA3, Runxl and miR-142-3p have been shown to have a role in
- miR- 1 0a is the first reported regulator of endothelial development from the hemato-endothelial progenitors ( Figure 8).
- Chromosome 7 30,633,616-30,635,852 reverse strand.
- CCDS This gene is a member of the Mouse CCDS set: CCDS39888.1 UniProtKB: Uniprot identifiers: ⁇ 4 ⁇ 63
- RefSeq Gene ID 14008 mRNA sequence of mEtv2
- KDLWNWDEASLQEVPPGDKLTGLGAEFGFYFPEVALQEDTPITP M VEGCWKGFPELD NPALPHEDVPFQAEPVAHPLP SRDWTDLGCNTSDPWSCASQT PGPAPPGTSPSPFVGFEGATGQNPATSAGGVPSWSHPPAAWSTTSWDCSVGPSGATYW D GLGGEAHEDYKMSWGGSAGSD iTTT KTGLQDCSIPFEGRQSPAFTTPSKSNKQSD RATLTRYSKTNHRGP IQL QFLLELLHDGARSSCIRWTG SREFQLCDPKEVARL GE RKRKPGMNYEKLSRGLRYYYRRDIVLKSGGRKYTYRFGGRVFVLAYQDDMGHLPGAEG
- Organism Homo sapiens
- ETV2 ENSG00000105672 Description: ets variant 2 [Source:HGNC Symbol;Acc:HGNC:3491] Synonym: ER71 Location: Chromosome 19: 35,641,745-35,644,871 forward strand.
- INSDC coordinates chromosome:GRCh38:CM0Q0681.2:35641745:35644871 :1
- This gene has 8 transcripts (splice variants), 30 orthologues, 12 paralogises, is a member of 2 Ensembl protein families and is associated with 23 phenotypes.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Engineering & Computer Science (AREA)
- Chemical & Material Sciences (AREA)
- Biomedical Technology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Organic Chemistry (AREA)
- Biotechnology (AREA)
- General Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Zoology (AREA)
- Wood Science & Technology (AREA)
- Developmental Biology & Embryology (AREA)
- Animal Behavior & Ethology (AREA)
- Veterinary Medicine (AREA)
- General Engineering & Computer Science (AREA)
- Public Health (AREA)
- Biochemistry (AREA)
- Microbiology (AREA)
- Medicinal Chemistry (AREA)
- Cell Biology (AREA)
- Pharmacology & Pharmacy (AREA)
- Reproductive Health (AREA)
- Gynecology & Obstetrics (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Environmental Sciences (AREA)
- Hematology (AREA)
- Dermatology (AREA)
- Cardiology (AREA)
- Heart & Thoracic Surgery (AREA)
- Molecular Biology (AREA)
- Biodiversity & Conservation Biology (AREA)
- Animal Husbandry (AREA)
- Epidemiology (AREA)
- Transplantation (AREA)
- Immunology (AREA)
- Vascular Medicine (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
Abstract
Disclosed is a method to differentiate stern, progenitor or precursor cells comprising contacting said stem, progenitor or precursor cells with miR-130a, or an RNA having at least 95% identity thereto, so as to yield cells of endothelial lineage. Further disclosed are compositions comprising the endothelial lineage cells obtained and methods of using the compositions for treating diseases including cardiovascular diseases.
Description
REGULATION OF MESODERMAL SPECIFICATION
GOVERNMENT GRANT SUPPORT
This invention was made with government support under U01HL100407 and R01 AR0641 5 awarded by the National institutes of Health. The government has certain rights in the invention.
CLAIM OF PRIORITY
This application claims the benefit of priority of U.S. Provisional Patent Application No. 62/199,044, filed 30 July 2015, the benefit of priority of which is claimed hereby, and which application is incorporated by reference herein in its entirety.
BACKGROUND OF THE INVENTION
During embryogenesis mesodermal progenitors give rise to multiple lineages including hemato-endothelial and cardiac lineages. Precise control of the specification of these lineages are necessary for proper development and embryogenesis, although the transcriptional regulators and signaling pathways that govern mesodermal progenitors are incompletely defined (Kattman et al., 2006; Loebel et al., 2003).
Genetic studies have demonstrated the emergence of hematopoietic lineages, both independently, as well as from the hemogenic endothelium (Huber et al., 2004; Ueno and Weisman, 2006). Studies have established a hierarchy of transcriptional regulators, including Mesp l, Vegf Flkl and Etv2 as modulators of hemato-endothelial development (Shaiaby et al., 1995; Saga et al., 1999; Ferdous et al., 2009). Genetic ablation of Etv2 results in embryonic lethality by E9.5 with complete absence of the hemato-endothelial lineages (Ferdous et al., 2009). Etv2 activates downstream targets including Tie2 and Lmo2 and interacts with Gata2 and FoxC2 to regulate the hemato-endothelial program (De Val et al., 2008; Rasmussen et al, 2011 ; Koyano-Nakagawa et al., 2012).
SUMMARY OF THE INVENTION
Described herein is a novel Etv2-miR- 130a-Pdgfra network that directs stem cells, such as hemato-endothelial progenitors, towards the endothelial fate without affecting the hematopoietic lineage. This is the first report that defines a factor that directs endothelial development without affecting the hematopoietic lineage (directs cell fate to endothelium without effecting blood).
One embodiment provides a method to differentiate ceils comprising contacting (in vitro and/or in vivo) stem, progenitor or precursor cells with miR- OOa, or nucleic acid, such as, RNA having at least 95% identity thereto, so as to yield cells of endothelial lineage. In one embodiment, the stem, progenitor or precursor cells are embryonic stem cells, adult stem cells, induce pluripotent stem cells, and/or multipotent stem cells, such as multipotent mesodermal precursors. In another embodiment, the stem, progenitor or precursor cells are mammalian cells. In one embodiment, the progenitor cells are hemato- endothelial progenitors. In another embodiment, the precursor cells are mesodermal precursor cells expressing FlkTVPdgfra*
One embodiment provides for admixing the endothelial lineage cells produced by the methods described herein with a pharmaceutically acceptable carrier.
One embodiment provides a method treat cardiovascular disease, a wound, and/or repopulate vasculature in a subject in need thereof comprising administering an effective amount of the endothelial lineage cells produced by the methods described herein so as to treat cardiovascular disease, a wound, and/or repopulate vasculature in said subject. In one embodiment, the administered cells are autologous or allogeneic.
One embodiment provides a composition consisting essentially of miR-
OOa and stem, progenitor and/or precursor cells. In one embodiment, the cells are mammalian.
One embodiment provides a composition comprising the endothelial lineage cells obtained by the methods described herein and a cell culture media or a pharmaceutically acceptable carrier.
One embodiment provides a method to differentiate stem, progenitor and/or precursor cells comprising contacting said stem, progenitor and/or precursor cells with Etv2, so as to increase expression of Flkl and decrease expression of Pdgfra relative to the initial cell population and contacting said cells with increased expression Flkl and decreased expression of Pdgfra with miR- OOa so to generate cells predominately of endothelial lineages, while not generating a significant population of cells of the hematopoietic lineage.
Another embodiment provides a method to differentiate cells comprising contacting stem, progenitor and/or precursor cells with Etv2 and miR- OOa so as
to yield cells predominantly of endothelial lineages, while not yielding a significant population of cells of the hematopoietic lineage.
Another embodiment provides a method to differentiate cells comprising contacting stem, progenitor and/or precursor cells with miR- 130a so as to yield cells predominantly of endothelial lineages, while not yielding a significant population of cells of the hematopoietic lineage.
In one embodiment, the stem, progenitor or precursor cells are embryonic stem cells, adult stem cells, induced pluripotent stem cells, and/or multipotent stem cells (such as multipotent mesodermal precursors). In one embodiment, the stem, progenitor or precursor cells are mammalian ceils.
One embodiment provides for the admixing of the endothelial lineage cells described/prepared herein with a pharmaceutically acceptable carrier.
In one embodiment, the endothelial lineage cells described/prepared herein are administered to a subject.
One embodiment provides a composition of miR- 130a and stem, progenitor and/or precursor cells. In one embodiment, the ceils are mammalian.
Another embodiment provides a composition comprising the endothelial lineage cells obtained by the methods described herein and a cell culture media or a pharmaceutically acceptable carrier.
BRIEF DESCRIPTION OF THE DRAWINGS
Figures IA-L demonstrate that Etv2 modulates miR- 130a expression in endothelial progenitors. (A-F) FACS profile (A, D) and quantification (B, C, E, F) of mesodermal populations in Etv2-EYFP::Etv2CtE +;DicerL L embryos at E7.5 from EYFP+ and EYFP" compartments. (G) qPCR analysis of miR- 130a in CD31+ cells sorted from Dicer1^ and Eiv2' : " :Πκ:ο!·! 1 embryos at E9.5. (H) Evolutionary conservation of the 5.0 kb upstream fragment of the miR- 130a gene. (I) Top: Schematic of the 2.8 kb upstream region of the miR- 130a promoter. Bottom: ChIP analysis of d4 Dox-ind ucible HA-Etv2 EBs using an HA antibody. Chip assay for the Gapdh promoter (Control) and a non-specific locus (miR- 130a 3 ' UTR region: 3 ' Flank) are shown as controls. (J) EMS A showing Etv2 bound to the Ets binding site in the miR- 130a promoter region. (K) Luciferase reporter constructs using the miR-130a promoter (-1.0 kb) harboring wild-type (wt; open box) or mutant (mut; crossed box) Etv2 binding sites. (L) qPCR analysis of miR- 130a using EYFP4" sorted cells from Etv2 wild-
type and mutant embryos at E7.5. Error bars indicate SEM (n - 4; *p<0.05; **p < 0.005) (see also Figure 5).
Figures 2A-L show miR- 130a promotes the endothelial lineage. (A) Left panels: phase contrast images of wild-type E 14 (ES cells) and Dox- inducible miR- 130a ES cell (miR- 130a iES) colonies. Right panel: qPCR analysis of miR- 130a in the absence (-Dox) and presence of Dox (+Dox). (B) qPCR analyses for endothelial and hematopoietic markers using -Dox and ÷Dox EBs at d6 of differentiation (ratio shown as +Dox/-Dox). (C-F) FACS profiles (C, E) and quantitication (D, F) of endothelial (Tie2 and CD31 (C, Dj); and hematopoietic (CD41 and CD45 (E, F)) markers in -Dox and +Dox conditions. (G) Schematic representation of the miR- 130a knockdown approach in the ES/EB system. (H) qPCR analysis of Meox2 using RNA isolated from controi and miR-130a antagomir transfected cells. (I-L) FACS profiles (I, K) and quantification (J, L) of endothelial (Tie2 and CD31 (L J)) and hematopoietic (CD41 and CD45 (K, L)) markers in control and antagomir- treated EBs. Error bars indicate SEM (n = 4 ; *p < 0.05). Scale bar: 200 μηι (see also Figure 6).
Figures 3A-0 show miR- 130a targets Pdgfra and miR-130a-Pdgfra pathway modulates mesodermal progenitors. (A) ClustalW multiple sequence alignment of Pdgfra 3' UTR and miR- 130a. (B) Luciferase activity of Luc- Pdgfra- 3 '-UTR reporter constructs in the presence of miR- 130a mimic and miR- 130a inhibitor. (C) Whole-mount in situ hybridization images of control and miR- 1 30a morphants using Pdgfra probes at 48 hpf. (D) qPCR analysis of Pdgfra transcripts using flii -EYFP+ sorted ceils from controi and miR- 130a morphants at 48 hpf. (E-G) qPCR analysis of CD31 , Tie2 and CD45 transcripts from control and Pdgfra neutralizing antibody-treated EBs at d6 of
differentiation. (Ή-Κ) FACS profile (H, J) and quantification (I, K) of endothelial lineages (Tie2 and CD31 (H, I)) and hematopoietic lineages (CD41 and CD45 (J, K)) in control and Pdgfra neutralizing antibody-treated EBs at d6 of differentiation. (L-O) FACS profile (L, N) and quantification (M, O) of endothelial lineages (Tie2 and CD31 (L, M)) and hematopoietic lineages (CD41 and CD45 (N, O)) using d6 EB in control and Pdgfra over-expression conditions. Error bars indicate SEM (n - 4; *p < 0.05 ). Scale bar: 200 μπι,
Figures 4 A-J show miR- 130a targets Pdgfra in vivo and promotes lateral plate mesodermal lineage. (A-C) FACS profile (A) and quantification (B, C) of
mesodermal populations in miR- 130a iES/EB differentiation in -Dox and +Dox conditions. (D) qPCR analysis of Pdgfra in -Dox and +Dox conditions using d4 EBs. (E) FACS profile of endothelial (Fikl and CD31) markers during miR- 130a iES/EB differentiation in -Dox and +Dox conditions. (F) Schematic of the experiment to determine the ability of miR- 1.30a to re-specify mesoderm. (G, H) FACS profiles (G) and quantification (H) of endothelial (Fikl and CD31) markers at d6. (I. J) Hematopoietic colony forming assay from Fikl VPdgfra" (I) and Flk+/Pdgfra+ (J ) sorted cells using d3.5 miR-130a iES/EB system. Error bars indicate SEM (n = 3; *p < 0.05). (see also Figure 7).
Figures 5 A-E are related to Figure 1 ; miR- 130a is highly enriched in endothelial progenitors. (A) qRT-PCR analysis for Mes l, Fikl and Etv2 transcripts using RN A isolated from differentiating EBs. Expression was normalized to Gapdh levels. (B) qRTPCR for Dicer using primers directed to the RNase III domain. Mesp I and Fikl expressing ceils were sorted using ROR2 (Drukker et al, 2012) and Fikl antibodies, respectively. Etv2 expressing cells were sorted using EYFP fluorescence obtained from Etv2Crc/+;DicerL + and Etv2- EYFP;DicerL/L crosses at E8.5. (C) Whole mount images of F ^Dice 1^ and Etv2Cre +;DicerL/L mutant embryos demonstrated edema, hemorrhage (arrowheads) and were lethal by E12.5. (D) qPCR of mature miR-130a using RNA isolated from FACS sorted Flkl+ and Fikl" cells from EBs at day4 of differentiation. (E) qPCR of mature miR-130a using RNA isolated from FACS sorted CD3 T, CD4 T, CPC (Nkx2.5-GFP) and negative cell populations at E9.5. Error bars indicate SEM (n=3; *p < 0.05). Scale bar: 2 mm.
Figures 6A-H are related to Figure 2; miR -130a induces the endothelial program and suppresses the cardiogenic program without impacting
hematopoiesis. (A) qPCR analyses of mature miR- 130a during ES/EB differentiation. (B, C) FACS profile (B) and quantification (C) of endothelial lineages ( VE-Cadherin and CD31) markers in the presence of Dox (+Dox) as compared to no Dox (-Dox). (D) Hematopoietic colony forming cell (CFC) assays from induced (+Dox) and uninduced (-Dox) miR- 130a iES/EBs, (E)
Representative sections of -Dox and +Dox miR-130a iES/EBs immunostained with cTnT (green), CD31 (red.) and counterstained with DAPI (blue) at d lO of EB differentiation. (F) Quantitative analysis of cTnT+ EBs in 142 induced
(-t-Dox) and 123 uninduced (-Dox) EBs. (G) Contractility assay from 130
induced (+Dox) and 136 uninduced (-Dox) EBs. (H) qPCR analyses of a cardiac marker (cTnT) from induced (+Dox) and uninduced (-Dox) miR- 130a iES/EBs. Error bars indicate SEM (n - 4: *p < 0.05 ). Scale bar: 200 μη .
Figures 7A-E are related to Figure 4; miR- 130a modulates the endothelial program via Pdgfra signaling. (A) linages of differentiating EBs obtained from miR- 130a+Pdgfra; IRES-GFP inducible ES cell lines in the absence (-Dox) and presence of Dox (+Dox). (B-E). FACS profiles (B, D) and quantification (C, E) of endothelial lineages (Tie2 and CD31 (B, C)) and hematopoietic lineages (CD41 and CD45 (D, E)) during d6 of miR-130a+Pdgfra iES/EB differentiation. Error bars indicate SEM (n - 3 : *p < 0.05 ).
Figure 8 depicts Etv2-miR- 130a- Pdgfra network regulates endothelial development. A model summarizing the involvement of Etv2-miR- 130a network in the regulation of hemato-endothelial development. Flkl and Pdgfra are highly expressed in early multipotent mesodermal precursors (unpatterned mesoderm). Etv2 serves as a key mediator in the derivation of hemato-endothelial progenitors (Flkl+/Pdgfralow) from mesodermal precursors by down-regulating Pdgfra. Among the Flkl VPdgfralow hematoendothelial progenitor cells, those that express miR~130a will further down-regulate Pdgfra and have an endothelial fate. It is believed that this mechanism mediates the segregation of the endothelial lineage from the hemato-endothelial progenitors.
Figure 9 provides a graphical presentation of the Etv2-miR- 130a network.
DETAILED DESCRIPTION OF THE INVENTION
MicroRNAs (small non-coding RNAs) are known to regulate developmental stages during embryogenesis. MicroRNAs (miRNAs) govern the molecular switch by suppressing gene expression, thereby modulating and fine- tuning cell fate decisions (I ey and Srivastava, 2010). Although global deletion as well as hypomorphie mutants of Dicer (miRNA processing enzyme) results in embryonic lethality (Bernstein et al., 2003; Yang et al., 2005), it is unclear whether miRNAs play any role in the hemato-endothelial segregation and vascular development.
Herein is disclosed a novel Etv2-miR-130a cascade that regulates mesodermal specification and determination. Ablation of Dicer in the Etv2- expressing precursors resulted in altered mesodermal lineages and embryonic
lethality by E12.5. miR-130a was identified as a direct target of Etv2 and demonstrated its role in the segregation of bipotent hemato-endothelial progenitors towards the endothelial lineage. Loss- and gain-of-function experiments demonstrated that miR-130a is a regulator of the endothelial program at the expense of cardiac program without impacting the hematopoietic lineages. Mechanistically, miR- 130a directly suppresses expression level of Pdgfra and promotes the endothelial program by blocking Pdgfra signaling. Inhibition or activation of Pdgfra signaling phenocopied the miR-130a over- expression and knockdown, respectively. This is the first report of a miRNA that specifically promotes the divergence of the common hemato-endothelial progenitor to the endothelial lineage (miRNA mediated regulation of mesodermal precursors).
Definitions
The terminology used herein is for the purpose of describing particular embodiments only and is not intended to be limiting of the invention.
As used herein, the indefinite articles "a", "an" and "the" should be understood to include plural reference unless the context clearly indicates otherwise.
The phrase "and/or," as used herein, should be understood to mean "either or both" of the elements so conjoined, e.g., elements that are conjunctively present in some cases and disjunctively present in other cases.
As used herein, "or" should be understood to have the same meaning as "and/or" as defined above. For example, when separating a listing of items, "and/or" or "or" shall be interpreted as being inclusive, e.g., the inclusion of at least one, but also including more than one, of a number of items, and, optionally, additional unlisted items. Only terms clearly indicated to the contrary, such as "only one of or "exactly one of," or, when used in the claims, "consisting of," will refer to the inclusion of exactly one element of a number or list of elements. In general, the term "or" as used herein shall oniy be interpreted as indicating exclu ive alternatives (i.e., "one or the other but not both") when preceded by terms of exclusivity, such as "either," "one of," "only one of," or "exactly one of."
As used herein, the terms "including", "includes", "having", "has", "with", or variants thereof, are intended to be inclusive similar to the term "comprising."
As used herein, the term "about" means plus or minus 10% of the indicated value. For example, about 100 means from 90 to 1 10.
The term "isolated" refers to a cell or cells which are not associated with one or more cells or one or more cellular components that are associated with the cell or cells in vivo.
A "subject" is a vertebrate, such as a mammal, including a human. Mammals include, but are not limited to, humans, farm animals, sport animals and companion animals. Included in the term "animal" is dog, cat, fish, gerbil, guinea pig, hamster, horse, rabbit, swine, mouse, monkey (e.g., ape, gorilla, chimpanzee, and orangutan) rat, sheep, goat, cow and bird. Subjects that can benefit from the cells and methods of the invention include, but are not limited to, those suffering from a loss of function of endodermal cells, including, but not limited to, liver or pancreatic cells, as a result of physical or disease related damage.
Totipotent (a.k.a. omnipotent) stem cells can differentiate into embryonic and extraembryonic cell types. Such cells can construct a complete, viable organism. These cells are produced from the fusion of an egg and sperm cell. Cells produced by the first few divisions of the fertilized egg are also totipotent. Pluripotent stem ceils are the descendants of totipotent ceils and can differentiate into nearly all cells, i.e. cells derived from any of the three germ layers.
Multipotent stem cells can differentiate into a number of cell types, but only those of a closely related family of cells. Oligopotent stem cells can differentiate into only a few cell types, such as lymphoid or myeloid stem cells. Unipotent cells can produce only one cell type, their own, [4] but have the property of self- renewal, which distinguishes them from non-stem cells (e.g. progenitor cells, muscle stem cells).
"Expansion" refers to the propagation of cells without differentiation.
"Progenitor cells" are cells produced during differentiation of a stem cell that have some, but not all, of the characteristics of their terminally- differentiated progeny. Defined progenitor cells are committed to a lineage, but not to a specific or terminally-differentiated cell type. The phrase "endothelial
cells" encompasses not only terminally-differentiated cells types, but also cells that are committed to an endothelial lineage, but are not terminally- differentiated.
"Differentiation factors" refer to cellular factors, preferably growth factors or angiogenic factors that induce lineage commitment.
"Self-renewal" refers to the ability to produce replicate daughter cells having differentiation potential that is identical to those from which they arose. A similar term used in this context is "proliferation."
An "effective amount" generally means an amount which provides the desired local or systemic effect and/or performance, particularly for treating a condition of interest.
The terms "comprises," "comprising," and the like can have the meaning ascribed to them in U.S. Patent Law and can mean "includes," "including" and the like. As used herein, "including" or "includes" or the like means including, without limitation.
Stem/Precursor/Progenitor Cells
Siem/Precursor/Progenitor cells are undifferentiated biological cells that can differentiate into specialized cells and can divide (through mitosis) to produce more stem cells. They are found in multicellular organisms. In adult organisms, stem ceils and progenitor cells act as a repair system for the body, replenishing adult tissues. In a developing embryo, stem cells can differentiate into all the specialized cells-ectoderm, endoderm and mesoderm (see induced pluripotent stem cells)-but also maintain the normal turnover of regenerative organs, such as blood, skin, or intestinal tissues.
Autologous adult stem cells can be obtained from many sources in humans, such as bone marrow (which requires extraction by harvesting that is, drilling into bone (typically the femur or iliac crest); adipose tissue (lipid cells; which requires extraction, such as by liposuction); and/or blood (which requires extraction through apheresis, wherein blood is drawn from the donor (similai- to a blood donation), and passed through a machine that extracts the stem cells and returns other portions of the blood to the donor). Heterologous and xenogeneic cells can also be used in methods of the invention.
Stem ceils can also be taken from umbilical cord blood just after birth. By definition, autologous cells are obtained from one's own body, just as one may bank his or her own blood for elective surgical procedures.
In one embodiment, the precursor cells are multipotent mesodermal precursor cells expressing Flkl +/Pdgfra+.
Methods of isolating various stem and/or progenitor and/or precursor cells are available to an art worker. Stem and/or progenitor and/or precursor cells can also be isolated in the presence of various factors such as LIF (e.g., at a concentration of about 5,000 U/ml to about 50,000 U/ml, such as about 10,000 U/ml), EGF (e.g., at a concentration of about 5 ng/ml to about 50 ng/ml, such as about 10 ng ml), basic FGF (e.g., at a concentration of about 5 ng ml to about 50 ng/ml, such as about 10 ng/ml) or PDGF (e.g., at a concentration of about 5 ng/ml to about 50 ng/ml, such as about 10 ng/ml).
During and after isolation, stem and/or progenitor and/or precursor cells can be cultured in culture medium that is well established in the art and commercially available from the American Type Culture Collection (ATCC). Such media include, but are not limited to, Dulbecco's Modified Eagle' s Medium (DMEM), DMEM F12 medium. Eagle's Minimum Essential Medium, F-12K medium, Iscove's Modified Dulbecco' s Medium, or RPMI-1640 medium. It is within the skill of one in the art to modify or modulate concentrations of media and/or media supplements as needed for the cells used. It will also be apparent that many media are available as low-glucose formulations, with or without sodium pyruvate.
Also contemplated is supplementation of cell culture medium with mammalian sera. Sera often contain cellular factors and components that are necessary for viability and expansion. Examples of sera include fetal bovine serum (FBS), bovine serum (BS), calf serum (CS), fetal calf serum (FCS), newborn calf serum (NCS), goat serum (GS), horse serum (HS), human serum, chicken serum, porcine serum, sheep serum, rabbit serum, rat serum (RS), serum replacements, and bovine embryonic fluid. It is understood that sera can be heat- inactivated at 55-65μ€ if deemed necessary to inactivate components of the complement cascade. Modulation of serum concentrations, or withdrawal of serum from the culture medium can also be used to promote survival of one or more desired cell types. In one embodiment, the endodermal progenitor cells are
cultured in the presence of FBS /or serum specific for the species cell type. For example, endodermal progenitor cells can be isolated and/or expanded with total serum (e.g., FBS) concentrations of about 0.5% to about 5% or greater including about 5%> to about 15%. Concentrations of serum can be determined empirically.
Additional supplements can also be used to supply the cells with trace elements for optimal growth and expansion. Such supplements include insulin, transferrin, sodium selenium, and combinations thereof. These components can be included in a salt solution such as, but not limited to, Hanks' Balanced Salt Solution (HBSS), Earle's Salt Solution, antioxidant supplements, MCDB-201 supplements, phosphate buffered saline (PBS), N-2-hydroxyethylpiperazine-N' - ethanesulfonic acid (HEPES), nicotinamide, ascorbic acid and/or ascorbic acid- 2 -phosphate, as well as additional amino acids. Many cell culture media already contain amino acids; however some require supplementation prior to culturing cells. Such amino acids include, but are not limited to, L-alanine, L-arginine, L- aspartic acid, L-asparagine, L-cysteine, L-cystine, L-glutamic acid, L-glutamine, L-glycine, L-histidine, L-inositol, L-isoleucine, L-leucine, L-lysine, L- methionine, L-phenylalanine, L-proline, L-serine, L-threonine, L-tryptophan, L- tyrosine, and L-valine.
Antibiotics are also typically used in cell culture to mitigate bacterial, mycoplasmal, and fungal contamination. Typically, antibiotics or anti-mycotic compounds used are mixtures of penicillin/streptomycin, but can also include, but are not limited to, amphotericin (Fungizone), ampicillin, gentamicin, bleomycin, hygromycin, kanamycin, mitomycin, mycophenolic acid, nalidixic acid, neomycin, nystatin, paromomycin, polymyxin, puromyein, rifampicin, spectinomycin, tetracycline, tylosin, and zeocin.
Hormones can also be advantageously used in cell culture and include, but are not limited to, D-aldosterone, diethylstilbestrol (DES), dexamethasone, β-estradiol, hydrocortisone, insulin, prolactin, progesterone, somatostatin/human growth hormone (HGH), thyrotropin, thyroxine, and L-thyronine. β- mercaptoethanol can also be supplemented in cell culture media.
Lipids and lipid carriers can also be used to supplement cell culture media, depending on the type of cell and the fate of the differentiated cell. Such lipids and carriers can include, but are not limited to cyclodextrin,, cholesterol,
linoleic acid conjugated to albumin, linoleic acid and oleic acid conjugated to albumin, unconjugated linoleic acid, linoleic-oleic-arachidonic acid conjugated to albumin, oleic acid unconjugated and conjugated to albumin, among others. Albumin can similarly be used in fatty-acid free formulation.
Also contemplated is the use of feeder cell layers. Feeder cells can be used to support the growth of cultured cells, including, stem and/or progenitor and/or precursor ceils. Feeder cells are normal cells that have been inactivated by y -irradiation. In culture, the feeder layer serves as a basal layer for other cells and supplies cellular factors without further growth or division of their own (Lim and Bodnar 2002). Examples of feeder layer cells typically used with liver cell cultures are hepatocytes and embryonic fibroblasts (Suzuki, A. et al. 2000), but can be any post-mitotic cell that is capable of supplying cellular components and factors that are advantageous in allowing optimal growth, viability, and expansion o , stem and/or progenitor and/or precursor cells, in some cases, feeder cell layers are not needed to keep cells in an undifferentiated, proliferative state, as leukemia inhibitory factor (LIF) has anti-differentiation properties. Often, supplementation of a defined concentration of LIF is all that is necessary to maintain cells in an undifferentiated state.
Ceils in culture can be maintained either in suspension or attached to a solid support, such as extracellular matrix components and synthetic or biopolymers. Cells often require additional factors that encourage their attachment to a solid support (e.g., attachment factors) such as type I, type II, and type IV collagen, cone ana val in A, chondroitin sulfate, fibronectin,
"superfibronectin" and/or fibronectin-like polymers, gelatin, laminin, poly-D and poly-L-lysine, Matrigel, thrombospondin, and/or vitronectin.
The maintenance conditions of cells can also contain cellular factors that allow ceils, such as stem and/or progenitor and/or precursor cells, to remain in an undifferentiated form. It may be advantageous under conditions where the cell must remain in an undifferentiated state of self-renewal for the medium to contain epidermal growth factor (EGF), platelet derived growth factor (PDGF), leukemia inhibitory factor (LIF), basic fibroblast growth factor (bFGF) and combinations thereof. It is apparent to those skilled in the art that supplements that allow the cell to self-renew (e.g., to produce replicate daughter cells having differentiation potential that is identical to those from which they arose; a similar
term used in this context is "proliferation"), but not differentiate should be removed from the culture medium prior to differentiation. It is also apparent that not all cells will require these factors. In fact, these factors may elicit unwanted effects, depending on the cell type.
Stem and/or progenitor and/or precursor cells can be selected based on the markers (gene and/or protein) described herein. Accordingly, positive selection methods can be used, either alone or together with the methods described above, to identify and/or isolate the cells of the invention. Methods of positive selection can include visual selection, using microscopy and/or other means of detection, including, but not limited to, immunoblotting,
immunofluorescence, and/or enzyme-linked immunosorbent assay. Other methods of positive selection can also include, but are not limited to, additional selective culture techniques (e.g., variable cell densities or amounts of C<¾), flow cytometry, RT-PCR, and/or microchip-based methods of ceil separation. Endothelium
The endothelium is the thin layer of simple squamous cells that lines the interior surface of blood vessels and lymphatic vessels, forming an interface between circulating blood or lymph in the lumen and the rest of the vessel wall. The cells that form the endothelium are called endothelial cells. Endothelial cells in direct contact with blood are called vascular endothelial cells, whereas those in direct contact with lymph are known as lymphatic endothelial cells.
Vascular endothelial ceils line the entire circulatory system, from the heart to the smallest capillaries. These cells have unique functions in vascular biology. These functions include fluid filtration, such as in the glomeruli of the kidney, blood vessel tone, hemostasis, neutrophil recruitment, and hormone trafficking. Endothelium of the interior surfaces of the heart chambers is called endocardium.
Endothelium is mesodermal in origin. Both blood and lymphatic capillaries are composed of a single layer of endothelial cells called a monolayer. In straight sections of a blood vessel, vascular endothelial cells typically align and elongate in the direction of fluid flow.
The foundational model of anatomy makes a distinction between endothelial cells and epithelial ceils on the basis of which tissues they develop
from, and states that the presence of vimentin rather than keratin filaments separate these from epithelial cells.
Endothelial cells are involved in many aspects of vascular biology, including: barrier function (the endothelium acts as a semi-selective barrier between the vessel lumen and surrounding tissue, controlling the passage of materials and the transit of white blood cells into and out of the blood tream; Excessive or prolonged increases in permeability of the endothelial monolayer, as in cases of chronic inflammation, may lead to tissue edema swelling); blood clotting (thrombosis & fibrinolysis; the endothelium! normally provides a non- thrombogenic surface because it contains, for example, heparan sulfate which acts as a cofactor for activating antithrombio, a protease that inactivates several factors in the coagulation cascade); inflammation; formation of new blood vessels (angiogenesis); vasoconstriction and vasodilation (and hence the control of blood pressure); repair of damaged or diseased organs via an injection of blood vessel cells; and angiopoietin-2 works with VEGF to facilitate cell proliferation and migration of endothelial cells.
Endothelial dysfunction, or the loss of proper endothelial function, is a hallmark for vascular diseases, and is often regarded as a key early event in the development of atherosclerosis. Impaired endothelial function, causing hypertension and thrombosis, is often seen in patients with coronary artery disease, diabetes mellitus, hypertension, hypercholesterolemia, as well as in smokers. Endothelial dysfunction has also been shown to be predictive of future adverse cardiovascular events, and is also present in inflammatory disease such as rheumatoid arthritis and systemic lupus erythematosus. One of the main mechanisms of endothelial dysfunction is the diminishing of nitric oxide, often due to high levels of asymmetric dimethylarginine, which interfere with the normal L-arginine-stimulated nitric oxide synthesis and so leads to hypertension. The most prevailing mechanism of endothelial dysfunction is an increase in reactive oxygen species, which can impair nitric oxide production and activity via se veral mechanisms. The signaling protein ERK5 plays a role in maintaining normal endothelial cell function. A further consequence of damage to the endothelium is the release of pathological quantities of von Willebrand factor, which promote platelet aggregation and adhesion to the sub-endothelium, and thus the formation of thrombi.
Differentiation and Use for Endothelial Cells
Stem, precursor and progenitor cells can be used for the generation of endothelial cells or endotheli precursors (the term endothelial ceils refers to cells of varying degree of differentiation, some may be fully differentiated down the endothelial pathway, while others are in the early stages and can still be directed down one or endothelial lineages). One embodiment provides methods for providing endothelial cells comprising differentiating stem, precursor and progenitor cells in the presence of miR- 130a and optionally Etv2 (sequence information provided in Example 2 below), and isolating the endothelial cells. Differentiation can occur in vitro, in vivo or ex vivo.
niiR- 130 micro RN A precursor is a small non-coding RNA that regulates gene expression. This microRNA has been identified in mouse (MI0000156 (GAGCUCUUUUCACAUUGUGCUACUGUCUAACGUGUACCGAGCAGU GCAAUGU'UAAAAGGGCAUC; SEQ ID ΝΟ: 1 ), MI0000408
(GGCUUGUUGGACACUCUIJUCCCUGUUGCACUACUGUGGGCCUCUG GGAAGCAGUGCAAUGAUGAAAGGGCAUCUGUCGGGCC; SEQ ID NO:2)), and in human (MI0000448
(UGCUGCUGGCCAGAGCUCUUUUCACAUUGUGCUACUGUCUGCACC UG UC AC UAGC AG UGC A AUGUUA A A AGGGC AUUGGCCGUGUAGUG ; SEQ ID O:3), MI0000748
(GGCCUGCCCGACACUCUUUCCCUGUUGCACUACUAUAGGCCGCUG GGAAGCAGUGCAAUGAUGAAAGGGCAUCGGUCAGGUC; SEQ ID NO:4)). Mentioned below is the seed sequence for miR-130a. The data is obtained fro mi the mirbase (http://www.mirbase.org) >mmu-miR-130a-3p M1MAT0000141 - CAG UGCA A U G U U AAA AGGGCA U (SEQ ID NO:5) (the seed sequence for miR-130 can be used as a screening tool to search and/or engineer small molecules that bind/interact with the seed sequence and cause the effect of, for example, increased endothelium, as with miR- 130).
In one embodiment, the miR-130 is as disclosed herein or 95% identical thereto. IN another embodiment, the mirNA-130 has at least about 85 %, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 99.5 % identity to the nucleic acid sequences disclosed herein.
As used herein, percent identity of two nucleic acid sequences (or of two amino acid sequences) is determined using the algorithm of Karlin and Altschul
(PNAS USA 87:2264-2268, 1990), modified as in arlin and Altschul, PNAS USA 90:5873-5877, 1993). Such an algorithm is incorporated into the NBLAST and XBLAST programs of Altschul et al. (J. Mol. Biol. 215 :403-410, 1990). BLAST nucleotide searches are performed with the NBLAST program, score=l 00, word!eogth= 12. BLAST protein searches are performed with the XBLAST program, score=50, wordlength=3. To obtain gapped alignment for comparison purposes GappedBLAST is utilized as described in Altschul et al. (Nucleic Acids Res. 25:3389-3402, 1997). When utilizing BLAST and
GappedBLAST programs the default parameters of the respective programs (e.g., XBLAST and NBLAST) are used to obtain nucleotide sequences homologous to a nucleic acid molecule of the in vention.
Identity or identical means nucleic acid sequence (or amino acid sequence) similarity and has an art recognized meaning. Sequences with identity share identical or similar amino acids (or nucleic acids). Sequence identity is the percentage of amino acids identical to those in the antibody's original amino acid sequence, determined after the sequences are aligned and gaps are appropriately introduced to maximize the sequence identit as necessary. Thus, a candidate sequence sharing 85 % amino acid sequence identity with a reference sequence requires that, following alignment of the candidate sequence with the reference sequence, 85 % of the amino acids in the candidate sequence are identical to the corresponding amino acids in the reference sequence, and/or constitute conservative amino acid changes.
miR-130 appears to be vertebrate-specific miRNA and has now been predicted or experimentally confirmed in a range of vertebrate species
(MIPF0000034). Mature microRNAs are processed from the precursor stem- loop by the Dicer enzyme. In this case, the mature sequence is excised from the 3' arm of the hairpin, it has been found that miR-130 is upregulated in a type of cancer called hepatocellular carcinoma.
Methods of identifying and subsequently isolating differentiated cells from their undifferentiated counterparts can be carried out by methods available to an art worker. Cells that have been induced to differentiate can be identified by selectively culturing cells under conditions whereby differentiated cells outnumber undifferentiated cells. These conditions include, for example, extending the amount of time that cells are grown in culture, such that survival
of a desired ceil type is encouraged. Many primary cells achie ve senescence, and fail to divide, or die, after a period of time. Other conditions comprise modulating the type and concentration of serum, or cuituring the cells in the presence or absence of growth factors and/or cytokines that induce
differentiation to another cell type. Differentiation can also be advantageously achieved by modulation of serum concentrations, or withdrawal of serum from the culture. Other methods of inducing differentiation can include, but are not limited to, modulating the acidity of the culture medium, as well as the oxygen and carbon dioxide levels during culture.
Similarly, differentiated cells can be identified by morphological changes and characteristics that are not present on their undifferentiated counterparts, such as cell size, the number of cellular processes (i.e., formation of dendrites and/or branches), and the complexity of intracellular organelle distribution. Also contemplated are methods of identifying differentiated ceils by their expression of specific cell- urface markers such as cellular receptors and transmembrane proteins. Monoclonal antibodies against these cell -surface markers can be used to identify differentiated cells. Detection of these cells can be achieved through fluorescence activated cell sorting (FACS), and/or enzyme-linked
immunosorbent assay (ELISA). From the standpoint of transcriptional upregulation of specific genes, differentiated cells often display levels of gene expression that are different from undifferentiated cells. Reverse-transcription polymerase chain reaction (RT-PCR) can also be used to monitor changes in gene expression in response to differentiation. In addition, whole genome analysis using microarray technology can be used to identify differentiated cells.
Accordingly, once differentiated cells are identified, they can be separated from their undifferentiated counterparts, if necessary. The methods of identification detailed above also provide methods of separation, such as FACS, preferential cell culture methods, ELISA, magnetic beads, and combinations thereof. One embodiment of the invention envisions the use of FACS to identify and separate cells based on cell-surface antigen expression.
Administration/Treatment
Endothelial cells of the invention can be used in cell replacement therapies. Endothelial cells can be administered to a tissue of interest in a subject to supplement functioning cells or replace cells, which have lost
function. Alternatively, methods of providing differentiated ceils are also contemplated, wherein the endothelial cells are differentiated in the presence of differentiation factors, isolated, and administered into or upon the body of a subject.
For the purposes described herein, either autologous, allogeneic or xenogeneic cells can be administered to a patient, either in u differentiated, terminally differentiated or in a partiaily differentiated form, genetically altered or unaltered, by direct introduction to a site of interest, e.g., on or around the surface of an acceptable matrix ,or systemically, in combination with a pharmaceutically acceptable carrier so as to repair, replace or promote the growth of existing and/or new blood vessels.
Disease states could benefit from endothelial cells and methods of the invention include, but are not limited to, cardiovascular disease, wound healing, and/or repopulation or engineering vasculature in vitro and/or in vivo.
Exogenous factors (e.g., cytokines, differentiation factors and other factors) can be administered prior to, after or concomitantly with the endothelial cells of the invention. For example, a form of concomitant administration would comprise combining a factor of interest in the culture media and/or pharmaceutically acceptable carrier prior to administration. Doses for administrations are variable, may include an initial administration followed by subsequent administrations; but nonetheless, can be ascertained by the skilled artisan, from this disclosure, the documents cited herein, and the knowledge in the art.
Endothelial cells of the invention or their progeny can be administered via localized injection, including catheter administration, systemic injection, localized injection, parenteral administration, or intrauterine injection into an embryo.
A method to potentially increase cell survival, when introducing the cells into a subject in need thereof, is to incorporate endothelial cells into a biopolymer or synthetic polymer. Depending on the subject' s condition, the site of injection might prove inhospitable for cell seeding and growth because of scarring or other impediments. Examples of biopolymer include, but are not limited to, cells mixed with fibronectin, fibrin, fibrinogen, thrombin, collagen, and proteoglycans. This could be constructed with or without included
cytokines, growth factors, differentiation factors or nucleic acid expression constructs. Additionally, these could be in suspension, but residence time at sites subjected to flow would be nominal. Another alternative is a three- dimensional gel with cells entrapped within the interstices of the cell biopohmer admixture. Again, differentiation factors, growth factors or cytokines could be included within the cells. These could be deployed by injection via various routes described herein.
A parameter involved in the therapeutic use of endothelial cells is the quantity of cells necessary to achieve an optimal effect. In current human studies of autologous mononuclear bone marrow cells, empirical doses ranging from 1 to 4 x 107 cells have been used with encouraging results. However, different scenarios may require optimization of the amount of cells injected into a tissue of interest. Thus, the quantity of cells to be administered will vary for the subject being treated. In one embodiment, between 104 to 10s, more preferably lir to 10;, and most preferably 3 x 10 ' progenitor cells and optionally, 50 to 500 fig/kg per day of a cytokine can be administered to a human subject. However, the precise determination of what would be considered an effective dose may be based on factors individual to each patient, including their size, age, size tissue damage, and amount of time since the damage occurred. Therefore, dosages can be readily ascertained by those skilled in the art from this disclosure and the knowledge in the art.
Another parameter involved in the use of endothelial cells is the purity of the population. Those skilled in the art can readily determine the percentage of endothelial cells in a population using various well-known methods, such as fluorescence activated cell sorting (FACS). Preferable ranges of purity in populations comprising endothelial cells are about 1 to about 5 %, about 5 to about 10%, about 10 to about 15%, about 15 to about 20%, about 20 to about 25%, about 25 to about 30%, about 30 to about 35%, about 35 to about 40%, about 40 to about 45%, about 45 to about 50%, about 50 to about 55%, about 55 to about 60%, about 60 to about 65%, about 65 to about 70%, about 70 to about 75%, about 75 to about 80%, about 80 to about 85%, about 85 to about 90%, about 90%· to about 95% or about 95 to about 100%. Purity of the cells can be determined according to the cell surface marker profile within a population.
Dosages can be readily adjusted by those skiiied in the art (e.g., a decrease in purity may require an increase in dosage).
The skilled artisan can readily determine the amount of cells and optional additives, vehicles, and/or carrier in compositions to be administered in methods of the invention. Typicaliy, any additives (in addition to the active cell(s) and/or cytokine(s)) are present in an amount of 0.001 to 50 % (weight) solution in phosphate buffered saline, and the active ingredient is present in the order of micrograms to milligrams, such as about 0.0001 to about 5 wt %, preferably about 0.0001 to about 1 wt %, most preferably about 0.0001 to about 0.05 wt % or about 0.001 to about 20 wt %, preferably about 0.01 to about 10 wt %, and most preferably about 0.05 to about 5 wt %. Of course, for any composition to be administered to an animal or human, and for any particular method of administration, it is preferred to determine the toxicity, such as by determining the lethal dose (LD) and LD50 in a suitable animal model e.g., rodent such as mouse; and, the dosage of the composition(s), concentration of components therein and timing of administering the composition(s), which elicit a suitable response. Such determinations do not require undue experimentation from the knowledge of the skilled artisan, this disciosure and the documents cited herein. And, the time for sequential administrations can be ascertained without undue experimentation.
When administering a therapeutic composition of the present invention, it will generally be formulated in a unit dosage injectable form (solution, suspension, emulsion) However, the cells can be administered to a subject by a variety of methods available to the art, including but not limited to localized injection, catheter administration, systemic injection, intraperitoneal injection, parenteral administration, oral administration, intracranial injection, intra-arterial injection, intravenous injection, intraventricular infusion, intraplacental injection, intrauterine injection, surgical intramyocardial injection,
transendocardial injection, transvascular injection, intracoronary injection, transvascular injection, intramuscular injection, surgical injection into a tissue of interest or via direct application to tissue surfaces (e.g., during surgery or on a wound). The pharmaceutical formulations suitable for injection include sterile aqueous solutions and dispersions. The carrier can be a solvent or dispersing medium containing, for example, water, saline, phosphate buffered saline, polyol
(for example, glycerol, propylene glycol, liquid polyethylene glycol, and the like) and suitable mixtures thereof.
Additionally, various additives which enhance the stability, sterility, and isotonicity of the compositions, including antimicrobial preservatives, antioxidants, chelating agents, and buffers, can be added. Prevention of the action of microorganisms can be ensured by various antibacterial and antifungal agents, for example, parabens, chlorobutanoL, phenol, sorbic acid, and the like. In many cases, it will be desirable to include isotonic agents, for example, sugars, sodium chloride, and the like. Prolonged absorption of the injectable pharmaceutical form can be brought about by the use of agents delaying absorption, for example, aluminum monostearate and gelatin. According to the present invention, however, any vehicle, diluent, or additive used would have to be compatible with the cells.
Sterile injectable solutions can be prepared by incorporating the cells utilized in practicing the present invention in the required amount of the appropriate solvent with various amounts of the other ingredients, as desired. Examples of compositions comprising progenitor cells of the invention include liquid preparations for administration, including suspensions; and, preparations for intramuscular or intravenou administration (e.g., injectable administration), such as sterile suspensions or emulsions. Such compositions may be in admixture with a suitable carrier, diluent, or excipient such as sterile water, physiological saline, glucose, dextrose, or the like. The compositions can also be lyophilized. The compositions can contain auxiliary substances such as wetting or emulsifying agents, pH buffering agents, gelling or viscosity enhancing additives, preservatives, flavoring agents, colors, and the like, depending upon the route of administration and the preparation desired.
Standard texts, such as "REMINGTON'S PHARMACEUTICAL SCIENCE", 17th edition, 1985, which is incorporated herein by reference, may be consulted to prepare suitable preparations, without undue experimentation.
Compositions of the invention are conveniently provided as liquid preparations, e.g., isotonic aqueous solutions, suspensions, emulsions or viscous compositions, which may be buffered to a selected pH. Liquid preparations are normally easier to prepare than gels, other viscous compositions, and solid compositions. Additionally, liquid compositions are somewhat more convenient
to administer, especially by injection. Viscous compositions, on the other hand, can be formulated within the appropriate viscosity range to provide longer contact periods with specific tissues.
The choice of suitable carriers and other additives will depend on the exact route of administration and the nature of the particular dosage form, e.g., liquid dosage form (e.g., whether the composition is to be formulated into a solution, a suspension, gel or smother liquid form, such as a time release form or liquid-filled form).
Solutions, suspensions and gels normally contain a major amount of water (e.g., purified, sterilized water) in addition to the cells. Minor amounts of other ingredients such as pH adjusters (e.g., a base such as NaOH), emulsifiers or dispersing agents, buffering agents, preservatives, wetting agents and jelling agents (e.g., methyiceliuiose), may also be present. The compositions can be isotonic, i.e., they can have the same osmotic pressure as blood and lacrimal fluid.
The desired isotonicity of the compositions of this invention may be accomplished using sodium chloride, or other pharmaceutically acceptable agents such as dextrose, boric acid, sodium tartrate, propylene glycol or other inorganic or organic solutes.
Viscosity of the compositions, if desired, can be maintained at the selected level using a pharmaceutically acceptable thickening agent.
Methyiceliuiose is readily and economically available and is easy to work with. Other suitable thickening agents include, for example, xanthan gum, carboxymethyl cellulose, hydroxy-propyl cellulose, carbomer, and the like. The concentration of the thickener will depend upon the agent selected. The point is to use an amount, which will achieve the selected viscosity. Viscous compositions are normally prepared from solutions by the addition of such thickening agents.
A pharmaceutically acceptable preservative or cell stabilizer can be employed to increase the life of the compositions. If preservatives are used, it is well within the purview of the skilled artisan to select compositions that will not affect the viability or efficacy of the endodermal progenitor cells as described herein.
Those skilled in the art will recognize that the components of the compositions should be selected to be chemically inert. This will present no problem to those skilled in chemical and pharmaceutical principles, or problems can be readily avoided by reference to standard texts or by simple experiments (not involving undue experimentation), from this disclosure and the documents cited herein.
Compositions can be administered in dosages and by techniques well known to those skilled in the medical and veterinary arts taking into consideration such factors as the age, sex, weight, and condition of the particular patient, and the composition form used for administration (e.g., solid vs. liquid). Dosages for humans or other mammals can be determined without undue experimentation by the skilled artisan, from this disclosure, the documents cited herein, and the knowledge in the art.
Suitable regimes for initial administration and further doses or for sequential administrations also are variable and may include an initial
administration followed by subsequent administrations; but nonetheless, can be ascertained by the skilled artisan, from this disclosure, the documents cited herein, and the knowledge in the art.
Endothelial cells of the invention can be used for many diverse clinical and pre-clinical applications, which can include, but are not limited to, use in toxicological or genomic screening methods, determination of levels of enzymes and coagulation factors, as well as treatment of the diseases disclosed herein. Endothelial cells of the invention can provide a variety of differentiated cultured cell types for high-throughput toxicological or genomic screening. The cells can be cultured in, for example, 96-well or other multi-well culture plates to provide a system for high-throughput screening of, for example, target cytokines, chemokines, growth factors, or pharmaceutical compositions in
pharmacogenomics or pharmacogenetics.
The invention also envisions a tissue-engineered organ, or portion, or specific section thereof, a tissue engineered device comprising a tissue of interest and optionally, cytokines, growth factors, or differentiation factors that induce differentiation into a desired cell type, wherein the endothelial cells are used to generate tissue/vasculature.
The following examples are provided in order to demonstrate and further illustrate certain embodiments and aspects of the present invention and is not to be construed as limiting the scope thereof.
EXAMPLES
Materials and Methods
Generation of Dicer conditional null mice and morphological analysis
DicerL L mice (strain: B6.Cg-DicertmlBdh/J) (Harfe et al., 2005) were intercrossed with Mespl-Cre (Saga et al, 1999), Flkl -Cre (Shalaby et al., 1995) and Etv2-Cre (Rasmussen et al., 2011) mice to generate Mesp 1 Cre/+;DicerL'+, FM^Dicer1-7* and Etv2Cie +;DicerL/+ mice and subsequently crossed with DicerLI ice to generate conditional Dicer knockouts.
Generation of doxyc cline-inducible miR-13(5a mouse ESC line, inducible Pdgfra ESC lines, ES/EB culture conditions and FACS analysis
ESC culture conditions, ES/EB differentiation and the generation of the Dox -inducible miR- 130a ESCs were performed as previously reported (Iacovino et al., 201 1 ).
ESC culture and ES/EB differentiation
The wild-type mouse E14 ES ceil line was maintained in Knockout Medium (Invitrogen) supplemented with 15 % FBS (Benchmark), 1000 U/tnl LIF (Millipore), glutamine (Hyclone), 0.1 mM non-essential amino acids (NEAA) and 0.1 mM β-mercaptoethanol ( Sigma) in gelatin-coated tissue-culture plates. The ES cells were differentiated into embryoid bodies (EBs) by the hanging drop method using mesodermal differentiation media containing IMDVI (Invitrogen), 15% FBS, penicillin/streptomycin, 2 mM GlutaMAX, 50 mg ml Fe- saturated transferrin (R & D Systems), 0.1 mM monothioglycerol (Sigma), and 50 mg/ml ascorbic acid (Sigma). Cryosectioning and immunohistochemical analyses were performed using a standard protocol with anti-TnT (1 :200, Sigma) and anti- CD31 (1 :200, BD Pharrningen) sera.
Flow cytometry analysis and sorting
FACS analysis was performed using a BD FACSAriall (BD Biosciences,
San Diego, CA, USA). Stage specific embryos were separated from yolk sacs, and digested with 0.25% trypsin (Hyclone) to obtain a single cell suspension. Cells were incubated with antibody cocktails for 30 minutes at 4°C, washed, and resuspended in PBS with 2% FBS. Cocktails of antibodies including Fikl -APC
(eBiosciences 17-5821 ), Pdgfra-PE (eBiosciences 12- 1401 ), CD31-APC (eBiosciences 25-0311 ), CD41-PECy7 (eBiosciences 25-041 1), CD45-PE (BD Pharmingen 553081), CD31-PE (BD Pharniigen), VE-cadherin (BD Pharniigen) were used in this study. For the FACS analysis of EYFP+ cells, embryos were digested and cells were sorted based on EYFP fluorescence. For EBs, single-cell suspensions were incubated with the desired antibody combinations, washed and resuspended in FACS buffer (PBS/1 %FBS). Cells were analyzed or sorted using FACS Aria (BD Biosciences). FACS data were quantified using data obtained from four independent experiments.
RNA isolation and quantitative gene expression analysis
Total RNA was isolated from embryos and EBs at various time-periods using miRVANA RNA isolation kit ( Ambion), and cDNA was synthesized using superscript cDNA synthesis kit (Invitrogen). Quantitative RT-PCR was performed using ABI Taqman probe sets. Probes used in these studies include the following: VIC-3abeled GAPDH:4352339E, FAM-labe3ed U6 snRNA: 001973; hsa-miR- 130a: 000454; Flkl :mm00440099_ml , PECAM:
mm01246167_ml, Tie2: mm01256892_ml , Tnnt2:mm00441922_ml, c-kit: mm00445212_ml, Lmo2: mm00493153_ml , CD41 :mm00439741_ml , and Dicer: Mm00521722_ml .
Electrophoretic Mobility Shift Assay (EMSA)
Experimental details for performing EMSA were previously described (Koyano-
Nakaga a et al., 2012). The oligonucleotides harboring the Etv2 binding motif in the miR-130a promoter region were; sense strand : 5 ' - GAATATAGGCAGGAAATTGACCAGAT-3 ' (SEQ ID NO:6); and antisense strand: 5 ' - ATCTGGTC AATTTCCTGCCT ATATTC - 3 ' (SEQ ID NO:7).
Cell transtection and luciferase assays
COS7 cells were transfected using Lipofectamine 2000 (Invitrogen) according to the manufacturer' s protocols. For the luciferase transactivation assay, O.SxIO5 cells were cultured in 24-well plates and transfected at 90% confluency with 0.25 ng well of reporter construct together with increasing amounts of Etv2 constructs. pRL-TK (50 ng) was used as a control for transfection efficiency. Cells were analyzed at 24 hr posttransfection. Activities of firefly and Renilla iuciferases were measured sequentially using the Dual-
Luciferase Reporter Assay system (Promega) and a luminometer (Berthold Detection Systems, Sirius). For the miR- 13Ga target assay, COS7 cells were transfected using Lipofectamine 2000 (Invitrogen) with 150 nM/well of miR- 130a mimic s/antagomir and 0.2 μ^ννεΐΐ of Pdgfra constructs. pRL-TK (20 ng) was used as a control for transfection efficiency. Transfected cells were harvested after 48 hr using the Dual-Luciferase Reporter Assay system
(Promega). Luciferase activities were expressed in relative light units that were normalized to the transfection efficiency using the Renilia luciferase activity. CFC Assay using miR-130a iESCs
For the CFC assays, miR- 130a iESCs were differentiated in the mesoderm-inducing condition and treated from Days 2-6 with doxycycline. For the lineage committed CFC assay, FlkvPdgfr (hemato-endothelial mesoderm) and Flk Pdgfra+ (unpatterned mesoderm! and prospective cardiac mesoderm) were sorted at day 3.5 of EB differentiation without Dox. Sorted ceils were reaggregated for an additional two days in the presence or absence of Dox.
50,000 dissociated ceils from whole EBs or FACS sorted EBs were plated on a 35 mm culture dish with 1.5 ml of MethoCult (M3434, Stem Cell Technologies) according to the manufacturer' s instructions. Hematopoietic colonies were identified and quantified after 10 days of incubation. These assays were performed in triplicate and independently repeated three times.
Reaggregation assay
Reaggregation of the sorted cells was performed as described (Kouskoff et al., 2005). Briefly, 4x10" FACS-sorted cells were plated in a low attachment 24-well plate (Costar) containing EB differentiation media in the absence or the presence of Dox. Reaggregated EBs were FACS analyzed at day 6 as previously described (Rasmussen et al., 2011). These assays were repeated at least three times and statistical analysis was performed using Student' s t-test.
ChIP assay
The DNA-protein complex was immuno recipitated with anti-HA serum (Santa Cruz, sc-805) from cell lysat.es using inducible HA-Etv2 EBs at day 3 of differentiation. qPCR was performed to detect the target region using the indicated primers; Fwd: 5'-GCTTTGGGTGAGGCTAAAACG-3' (SEQ ID NO:8); Rev: 5'-CAGAAGCCCTGTTCCCAGATG-3' (SEQ ID NO:9).
miR-130a antagomir transfection
Transfection of miR-130a antagomirs were performed as previously described (Zhang et al., 2014) with minor modifications. Briefly, ES cell suspensions were treated with 150 nM of control or miR- 130a antagomirs together with RNAimax reagent (Invitrogen) in low -attachment 6 -well plates (Costar). EBs were incubated with these oligonucleotides in a shaking culture and FACS assay was performed, on d6 of EB differentiation.
Generation of inducible Pdgfra ES cell lines
Lentiviruses expressing full-length of Pdgfra (ImageClone 5704645, Open Biosystems) were generated and infected into A21ox as well as miR-13Ga iES clones. Viral infected cells were FACS sorted for EGFP"1" fluorescence after addition of Dox. Sorted GFP+ cells were amplified and experiments were performed as described in the results section.
Zebrafish morpholioo and in situ hybridization experiments
The following antisense MO oligonucleotides were designed by and obtained from the Gene Tools LLC. miR- 130a-MO: 5 ' -
CAATGCCCTTTTAACATTGCACTGC -3 '(SEQ ID NO: 10) miR- 130a mis- MO: 5 ' -CAATaCCaTTTTAAaATTaC ACTaC -3 '(SEQ ID NO: l 1 ) (lower case represents mismatch bases).
Wild-type and transgenic zebrafish lines, Tg(fli l a:GFP) (Motoike et al, 2003) were maintained according to the TACUC, UMN approved protocols.
Zebrafish embryos at the one-two cell stage were injected with 25 ng mismatch control or miR- 130a morpholinos following a standard procedure (Akiyama et al., 2014). The following antisense MO oligonucleotides were designed by and obtained from the Gene Tools LLC. miR- 130a-MO: 5' - CAATGCCCTTTTAACATTGCACTGC -3 ' (SEQ ID NO: 12) miR- 130a mis- MO: 5'- CAATaCCaTTTTAAaATTaC ACT aC -3' (SEQ ID NO:13) (lower case represents mismatch bases). Whole mount in situ hybridization for Pdgfra was done using standard procedures as described previously (Ng et al., 2002). For the zebrafish in situ hybridization experiments, 25-30 embryos were examined for each set.
Morphological analysis
For morphological analysis, embryos from time-mated females were harvested at specified stages. Embryos were fixed in 4% PFA overnight at 4°C and imaged using the Zeiss Axio Observer Zl inverted microscope.
Statistical Analysis
All experiments were repeated at least three times and the data represent the mean ± SEM. Statistical significance was determined using the Student' s t- test and a p-value < 0.05 was considered as a significant change.
Results
Etv2-Cre-mediated Dicer deletion results in altered mesodermal lineages and embryonic lethality
Analysis of mesodermal transcripts during embryonic stem cell/embryoid body (ES EB) differentiation indicated thai Mespl was transiently, but robustly expressed at day (d) 3, with subsequent expression of both Fikl and Etv2 at d4, marking the appearance of the mesodermal lineages (Figure 5A). To examine the requirement for miRN As in the mesodermal progenitors, floxed-Dicer was conditionally deleted in Mespl, Fikl and Etv2-expressing precursors using Cre recombinase under the control of either Mes l , Fikl and Etv2 promoter elements. qPCR analysis revealed efficient deletion of the Dicer allele from the FACS-sorted cells (Figure 5B). Whole mount analysis revealed embryonic lethality in Mes l Cre +;DicerL/L embryos by E10.5; and the FlklCre +;DicerL L and the Etv2C!e'+;DicerL/L embryos were lethal by E12.5 due to vascular defects (Figure 5C, Table 1).
Table 1 (related to Figure 1 ). Dicer functions are needed in mesodermal progenitors. Table showing embryonic lethality at distinct developmental stages of conditional knockout embryos obtained from Mespl -Cre, Flki -Cre and Etv2- Cre mediated Dicer deletions.
These results indicated a need for miRNAs in the endothelial lineage. Previous studies analyzing Tie2Cre/+;DicerL'L or VE-CadCre'+;DicerL L conditional mutants revealed viable animals with no obvious vascular defects (Saurez et al., 2007). Based on the findings and these reports, it is believed that miRNAs induced during Flk l and Etv2 expression are needed for endothelial development.
Etv2 marks the earliest hemato-endothelial progenitors (Koyano- Nakagawa et al., 2012). Previous studies have demonstrated that Etv2-mutants have altered mesodermai populations (Rasmussen et al., 2011). To evaluate whether mesodermal derivatives were affected in Etv2Cre +;DicerL/L mutants, Etv2Cre +;Diceru+ and Etv2-EYFP;DicerL L lines were crossed and FACS analysis performed at E7.5. Etv2-EYFP reporter has been shown to label the hemato- endothelial lineages during embryo genesis (Rasmussen et al., 2011 ). The analysis showed a significant increase in the number of the Flkl -/Pdgfra+ cells in the Dicer conditional mutants (Figures 1 A-C). In contrast, in the EYFP- fractions, no changes in the Flkl7Pdgfra+ or Flkl+/Pdgfra+ populations were observed (Figures 1D-F). These results indicated that miRNAs that are expressed in the Etv2+ progenitors are needed for segregation of the mesodermai lineages.
To identify a specific miRNA that regulates the hemato-endothelial lineages, Flkl"1" cells from d4 EBs were FACS sorted and a robust enrichment of miR- 130a in Flkl * cells was observed relative to Flkl" cells (Figure 5D). To evaluate the enriched expression of miR- 130a in the endothelial lineages in vivo, CD31+, CD41+, and cardiac progenitor cells (CPCs) from E9.5 embryos were sorted and miR- 130a expression analysis was performed. A robust expression of miR- 130a in CD31+ cells was detected relative to other lineages (Figure 5E). These results indicated that miR- 130a is enriched in the endothelial progenitors. FACS-sorted CD3 T cells from the Etv2Cre/"'":DicerLL embryos demonstrated reduced expression of mature miR- 130a, indicating that Dicer is required for miR- 130a biogenesis in the Etv2+ lineage (Figure 1 G). To define the regulatory network for miR- 130a, the 5.Okb upstream region of the miR- 130a locus was analyzed and three highly conserved binding motifs for Etv2 (Figure 1H) were identified. Doxycycline (Dox) inducible HA-Etv2 ES cell line (Koyano- Nakagawa et al., 2012) was utilized to examine the binding of Etv2 to the miR- 130a promoter in vivo. ChIP assay using Dox-induced cell lysates showed a 15-
fold enrichment of Etv2 at the cis-regulatory region of the miR-130a promoter, but not in the non-specific region of the miR- 130a locus (Figure II). Gel-shift assays further confirmed that Etv2 could bind to the miR- 130a promoter containing the Etv2 recognition sequence (Figure IJ). Transcriptional assays using the l .Okb miR- 130a promoter-reporter construct revealed that Etv2 potently transactivated the miR- 130a promoter in a dose-dependent fashion. Mutagenesis of the Etv2 binding motifs resulted in abolishment of the transcriptional activity (Figure IK). To monitor whether Etv2 could regulate miR- 130a expression in vivo, the Etv2-EYFP* cells from the Etv2-wildtype (Etv2+/+) and null (Etv2";") embryos at E7.5 were FACS sorted. qPCR analysis for miR- 130a showed reduced expression of miR- 130a in Etv2~''~ embryos compared to controls (Figure 1L). These results indicated that miR- 130a was expressed in early endothelial progenitors and that Etv2 is a direct upstream regulator of miR- 130a.
miR- 130a modulates the endothelial lineage during embryogenesis
qPCR analysis using ES/EBs revealed that mature miR- 130a transcripts were induced by d4 (hemato-endothelial specification stage) and remained high at d8 (endothelial maturation stage) of EB differentiation (Figure 6A). To define the role miR- 130a in endothelial progenitors, ind cible ESC line was generated which over-expresses miR- 130a in response to Dox (miR- 130a iES). Stable integration of the miR- 130a construct did not alter colony morphology (Figure 2 A, left panel), and addition of Dox resulted in a significant increase (~7 fold) of the miR- 130a transcript (Figure 2A, right panel). Dox-mediated induction of miR- 130a from d2-d6 resulted in increased expression of endothelial transcripts including: CD31, Tie2, and Flkl with no effect in the key hematopoietic transcripts including CD41, c-kit and Lmo2 (Figure 2B). Similar to the qPCR results, FACS analysis revealed that the over-expression of miR- 130a resulted in an increase of the endothelial program (CD31VTie2+ and CD31+/VE-cadherin" populations) by 2.5 -fold and 2-fold, respectively (Figures 2C and 2D; Figures 6B and 6C) without any significant changes in the hematopoietic lineage (CD417CD45+ population) at d6 of EB differentiation (Figures 2E and 2F). Colony forming (CFC) assays revealed that the definitive hematopoietic colonies (Ery-D, GEMM, GM and Mac) were not significantly changed between uninduced and Dox-induced ES/EBs (Figure 6D). These data demonstrated that
miR- 130a promoted the endothelial lineage with no effect on hematopoiesis. To examine the differential effect of miR-OOa, miR-OOa aniagomir-niediated knockdown assays were performed using ES/EBs (Figure 2G). Knockdown of miR- OOa resulted in a robust increase in Meox2 (a known target of miR-OOa (Chen and Gorski, 2008)) expression (Figure 2H). FACS analysis revealed that functional inhibition of miR-OOa resulted in a significant reduction of the endothelial lineage (Figures 21 and 23), whereas the hematopoietic lineages were unaffected (Figures 2K and 2L). These results confirmed the preferential effect of miR- 130a on endothelial development.
To examine whether miR-OOa induction affects other mesodermal- derived lineages, immunohistochemical analyses was performed for cardiac and endothelial markers in differentiating miR-OOa iES/EBs. Dox-induction of miR- OOa from d2-d6 resulted in a significant reduction of cardiac Troponin (cTnT) expression in d 10 EBs with a corresponding increase of CD 31 expression (Figure 6E). Quantitative assessment of the number of cTnT* EBs and beating EBs following miR- OOa overexpression revealed a significant decrease in the cardiogenic program compared to controls (-Dox) (Figures 6F and 6G). Furthermore, qPCR analysis revealed decreased expression of cTnT, concurrent with reduced cardiac contractility in the Dox-induced EBs (Figure 6H). These data suggested that miR- 130a promoted the endothelial lineage at the expense of the cardiac program.
miR- 130a targets Pdgfra expression and modulates mesodermal lineage development
To explore the mechanism by which miR- OOa modulates endothelial lineage development, three miRNA target prediction tools including TargetScan 6.2, PicTar and miRANDA were employed to mine common predicted targets. Among the multipie targets, Pdgfra was identified as a highly conserved target of miR- 130a with a high percentile score using TargetScan 6.2 in both mouse and zebraiish genomes (data not shown). Multiple sequence alignment revealed a highly conserved miR- 130a seed -sequence in the Pdgfra-3 ' -UTR region
(Figure 3A). To examine whether miR- OOa targets Pdgfra mRNA, !uciferase assays using a PGK promoter-driven luciferase reporter ( GK-Luc-Pdgfra-3 ' - UTR) construct were performed. Co-transfection of the PGK-Luc-Pdgfra-3'- UTR reporter with a miR- OOa mimic resulted in a statistically significant
reduction (-40%) of the !uciferase activity; whereas, co-transfection with miR- 130a inhibitor resulted in enhancement of the luciferase activity, indicating that endogenous miR-130a could target the Pdgfra mRNA (Figure 3B). To assess whether miR-130a could target Pdgfra transcripts in vivo, mopholinos against miR- 130a (miR- 1 30a-MO) were injected at the one-two cell stage into fertilized zebrafish eggs and performed in situ hybridization for Pdgfra mRNA. The data demonstrated increased expression of Pdgfra in the miR- 1 30a morphants, indicating that miR-130a could suppress Pdgfra expression in vivo (Figure 3C). To further examine its effect on the endothelial lineage, endothelial specific transgenic reporter [Tg(flil-EGFP)] line was utilized and injected control MO or miR- 130a MO into the fertilized eggs. qPCR analysis from FACS sorted f!il- EGFP+ ceils revealed enrichment of Pdgfra transcripts in the miR-130a morphants relative to the control (Figure 3D). These results indicated that miR- 130a could target Pdgfra transcripts both in vitro and in vivo.
Next, it was examined whether down regulation of Pdgfra regulation is the mechanism by which miR- 130a regulates endothelial lineages. Antibody- mediated inhibition of Pdgfra signaling resulted in a significant induction of CD31 and Tie2 transcripts, but had no effect on CD45 transcript levels (Figures 3E-G). Similarly, FACS analysis showed that blocking Pdgfra signaling led to a significant increase in the endothelial lineage (Tie2+/CD31+cell population from 13.5 %±2.0% to 26.1 %±3.0%) with no effect on the hematopoietic lineage (Figures 3H-K). To validate these findings, a Dox-inducible lentiviral vector expressing Pdgfra was generated. In contrast to the inhibition studies, lentiviral- mediated Dox-inducible overexpression of Pdgfra repressed the endothelial program (Tie27CD3 T'cell population decreased from 3.13%±0.25 to
0.95 %±0.50%) without affecting the hematopoietic lineage (Figures 3L-0). These results demonstrated that modulation of Pdgfra signaling had a profound effect on the endothelial lineage, but not on the hematopoietic lineage during development.
miR-130a modulates Flkl+/Pdgfra+ mesodermal progenitors towards lateral p!aie mesodermal lineage
Previous studies have shown that Flkl "/Pdgfra"1" (paraxial mesoderm) and Flkl "VPdgfra" (lateral plate mesoderm) cells arise from the Fikl"7Pdgfra+ cell population by modulating Pdgfra le vels at early stages of ES/EB differentiation
(Kataoka et al., 2011 ; Sakurai et al., 2006). Therefore, a shorter pulse (48h) was performed and it was examined whether miR- 130a promoted the endothelial lineage from mesodermal progenitors by suppressing Pdgfra expression. A 48h Dox pulse between d2-d4 using miR- 130a iES/EBs resulted in a markedly reduced percentage (54%±4% to 35%±2%) of the Flkl 7Pdgfra+, but not
Flkl+/Pdgfra+ populations (Figures 4A-C). Congruent with the luciferase activity and the FACS data, qPCR analyses showed reduced levels of Pdgfra transcripts in Dox-puised miR- 130a EBs, indicating that miR- 130a targets Pdgfra mRNA (Figure 4D). Also observed was a small but non-significant increase in
Flkl+/Pdgfra" populations (data not shown). Notably, similar to a long pulse (d2- 6) of miR- 130a (Figure 2), a shorter pulse (d2-4) resulted in an equivalent promotion of the endothelial lineage (Figure 4E). To further investigate the correlation between miR- 130a and Pdgfra signaling, an inducible Pdgfra mouse ES cell line was engineered using miR- 130a iES cells, which over-expresses both miR- 130a and Pdgfra in response to doxycycline (miR- 1.30a+Pdgfra iES) (Figure 7 A). As expected, induction of miR- 130a alone resulted in an induction of the endothelial lineage. Forced overexpression of miR- 130a and Pdgfra resulted in a significant reduction of Tie2 "7CD3 V cells (2.45% ± 0.80% to 0.74% ± 0.20%) with no effect on the hematopoietic populations (Figures 7B-E). These data further supported the hypothesis that miR- 1 30a regulates the endothelial lineage via down-regulation of Pdgfra signaling.
Aggregation-reaggregation assays were performed to test the ability of miR- 130a to modulate mesodermal precursors. Uninduced FACS sorted Flkl TPdgfr and Flkl7Pdgfra+ cells from miR- 130a iES EBs (d3.5) were reaggregated for an additional 48h in the absence or presence of Dox and were analyzed for mesodermal-derivatives at d6 using cell surface markers (Figure 4F). No significant differences were detected in the number of endothelial cells derived from the Flkl+/Pdgfra" population, demonstrating that over-expression of miR- 130a did not influence the fate of lineage-committed endothelial populations (data not shown). FACS analyses of Flkl+ Pdgfra+ reaggregates revealed an emergence of the endothelial lineages (Figure 4G), supporting the existence of early uapatterned mesodermal cells within this population (Sakurai et al., 2006). A Dox-puise (d4-6) in the double-positive reaggregates resulted in a significant increase (12% ± 3% to 22% ± 2%) of endothelial cells (Figures 4G
and 4H). in contrast, the biood coiony forming activity from either Flkl+/Pdgfra~ or Flkl+ Pdgfra+ cell populations did not show significant changes (Figures 41 and 4 J), demonstrating that the effect of miR-130a is specific to the promotion of the endothelial lineage. These data indicated that miR- 130a directed the mesodermal lineage towards lateral plate mesoderm by suppression of Pdgfra expression.
Discussion
Defined herein is the role of the Etv2-miR-130a-Pdgfra network in the divergence of hemato-endotheiial progenitors. Mechanistically, miR- 130a promotes endothelial lineage development by modulating Pdgfra signaling. This is the first report of a miRNA that specifically promotes the endothelial lineage without affecting the hematopoietic lineage.
miRNAs are regulators of transcript expression, however, only a limited number of miRNAs have specific developmental roles. For example, the miR- 430/427/302 family controls mesendodermal fate specification and miR- 1/miR- 133 (muscle-specific miRNAs) can promote mesodermal formation during embryogenesis (Ivey et al., 2008; Rosa et al, 2009). The data herein reports a novel functional role for miR- 130a that specifically promotes differentiation of the endothelial lineage.
Previous reports suggest that Etv2 plays a major role for the progression of Flkl+/Pdgfra+ progenitors (primitive mesoderm) to the Flki VPdgfra" (vascular mesoderm) state (Kataoka et al., 201 1 ). Based on the data, it is believed that the Etv2-miR- 130a cascade down-regulates Pdgfra expression and promotes the transition of Flkl 7Pdgfra+ to the Flkl Pdgfra". It is further believed that miR- 130a facilitates the segregation of bipotent progenitors towards the endothelial lineage without affecting the hematopoietic lineage. However, the involvement of functionally redundant miRNAs cannot be ruled out.
Since mutation of Etv2 affects both hematopoietic and endothelial lineages (Koyano-Nakagawa et al., 2012), it was unexpected to discover that miR- 130a targets Pdgfra and promotes only the endothelial lineage. However, these results are supported by the finding that fetal liver hematopoiesis was not affected in the Pdgfra conditional knockout embryos (Ding et al., 2013). The data herein together with others (Ding et al., 2013) support the notion that the endothelial, but not the hematopoietic lineage is sensitive to the level of Pdgfra.
li is beleived that as Flkl Pdgfra1' common mesodermal progenitors progress to the FlklTPdgfra" hemato-endothelial progenitors, miR- 130a further down- regulates Pdgfra expression to direct ceils towards the endothelial lineage (Figure 8). This is in agreement with a previous report highlighting that newly- generated Flkl single positive cells are still plastic in nature and could switch between the Pdgfra single positive state (and vice versa) before lineage commitment (Sakurai et al., 2006). it is believed that the Etv2-miR- 130a-Pdgfra pathway may function to stabilize this plastic intermediate state towards an endothelial fate by suppressing the fluctuating levels of Pdgfra. Early developmental events are regulated by multiple signaling pathways including FGF and Wnt signaling in a context-dependent manner. For example, inhibition of FGF-Erkl/2 signaling results in loss of Pdgfra'" cells (Kunath et al., 2007), whereas a Wnt signaling wave regulates cardiogenesis and hematopoiesis in a temporally distinct fashion (Naito et al., 2006). The data herein, together with others, illustrate the role of signaling pathways, transcription factors and miRNAs in the regulation of cell fate decisions, thereby forming an integral part of the regulatory network in the emergence of mesodermal lineages.
In summary, a novel role for miR-130a has been discovered in the modulation of early endothelial progenitors. While several factors including HoxA3, Runxl and miR-142-3p have been shown to have a role in
hematopoietic lineage segregation and hemangioblast specification (Iacovino et al., 201 1 ; Nimmo et al., 2013), endothelial specific regulators have not been described. miR- 1 0a is the first reported regulator of endothelial development from the hemato-endothelial progenitors (Figure 8).
Example 2
Mus musculus ets variant 2 (Etv2) sequence information
NCBI Reference Sequence for mEtv2 gene: NM„ 007959.2
LOCUS :NM_007959 1050 bp mRNA linear ROD 15-FEB-2015
DEFINITIO :Mus musculus ets variant 2 (Etv2), mRNA.
ACCESSTON:NM. 007959 XM_ 909688
VERSION:NM__0079S9.2 GI: 119964691
SOURCE:Mus musculus (house mouse)
Ensembi information for mEtv2 gene: Etv2 ENSMUSG00000006311
Description; ets variant 2 [Source:MGT Symbol;Acc:MGT:99253]
Location; Chromosome 7: 30,633,616-30,635,852 reverse strand.
INSDC coordinates;
chromosome:GRCm38:CM001000.2:30633616:30635852: l
Name: Etv2 (MGI Symbol)
CCDS: This gene is a member of the Mouse CCDS set: CCDS39888.1 UniProtKB: Uniprot identifiers: Ρ4 Π63
RefSeq: RefSeq Gene ID 14008 mRNA sequence of mEtv2
gene— "Etv2"
gene_synonym="Etsr 71 "
stand ard_narne= " B E 102623 "
_xref="UniSTS:244290"
1 agaaccgtca gaacaagcat ccatggacct gtggaactgg gatgaggcgt cactgcagga
61 agtgcctcct ggggacaagc tgacaggact gggagcggaa tttggtttct atttccctga
121 agtggctcta caagaggaca caccgatcac accaatgaac gtagaaggct gctggaaagg
181 gttcccagag ctggactgga accccgcttt acctcacgaa gacgtacctt tccaggcgga
241 gcccgttgct oacccccttc cgtggtcgcg agactggaca gacctgggat gcaacacctc
301 ggacccgtgg agctgtgctt cacagacgcc aggccctgcc cctcctggca cgagcccctc
361 ccccttcgtc ggctttgaag gggcgaccgg ccagaatcct. gccacctcgg caggaggggt
421 cccctcgtgg tcgcaccctc cagctgcctg gagcactacc agctgggact gttctgtggg
481 ccccagtggc gccacctact gggacaatgg cctgggcggg gaagcgcatg gacta aa
541 aatgtcatgg ggcgggtctg ccggttcgga ctacaccacc acgtggaata ctgggctgca
601 ggactgcagc atcccttt.cg aggggcacca gagtccagca ttcaccacgc cctccaaatc
661 gaacaagcag tctga agag ccacattgac cgctactcc aaaac aacc accgaggtcc
721 cat cagc g ggcaattcc cc ggagct gc ccacgac ggggctcgca gcagctgcat
781 ccgctggacg ggcaacagcc gcgagttcca gccgtgcgac cccaaagagg tggcccggct
841 g ggggcgag cgcaagagga agccgggaat gaattatgag aaac gagtc gaggtct acg
901 ttattattac cgccgcgaca tcgtgctcaa gagtggtggg cgcaagtaca cataccgctt
961 cgggggacg gtgcc gtcc cgcc atca ggatgata g gggcatc gc caggtgcaga
1021 aggccaataa aacaaaaaac aaaaacaaaa (SEQ ID NO: 14) Protein Sequence of mouse Etv2
KDLWNWDEASLQEVPPGDKLTGLGAEFGFYFPEVALQEDTPITP M VEGCWKGFPELD NPALPHEDVPFQAEPVAHPLP SRDWTDLGCNTSDPWSCASQT PGPAPPGTSPSPFVGFEGATGQNPATSAGGVPSWSHPPAAWSTTSWDCSVGPSGATYW D GLGGEAHEDYKMSWGGSAGSD iTTT KTGLQDCSIPFEGRQSPAFTTPSKSNKQSD RATLTRYSKTNHRGP IQL QFLLELLHDGARSSCIRWTG SREFQLCDPKEVARL GE RKRKPGMNYEKLSRGLRYYYRRDIVLKSGGRKYTYRFGGRVFVLAYQDDMGHLPGAEG
Q (SEQ ID NO: 15)
Human ets variant 2 (Etv2) sequence information
NCBI information from Gene ID 2116
Official symbol: ETV2
Official Full Name: ets variant 2
Primary source: HGNC:HGNC:3491
See related; Ensembl:ENSG00000105672; HPRD: 16871 ; MIM:609358; Vega:OTTHUMG00000150545
Organism; Homo sapiens
Also known as; ER71 ; ETSRP71
Ensembl information for human Etv2 Gene: ETV2 ENSG00000105672 Description: ets variant 2 [Source:HGNC Symbol;Acc:HGNC:3491] Synonym: ER71
Location: Chromosome 19: 35,641,745-35,644,871 forward strand.
INSDC coordinates: chromosome:GRCh38:CM0Q0681.2:35641745:35644871 :1 About this gene: This gene has 8 transcripts (splice variants), 30 orthologues, 12 paralogises, is a member of 2 Ensembl protein families and is associated with 23 phenotypes. mRNA sequence of human ets variant 2 (ETV2), transcript variant 1
LOCUS: NM..014209 1510 bp
DEFINITION: Homo sapiens ets variant 2 (ETV2), transcript variant 1 , mRNA. ACCESSION : NM..014209 X.VI 29083 !
VERSION: NM_014209.3 GL665821253
1 ttcctgttgc agataagccc agcttagccc agctgacccc agaccctctc ccctcactcc
61 ccccatgtcg caggatcgag accctgaggc agacagcccg ttcaccaagc cccccgcccc
121 gcccccatca ccccgtaaac ttctcccagc ctccgccctg ccctcaccca gcccgctgc t
181 ccccaagcct cgctccaagc ccacgccacc cctgcagcag ggcagcccca gaggccagca
241 cctatccccg aggctggggt cgaggctcgg ccccgcccct gcctctgcaa cttgagcctg
301 gctgcgaccc ctgctctgac gtcccggaaa attccccctt gcccaggccc tgggggagg
361 gggtgcatgg tatgaaatgg ggctgagacc cccggctggg ggcagaggaa cccgccagag
421 aacattcaga aggccttcat cgcatccacg gacctgtgga accgggatga ggcatcccca
481 caggaagtgc ctccagggaa caagctggca gggcttgaag gagccaaatt aggcttctgt
541 ctccctgatc tggcactcca aggggacacg ccgacagcga cagcagagac atgctggaaa
601 ggtacaagct catccctggc aagcttccca cagctggact ggggctccgc gttactgcac
661 ccagaagttc catggggggc ggagcccgac tctcaggctc ttccgtggtc cggggactgg
721 acagacatgg cgtgcacagc ctgggactct cggagcggcg cctcgcagac cctgggcccc
781 gcccct.ctcg gcccgggccc catccccgcc gccggctccg aaggcgccgc gggccagaac
841 tgcgtccccg tggcgggaga ggccacctcg tggtcgcgcg cccaggccgc cgggagcaac
901 accagctggg actgttctgt ggggcccgac ggcgatacc actggggcag cggcctgggc
961 ggggagccgc gcacggactg caccatttcg tggggcgggc ccgcgggccc ggactgtacc
1021 acctcctgga acccggggc gcatgcgggt ggcaccacct ctttgaagcg gtaccagagc
1081 tcagctctca ccgcttgctc cgaaccgagc ccgcagtcgg accgtgccag tttggctcga
1141 tgccccaaaa ctaaccaccg aggtcccatt cagctgtggc ag cctcct ggagctgctc
1201 cacgacgggg cgcgtagcag ctgcatccgt tggactggca acagccgcga g ttccagctg
1261 tgcgacccca aagaggtggc tcggctgtgg ggcgagcgca agagaaagcc gggca gaat
1321 tacgagaagc tgagccgggg cct.tcgctac tactatcgcc gcgacatcgt gcgcaagagc
1381 ggggggcgaa agtacacgta ccgcttcggg ggccgcgtgc ccagcctagc cta ccggac
1441 tgtgcgggag gcggacgggg agcagagaca caataaaaat tcccggtcaa acc caaaaa
1501 aaaaaaaaaa (SEQ ID NO: 16)
Protein sequence of human ets variant 2 (ETV2), transcript variant 1 product-"ETS transiocation variant 2 isoform 1 "
protein_id="NP_055024.2"
db_xref="GI: 153791 178''
db_xref="CCDS:CCDS32995.2"
db . ret™"GeneID:2116"
db„xrefc:"HGNC:HGNC:3491 "
db_xref="MIM:609358"
KDLiiNWDEASPQEVPPGNKLAGLEGAKLGFCFPDLALQGDTPTA
TAEXCWKGTSSSLASFPQLDWGSALLHPEVPWGAEPDSQALPWSGDWTDMACTAWDSK SGASQTLGPAPLGPGPIPAAGSEGAAGQNCVPVAGEATSWSRAQAAGSNTSWDCSVGP DGDTYWGSGLGGEPRTDCTTSWGGPAGPDCTTSWilPGLHAGGTTSLKRYQSSALTVCS BPSPQSDBASLARCPKXNHBGPIQL QFLLELLHDGARSSCIRWTGNSBEFQLCDPKB
VARLWGERKRKPGMSYEKLSRGLRYYYRRDIVRKSGGRKYTYRFGGRVP SLAYPDCAG GGRGAETQ ( SEQ ID NO : 17 ) Bernstein, E., et at. (2003). Nat. Genet. 35, 2 S -2 i 7.
Chen, Y., and Gorski, D.H. (2008). Blood 111, 1217-1226.
De Val, S., et al. (2008). Cell 135, 1053- 1064.
Ding, G., et al. (2013). Dev. Dyn. 242, 254-268.
Ferdous, A., et al. (2009). Proc. Natl. Acad. Sci. USA 106, 814-8 9. Harfe, B.D., et al. (2005). Proc. Natl. Acad . Sci. USA 102, 10898- 10903.
Huber, T,L., et al. (2004) Nature 432, 625-630.
lacovino, M., et al. (201 1 ). Nat. Cell Biol. 13, 72-78.
Ivey, K.N., and Srivastava, D. (2010). Cell Stem Cell 7, 36-41.
Ivey, K.N., et al. (2008). Cell Stem Cell 2, 219-229.
Kalaoka, PL, et ai. (20 i 1 ) Blood i 18, 6975 -6986.
Kattman, S.J., et al. (2006). Dev. Cell 1 , 723-732.
oyano-Nakaga a, N., et al. (2012). Stem Ceils 30, 1611-1623.
Kunath, T., et al. (2007) Development 134, 2895-2902.
Loebel, D.A., et al. (2003) Dev. Biol. 264, 1-14.
Naito, A.T., et ai. (2006) Proc. Natl. Acad. Sci. USA 103, 19812-19817.
Nimmo, R., et al. (2013) Dev. Cell 26, 237-249.
Rasmussen, T.L., et ai. (201 1 ) Development 1 8, 4801 -4812.
Rosa, A, et al. (2009) Dev. Cell 16, 517-527.
Shalaby, F., et ai. (1995) Nature 376, 62-66.
Saga, Y., et al. (1999) Development 126, 3437-3447.
Sakurai, H., et al. (2006). Stem Ceils 24, 575-586.
Ueno, H. and Weissman, l.L. (2006) Dev. Cell 1 1 , 519-533.
Yang, W.J., et ai. (2005). J. Biol. Chem. 280, 9330-9335.
Akiyama, R., et al. (2014). Development 141 , 1 104-1 109.
Drakker, VI .. et al. (2012). Nat.Biotech. 30, 531 -542.
ouskoff, V., et al. (2005). Proc. Nat. Acad. Sci. USA 102, 13170-13175.
Moioike, T., et al. (2003 ). Genesis 35, 153-159.
Ng, J.K., et al. (2002). Development 129, 5161 - 170.
Zhang, K., et al. (2014) J. Am. Coll. Cardiol. 63, 358-368.
All publications, patents, and patent applications mentioned in this specification are herein incorporated by reference to the same extent as if each individual publication, patent, or patent application was specifically and individually indicated to be incorporated by reference. In the event that the definition of a term incorporated by reference conflicts with a term defined herein, this specification shall control.
Claims
1. A method to differentiate cells comprising contacting stem, progenitor or precursor cells with miR- 130a, or nucleic acid, such as an RNA, having at least 95% identity thereto, so as to yield cells of endothelial lineage.
2. The method of claim 1 , wherein the stem, progenitor or precursor cells are embryonic stem cells, adult stem cells, induce pluripotent stem cells, and/or multipotent stem cells, such as multipotent mesodermal precursors,
3. The method of claim 1, wherein the stem, progenitor or precursor cells are mammalian cells.
4. The method of claim 1 , wherein the progenitor cells are hemato- endothelial progenitors.
5. The method of claim 1 , wherein the precursor cells are mesodermal precursor cells expressing Flkl7Pdgfra+.
6. The method of claim 1 , further comprising admixing the endothelial lineage cells with a pharmaceutically acceptable carrier.
7. The method of claim I , comprising administering the endothelial lineage cells to a subject to a subject in need thereof so as to treat cai'diovascular disease, wound healing, and/or repopulatkm of vasculature.
8. The method of claim 7, wherein cells administered to the subject are autologous or alloseneic.
9. A composition consisting essentially of miR- 130a and stem, progenitor and/or precursor ceils.
10. The composition of claim 9, wherein the cells are mammalian.
11. A composition comprising the endothelial lineage cells obtained by the methods of claim 1 and a cell culture media or a pharmaceutically acceptable carrier.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US15/748,772 US10858627B2 (en) | 2015-07-30 | 2016-07-29 | Regulation of mesodermal specification |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201562199044P | 2015-07-30 | 2015-07-30 | |
| US62/199,044 | 2015-07-30 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2017020009A1 true WO2017020009A1 (en) | 2017-02-02 |
Family
ID=57885023
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2016/044859 Ceased WO2017020009A1 (en) | 2015-07-30 | 2016-07-29 | Regulation of mesodermal specification |
Country Status (2)
| Country | Link |
|---|---|
| US (1) | US10858627B2 (en) |
| WO (1) | WO2017020009A1 (en) |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10858627B2 (en) | 2015-07-30 | 2020-12-08 | Regents Of The University Of Minnesota | Regulation of mesodermal specification |
Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20090176723A1 (en) * | 2004-11-12 | 2009-07-09 | David Brown | Methods and compositions involving miRNA and miRNA inhibitor molecules |
| US20100184032A1 (en) * | 2006-12-04 | 2010-07-22 | The Johns Hopkins University | Stem-Progenitor Cell Specific Micro-Ribonucleic Acids and Uses Thereof |
| US20120135051A1 (en) * | 2009-06-10 | 2012-05-31 | The General Hospital Corporation | Generation of vascularized human heart tissue and uses thereof |
Family Cites Families (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP1783207A4 (en) * | 2004-06-22 | 2008-07-30 | Mitsubishi Tanabe Pharma Corp | PRODUCTION PROCESS FOR VASCULAR ENDOTHELIAL CELLS FROM EMBRYONIC STEM CELLS |
| US10858627B2 (en) | 2015-07-30 | 2020-12-08 | Regents Of The University Of Minnesota | Regulation of mesodermal specification |
-
2016
- 2016-07-29 US US15/748,772 patent/US10858627B2/en active Active
- 2016-07-29 WO PCT/US2016/044859 patent/WO2017020009A1/en not_active Ceased
Patent Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20090176723A1 (en) * | 2004-11-12 | 2009-07-09 | David Brown | Methods and compositions involving miRNA and miRNA inhibitor molecules |
| US20100184032A1 (en) * | 2006-12-04 | 2010-07-22 | The Johns Hopkins University | Stem-Progenitor Cell Specific Micro-Ribonucleic Acids and Uses Thereof |
| US20120135051A1 (en) * | 2009-06-10 | 2012-05-31 | The General Hospital Corporation | Generation of vascularized human heart tissue and uses thereof |
Non-Patent Citations (5)
| Title |
|---|
| KATAOKA ET AL.: "Etv2/ER71 induces vascular mesoderm from Flk1 PDGFR primitive mesoderm.", BLOOD., vol. 118, no. 26, 2011, pages 6975 - 86, XP055216030 * |
| MARCOLA ET AL.: "Endothelial Progenitor Cells in Tumor Angiogenesis: Another Brick in the Wall.", STEM CELLS INT., vol. 2015, 2015, pages 832649, XP055350629 * |
| MENG ET AL.: "Downregulation of MicroRNA-130a Contributes to Endothelial Progenitor Cell Dysfunction in Diabetic Patients via Its Target Runx3.", PLOS ONE., vol. 8, no. 7, 2013, pages e68611, XP055350620 * |
| RUSU ET AL.: "G protein-dependent basal and evoked endothelial cell vWF secretion.", BLOOD., vol. 123, no. 3, January 2014 (2014-01-01), pages 442 - 50, XP055350628 * |
| SINGH ET AL.: "Etv2-miR-130a network regulates mesodermal specification.", CELL REP., vol. 13, no. 5, November 2015 (2015-11-01), pages 915 - 23, XP055350631 * |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10858627B2 (en) | 2015-07-30 | 2020-12-08 | Regents Of The University Of Minnesota | Regulation of mesodermal specification |
Also Published As
| Publication number | Publication date |
|---|---|
| US10858627B2 (en) | 2020-12-08 |
| US20190010458A1 (en) | 2019-01-10 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| Huszar et al. | MicroRNA 146 (Mir146) modulates spermatogonial differentiation by retinoic acid in mice | |
| Jia et al. | Down-regulated non-coding RNA (lncRNA-ANCR) promotes osteogenic differentiation of periodontal ligament stem cells | |
| US8969315B2 (en) | Enhancement of placental stem cell potency using modulatory RNA molecules | |
| CN107709546B (en) | Method for producing highly functional platelets | |
| Cui et al. | Exosomes derived from mesenchymal stem cells attenuate diabetic kidney disease by inhibiting cell apoptosis and epithelial‐to‐mesenchymal transition via miR‐424‐5p | |
| Clark et al. | MicroRNAs in the myocyte enhancer factor 2 (MEF2)-regulated Gtl2-Dio3 noncoding RNA locus promote cardiomyocyte proliferation by targeting the transcriptional coactivator Cited2 | |
| US20180142206A1 (en) | Reversion of primed pluripotent stem cells to naive pluripotent stem cells | |
| US20240002811A1 (en) | Methods for Generation for Pluripotent and Multipotent Cells | |
| Huang et al. | Regulated expression of microRNAs-126/126* inhibits erythropoiesis from human embryonic stem cells | |
| CA2975268A1 (en) | Generating arterial endothelial cell populations | |
| Huang et al. | Suppression of androgen receptor enhances the self-renewal of mesenchymal stem cells through elevated expression of EGFR | |
| US20200009197A1 (en) | Compositions and methods for the reprogramming of cells into cardiomyocytes | |
| US20080254003A1 (en) | Differentiation of Human Embryonic Stem Cells and Cardiomyocytes and Cardiomyocyte Progenitors Derived Therefrom | |
| KR20160131096A (en) | Method for generating endothelial colony forming cell-like cells | |
| Tseng et al. | Markers of accelerated skeletal muscle regenerative response in murphy roths large mice: characteristics of muscle progenitor cells and circulating factors | |
| Liu et al. | A reciprocal antagonism between miR‐376c and TGF‐β signaling regulates neural differentiation of human pluripotent stem cells | |
| Magadum et al. | Phosphoserine aminotransferase 1 promotes serine synthesis pathway and cardiac repair after myocardial infarction | |
| Kim et al. | Testicular endothelial cells promote self-renewal of spermatogonial stem cells in rats | |
| US20210002641A1 (en) | Compositions and methods for treating graves disease | |
| US10858627B2 (en) | Regulation of mesodermal specification | |
| WO2017053681A1 (en) | Methods of expanding hematopoietic stem cells, compositions, and methods of use thereof | |
| KR20250016667A (en) | Composition for promoting differentiation of Mesenchymal Stem Cells into osteoblast comprising PSEM4 inhibitor | |
| Xiao et al. | Nucleofection is highly efficient for transfecting genes into murine embryonic palatal mesenchymal cells in primary culture | |
| CN120641558A (en) | Methods for regulating cell differentiation | |
| Li et al. | The mesenchymal stem cell-derived exosomal long noncoding RNA H19 promotes wound healing in diabetic foot ulcers by up-regulating PTEN via MicroRNA-152-3p |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 16831451 Country of ref document: EP Kind code of ref document: A1 |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 16831451 Country of ref document: EP Kind code of ref document: A1 |
