WO2017019804A2 - Compounds and methods for kinase modulation, and indications therefor - Google Patents
Compounds and methods for kinase modulation, and indications therefor Download PDFInfo
- Publication number
- WO2017019804A2 WO2017019804A2 PCT/US2016/044330 US2016044330W WO2017019804A2 WO 2017019804 A2 WO2017019804 A2 WO 2017019804A2 US 2016044330 W US2016044330 W US 2016044330W WO 2017019804 A2 WO2017019804 A2 WO 2017019804A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- alkyl
- disease
- independently
- flt3
- haloalkyl
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
- 0 C*N(*)C(*(*)c(cc1)ccc1C(*1)=C(*)N=C1N(*)*)=I Chemical compound C*N(*)C(*(*)c(cc1)ccc1C(*1)=C(*)N=C1N(*)*)=I 0.000 description 5
- XAEGPWDYFZFGMO-UHFFFAOYSA-N Brc1cnc(Nc2c3OCC[n]3nc2)nc1 Chemical compound Brc1cnc(Nc2c3OCC[n]3nc2)nc1 XAEGPWDYFZFGMO-UHFFFAOYSA-N 0.000 description 1
- XDTMQSROBMDMFD-UHFFFAOYSA-N C1CCCCC1 Chemical compound C1CCCCC1 XDTMQSROBMDMFD-UHFFFAOYSA-N 0.000 description 1
- GMQJPRYCRZDRMJ-UHFFFAOYSA-N CC(C)(C(C)(C)OBB1OC(C)(C)C(C)(C)O1)O Chemical compound CC(C)(C(C)(C)OBB1OC(C)(C)C(C)(C)O1)O GMQJPRYCRZDRMJ-UHFFFAOYSA-N 0.000 description 1
- DBOAOJCZYLBQPF-UHFFFAOYSA-N CC(C)(C)OC(N(c1ncc[s]1)c(nc1)ncc1Br)=O Chemical compound CC(C)(C)OC(N(c1ncc[s]1)c(nc1)ncc1Br)=O DBOAOJCZYLBQPF-UHFFFAOYSA-N 0.000 description 1
- NCJXQSNROJRSSL-UHFFFAOYSA-N CC(C)(C)OC(Nc1ncc[s]1)=O Chemical compound CC(C)(C)OC(Nc1ncc[s]1)=O NCJXQSNROJRSSL-UHFFFAOYSA-N 0.000 description 1
- QRKHKVGCUCDAAU-UHFFFAOYSA-N CC(C)c1n[n](C)cc1Nc(nc1)ncc1-c1ccc(CC(Nc2n[o]c(C3(CC3)C(F)(F)F)c2)=O)c(F)c1 Chemical compound CC(C)c1n[n](C)cc1Nc(nc1)ncc1-c1ccc(CC(Nc2n[o]c(C3(CC3)C(F)(F)F)c2)=O)c(F)c1 QRKHKVGCUCDAAU-UHFFFAOYSA-N 0.000 description 1
- HBBAUWZHXDEHBH-UHFFFAOYSA-N CC(Nc1n[n](C)cc1)=O Chemical compound CC(Nc1n[n](C)cc1)=O HBBAUWZHXDEHBH-UHFFFAOYSA-N 0.000 description 1
- IEEQTDOZDRTVQP-UHFFFAOYSA-N CC(Nc1n[n](C)cc1[N+]([O-])=O)=O Chemical compound CC(Nc1n[n](C)cc1[N+]([O-])=O)=O IEEQTDOZDRTVQP-UHFFFAOYSA-N 0.000 description 1
- VFFHLZJSZHWXAJ-VMPITWQZSA-N CCOC(/C=C/N1CCCC1)=O Chemical compound CCOC(/C=C/N1CCCC1)=O VFFHLZJSZHWXAJ-VMPITWQZSA-N 0.000 description 1
- PPQYYHYNKVWIBP-UHFFFAOYSA-N CCOc1n[n](C)c(N)c1 Chemical compound CCOc1n[n](C)c(N)c1 PPQYYHYNKVWIBP-UHFFFAOYSA-N 0.000 description 1
- RNWRXCIKBKTFTK-UHFFFAOYSA-N CCOc1n[n](C)c([N+]([O-])=O)c1 Chemical compound CCOc1n[n](C)c([N+]([O-])=O)c1 RNWRXCIKBKTFTK-UHFFFAOYSA-N 0.000 description 1
- CCRFPEZKVHBGAS-UHFFFAOYSA-N CCc1c(CC(Nc2n[o]c(C3(CC3)C(F)(F)F)c2)=O)ccc(B2OC(C)(C)C(C)(C)O2)c1 Chemical compound CCc1c(CC(Nc2n[o]c(C3(CC3)C(F)(F)F)c2)=O)ccc(B2OC(C)(C)C(C)(C)O2)c1 CCRFPEZKVHBGAS-UHFFFAOYSA-N 0.000 description 1
- PYQZBPHVXUATLZ-UHFFFAOYSA-N C[n](cc1Nc(nc2)ncc2-c2cc(F)c(CC(Nc3n[o]c(C4(CC4)C(F)(F)F)c3)=O)cc2)nc1NC(C=C)=O Chemical compound C[n](cc1Nc(nc2)ncc2-c2cc(F)c(CC(Nc3n[o]c(C4(CC4)C(F)(F)F)c3)=O)cc2)nc1NC(C=C)=O PYQZBPHVXUATLZ-UHFFFAOYSA-N 0.000 description 1
- DUTFYIUFKXNVRJ-UHFFFAOYSA-N C[n](cc1[N+]([O-])=O)nc1S Chemical compound C[n](cc1[N+]([O-])=O)nc1S DUTFYIUFKXNVRJ-UHFFFAOYSA-N 0.000 description 1
- WDOZRISSHPXRGK-UHFFFAOYSA-N C[n](cc1[N+]([O-])=O)nc1SC Chemical compound C[n](cc1[N+]([O-])=O)nc1SC WDOZRISSHPXRGK-UHFFFAOYSA-N 0.000 description 1
- GYHIJNBSDRSGHZ-ONEGZZNKSA-N C[n]1nc(/C=C/OC)c([N+]([O-])=O)c1 Chemical compound C[n]1nc(/C=C/OC)c([N+]([O-])=O)c1 GYHIJNBSDRSGHZ-ONEGZZNKSA-N 0.000 description 1
- KFFXVLMRFHOETM-UHFFFAOYSA-N C[n]1nc(C(F)F)c(N)c1 Chemical compound C[n]1nc(C(F)F)c(N)c1 KFFXVLMRFHOETM-UHFFFAOYSA-N 0.000 description 1
- REQIMODQJFQLSF-UHFFFAOYSA-N C[n]1nc(C(F)F)c(Nc(nc2)ncc2Br)c1 Chemical compound C[n]1nc(C(F)F)c(Nc(nc2)ncc2Br)c1 REQIMODQJFQLSF-UHFFFAOYSA-N 0.000 description 1
- YVMXSLMGSDQURV-UHFFFAOYSA-N C[n]1nc(C(N)=O)c([N+]([O-])=O)c1 Chemical compound C[n]1nc(C(N)=O)c([N+]([O-])=O)c1 YVMXSLMGSDQURV-UHFFFAOYSA-N 0.000 description 1
- OMMBYRSUPXNTEK-UHFFFAOYSA-N C[n]1nc(C(O)=O)c([N+]([O-])=O)c1 Chemical compound C[n]1nc(C(O)=O)c([N+]([O-])=O)c1 OMMBYRSUPXNTEK-UHFFFAOYSA-N 0.000 description 1
- LTDRJEUPCWOBPP-UHFFFAOYSA-N C[n]1nc(C=O)c([N+]([O-])=O)c1 Chemical compound C[n]1nc(C=O)c([N+]([O-])=O)c1 LTDRJEUPCWOBPP-UHFFFAOYSA-N 0.000 description 1
- JZAYDNQLKJMYLK-UHFFFAOYSA-N C[n]1nc(CCO)c(Nc(nc2)ncc2-c2cc(F)c(CC(Nc3n[o]c(C4(CC4)C(F)(F)F)c3)=O)cc2)c1 Chemical compound C[n]1nc(CCO)c(Nc(nc2)ncc2-c2cc(F)c(CC(Nc3n[o]c(C4(CC4)C(F)(F)F)c3)=O)cc2)c1 JZAYDNQLKJMYLK-UHFFFAOYSA-N 0.000 description 1
- XPGIBDJXEVAVTO-UHFFFAOYSA-N Clc(nc1)ncc1Br Chemical compound Clc(nc1)ncc1Br XPGIBDJXEVAVTO-UHFFFAOYSA-N 0.000 description 1
- CTWZYPZCDJKBRS-UHFFFAOYSA-N Fc(nc1)ncc1Br Chemical compound Fc(nc1)ncc1Br CTWZYPZCDJKBRS-UHFFFAOYSA-N 0.000 description 1
- TZEDIKKTUBFPMF-UHFFFAOYSA-N Nc1n[o]c(C2(CC2)C(F)(F)F)c1 Chemical compound Nc1n[o]c(C2(CC2)C(F)(F)F)c1 TZEDIKKTUBFPMF-UHFFFAOYSA-N 0.000 description 1
- BGCOTWHMBOSASD-UHFFFAOYSA-N O=C(Cc(ccc(-c1cnc(Nc2c[n](CCC3)c3n2)nc1)c1)c1F)Nc1n[o]c(C2(CC2)C(F)(F)F)c1 Chemical compound O=C(Cc(ccc(-c1cnc(Nc2c[n](CCC3)c3n2)nc1)c1)c1F)Nc1n[o]c(C2(CC2)C(F)(F)F)c1 BGCOTWHMBOSASD-UHFFFAOYSA-N 0.000 description 1
- TZQODINQTUHDGU-UHFFFAOYSA-N OC(c1c[n](CCC2)c2n1)=O Chemical compound OC(c1c[n](CCC2)c2n1)=O TZQODINQTUHDGU-UHFFFAOYSA-N 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D413/00—Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms
- C07D413/02—Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms containing two hetero rings
- C07D413/12—Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms containing two hetero rings linked by a chain containing hetero atoms as chain links
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/495—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
- A61K31/505—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
- A61K31/506—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim not condensed and containing further heterocyclic rings
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07B—GENERAL METHODS OF ORGANIC CHEMISTRY; APPARATUS THEREFOR
- C07B59/00—Introduction of isotopes of elements into organic compounds ; Labelled organic compounds per se
- C07B59/002—Heterocyclic compounds
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D413/00—Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms
- C07D413/14—Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms containing three or more hetero rings
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D417/00—Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and sulfur atoms as the only ring hetero atoms, not provided for by group C07D415/00
- C07D417/14—Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and sulfur atoms as the only ring hetero atoms, not provided for by group C07D415/00 containing three or more hetero rings
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D471/00—Heterocyclic compounds containing nitrogen atoms as the only ring hetero atoms in the condensed system, at least one ring being a six-membered ring with one nitrogen atom, not provided for by groups C07D451/00 - C07D463/00
- C07D471/02—Heterocyclic compounds containing nitrogen atoms as the only ring hetero atoms in the condensed system, at least one ring being a six-membered ring with one nitrogen atom, not provided for by groups C07D451/00 - C07D463/00 in which the condensed system contains two hetero rings
- C07D471/04—Ortho-condensed systems
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D487/00—Heterocyclic compounds containing nitrogen atoms as the only ring hetero atoms in the condensed system, not provided for by groups C07D451/00 - C07D477/00
- C07D487/02—Heterocyclic compounds containing nitrogen atoms as the only ring hetero atoms in the condensed system, not provided for by groups C07D451/00 - C07D477/00 in which the condensed system contains two hetero rings
- C07D487/04—Ortho-condensed systems
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D498/00—Heterocyclic compounds containing in the condensed system at least one hetero ring having nitrogen and oxygen atoms as the only ring hetero atoms
- C07D498/02—Heterocyclic compounds containing in the condensed system at least one hetero ring having nitrogen and oxygen atoms as the only ring hetero atoms in which the condensed system contains two hetero rings
- C07D498/04—Ortho-condensed systems
Definitions
- the present disclosure relates to protein kinases and compounds which selectively modulate kinases, and uses therefor.
- Particular embodiments contemplate disease indications which are amenable to treatment by modulation of kinase activity by the compounds of the present disclosure.
- FMS-like tyrosine kinase 3 is mutated in about one third of acute myeloid leukemia cases.
- the most frequent FLT3 mutations in acute myeloid leukemia are internal tandem duplication (ITD) mutations in the juxtamembrane domain (23%) and point mutations in the tyrosine kinase domain (10%).
- the most frequent kinase domain mutation is the substitution of aspartic acid at position 838 (equivalent to the human aspartic acid residue at position 835) with a tyrosine (FLT3/D835Y), converting aspartic acid to tyrosine.
- tyrosine kinase domain is one of the most common causes of acquired clinical resistance to small molecule tyrosine kinase inhibitors (TKIs) in human cancer.
- TKIs small molecule tyrosine kinase inhibitors
- Recent pharmaceutical efforts have focused on the development of "type IT' kinase inhibitors, which bind to a relatively non-conserved inactive kinase conformation and exploit an allosteric site adjacent to the ATP -binding pocket as a potential means to increase kinase selectivity.
- Mutations in FLT3 are the common genetic alteration in patients with acute myeloid leukemia (AML) (TCGA, N Engl J Med.
- the type II multikinase inhibitor sorafenib which also has some clinical activity in FLT3-ITD+ AML, is ineffective against all identified quizartinib resistance-causing mutants, in addition to other mutant isoforms (Smith et al).
- the type I inhibitor crenolanib has been identified a type I inhibitor of quizartinib-resistant D835 mutants (Zimmerman et al.
- the present disclosure relates to protein kinases and compounds which selectively modulate kinases, and uses therefor.
- Particular embodiments contemplate disease indications which are amenable to treatment by modulation of kinase activity by the compounds of the present disclosure.
- This disclosure relates to novel compounds, as described in any of the embodiments herein, or a pharmaceutically acceptable salt, a solvate, a tautomer, an isomer or a deuterated analog thereof, wherein these novel compounds can modulate FLT3.
- the compounds described herein further modulate c-Kit, CSF-1R, or both c-Kit and CSF-1R.
- the compounds described herein can further modulate FLT3 having an ITD mutation and optionally an F691L mutation and/or D835Y mutation.
- the compounds of this disclosure are novel in structure and unexpectedly advantageous in function.
- the compounds of this disclosure overcome the deficiencies of past FLT3 inhibitors, including those disclosed in WO 2011/022473.
- the compounds of this disclosure is a selection invention of WO 2011/022473 and have a novel structural motif and a moiety not specifically disclosed in WO 201 1/022473.
- This novel structural motif is a cyclic group, as defined by R 2 herein, attached directly to an amino group that is attached to a heteroaryl moiety on the right hand side of the compounds as described herein.
- the novel compounds of this disclosure exhibit superior and unexpectedly better potency against the mutated forms of the FLT3 tyrosine kinase enzymes, particularly the F691L mutation and/or D835Y mutation when compared to the compounds in WO 2011/022473.
- One aspect of the disclosure relates to a compound having Formula I:
- Ring A is a 5 or 6 membered aryl or heteroaryl ring
- J is O or S
- R 1 is hydrogen or alkyl
- B is a fused 5- or 6-membered saturated or unsaturated ring having 0-3 heteroatoms selected from O, N, or S;
- each Q is independently hydrogen, alkyl, halo, cyano, deuteroalkyl, haloalkyl, cycloalkyl, cycloalkylalkyl, heterocycloalkyl, heterocyclylalkyl,
- alkyl, cycloalkyl, cycloalkylalkyl, heterocycloalkyl or heterocyclylalkyl is each independently optionally substituted with 1 to 3 groups each independently halo, oxo, - 1 ⁇ 4, alkyl, haloalkyl or -R u OR x , provided that when Q is attached to nitrogen, Q is not halo or cyano;
- Q 1 is hydrogen, alkyl, deuteroalkyl, haloalkyl, cycloalkyl, cycloalkylalkyl,
- heterocyclylalkyl -R u OR x , -R u OR v OR x , -R u C(0)R x' , -R u N(R y )(R z ), -R u OC(0)R x' ,
- alkyl, cycloalkyl, cycloalkylalkyl, heterocycloalkyl or heterocyclylalkyl is each independently optionally substituted with 1 to 3 groups each independently halo, oxo, amino, alkyl, haloalkyl or - u OR x ;
- Q 2 is hydrogen, methoxyethoxy, ethoxymethoxy, cyclopropyl, or C 1 -C 2 alkyl optionally subsiuted with 1-3 substituents each independently halo, hydroxyl or methoxy;
- Q 4 is hydrogen, cyclopropyl, or C 1 -C 2 alkyl optionally subsiuted with 1-3 substituents each independently halo, hydroxyl or methoxy;
- R 3 is hydrogen, alkyl or haloalkyl
- R 4 and R 5 are each independently hydrogen, deuterium, halo, alkyl, haloalkyl, hydroxy, alkoxy or amino;
- each R 6 is independently deuterium, halo or alkyl
- each R 7 is independently deuterium, halo, alkyl, haloalkyl, cycloalkyl, cycloalkylalkyl, aryl, aralkyl, heterocycloalkyl, heterocyclylalkyl, heteroaryl, heteroarylalkyl, or -R u OR x , wherein the alkyl, cycloalkyl, heterocycloalkyl, and heterocyclylalkyl moieties are each independently optionally substituted with 1 to 5 groups each independently halo, alkyl, or haloalkyl;
- each R 9 is independently hydrogen, halo, -NH 2 , alkyl, haloalkyl, alkoxy, or cyano; each t is independently 0, 1 or 2;
- each R u is independently alkylene, alkenylene, alkynylene or a direct bond
- each R x is independently hydrogen, alkyl, haloalkyl, alkenyl, alkynyl or cycloalkyl; each R x is independently alkyl, haloalkyl, alkenyl, alkynyl or cycloalkyl;
- each R v is independently alkylene, alkenylene or alkynylene wherein the alkylene, alkenylene or alkynylene are each optionally substituted with one or more deuterium atoms;
- R y and R z are each independently hydrogen or alkyl
- n 1 or 2
- n 0, 1 or 2.
- Another aspect of the disclosure relates to a pharmaceutical composition
- a pharmaceutical composition comprising a compound according to Formula I, or any embodiment and sub-embodiment of Formula I described herein, or a pharmaceutically acceptable salt, a solvate, a tautomer, an isomer or a deuterated analog of any of these compounds, and a pharmaceutically acceptable carrier or excipient.
- Another aspect of the disclosure relates to a pharmaceutical composition
- a pharmaceutical composition comprising a compound according to Formula I, or any embodiment and sub-embodiment of Formula I herein, or a pharmaceutically acceptable salt, a solvate, a tautomer, an isomer or a deuterated analog of any of these compounds, and another therapeutic agent.
- Another aspect of the disclosure relates to a method for treating a subject with a disease or condition mediated by FLT3, CSF1R or c-kit, said method comprising administering to the subject an effective amount of a compound according to Formula I, or any embodiment and sub- embodiment of Formula I described herein, or a pharmaceutically acceptable salt, a solvate, a tautomer, an isomer or a deuterated analog of any of these compounds, wherein the disease or condition is acute myeloid leukemia, stem cell ablation and myelopreparation for stem cell transplant, primary progressive multiple sclerosis, traumatic brain injury, epilepsy, tauopathies, Erdheim-Chester Disease, Langerhans cell histocytosis, hairy cell leukemia, HIV, glioblastoma, scleroderma, anterior or posterior eye disease, lysosomal storage diseases, complex regional pain syndrome, reflex sympathetic dystrophy, muscular dystrophy, duchenne muscular dystrophy, causalgia, neuro-
- leiomyoadenomatoid tumor fibroids, uterine fibroids, leiomyosarcoma, papillary thyroid cancer, anaplastic thyroid cancer, medullary thyroid cancer, follicular thyroid cancer, hurthle cell carcinoma, thyroid cancer, ascites, malignant ascites, mesothelioma, salivary gland tumors, mucoepidermoid carcinoma of the salivary gland, acinic cell carcinoma of the salivary gland, gastrointestinal stromal tumors (GIST), tumors that cause effusions in potential spaces of the body, pleural effusions, pericardial effusions, peritoneal effusions aka ascites, giant cell tumors (GCT), GCT of bone other sarcomas, tumor angiogenesis, paracrine tumor growth or tumors that express aberrantly or otherwise a FLT3 ligand, or activating mutations or translocations of any of the foregoing.
- GIST gastrointestinal stromal tumors
- GCT giant cell tumors
- Another aspect of the disclosure relates to a method for treating a subject with a disease or condition mediated by FLT3, CSF1R or c-kit, said method comprising administering to the subject an effective amount of a compound according to Formula I, or any embodiment and sub- embodiment of Formula I described herein, or a pharmaceutically acceptable salt, a solvate, a tautomer, an isomer or a deuterated analog of any of these compounds, wherein the disease or condition is wherein the disease or condition is alysosomal storage disease selected from the group consisting of mucolipodosis, alpha-mannosidosis; aspartylglucosaminuria; Batten disease; beta-mannosidosis; cystinosis; Danon disease; Fabry disease; Farber disease; fucosidosis;
- galactosialidosis galactosialidosis
- Gaucher disease gangliosidosis
- Krabbe disease metachromatic
- galactosialidosis galactosialidosis
- Gaucher disease gangliosidosis
- Krabbe disease metachromatic
- Mucolipidosis type II (I-Cell disease); Mucolipidosis type III (Pseudo-Hurl er polydystrophy); Mucolipidosis type IV; multiple sulfatase deficiency; Niemann-Pick types A, B, C; Pompe disease (glycogen storage disease); pycnodysostosis; Sandhoff disease; Schindler disease; Salla disease/sialic acid storage disease; Tay-Sachs; and Wolman disease.
- I-Cell disease I-Cell disease
- Mucolipidosis type III Pseudo-Hurl er polydystrophy
- Mucolipidosis type IV multiple sulfatase deficiency
- Niemann-Pick types A, B, C Pompe disease (glycogen storage disease); pycnodysostosis; Sandhoff disease; Schindler disease; Salla disease/sialic acid storage disease; Tay-Sach
- Another aspect of the disclosure relates to a method for treating a subject suffering from a disease or condition as described herein, said method comprising administering to the subject a pharmaceutical composition comprising a compound according to Formula I, or any embodiment and sub -embodiment of Formula I described herein, or a pharmaceutically acceptable salt, a solvate, a tautomer, an isomer or a deuterated analog of any of these compounds, and another therapeutic agent, wherein the other therapeutic agent is selected from: i) an alkylating agent selected from adozelesin, altretamine, bizelesin, busulfan, carboplatin, carboquone, carmustine, chlorambucil, cisplatin, cyclophosphamide, dacarbazine, estramustine, fotemustine, hepsulfam, ifosfamide, improsulfan, irofulven, lomustine, mechlorethamine, melphal
- Another aspect of the disclosure relates to a method of (1) identifying the presence of a tumor in a patient; and (2) treating the patient, identified as needing the treatment, by administering a therapeutically effective amount of a compound according to Formula I, or any embodiment and sub -embodiment of Formula I described herein, or a pharmaceutically acceptable salt, a solvate, a tautomer, an isomer or a deuterated analog of any of these compounds, or any composition thereof as described in the specificiation, wherein the step of identifying the patient includes identifying a patient having an oncogenic Flt3 mutant that is encoded by a Flt3 gene having an ITD mutation and optionally an F691L mutation and/or D835Y mutation.
- Halogen or "halo” refers to all halogens, that is, chloro (CI), fluoro (F), bromo (Br), or iodo (I).
- Hydroxyl or "hydroxy” refers to the group -OH.
- oxo refers to C(O) or -0-.
- Heteroatom is meant to include oxygen (O), nitrogen (N), and sulfur (S).
- alkyl by itself or as part of another substituent, means, unless otherwise stated, a straight or branched chain hydrocarbon, having the number of carbon atoms designated (i.e. Ci-6 means one to six carbons).
- Representative alkyl groups include straight and branched chain alkyl groups having 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 or 12 carbon atoms. Further representative alkyl groups include straight and branched chain alkyl groups having 1, 2, 3, 4, 5, 6, 7 or 8 carbon atoms.
- alkyl groups include methyl, ethyl, n-propyl, isopropyl, n- butyl, t-butyl, isobutyl, sec-butyl, n-pentyl, n-hexyl, n-heptyl, n-octyl, and the like.
- alkyl e.g., alkyl, alkoxy, arylalkyl, cycloalkylalkyl, heterocycloalkylalkyl, heteroarylalkyl, etc.
- the alkyl moiety or portion thereof will have 12 or fewer main chain carbon atoms or 8 or fewer main chain carbon atoms or 6 or fewer main chain carbon atoms.
- Ci_ 6 alkyl refers to a straight or branched hydrocarbon having 1, 2, 3, 4, 5 or 6 carbon atoms and includes, but is not limited to, C 1-2 alkyl, C .4 alkyl, C 2 -6 alkyl, C 2 - alkyl, C -5 alkyl, C 2 -8 alkyl, Ci- 7 alkyl, C 2 - 7 alkyl and C3. 6 alkyl.
- deuteroalkyl refers to a deuterated analog of an alkyl group.
- haloalkyl refers to an alkykl substituted by one to seven halogen atoms. Haloalkyl includes monohaloalkyl or polyhaloalkyl.
- 6haloalkyl is mean to include trifluoromethyl, difluoromethyl, 2,2,2-trifluoroethyl, 4- chlorobutyl, 3 )romopropoyl, and the like. While it is understood that substitutions are attached at any available atom to produce a stable compound, when optionally substituted alkyl is an R group of a moiety such as -OR (e.g. alkoxy), -SR (e.g. thioalkyl), - HR (e.g.
- substitution of the alkyl R group is such that substitution of the alkyl carbon bound to any O, S, or N of the moiety (except where N is a heteroaryl ring atom) excludes substituents that would result in any O, S, or N of the substituent (except where N is a heteroaryl ring atom) being bound to the alkyl carbon bound to any O, S, or N of the moiety.
- alkyl is meant to encompass alkenyl and alkynyl as defined herein.
- alkylene by itself or as part of another substituent means a linear or branched saturated divalent hydrocarbon moiety derived from an alkane having the number of carbon atoms indicated in the prefix.
- Ci_ 6 means one to six carbons; Ci-s alkylene is meant to include methylene, ethylene, propylene, 2-methylpropylene, pentylene, hexylene and the like).
- CL- 4 alkylene includes methylene -CH 2 -, ethylene -CH 2 CH 2 -, propylene -CH 2 CH 2 CH 2 -, and isopropylene -CH(C3 ⁇ 4)CH 2 - , -CH 2 CH(CH 3 )-, -CH 2 -(CH 2 ) 2 CH 2 -, -CH 2 -CH(CH 3 )CH 2 -, -CH 2 -C(CH 3 ) 2 ⁇ CH 2 -CH 2 CH(CH 3 )- .
- an alkyl (or alkylene) group will have from 1 to 24 carbon atoms, with those groups having 10 or fewer, 8 or fewer, or 6 or fewer carbon atoms.
- the alkylene moiety or portion thereof will have 12 or fewer main chain carbon atoms or 8 or fewer main chain carbon atoms, 6 or fewer main chain carbon atoms, or 4 or fewer main chain carbon atoms, or 3 or fewer main chain carbon atoms, or 2 or fewer main chain carbon atoms, or 1 carbon atom.
- alkenyl refers to a linear monovalent hydrocarbon radical or a branched monovalent hydrocarbon radical having the number of carbon atoms indicated in the prefix and containing at least one double bond.
- (C 2 -Ce)alkenyl is meant to include ethenyl, propenyl, and the like.
- alkynyl refers to a monoradical of an unsaturated
- alkynyl groups include ethynyl (-C ⁇ CH), propargyl (or propynyl, i.e -C ⁇ CCH 3 ), and the like.
- alkenyl or alkynyl moiety or portion thereof will have 12 or fewer main chain carbon atoms or 8 or fewer main chain carbon atoms, 6 or fewer main chain carbon atoms or 4 or fewer main chain carbon atoms.
- alkenylene refers to a linear monovalent hydrocarbon radical or a branched monovalent hydrocarbon radical containing at least one double bond and having the number of carbon atoms indicated in the prefix.
- alkynylene refers to a linear monovalent hydrocarbon radical or a branched monovalent hydrocarbon radical containing at least one triple bond and having the number of carbon atoms indicated in the prefix.
- unsaturated alkyl groups include vinyl, 2-propenyl, crotyl, 2-isopentenyl, 2-(butadienyl), 2,4- pentadienyl, 3-(l,4-pentadienyl), ethynyl, 1 - and 3-propynyl, 3-butynyl, and the higher homologs and isomers
- Cycloalkyl or “Carbocycle” by itself or as part of another substituent, refers to saturated or unsaturated, non-aromatic monocyclic, bicyclic or tricyclic carbon ring systems having the number of carbon atoms indicated in the prefix or if unspecified having 3-10, also 3-8, and also 3-6, ring members per ring, such as cyclopropyl, cyclopentyl, cyclohexyl, 1- cyclohexenyl, adamantyl, and the like, where one or two ring carbon atoms may optionally be replaced by a carbonyl.
- Cycloalkyl refers to hydrocarbon rings having the indicated number of ring atoms (e.g., C3-8 cycloalkyl means three to eight ring carbon atoms).
- Cycloalkyl or “carbocycle” may form a bridged ring or a spiro ring.
- the cycloalkyl group may have one or more double or triple bond(s), in which case they would be termed cycloalkenyl and cycloalkynyl respectively.
- cycloalkylcarbonyl refers to a -cycloalkyl-C(O)- group, wherein cycloalkyl is as defined herein.
- alkylcarbonyl refers to -alkyl-C(O)-, wherein alkyl is as defined herein.
- Cycloalkylalkyl refers to an -(alkylene)-cycloalkyl group where alkylene as defined herein has the indicated number of carbon atoms or if unspecified having six or fewer, or four or fewer main chain carbon atoms; and cycloalkyl is as defined herein has the indicated number of carbon atoms or if unspecified having 3-10, also 3-8, and also 3-6, ring members per ring.
- C 3 . 8 cycloalkyl-Ci. 2 alkyl is meant to have 3 to 8 ring carbon atoms and 1 to 2 alkylene chain carbon atoms.
- Exemplary cycloalkylalkyl includes, e.g., cyclopropylmethylene, cyclobutylethylene, cyclobutylmethylene, and the like.
- Cycloalkenyl by itself or as part of another substituent, refers to a non-aromatic monocyclic, bicyclic or tricyclic carbon ring system having the number of carbon atoms indicated in the prefix or if unspecified having 3-10, also 3-8, and also 3-6, ring members per ring, which contains at least one carbon-carbon double bond.
- Exemplary cycloalkenyl includes, e.g., 1-cyclohexenyl, 4-cyclohexenyl, 1 -cyclopentenyl, 2-cyclopentenyl and the like.
- Alkoxy or “alkoxyl” refers to a -O-alkyl group, where alkyl is as defined herein.
- Cycloalkoxy refers to a -O-cycloalkyl group, where cycloalkyl is as defined herein. While it is understood that substitutions on alkoxy are attached at any available atom to produce a stable compound, substitution of alkoxy is such that O, S, or N (except where N is a heteroaryl ring atom), are not bound to the alkyl carbon bound to the alkoxy O. Further, where alkoxy is described as a substituent of another moiety, the alkoxy oxygen is not bound to a carbon atom that is bound to an O, S, or N of the other moiety (except where N is a heteroaryl ring atom), or to an alkene or alkyne carbon of the other moiety.
- hydroxyalkyl refers to an alkyl as defined herein substituted by at least one hydroxyl group as defined herein.
- carboxylalkyl refers to -C(0)-alkyl group, wherein alkyl is as defined herein.
- alkoxycarbonyl refers to a -C(0)-alkoxy group, wherein alkoxy is as defined herein.
- Amino or "amine” denotes the group -NH 2 .
- cyano refers to the group - CN.
- Alkylamino refers to a -NH-alkyl group, where alkyl is as defined herein.
- alkylamino groups include CH 3 H-, ethylamino, and the like.
- Dialkylamino refers to a -N(alkyl)(alkyl) group, where each alkyl is independently as defined herein.
- Exemplary dialkylamino groups include dimethylamino, diethylamino, ethylmethylamino, and the like.
- Cycloalkylamino denotes the group -NR dd R ee , where R dd and R ee combine with the nitrogen to form a 5-7 membered heterocycloalkyl ring, where the heterocycloalkyl may contain an additional heteroatom within the ring, such as O, N, or S, and may also be further substituted with alkyl.
- cycloalkylamino refers to a -NH- cycloalkyl group, where cycloalkyl is as defined herein.
- cycloalkylaminocarbonyl refers to a cycloalkylamino-C(O) group, where cycloalkylamino is as defined herein.
- Aryl by itself or as part of another substituent refers to a monocyclic, bicyclic or polycyclic polyunsaturated aromatic hydrocarbon radical containing 6 to 14 ring carbon atoms, which can be a single ring or multiple rings (up to three rings) which are fused together or linked covalently.
- unsubstituted aryl groups include phenyl, 1-naphthyl and 2-naphthyl.
- arylene refers to a divalent aryl, wherein the aryl is as defined herein.
- Arylalkyl or “aralkyl” refers to -(alkylene)-aryl, where the alkylene group is as defined herein and has the indicated number of carbon atoms, or if unspecified having six or fewer main chain carbon atoms or four or fewer main chain carbon atoms; and aryl is as defined herein.
- arylalkyl include benzyl, phenethyl, 1-methylbenzyl, and the like.
- Heteroaryl by itself or as part of another substituent refers to a monocyclic aromatic ring radical containing 5 or 6 ring atoms, or a bicyclic aromatic radical having 8 to 10 atoms, containing one or more, 1-4, 1-3, or 1-2, heteroatoms independently selected from the group consisting of O, S, and . Heteroaryl is also intended to include oxidized S or , such as sulfinyl, sulfonyl and N-oxide of a tertiary ring nitrogen. A carbon or nitrogen atom is the point of attachment of the heteroaryl ring structure such that a stable compound is produced.
- heteroaryl groups include, but are not limited to, pyridinyl, pyridazinyl, pyrazinyl, indolizinyl, benzo[b]thienyl, quinazolinyl, purinyl, indolyl, quinolinyl, pyrimidinyl, pyrrolyl, pyrazolyl, oxazolyl, thiazolyl, thienyl, isoxazolyl, oxathiadiazolyl, isothiazolyl, tetrazolyl, imidazolyl, triazolyl, furanyl, benzofuryl, indolyl, triazinyl, quinoxalinyl, cinnolinyl, phthalaziniyl, benzotriazinyl, benzimidazolyl, benzopyrazolyl, benzotriazolyl, benzisoxazolyl, isobenzofuryl, isoind
- Heterocycloalkyl refers to a saturated or unsaturated non-aromatic cycloalkyl group that contains from one to five heteroatoms selected from N, O, and S, wherein the nitrogen and sulfur atoms are optionally oxidized, and the nitrogen atom(s) are optionally quaternized, the remaining ring atoms being C, where one or two C atoms may optionally be replaced by a carbonyl.
- the heterocycloalkyl can also be a heterocyclic alkyl ring fused with a cycloalkyl, an aryl or a heteroaryl ring.
- heterocycloalkyl groups include pyrrolidinyl, piperidinyl, imidazolidinyl, benzofuranyl, pyrazolidinyl, morpholinyl, and the like.
- a heterocycloalkyl group can be attached to the remainder of the molecule through a ring carbon or a heteroatom.
- heterocycloalkylene refers to a divalent heterocycloalkyl, wherein the heterocycloalkyl is as defined herein.
- heterocycloalkylsulfonyl refers to a -S(0) 2 -heterocycloalkyl group where heterocycloalkyl is as defined herein.
- Heterocycloalkylalkyl or “heterocyclylalkyl” refers to -(alkylene)-heterocycloalkyl, where the alkylene group is as defined herein and has the indicated number of carbon atoms, or if unspecified having six or fewer main chain carbon atoms or four or fewer main chain carbon atoms; and heterocycloalkyl is as defined herein.
- Protecting group refers to a grouping of atoms that when attached to a reactive group in a molecule masks, reduces or prevents that reactivity. Examples of protecting groups can be found in T.W. Greene and P.G.
- Representative amino protecting groups include formyl, acetyl, trifluoroacetyl, benzyl, benzyloxycarbonyl (CBZ), fert-butoxycarbonyl (Boc), trimethyl silyl (TMS), 2-trimethylsilyl- ethanesulfonyl (SES), trityl and substituted trityl groups, allyloxycarbonyl, 9- fluorenylmethyloxycarbonyl (FMOC), nitro-veratiyloxycarbonyl ( VOC), tri-isopropylsilyl (TIPS), phenylsulphonyl and the like (see also, Boyle, A.
- composition refers to a formulation suitable for administration to an intended animal subject for therapeutic purposes that contains at least one pharmaceutically active compound and at least one pharmaceutically acceptable carrier or excipient.
- pharmaceutically acceptable indicates that the indicated material does not have properties that would cause a reasonably prudent medical practitioner to avoid administration of the material to a patient, taking into consideration the disease or conditions to be treated and the respective route of administration. For example, it is commonly required that such a material be essentially sterile, e.g., for injectables.
- “Pharmaceutically acceptable salt” refers to a salt which is acceptable for
- salts having acceptable mammalian safety for a given dosage regime can be derived from pharmaceutically acceptable inorganic or organic bases and from pharmaceutically-acceptable inorganic or organic acids, depending on the particular substituents found on the compounds described herein.
- base addition salts can be obtained by contacting the neutral form of such compounds with a sufficient amount of the desired base, either neat or in a suitable inert solvent.
- Salts derived from pharmaceutically acceptable inorganic bases include aluminum, ammonium, calcium, copper, ferric, ferrous, lithium, magnesium, manganic, manganous, potassium, sodium, zinc and the like.
- Salts derived from pharmaceutically acceptable organic bases include salts of primary, secondary, tertiary and quaternary amines, including substituted amines, cyclic amines, naturally-occurring amines and the like, such as arginine, betaine, caffeine, choline, N, N'- dibenzylethylenediamine, diethylamine, 2-diethylaminoethanol, 2- dimethylaminoethanol, ethanolamine, ethylenediamine, N-ethylmorpholine, N-ethylpiperidine, glucamine, glucosamine, histidine, hydrabamine, isopropylamine, lysine, methylglucamine, morpholine, piperazine, piperidine, polyamine resins, procaine, purines, theobromine, triethylamine, trimethylamine, tripropylamine, tromethamine, ⁇ , ⁇ '-dibenzylethylenediamine, chloroprocaine
- acid addition salts can be obtained by contacting the neutral form of such compounds with a sufficient amount of the desired acid, either neat or in a suitable inert solvent.
- Salts derived from pharmaceutically acceptable acids include acetic, trifluoroacetic, propionic, ascorbic, benzenesulfonic, benzoic, camphosulfonic, citric, ethanesulfonic, fumaric, glycolic, gluconic, glucoronic, glutamic, hippuric, hydrobromic, hydrochloric, isethionic, lactic, lactobionic, maleic, malic, mandelic, methanesulfonic, mucic, naphthalenesulfonic, nicotinic, nitric, pamoic, pantothenic, phosphoric, succinic, sulfuric, hydroiodic, carbonic, tartaric, p- toluenesulfonic, pyruvic, aspartic,
- salts of amino acids such as arginate and the like, and salts of organic acids like glucuronic or galactunoric acids and the like (see, for example, Berge, S. M. et al, "Pharmaceutical Salts", J. Pharmaceutical Science, 1977, 66: 1-19).
- Certain specific compounds of the present disclosure contain both basic and acidic functionalities that allow the compounds to be converted into either base or acid addition salts.
- the neutral forms of the compounds may be regenerated by contacting the salt with a base or acid and isolating the parent compound in the conventional manner.
- the parent form of the compound differs from the various salt forms in certain physical properties, such as solubility in polar solvents, but otherwise the salts are equivalent to the parent form of the compound for the purposes of the present disclosure.
- the term "therapeutically effective” or “effective amount” indicates that a compound or material or amount of the compound or material when
- administered is sufficient or effective to prevent, alleviate, or ameliorate one or more symptoms of a disease, disorder or medical condition being treated, and/or to prolong the survival of the subject being treated.
- the therapeutically effective amount will vary depending on the compound, the disease, disorder or condition and its severity and the age, weight, etc., of the mammal to be treated. In general, satisfactory results in subjects are indicated to be obtained at a daily dosage of from about 0.1 to about 10 g/kg subject body weight.
- a daily dose ranges from about 0.10 to 10.0 mg/kg of body weight, from about 1.0 to 3.0 mg/kg of body weight, from about 3 to 10 mg/kg of body weight, from about 3 to 150 mg/kg of body weight, from about 3 to 100 mg/kg of body weight, from about 10 to 100 mg/kg of body weight, from about 10 to 150 mg/kg of body weight, or from about 150 to 1000 mg/kg of body weight.
- the dosage can be conveniently administered, e.g., in divided doses up to four times a day or in sustained-release form.
- enzymes can be assayed based on their ability to act upon a detectable substrate.
- a compound can be assayed based on its ability to bind to a particular target molecule or molecules.
- ligand and “modulator” are used equivalently to refer to a compound that changes (/ ' . e., increases or decreases) the activity of a target biomolecule, e.g. , an enzyme such as a kinase.
- a ligand or modulator will be a small molecule, where "small molecule refers to a compound with a molecular weight of 1500 Daltons or less, 1000 Daltons or less, 800 Daltons or less, or 600 Daltons or less.
- an "improved ligand” is one that possesses better pharmacological and/or pharmacokinetic properties than a reference compound, where “better” can be defined by one skilled in the relevant art for a particular biological system or therapeutic use.
- binding compound in connection with the interaction between a target and a potential binding compound indicates that the potential binding compound associates with the target to a statistically significant degree as compared to association with proteins generally ⁇ i.e., nonspecific binding).
- binding compound refers to a compound that has a statistically significant association with a target molecule.
- a binding compound interacts with a specified target with a dissociation constant (K D ) of 1 mM or less, 1 ⁇ or less, 100 nM or less, 10 nM or less, or 1 nM or less.
- the terms “greater affinity” and “selective” indicates that the compound binds more tightly than a reference compound, or than the same compound in a reference condition, i.e., with a lower dissociation constant.
- the greater affinity is at least 2, 3, 4, 5, 8, 10, 50, 100, 200, 400, 500, 1000, or 10,000-fold greater affinity.
- “synthesizing” and like terms means chemical synthesis from one or more precursor materials.
- the term “modulating” or “modulate” or the like refers to an effect of altering a biological activity, especially a biological activity associated with a particular biomolecule such as a protein kinase.
- a biological activity associated with a particular biomolecule such as a protein kinase.
- an agonist or antagonist of a particular biomolecule modulates the activity of that biomolecule, e.g., an enzyme, by either increasing (e.g. agonist, activator), or decreasing (e.g. antagonist, inhibitor) the activity of the biomolecule, such as an enzyme.
- Such activity is typically indicated in terms of an inhibitory concentration (IC 50 ) or excitation concentration (EC 50 ) of the compound for an inhibitor or activator, respectively, with respect to, for example, an enzyme.
- IC 50 inhibitory concentration
- EC 50 excitation concentration
- Prodrugs means any compound which releases an active parent drug according to Formula I in vivo when such prodrug is administered to a mammalian subject.
- Prodrugs of a compound of Formula I are prepared by modifying functional groups present in the compound of Formula I in such a way that the modifications may be cleaved in vivo to release the parent compound.
- Prodrugs may be prepared by modifying functional groups present in the compounds in such a way that the modifications are cleaved, either in routine manipulation or in vivo, to the parent compounds.
- Prodrugs include compounds of Formula I wherein a hydroxy, amino, carboxyl or sulfhydryl group in a compound of Formula I is bonded to any group that may be cleaved in vivo to regenerate the free hydroxyl, amino, or sulfhydryl group, respectively.
- Examples of prodrugs include, but are not limited to esters ⁇ e.g., acetate, formate, and benzoate derivatives), amides, guanidines, carbamates (e.g. , ⁇ , ⁇ -dimethylaminocarbonyl) of hydroxy functional groups in compounds of Formula I, and the like. Preparation, selection, and use of prodrugs is discussed in T. Higuchi and V.
- Tautomer means compounds produced by the phenomenon wherein a proton of one atom of a molecule shifts to another atom. See, Jerry March, Advanced Organic Chemistry: Reactions, Mechanisms and Structures, Fourth Edition, John Wiley & Sons, pages 69-74 (1992). The tautomers also refer to one of two or more structural isomers that exist in equilibrium and are readily converted from one isomeric form to another.
- keto-enol tautomers such as acetone/propen-2-ol, imine-enamine tautomers and the like
- ring-chain tautomers such as glucose/2,3,4,5, 6-pentahydroxy-hexanal and the like
- tautomeric isomerism ('tautomerism') can occur.
- the compounds described herein may have one or more tautomers and therefore include various isomers.
- a person of ordinary skill in the art would recognize that other tautomeric ring atom arrangements are possible. All such isomeric forms of these compounds are expressly included in the present disclosure.
- Isomers mean compounds having identical molecular formulae but differ in the nature or sequence of bonding of their atoms or in the arrangement of their atoms in space. Isomers that differ in the arrangement of their atoms in space are termed "stereoisomers" .
- Steps and “stereoisomers” refer to compounds that exist in different stereoisomeric forms if they possess one or more asymmetric centers or a double bond with asymmetric substitution and, therefore, can be produced as individual stereoisomers or as mixtures.
- Stereoisomers include enantiomers and diastereomers. Stereoisomers that are not mirror images of one another are termed “diastereomers” and those that are non-superimposable mirror images of each other are termed “enantiomers" When a compound has an asymmetric center, for example, it is bonded to four different groups, a pair of enantiomers is possible.
- An enantiomer can be characterized by the absolute configuration of its asymmetric center and is described by the R- and S-sequencing rules of Cahn and Prelog, or by the manner in which the molecule rotates the plane of polarized light and designated as dextrorotatory or levorotatory (i.e., as (+) or (-)-isomers respectively).
- a chiral compound can exist as either individual enantiomer or as a mixture thereof.
- a mixture containing equal proportions of the enantiomers is called a "racemic mixture". Unless otherwise indicated, the description is intended to include individual stereoisomers as well as mixtures.
- Certain compounds of the present disclosure can exist in unsolvated forms as well as solvated forms, including hydrated forms.
- “Hydrate” refers to a complex formed by combination of water molecules with molecules or ions of the solute.
- Solvate refers to a complex formed by combination of solvent molecules with molecules or ions of the solute.
- the solvent can be an organic compound, an inorganic compound, or a mixture of both. Solvate is meant to include hydrate.
- Some examples of solvents include, but are not limited to, methanol, ⁇ , ⁇ -dimethylformamide, tetrahydrofuran, dimethylsulfoxide, and water.
- the solvated forms are equivalent to unsolvated forms and are encompassed within the scope of the present disclosure.
- Certain compounds of the present disclosure may exist in multiple crystalline or amorphous forms. In general, all physical forms are equivalent for the uses contemplated by the present disclosure and are intended to be within the scope of the present disclosure.
- the term "contacting" means that the compound(s) are caused to be in sufficient proximity to a particular molecule, complex, cell, tissue, organism, or other specified material that potential binding interactions and/or chemical reaction between the compound and other specified material can occur.
- the term "subject” refers to a living organism that is treated with compounds as described herein, including, but not limited to, any mammal, such as a human, other primates, sports animals, animals of commercial interest such as cattle, farm animals such as horses, or pets such as dogs and cats.
- administering refers to oral administration, administration as a suppository, topical contact, intravenous, intraperitoneal, intramuscular, intralesional, intranasal or subcutaneous administration, or the implantation of a slow-release device e.g., a mini-osmotic pump, to a subject.
- Administration is by any route, including parenteral and transmucosal (e.g., buccal, sublingual, palatal, gingival, nasal, vaginal, rectal, or transdermal).
- Parenteral administration includes, e.g., intravenous, intramuscular, intra-arteriole, intradermal, subcutaneous, intraperitoneal, intraventricular, and intracranial.
- Solid form refers to a solid preparation (i.e. a preparation that is neither gas nor liquid) of a pharmaceutically active compound that is suitable for administration to an intended animal subject for therapeutic purposes.
- the solid form includes any complex, such as a salt, co-crystal or an amorphous complex, as well as any polymorph of the compound.
- the solid form may be substantially crystalline, semi-crystalline or substantially amorphous.
- the solid form may be administered directly or used in the preparation of a suitable composition having improved pharmaceutical properties.
- the solid form may be used in a formulation comprising at least one pharmaceutically acceptable carrier or excipient.
- prevent refers to a method of partially or completely delaying or precluding the onset or recurrence of a disease, disorder or condition and/or one or more of its attendant symptoms or barring a subject from acquiring or reacquiring a disorder or condition or reducing a subject's risk of acquiring or requiring a disorder or condition or one or more of its attendant symptoms.
- Unit dosage form refers to a composition intended for a single administration to treat a subject suffering from a disease or medical condition.
- Each unit dosage form typically comprises each of the active ingredients of this disclosure plus pharmaceutically acceptable excipients.
- Examples of unit dosage forms are individual tablets, individual capsules, bulk powders, liquid solutions, ointments, creams, eye drops, suppositories, emulsions or suspensions.
- Treatment of the disease or condition may require periodic administration of unit dosage forms, for example: one unit dosage form two or more times a day, one with each meal, one every four hours or other interval, or only one per day.
- oral unit dosage form indicates a unit dosage form designed to be taken orally.
- the compounds of the present disclosure may also contain unnatural proportions of atomic isotopes at one or more of the atoms that constitute such compounds.
- the compounds may be radiolabeled with radioactive isotopes, such as for example tritium ( 3 H), iodine-125 ( 12 I), carbon-14 ( 14 C), carbon-11 ( U C) or fluorine-18 ( 18 F). All isotopic variations of the compounds of the present disclosure, whether radioactive or not, are intended to be encompassed within the scope of the present disclosure.
- isolated indicates that the sequence is separated from at least a portion of the amino acid and/or nucleic acid sequences with which it would normally be associated.
- the term "purified" indicates that the subject molecule constitutes a significantly greater proportion of the biomolecules in a composition than the proportion observed in a prior composition, e.g., in a cell culture.
- the greater proportion can be 2-fold, 5-fold, 10-fold, or more than 10-fold, with respect to the proportion found in the prior composition.
- deuterated as used herein alone or as part of a group, means substituted deuterium atoms.
- deuterated analog as used herein alone or as part of a group, means substituted deuterium atoms in place of hydrogen.
- the deuterated analog of the disclosure may be a fully or partially deuterium substituted derivative. In some embodiments, the deuterium substituted derivative of the disclosure holds a fully or partially deuterium substituted alkyl, aryl or heteroaryl group.
- the disclosure also embraces isotopically-labeled compounds of the present disclosure which are identical to those recited herein, but for the fact that one or more atoms are replaced by an atom having an atomic mass or mass number different from the atomic mass or mass number usually found in nature.
- isotopes that can be incorporated into compounds of the disclosure include isotopes of hydrogen, carbon, nitrogen, oxygen, phosphorous, fluorine, and chlorine, such as, but not limited to 2 H (deuterium, D), 3 H (tritium), n C, 1 C, L4 C, 15 N, L8 F, 31 P, 32 P, 35 S, 36 C1, and 125 I.
- H hydrogen at its natural abundance isotopic composition or its isotopes, such as deuterium (D) or tritium ( 3 H).
- isotopically-labeled compounds of the present disclosure e.g., those labeled with 3 H and 14 C
- Tritiated (i.e., H) and carbon-14 (i.e., 14 C) and fluorine-18 ( L8 F) isotopes are useful for their ease of preparation and detectability.
- substitution with heavier isotopes such as deuterium (i.e., 2 H) may afford certain therapeutic advantages resulting from greater metabolic stability (e.g., increased in vivo half-life or reduced dosage requirements) and hence may be preferred in some circumstances.
- Isotopically labeled compounds of the present disclosure can generally be prepared by following procedures analogous to those described in the Schemes and in the Examples herein below, by substituting an isotopically labeled reagent for a non-isotopically labeled reagent.
- Embodiment 1 of this disclosure relates to a compound of Formula I:
- Ring A is a 5 or 6 membered aryl or heteroaryl ring
- J is O or S
- R 1 is hydrogen or alkyl
- B is a fused 5- or 6-membered saturated or unsaturated ring having 0-3 heteroatoms selected from O, N, or S;
- each Q is independently hydrogen, alkyl, halo, cyano, deuteroalkyl, haloalkyl, cycloalkyl, cycloalkylalkyl, heterocycloalkyl, heterocyclylalkyl,
- alkyl, cycloalkyl, cycloalkylalkyl, heterocycloalkyl or heterocyclylalkyl is each independently optionally substituted with 1 to 3 groups each independently halo, oxo, -M3 ⁇ 4, alkyl, haloalkyl or -R u OR x , provided that when Q is attached to nitrogen, Q is not halo or cyano ;
- Q 1 is hydrogen, alkyl, deuteroalkyl, haloalkyl, cycloalkyl, cycloalkylalkyl,
- heterocyclylalkyl -R u OR x' , -R u OR v OR x , -R u C(0)R x' , -R u N(R y )(R z ), -R u OC(0)R x' ,
- alkyl, cycloalkyl, cycloalkylalkyl, heterocycloalkyl or heterocyclylalkyl is each independently optionally substituted with 1 to 3 groups each independently halo, oxo, amino, alkyl, haloalkyl or -R u OR x ;
- Q 2 is hydrogen, methoxyethoxy, ethoxymethoxy, cyclopropyl, or C 1 -C 2 alkyl optionally subsiuted with 1-3 substituents each independently halo, hydroxyl or methoxy;
- Q 4 is hydrogen, cyclopropyl, or C 1 -C 2 alkyl optionally subsiuted with 1-3 substituents each independently halo, hydroxyl or methoxy;
- R 3 is hydrogen, alkyl or haloalkyl
- R 4 and R 5 are each independently hydrogen, deuterium, halo, alkyl, haloalkyl, hydroxy, alkoxy or amino;
- each R 6 is independently deuterium, halo or alkyl
- each R 7 is independently deuterium, halo, alkyl, haloalkyl, cycloalkyl, cycloalkylalkyl, aryl, aralkyl, heterocycloalkyl, heterocyclylalkyl, heteroaryl, heteroarylalkyl, or -R u OR x , wherein the alkyl, cycloalkyl, heterocycloalkyl, and heterocyclylalkyl moieties are each independently optionally substituted with 1 to 5 groups each independently halo, alkyl, or haloalkyl;
- each R 9 is independently hydrogen, halo, -NH 2 , alkyl, haloalkyl, alkoxy, or cyano;
- each t is independently 0, 1 or 2;
- each R u is independently alkylene, alkenylene, alkynylene or a direct bond
- each R x is independently hydrogen, alkyl, haloalkyl, alkenyl, alkynyl or cycloalkyl
- each R x is independently alkyl, haloalkyl, alkenyl, alkynyl or cycloalkyl
- each R v is independently alkylene, alkenylene or alkynylene wherein the alkylene, alkenylene or alkynylene are each optionally substituted with one or more deuterium atoms;
- R y and R z are each independently hydrogen or alkyl
- a 0, 1 , 2, or3 ;
- n 1 or 2
- n 0, 1 or 2.
- Embodiment 1(a) of this disclosure relates to a compound of Formula 1(a): R 2
- Ring A is a 5 or 6 membered aryl or heteroaryl ring
- J is O or S
- X is S
- R 1 is hydrogen or alkyl
- B is a fused 5- or 6-membered saturated or unsaturated ring having 0-3 heteroatoms selected from O, N, or S;
- Q is hydrogen, alkyl, halo, cyano, deuteroalkyl, haloalkyl, cycloalkyl, cycloalkylalkyl, heterocycloalkyl, heterocyclylalkyl,
- alkyl, cycloalkyl, cycloalkylalkyl, heterocycloalkyl or heterocyclylalkyl is each independently optionally substituted with 1 to 3 groups each independently halo, oxo, amino, alkyl, haloalkyl or -R u OR x' ,
- Q 1 is hydrogen, alkyl, halo, cyano, oxo, alkyl, deuteroalkyl, haloalkyl, cycloalkyl, cycloalkylalkyl, heterocycloalkyl,
- heterocyclylalkyl -R ⁇ )R X' , -R ⁇ )R v OR x , -R tt C(0)R x' , -R u N(R y )(R z ), -R u OC(0)R x' ,
- alkyl, cycloalkyl, cycloalkylalkyl, heterocycloalkyl or heterocyclylalkyl is each independently optionally substituted with 1 to 3 groups each independently halo, oxo, amino, alkyl, haloalkyl or -R u OR x ;
- Q 2 is hydrogen, methoxyethoxy, ethoxymethoxy, cyclopropyl, or C 1 -C 2 alkyl optionally subsiuted with 1-3 substituents each independently halo, hydroxyl or methoxy;
- Q 4 is hydrogen, cyclopropyl, or C 1 -C 2 alkyl optionally subsiuted with 1-3 substituents each independently halo, hydroxyl or methoxy;
- R 3 is hydrogen, alkyl or haloalkyl
- R 4 and R 5 are each independently hydrogen, deuterium, halo, alkyl, haloalkyl, hydroxy, alkoxy or amino;
- each R 6 is independently deuterium, halo or alkyl
- each R 7 is independently deuterium, halo, alkyl, haloalkyl, cycloalkyl, cycloalkylalkyl, aryl, aralkyl, heterocycloalkyl, heterocycloalkylalkyl, heteroaryl, heteroarylalkyl, or -R'tJR 5 ', wherein the alkyl, cycloalkyl and heterocycloalkyl moieties are each independently optionally substituted with 1 to 5 groups each independently halo, alkyl, or haloalkyl;
- each R 9 is independently hydrogen, halo, amino, alkyl, haloalkyl or alkoxy;
- each t is independently 0, 1 or 2;
- each R u is independently alkylene, alkenylene, alkynylene or a direct bond
- each R x is independently hydrogen, alkyl, haloalkyl, alkenyl, alkynyl or cycloalkyl; each R x is independently alkyl, haloalkyl, alkenyl, alkynyl or cycloalkyl;
- each R v is independently alkylene, alkenylene or alkynylene wherein the alkylene, alkenylene or alkynylene are each optionally substituted with one or more deuterium atoms;
- R y and R z are each independently hydrogen or alkyl
- a is an integer from 0 to 3;
- n 1 or 2
- n 1 or 2.
- Embodiment 1(b) of this disclosure relates to Embodiment 1 or 1(a) wherein J is O.
- Embodiment 1(e) of this disclosure relates to Embodiment 1, 1(a), or 1(b) wherein X is [0073]
- Embodiment 1(f) of this disclosure relates to Embodiment 1, 1(a), or 1(b) wherein X is
- Embodiment 2 of this disclosure relates to Formula I in embodiment 1 having Formula 11(a) or 11(b):
- ring A is phenyl or isoxazolyl
- Y is N or CR 9 ;
- R 1 is hydrogen
- R 3 is hydrogen or alkyl
- R 4 and R 5 are each independently hydrogen or deuterium
- each R 6 is independently deuterium, halo or alkyl
- each R 7 is independently alkyl, haloalkyl, cycloalkyl, heterocycloalkyl, cycloalkylalkyl, or heterocyclylalkyl, wherein the alkyl, haloalkyl, cycloalkyl, heterocycloalkyl, cycloalkylalkyl, or heterocyclylalkyl are each independently optionally substituted with 1 to 3 groups each independently halo, alkyl or haloalkyl;
- R 10 is hydrogen, halo, -NH 2 , alkyl, haloalkyl or alkoxy;
- n 1 or 2;
- n 0, 1 or 2.
- Embodiment 3 of this disclosure relates to Formulae I in embodiment 1 and Formulae 11(a) or 11(b) in embodiment 2, wherein:
- R 1 is hydrogen
- R 3 is hydrogen
- R 4 and R 5 are each hydrogen or deuterium
- R 6 is deuterium, halo or alkyl
- R 7 is alkyl, haloalkyl, cycloalkyl, heterocycloalkyl, where the alkyl, cycloalkyl and heterocycloalkyl are each independently optionally substituted with 1 to 3 groups each independently halo, alkyl and haloalkyl;
- R 9 or R 10 is hydrogen;
- n 0 or 1.
- Embodiment 4 relates to embodiments of Formulae 1, 1(a), 11(a) or 11(b), R 6 is fluoro; and n is 1.
- Embodiment 5 of this disclosure relates to embodiments 1-4, wherein: Ring A is phen l or isoxazolyl; and J is O.
- R x is as defined in any of the embodiments described herein.
- Embodiment 7 of this disclosure relates to a compound of Formula III
- Y is N or CH
- R 7 is alkyl, haloalkyl or cyclopropyl, where the alkyl, haloalkyl or cyclopropyl are each independently optionally substituted with 1 to 3 groups each independently halo, alkyl or haloalkyl; and
- R 1 and R 2 are as defined in any one of embodiments 1-6.
- Embodiment 7(a) of this disclosure relates to embodiment 7 wherein R 1 and R 2 are as defined in embodiment 6.
- Embodiment 7(b) of this disclosure relates to embodiment 7 wherein R 2 is as defined in embodiment 6.
- Embodiment 8 of this disclosure relates to embodiments 7, 7(a) or 7(b) having Formula IV or V:
- Embodiment 9 of this disclosure relates to any one of embodiments 1-8, wherein R 7 is
- Embodiment 10 of this disclosure relates to any one of embodiments 1-9, wherein R
- Embodiment 11 of this disclosure relates to any one of embodiments 1-10, wherein R 2 is:
- Embodiment 12(a) of this disclosure relates to any one of embodiments 1-10, wherein
- R 2 is:
- Embodiment 12(b) of this disclosure relates to any one of embodiments 1-10, wherein R 2 is:
- Embodiment 12(b)(i) of this disclosure relates to embodiment 12(b), wherein:
- each Q is independently hydrogen, C1-C3 alkyl, C1-C3 haloalkyl, or C1-C3 deuteroalkyl;
- Q 3 is hydrogen or C1-C2 alkyl optionally substituted with 1-3 halo.
- Embodiment 12(c) of this disclosure relates to any one of embodiments 1-10, wherein R 2 is:
- Embodiment 12(c)(i) of this disclosure relates to embodiment 12(c), wherein:
- each Q is independently hydrogen, C1-C3 alkyl, C1-C3 haloalkyl, or C1-C3 deuteroalkyl;
- Q 3 is hydrogen or C1-C2 alkyl optionally substituted with 1 -3 halo.
- Embodiment 12(d) of this disclosure relates to any one of embodiments 1 - 10, wherein
- Embodiment 12(d)(i) of this disclosure relates to embodiment 12(d), wherein:
- Q is hydrogen, C1-C3 alkyl, C1-C3 haloalkyl, or C1-C3 deuteroalkyl;
- Q 3 is hydrogen or C1-C2 alkyl optionally substituted with 1 -3 halo
- Q 4 is hydrogen or C1-C2 alkyl optionally substituted with 1 -3 halo.
- Embodiment 12(e) of this disclosure relates to any one of embodiments 1 -10, wherein
- Embodiment 12(e)(i) of this disclosure relates to embodiment 12(e), wherein:
- Q is hydrogen, C1-C3 alkyl, C1-C3 haloalkyl, or C1-C3 deuteroalkyl;
- Q 1 is hydrogen, C1-C3 alkyl, C1-C3 haloalkyl, or C1-C3 deuteroalkyl
- Q 3 is hydrogen or Ci-C 2 alkyl optionally substituted with 1 -3 halo.
- Embodiment 12(f) of this disclosure relates to any one of embodiments 1- 10, wherein
- R 2 is:
- Embodiment 12(f)(i) of this disclosure relates to embodiment 12(f), wherein: Q is hydrogen or C 1 -C 2 alkyl optionally substituted with 1-3 halo; and Q 4 is hydrogen or C 1 -C 2 alkyl optionally substituted with 1-3 halo.
- Embodiment 12(g) of this disclosure relates to any one of embodiments 1-10, wherein
- Embodiment 12(g)(i) of this disclosure relates to embodiment 12(g), wherein:
- Q 1 is hydrogen, C 1 -C3 alkyl, C 1 -C3 haloalkyl, or C 1 -C3 deuteroalkyl
- each Q 3 is independently hydrogen or C 1 -C 2 alkyl optionally substituted with 1-3 halo.
- Embodiment 13 of this disclosure relates to any one of embodiments 1-10 or 12(a)- 12(g)(i), wherein
- each Q is independently hydrogen, C 1 -C3 alkyl, C 1 -C3 haloalkyl, C 1 -C3 deuteroalkyl, C3-6 cycloalkyl, or a 4-6 membered heterocycloalkyl, wherein the C 1 -C3 alkyl, C 1 -C3 haloalkyl, Ci- C 3 deuteroalkyl, C 3 . 6 cycloalkyl, or 4-6 membered heterocycloalkyl are each independently optionally substituted with 1 to 3 groups each independently halo or -OH;
- Q 1 is hydrogen, C1-C3 alkyl, C1-C3 haloalkyl, C1-C3 deuteroalkyl, C3.6 cycloalkyl, or a 4- 6 membered heterocycloalkyl, wherein the C3 alkyl, C 1 -C3 haloalkyl, C 1 -C3 deuteroalkyl, C3- 6 cycloalkyl, or 4-6 membered heterocycloalkyl are each independently optionally substituted with 1 to 3 groups each independently halo or -OH;
- Q 4 is hydrogen or C 1 -C 2 alkyl optionally substituted with 1-3 substituents each independently halo, hydroxyl or methoxy.
- Embodiment 14 of this disclosure relates to any one of embodiments 1-10, wherein R 2 is:
- Embodiment 15 of this disclosure relates to one of compounds P-001 - P-255 of this disclosure, or a pharmaceutically acceptable salt, a solvate, a tautomer, an isomer or a deuterated analog of one of compounds P-001 - P-255.
- Embodiment 16 of this disclosure relates to a pharmaceutical composition
- a pharmaceutical composition comprising a compound of any of embodiments 1-15 and a pharmaceutically acceptable carrier.
- Embodiment 17 of this disclosure relates to a pharmaceutical composition of embodiment 16 further comprising a second pharmaceutical agent selected from the group consisting of an anti-proliferative agent, an anti-inflammatory agent, an immunomodulatory agent and an immunosuppressive agent.
- a second pharmaceutical agent selected from the group consisting of an anti-proliferative agent, an anti-inflammatory agent, an immunomodulatory agent and an immunosuppressive agent.
- Embodiment 18 of this disclosure relates to a pharmaceutical composition of embodiment 17, wherein the second pharmaceutical agent is i) an alkylating agent selected from adozelesin, altretamine, bizelesin, busulfan, carboplatin, carboquone, carmustine, chlorambucil, cisplatin, cyclophosphamide, dacarbazine, estramustine, fotemustine, hepsulfam, ifosfamide, improsulfan, irofulven, lomustine, mechlorethamine, melphalan, oxaliplatin, piposulfan, semustine, streptozocin, temozolomide, thiotepa, and treosulfan; ii) an antibiotic selected from bleomycin, dactinomycin, daunorubicin, doxorubicin, epirubicin, idarubicin, menogaril, mit
- diethylstilbestrol exemestane, flutamide, fulvestrant, goserelin, idoxifene, letrozole, leuprolide, magestrol, raloxifene, tamoxifen, and toremifene;
- a taxane selected from DJ-927, docetaxel, TPI 287, paclitaxel and DHA-paclitaxel;
- a retinoid selected from alitretinoin, bexarotene, fenretinide, isotretinoin, and tretinoin;
- an alkaloid selected from etoposide
- Embodiment 18(a) of this disclosure relates to a pharmaceutical composition of embodiment 17, wherein the second pharmaceutical agent is i) an alkylating agent selected from adozelesin, altretamine, bizelesin, busulfan, carboplatin, carboquone, carmustine, chlorambucil, cisplatin, cyclophosphamide, dacarbazine, estramustine, fotemustine, hepsulfam, ifosfamide, improsulfan, irofulven, lomustine, mechlorethamine, melphalan, oxaliplatin, piposulfan, semustine, streptozocin, temozolomide, thiotepa, and treosulfan; ii) an antibiotic selected from bleomycin, dactinomycin, daunorubicin, doxorubicin, epirubicin, idarubicin, menogar
- chemotherapeutic agent selected from 3-AP (3-amino-2-carboxyaldehyde thiosemicarbazone), altrasentan, aminoglutethimide, anagrelide, asparaginase, bryostatin-1, cilengitide, elesclomol, eribulin mesylate (E7389), ixabepilone, lonidamine, masoprocol, mitoguanazone, oblimersen, sulindac, testolactone, tiazofurin, mTOR inhibitors (e.g. sirolimus, temsirolimus, everolimus, deforolimus), PI3K inhibitors (e.g.
- Cdk4 inhibitors e.g. PD-332991
- Hsp90 inhibitors e.g. geldanamycin, radicicol, tanespimycin
- farnesyltransferase inhibitors e.g. tipifarnib
- Aromatase inhibitors anastrozole letrozole exemestan
- Embodiment 19 of this disclosure relates to a method for treatment of a disease modulated by FLT3, CSF1R, or c-kitgro wherein the disease is an inflammatory disease, an inflammatory condition, an autoimmune disease or cancer, said method comprising administering to a subject suffering from the disease a therapeutically effective amount of a compound of any of embodiments 1-15, or a pharmaceutical composition of any of embodiments 16-18.
- Embodiment 19(a) of this disclosure relates to a method for treatment of a disease modulated by a FLT3 protein kinase, wherein the disease is an inflammatory disease, an inflammatory condition, an autoimmune disease or cancer, said method comprising administering to a subject suffering from the disease a therapeutically effective amount of a compound of any of embodiments 1-15, or a pharmaceutical composition of any of embodiments 16-18.
- Embodiment 20 of this disclosure relates to a method for treating a subj ect with a disease or condition mediated by FLT3, CSF1R, or c-kit, said method comprising administering to the subject an effective amount of a compound according to any of embodiments 1-15, or a pharmaceutically acceptable salt, deuterated analog, a tautomer or an isomer thereof, or a pharmaceutical composition according to any of embodiments 16-18, wherein the disease or condition is acute myeloid leukemia, stem cell ablation and myelopreparation for stem cell transplant, primary progressive multiple sclerosis, traumatic brain injury, epilepsy, tauopathies, Erdheim-Chester Disease, Langerhans cell histocytosis, hairy cell leukemia, HIV, glioblastoma, scleroderma, anterior or posterior eye disease, lysosomal storage diseases, complex regional pain syndrome, reflex sympathetic dystrophy, muscular dystrophy, duchenne muscular dystrophy, causalgia, neurode, or
- leiomyoadenomatoid tumor fibroids, uterine fibroids, leiomyosarcoma, papillary thyroid cancer, anaplastic thyroid cancer, medullary thyroid cancer, follicular thyroid cancer, hurthle cell carcinoma, thyroid cancer, ascites, malignant ascites, mesothelioma, salivary gland tumors, mucoepidermoid carcinoma of the salivary gland, acinic cell carcinoma of the salivary gland, gastrointestinal stromal tumors (GIST), tumors that cause effusions in potential spaces of the body, pleural effusions, pericardial effusions, peritoneal effusions aka ascites, giant cell tumors (GCT), GCT of bone other sarcomas, tumor angiogenesis, paracrine tumor growth or tumors that express aberrantly or otherwise a FLT3 ligand, or activating mutations or translocations of any of the foregoing.
- GIST gastrointestinal stromal tumors
- GCT giant cell tumors
- Embodiment 20(a) of this disclosure relates to a method for treating a subject with a disease or condition mediated by a FLT3 protein kinase, said method comprising administering to the subject an effective amount of a compound according to any of embodiments 1-15, or a pharmaceutically acceptable salt, deuterated analog, a tautomer or an isomer thereof, or a pharmaceutical composition according to any of embodiments 16-18, wherein the disease or condition is acute myeloid leukemia, stem cell ablation and myelopreparation for stem cell transplant, primary progressive multiple sclerosis, complex regional pain syndrome, reflex sympathetic dystrophy, muscular dystrophy, duchenne muscular dystrophy, causalgia, neuro- inflammation, neuroinflammatory disorders, benign forgetfulness, HIV, binswager type dementia, dementia with lewy bodie, prosencephaly, microencepahy, cerebral palsy, congenital hydrocephalus, abdominal dropsy, progressive supranuclear palsy, glaucoma, addiction disorders
- Embodiment 21 of this disclosure relates to a method for treating a subj ect with a disease or condition mediated by FLT3, CSF1R, or c-kit, said method comprising administering to the subject an effective amount of a compound according to any of embodiments 1-15, or a pharmaceutically acceptable salt, deuterated analog, a tautomer or an isomer thereof, or a pharmaceutical composition according to any of embodiments 16-18, wherein the disease or condition is a lysosomal storage disease selected from the group consisting of mucolipodosis, alpha-mannosidosis; aspartylglucosaminuria; Batten disease; beta-mannosidosis; cystinosis; Danon disease; Fabry disease; Farber disease; fucosidosis; galactosialidosis; Gaucher disease; gangliosidosis; Krabbe disease; metachromatic leukodystrophy; mucopolysaccharidoses disorders; aspartylglucosa
- gangliosidosis gangliosidosis
- Krabbe disease metachromatic leukodystrophy
- mucopolysaccharidoses disorders mucolipidosis type I (Sialidosis); Mucolipidosis type II (I-Cell disease);
- Mucolipidosis type III Pseudo-Hurler polydystrophy
- Mucolipidosis type IV multiple sulfatase deficiency
- emann-Pick types A, B, C Pompe disease (glycogen storage disease); pycnodysostosis; Sandhoff disease; Schindler disease; Salla disease/sialic acid storage disease; Tay-Sachs; and Wolman disease.
- Embodiment 22 of this disclosure relates to a method according to any of
- FLT3 kinase is a mutated form comprising a FLT3 internal tandem duplication (ITD) mutation.
- Embodiment 23 of this disclosure relates to a method according embodiment 22, wherein mutated FLT3 kinase futher comprises a D835Y mutation, a F691L mutation, or both D835Y and F691L mutations.
- this embodiment includes embodiments where the selection can be from all listed groups in the paritucular embodiment as well as all possible subgroups of of this embodiment.
- Another embodiment of this disclosure relates to one or more compounds P-001 to P- 255, or a pharmaceutically acceptable salt, a solvate, a tautomer, an isomer or a deuterated analog thereof.
- the present disclosure relates to compounds of Formula I, all embodiments and sub-embodiments thereof including any one or more of compounds P-001-P- 255, and any other compounds as described herein, that are useful as inhibitors of an oncogenic Flt3 or a Flt3 mutant, and the use of the compounds in treating a subject suffering from diseases that are mediated by a mutated Flt3 kinase.
- FLT3 kinase is a tyrosine kinase receptor involved in the regulation and stimulation of cellular proliferation. See e.g., Gilliland et al, Blood 100: 1532-42 (2002).
- the FLT3 kinase is a member of the class III receptor tyrosine kinase (RTKIII) receptor family and belongs to the same subfamily of tyrosine kinases as c-kit, c-fms, and the platelet-derived growth factor a and ⁇ receptors.
- RTKIII receptor tyrosine kinase
- the FLT3 kinase has five immunoglobulin-like domains in its extracellular region as well as an insert region of 75-100 amino acids in the middle of its cytoplasmic domain. FLT3 kinase is activated upon the binding of the FLT3 ligand, which causes receptor dimerization. Dimerization of the FLT3 kinase by FLT3 ligand activates the intracellular kinase activity as well as a cascade of downstream substrates including Stat5, Ras, phosphatidylinositol-3 -kinase (PI3K), PLCy , Erk2, Akt, MAPK, SHC, SHP2, and SHIP.
- PI3K phosphatidylinositol-3 -kinase
- FLT3 kinase In normal cells, immature hematopoietic cells, typically CD34+ cells, placenta, gonads, and brain express FLT3 kinase. See, e.g., Rosnet, et al., Blood 82: 1110-19 (1993); Small et al., Proc. Natl. Acad. Sci. U.S.A. 91 : 459-63 (1994); and Rosnet et al., Leukemia 10: 238-48 (1996). However, efficient stimulation of proliferation via FLT3 kinase typically requires other hematopoietic growth factors or interleukins. FLT3 kinase also plays a critical role in immune function through its regulation of dendritic cell proliferation and differentiation See e.g., McKenna et al., Blood 95: 3489-97 (2000).
- FLT3 kinase Numerous hematologic malignancies express FLT3 kinase, the most prominent of which is AML. See e.g., Yokota et al., Leukemia 11 : 1605-09 (1997).
- FLT3 expressing malignancies include B-precursor cell acute lymphoblastic leukemias, myelodysplastic leukemias, T-cell acute lymphoblastic leukemias, and chronic myelogenous leukemias. See e.g., Rasko et al., Leukemia 9: 2058-66 (1995).
- FLT3 kinase mutations associated with hematologic malignancies are activating mutations.
- the FLT3 kinase is constitutively activated without the need for binding and dimerization by FLT3 ligand, and therefore stimulates the cell to grow
- the oncogenic Flt3 or Flt3 mutant is encoded by a Flt3 gene with an internal tandem duplication (ITD) mutation in the juxtamembrane as described in U.S. Patent No. 6,846,630, which is herein incorporated by reference.
- the oncogenic Flt3 or Flt3 mutant encoded by flt3 with ITD mutations has one or more mutations at residues F691, D835, Y842 or combinations thereof.
- the oncogenic Flt3 or Flt3 mutant has one or more mutations selected from F691L, D835V/Y, Y842C H or combinations thereof.
- the subject has a Flt3 gene mutation encoding an Flt3 mutant having an amino acid substitution at residues F691, D835, Y842 or combinations thereof.
- the amino acid substitution is selected from F691L, D835V/Y, Y842C/H or combinations thereof.
- the disclosure provides a method of inhibiting an oncogenic Flt3 or a mutant Flt3.
- the method includes contacting the Flt3 kinase with a compound as described herein.
- the oncogenic Flt3 or Flt3 mutant is encoded by a Flt3 gene having an ITD mutation.
- the oncogenic Flt3 or Flt3 mutant encoded by an Flt3 gene with an ITD mutation has one or more mutations at residues F691, D835, Y842 or combinations thereof.
- the oncogenic Flt3 or Flt3 mutant has one or more mutations are selected from F691L, D835V/Y, Y842C/H or combinations thereof.
- the oncogenic Flt3 mutant is encoded by a Flt3 gene having an ITD mutation. In another embodiment, the oncogenic Flt3 mutant is encoded by a Flt3 gene having an ITD mutation and a F691L mutation. In another embodiment, the oncogenic Flt3 mutant is encoded by a Flt3 gene having an ITD mutation and a D835Y mutation. In another
- the oncogenic Flt3 mutant is encoded by a Flt3 gene having an ITD mutation, a F691L mutation, and a D835Y mutation.
- Hematologic cancers also known as hematologic or hematopoietic malignancies, are cancers of the blood or bone marrow; including leukemia and lymphoma.
- Acute myelogenous leukemia (AML) is a clonal hematopoietic stem cell leukemia that represents about 90% of all acute leukemias in adults with an incidence of 3.9 per 100,000 (See e.g., Lowenberg et al., N. Eng. J. Med. 341 : 1051 -62 (1999) and Lopesde Menezes, et al, Clin. Cancer Res. (2005), 1 1 (14) 5281-5291).
- FLT3-ITD mutations Two types of activating mutations have been identified, in AML patients: internal tandem duplications (ITDs) and point mutation in the activating loop of the kinase domain FLT3-ITD mutations in AML patients is indicative of a poor prognosis for survival, and in patients who are in remission, FLT3-ITD mutations are the most significant factor adversely affecting relapse rate with 64% of patients having the mutation relapsing within 5 years (see Current Pharmaceutical Design (2005), 1 1 :3449-3457. The prognostic significance of FLT3 mutations in clinical studies suggests that FLT3 plays a driving role in AML and may be necessary for the development and maintenance of the disease.
- MLL Mixed Lineage Leukemia
- FLT3 signally is involved in the development and maintenance of MLL (see Armstrong, et al, Cancer Cell (2003), 3 : 173- 183) [0127]
- the FLT3-ITD mutation is also present in about 3% of cases of adult myelodysplastic syndrome and some cases of acute lymphocytic leukemia (ALL) (Current Pharmaceutical Design (2005), 11 :3449-3457).
- ALL acute lymphocytic leukemia
- FLT3 has been shown to be a client protein of Hsp90, and 17AAG, a benzoquinone ansamycin antibiotic that inhibits Hsp90 activity, has been shown to disrupts the association of Flt3 with Hsp90.
- 17AAG a benzoquinone ansamycin antibiotic that inhibits Hsp90 activity
- the compounds as described herein are useful for the treatment or prevention of haematological malignancies, including, but not limiting to, acute myeloic leukemia (AML); mixed lineage leukemia (MLL); acute promyelocytic leukemia; acute lymphocytic leukemia, acute lymphoblastic leukemia, myeloid sarcoma; T-cell type acute lymphocytic leukemia (T- ALL); B-cell type acute lymphocytic leukemia (B-ALL); chronic myelomonocytic leukemia (CMML); myelodysplastic syndrome; myeloproliferative disorders; other proliferative disorders, including, but not limiting to, cancer; autoimmune disorders; and skin disorders, such as psoriasis and atopic dermatitis.
- AML acute myeloic leukemia
- MLL mixed lineage leukemia
- acute promyelocytic leukemia acute lymphocytic leukemia, acute lymphoblast
- the present disclosure also provides a method for modulating Flt3 activity by contacting a Flt3 or a mutant Flt3 with administering an effective amount of compounds of Formula I, all embodiments and sub-embodiments thereof including Formula 1(a), Formula 11(a), Formula 11(b), Formula ⁇ , Formula IV, Formula V, and any one or more of compounds P-001-P-255, and any other compounds as described herein.
- the compound is, in some embodiments, provided at a level sufficient to modulate the activity of the Flt3 by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90%, or greater than 90%.
- the compound will be at a concentration of about 1 ⁇ , 100 ⁇ , or 1 mM, or in a range of 1-100 nM, 100-500 nM, 500-1000 nM, 1-100 ⁇ , 100-500 ⁇ , or 500-1000 ⁇ .
- the contacting is carried out in vitro. In other embodiments, the contacting is carried out in vivo.
- Flt3 mediated disease or condition refers to a disease or condition in which the biological function of Flt3 affects the development and/or course of the disease or condition, and/or in which modulation of Flt3 alters the development, course, and/or symptoms. These mutations attenuate the intrinsic tyrosine kinase activity of the receptor to different degrees and are models for the effect of modulation of Flt3 activity.
- a Flt3 mediated disease or condition includes a disease or condition for which Flt3 inhibition provides a therapeutic benefit, e.g. wherein treatment with Flt3 inhibitors, including compounds described herein, provides a therapeutic benefit to the subject suffering from or at risk of the disease or condition.
- Reference to particular amino acid residues in human Flt3 polypeptide is defined by the numbering corresponding to the Flt3 sequence in GenBank NP0041 10.2 (SEQ ID NO: l). Reference to particular nucleotide positions in a nucleotide sequence encoding all or a portion of Flt3 is defined by the numbering corresponding to the sequence provided in GenBank
- NM_44119 (SEQ ID NO:2).
- Flt3 also referred to herein as FLT3 or flt3
- Flt3 mean an enzymatically active kinase that contains a portion with greater than 90% amino acid sequence identity to amino acid residues including the ATP binding site of full-length Flt3 (e.g., human Flt3, e.g., the sequence NP 004110.2 , SEQ ED NO: 1), for a maximal alignment over an equal length segment; or that contains a portion with greater than 90% amino acid sequence identity to at least 200 contiguous amino acids of native Flt3 and retains kinase activity.
- the sequence identity is at least 95, 97, 98, 99, or even 100%.
- the specified level of sequence identity is over a sequence at least 100-500, at least 200-400, or at least 300 contiguous amino acid residues in length.
- the term includes reference to wild-type c- Flt3, allelic variants, and mutated forms (e.g., having activating mutations).
- Flt3 -mediated diseases or disorders shall include diseases associated with or implicating Flt3 activity, for example, the overactivity of Flt3, and conditions that accompany with these diseases.
- overactivity of Flt3 refers to either 1) Flt3 expression in cells which normally do not express Flt3; 2) Flt3 expression by cells which normally do not express v; 3) increased Flt3 expression leading to unwanted cell proliferation; or 4) mutations leading to constitutive activation of Flt3.
- Examples of "Flt3-mediated diseases or disorders” include disorders resulting from over stimulation of Flt3 or from abnormally high amount of Flt3 activity, due to abnormally high amount of Flt3 or mutations in Flt3. It is known that overactivity of Flt3 has been implicated in the pathogenesis of a number of diseases, including inflammatory and autoimmune diseases, cell proliferative disorders, neoplastic disorders and cancers as described herein.
- Flt3-ITD allelic ratio refers to the percentage of tumor DNA alleles harboring the Flt3-ITD mutation normalized to the percent blast cells in a patient sample.
- a low Flt3-ITD allelic ratio is where less than 25% of normalized tumor DNA alleles is a Flt3-ITD allele.
- an intermediate Flt3-ITD allelic ratio is where between 25% and 50% of normalized tumor DNA alleles is a Flt3-ITD allele.
- a high FU3-ITD allelic ratio is where greater than 50% of normalized tumor DNA alleles is a Flt3-ITD allele.
- the "Flt3/ITD mutation-containing cells” include any of cells having tandem duplication mutation absent in healthy humans in a region of exons 14 to 15 in a juxtamembrane region of Flt3, that is, cells highly expressing mRNA derived from the mutation, cells having increased Flt3-derived growth signals caused by the mutation, cells highly expressing the mutant Flt3 protein, etc.
- the "Flt3/ITD mutation-containing cancerous cells” include any of cancerous cells having tandem duplication mutation absent in healthy humans in a region of exons 14 to 15 in a juxtamembrane region of Flt3, that is, cancerous cells highly expressing mRNA derived from the mutation, cancerous cells having increased Flt3 -derived growth signals caused by the mutation, cancerous cells highly expressing the mutant Flt3 protein, etc.
- the "Flt3/ITD mutation-containing leukemic cells” include any of leukemic cells having tandem duplication mutation absent in healthy humans in a region of exons 14 to 15 in a juxtamembrane region of Flt3, that is, leukemic cells highly expressing mRNA derived from the mutation, leukemic cells having increased Flt3 -derived growth signals caused by the mutation, leukemic cells highly expressing the mutant Flt3 protein, etc.
- c-Kit mediated disease or condition refers to a disease or condition in which the biological function of c-Kit affects the development and/or course of the disease or condition, and/or in which modulation of c-Kit alters the development, course, and/or symptoms. These mutations attenuate the intrinsic tyrosine kinase activity of the receptor to different degrees and are models for the effect of modulation of c-Kit activity.
- a c-Kit mediated disease or condition includes a disease or condition for which c-Kit inhibition provides a therapeutic benefit, e.g. wherein treatment with c-Kit inhibitors, including compounds described herein, provides a therapeutic benefit to the subject suffering from or at risk of the disease or condition.
- Reference to particular amino acid residues in human c-kit polypeptide is defined by the numbering corresponding to the Kit sequence in GenBank NP 000213 (1).
- Reference to particular nucleotide positions in a nucleotide sequence encoding all or a portion of c-kit is defined by the numbering corresponding to the sequence provided in GenBank NM_000222.
- kit means an enzymatically active kinase that contains a portion with greater than 90% amino acid sequence identity to amino acid residues including the ATP binding site of full-length c-kit (e.g., human c-kit, e.g., the sequence NP 000213), for a maximal alignment over an equal length segment; or that contains a portion with greater than 90% amino acid sequence identity to at least 200 contiguous amino acids of native c-kit and retains kinase activity.
- sequence identity is at least 95, 97, 98, 99, or even 100%.
- the specified level of sequence identity is over a sequence at least 100-500, at least 200-400, or at least 300 contiguous amino acid residues in length.
- the term includes reference to wild-type c-kit, allelic variants, and mutated forms (e.g., having activating mutations).
- Target kinase Fms i.e., feline McDonough sarcoma
- Fms is a member of the family of genes originally isolated from the Susan McDonough strain of feline sarcoma viruses.
- Fms is a transmembrane tyrosine kinase of 108.0 kDa coded by chromosome 5q33.2-q33.3 (symbol: CSF IR).
- the structure of the transmembrane receptor Fms comprises two Ig-like domains, a IgC2 ⁇ iike domain, two additional Ig-like domains, a TM domain, and the T domain.
- Fms is the receptor for the macrophage colony-stimulating factor (M-CSF), and is crucial for the growth and differentiation of the monocyte-macrophage lineage. Upon binding of M-CSF to the extracellular domain of Fms, the receptor dimerizes and trans-autophosphorylates cytoplasmic tyrosine residues.
- M-CSF macrophage colony-stimulating factor
- M-CSF is a cytokine that controls the production, differentiation, and function of macrophages.
- M-CSF stimulates differentiation of progenitor cells to mature monocytes, and prolongs the survival of monocytes. Furthermore, M-CSF enhances cytotoxicity, superoxide production, phagocytosis, chemotaxis, and secondary cytokine production of additional factors in monocytes and macrophages. Examples of such additional factors include granulocyte colony stimulating factor (G-CSF), interleukin-6 (IL-6), and interleukm-8 (IL-8). M-CSF stimulates hematopoiesis, promotes differentiation and proliferation of osteoclast progenitor cells, and has profound effects on lipid metabolism.
- G-CSF granulocyte colony stimulating factor
- IL-6 interleukin-6
- IL-8 interleukm-8
- CSF 1R mediated disease or condition refers to a disease or condition in which the biological function of CSF1R affects the development and/or course of the disease or condition, and/or in which modulation of CSF1R alters the development, course, and/or symptoms. These mutations attenuate the intrinsic tyrosine kinase activity of the receptor to different degrees and are models for the effect of modulation of CSF1R activity.
- a CSF1R mediated disease or condition includes a disease or condition for which CSF 1R inhibition provides a therapeutic benefit, e.g. wherein treatment with CSF 1R inhibitors, including compounds described herein, provides a therapeutic benefit to the subject suffering from or at risk of the disease or condition.
- modulate refers to the ability of a compound to increase or decrease the function and/or expression of a protein kinase such as Flt3, where such function may include transcription regulatory activity and/or protein-binding. Modulation may occur in vitro or in vivo. Modulation, as described herein, includes the inhibition, antagonism, partial antagonism, activation, agonism or partial agonism of a function or characteristic associated with Flt3, either directly or indirectly, and/or the upregulation or downregulation of the expression of Flt3, either directly or indirectly.
- the modulation is direct Inhibitors or antagonists are compounds that, e.g., bind to, partially or totally block stimulation, decrease, prevent, inhibit, delay activation, inactivate, desensitize, or downregulate signal transduction.
- Activators or agonists are compounds that, e.g., bind to, stimulate, increase, open, activate, facilitate, enhance activation, activate, sensitize or upregulate signal transduction.
- the ability of a compound to inhibit the function of Flt3 can be demonstrated in a biochemical assay, e.g., binding assay, or a cell-based assay.
- the term "greater specificity" indicates that a compound binds to a specified target to a greater extent than to another biomolecule or biomolecules that may be present under relevant binding conditions, where binding to such other biomolecules produces a different biological activity than binding to the specified target.
- the specificity is with reference to a limited set of other biomolecules, e.g., in the case of Flt3, other tyrosine kinases or even other type of enzymes.
- the greater specificity is at least 2, 3, 4, 5, 8, 10, 50, 100, 200, 400, 500, or 1000-fold greater specificity.
- the term “specific for Flt3 kinase”, “specific for Flt3”, and terms of like import mean that a particular compound binds to Flt3 to a statistically greater extent than to other kinases that may be present in a particular sample. Also, where biological activity other than binding is indicated, the term “specific for Flt3” indicates that a particular compound has greater biological effect associated with binding Flt3 than to other tyrosine kinases, e.g., kinase activity inhibition. The specificity is also with respect to other biomolecules (not limited to tyrosine kinases) that may be present in a particular sample.
- the term "specific for Flt3 kinase”, “specific for Flt3”, and terms of like import mean that a particular compound binds to Flt3 to a statistically greater extent than to other kinases that may be present in a particular sample. Also, where biological activity other than binding is indicated, the term “specific for Flt3” indicates that a particular compound has greater biological effect associated with binding Flt3than to other tyrosine kinases, e.g., kinase activity inhibition. The specificity is also with respect to other biomolecules (not limited to tyrosine kinases) that may be present in a particular sample.
- first line cancer therapy refers to therapy administered to a subject as an initial regimen to reduce the number of cancer cells.
- First line therapy is also referred to as induction therapy, primary therapy and primary treatment.
- Commonly administered first-line therapy for AML is cytarabine-based therapy in which cytarabine is administered often in combination with one or more agents selected from daunorubicin, idarubicin, doxorubicin, mitoxantrone, tipifarnib, thioguanine or gemtuzumab ozogamicin.
- Common regimens used in cytarabine-based therapy include the "7 + 3" or "5 + 2" therapy comprising administration of cytarabine with an anthracycline such as daunorubicin or idarubicin.
- Another first-line therapy is clofarabine-based therapy in which clofarabine is administered, often in combination with an anthracycline such as daunorubicin, idarubicin or doxorubicin.
- Other first-line therapy for AML are etoposide-based therapy in which etoposide is administered, often in combination with mitoxantrone, and optionally, with cytarabine.
- AML AML
- ATRA all-trans-retinoic acid
- second line cancer therapy refers to a cancer treatment that is administered to a subject who does not respond to first line therapy, that is, often first line therapy is administered or who has a recurrence of cancer after being in remission.
- second line therapy that may be administered includes a repeat of the initial successful cancer therapy, which may be any of the treatments described under "first line cancer therapy" .
- second line therapy is the administration of gemtuzumab ozogamicin.
- investigational drugs may also be administered as second line therapy in a clinical trial setting.
- NCCN Clinical Practice Guidelines in Oncology for acute myeloid leukemia and the NCI guidelines on acute myeloid leukemia treatment see, e.g., http://www.cancer.gov/cancertopics/pdq/treatment/adultAML/HealthProfessional/page5).
- refractory refers to wherein a subject fails to respond or is otherwise resistant to cancer therapy or treatment.
- the cancer therapy may be first-line, second-line or any subsequently administered treatment.
- refractory refers to a condition where a subject fails to achieve complete remission after two induction attempts.
- a subject may be refractory due to a cancer cell's intrinsic resistance to a particular therapy, or the subject may be refractory due to an acquired resistance that develops during the course of a particular therapy.
- the methods of the present disclosure can involve assays that are able to detect the binding of compounds to a target molecule. Such binding is at a statistically significant level, with a confidence level of at least 90%, or at least 95, 97, 98, 99% or greater confidence level that the assay signal represents binding to the target molecule, i.e., is distinguished from background. In some embodiments, controls are used to distinguish target binding from nonspecific binding. A large variety of assays indicative of binding are known for different target types and can be used for this disclosure.
- Binding compounds can be characterized by their effect on the activity of the target molecule.
- a “low activity” compound has an inhibitory concentration (IC50) or effective concentration (EC 50 ) of greater than 1 uM under standard conditions.
- very low activity is meant an IC 50 or EC 50 of above 100 uM under standard conditions.
- extreme low activity is meant an IC 50 or EC 50 of above 1 mM under standard conditions.
- moderate activity is meant an IC 50 or EC 50 of 200 nM to 1 uM under standard conditions.
- Moderately high activity is meant an IC 50 or EC 50 of 1 nM to 200 nM.
- high activity is meant an IC 50 or EC 50 of below 1 nM under standard conditions
- the IC 50 or EC 50 is defined as the concentration of compound at which 50% of the activity of the target molecule (e.g. enzyme or other protein) activity being measured is lost or gained relative to the range of activity observed when no compound is present.
- Activity can be measured using methods known to those of ordinary skill in the art, e.g., by measuring any detectable product or signal produced by occurrence of an enzymatic reaction, or other activity by a protein being measured.
- background signal in reference to a binding assay is meant the signal that is recorded under standard conditions for the particular assay in the absence of a test compound, molecular scaffold, or ligand that binds to the target molecule.
- background signal in reference to a binding assay is meant the signal that is recorded under standard conditions for the particular assay in the absence of a test compound, molecular scaffold, or ligand that binds to the target molecule.
- standard deviation is meant the square root of the variance.
- Binding parameters can be measured using surface plasmon resonance, for example, with a BIAcore ® chip (Biacore, Japan) coated with immobilized binding components.
- Surface plasmon resonance is used to characterize the microscopic association and dissociation constants of reaction between an sFv or other ligand directed against target molecules.
- Such methods are generally described in the following references which are incorporated herein by reference. Vely F. et al., (2000) BIAcore ® analysis to test phosphopeptide-SH2 domain interactions, Methods in Molecular Biology 121 :313-21, Liparoto et al., (1999) Biosensor analysis of the interleukin-2 receptor complex, Journal of Molecular Recognition.
- BIAcore ® uses the optical properties of surface plasmon resonance (SPR) to detect alterations in protein concentration bound to a dextran matrix lying on the surface of a gold/glass sensor chip interface, a dextran biosensor matrix.
- SPR surface plasmon resonance
- proteins are covalently bound to the dextran matrix at a known concentration and a ligand for the protein is injected through the dextran matrix.
- Near infrared light, directed onto the opposite side of the sensor chip surface is reflected and also induces an evanescent wave in the gold film, which in turn, causes an intensity dip in the reflected light at a particular angle known as the resonance angle. If the refractive index of the sensor chip surface is altered (e.g.
- HTS typically uses automated assays to search through large numbers of compounds for a desired activity.
- HTS assays are used to find new drugs by screening for chemicals that act on a particular enzyme or molecule. For example, if a chemical inactivates an enzyme it might prove to be effective in preventing a process in a cell which causes a disease.
- High throughput methods enable researchers to assay thousands of different chemicals against each target molecule very quickly using robotic handling systems and automated analysis of results.
- high throughput screening or “HTS” refers to the rapid in vitro screening of large numbers of compounds (libraries); generally tens to hundreds of thousands of compounds, using robotic screening assays.
- Ultra high-throughput Screening generally refers to the high-throughput screening accelerated to greater than 100,000 tests per day.
- a multicontainer carrier facilitates measuring reactions of a plurality of candidate compounds simultaneously.
- Multi-well microplates may be used as the carrier. Such multi-well microplates, and methods for their use in numerous assays, are both known in the art and commercially available.
- Screening assays may include controls for purposes of calibration and confirmation of proper manipulation of the components of the assay. Blank wells that contain all of the reactants but no member of the chemical library are usually included.
- a known inhibitor (or activator) of an enzyme for which modulators are sought can be incubated with one sample of the assay, and the resulting decrease (or increase) in the enzyme activity used as a comparator or control.
- modulators can also be combined with the enzyme activators or inhibitors to find modulators which inhibit the enzyme activation or repression that is otherwise caused by the presence of the known the enzyme modulator. Measuring Enzymatic and Binding Reactions During Screening Assays
- Examples of such assays include the use of colorimetric assays for the detection of peroxides, as described in Gordon, A. J and Ford, R. A., (1972) The Chemist's Companion: A Handbook Of Practical Data, Techniques, And References, John Wiley and Sons, N.Y., Page 437.
- Fluorescence spectrometry may be used to monitor the generation of reaction products. Fluorescence methodology is generally more sensitive than the absorption methodology. The use of fluorescent probes is well known to those skilled in the art. For reviews, see Bashford et al, (1987) Spectrophotometry and Spectrofluorometry: A Practical Approach, pp. 91-114, IRL Press Ltd.; and Bell, (1981) Spectroscopy In Biochemistry, Vol. I, pp. 155-194, CRC Press.
- SMase activity can be detected using the Amplex ® Red reagent (Molecular Probes, Eugene, OR). In order to measure sphingomyelinase activity using Amplex ® Red, the following reactions occur. First, SMase hydrolyzes sphingomyelin to yield ceramide and phosphorylcholine. Second, alkaline phosphatase hydrolyzes phosphorylcholine to yield choline.
- choline is oxidized by choline oxidase to betaine.
- H 2 O 2 in the presence of horseradish peroxidase, reacts with Amplex ® Red to produce the fluorescent product, Resorufin, and the signal therefrom is detected using spectrofluorometry.
- Fluorescence polarization is based on a decrease in the speed of molecular rotation of a fluorophore that occurs upon binding to a larger molecule, such as a receptor protein, allowing for polarized fluorescent emission by the bound ligand.
- FP is empirically determined by measuring the vertical and horizontal components of fluorophore emission following excitation with plane polarized light. Polarized emission is increased when the molecular rotation of a fluorophore is reduced.
- a fluorophore produces a larger polarized signal when it is bound to a larger molecule (i.e. a receptor), slowing molecular rotation of the fluorophore.
- the magnitude of the polarized signal relates quantitatively to the extent of fluorescent ligand binding.
- FP Fluorescence Polarization Assays in High-Throughput Screening, Genetic Engineering News, 17:27.
- FP is particularly desirable since its readout is independent of the emission intensity (Checovich, W. I, et al., (1995) Nature 375:254-256; Dandliker, W B , et al., (1981) Methods in Enzymology 74:3-28) and is thus insensitive to the presence of colored compounds that quench fluorescence emission.
- FP and FRET are well-suited for identifying compounds that block interactions between sphingolipid receptors and their ligands.
- Fluorophores derived from sphingolipids that may be used in FP assays are commercially available.
- Molecular Probes (Eugene, OR) currently sells sphingomyelin and one ceramide flurophores.
- N-(4,4-difluoro-5,7- dimethyl-4-bora-3a,4a-diaza-s-indacene- 3-pentanoyl)sphingosyl phosphocholine BODIPY® FL C5-sphingomyelin
- N-(4,4-difluoro-5,7-dimethyl-4-bora-3a,4a-diaza-s-indacene- 3- dodecanoyl)sphingosyl phosphocholine BODIPY® FL C12-sphingomyelin
- N-(4,4- difluoro-5,7-dimethyl-4-bora-3a,4a-diaza-s-indacene- 3-pentanoyl)sphingosine BODIPY ® FL C5-ceramide
- U.S. Patent No. 4, 150,949 discloses fluorescein- labelled gentamicins, including fluoresceinthiocarbanyl gentamicin. Additional fluorophores may be prepared using methods well known to the skilled artisan.
- Exemplary normal-and-polarized fluorescence readers include the POLARION ® fluorescence polarization system (Tecan AG, Hombrechtikon, Switzerland). General multiwell plate readers for other assays are available, such as the VERSAMAX ® reader and the
- Fluorescence resonance energy transfer is another useful assay for detecting interaction and has been described. See, e.g., Heim et al., (1996) Curr. Biol. 6: 178-182; Mitra et al., (1996) Gene 173 : 13-17; and Selvin et al., (1995) Meth. Enzymol. 246:300-345.
- FRET detects the transfer of energy between two fluorescent substances in close proximity, having known excitation and emission wavelengths.
- a protein can be expressed as a fusion protein with green fluorescent protein (GFP).
- GFP green fluorescent protein
- the resonance energy can be transferred from one excited molecule to the other.
- the emission spectrum of the sample shifts, which can be measured by a fluorometer, such as a fJV!AX multiwell fluorometer (Molecular Devices, Sunnyvale Calif).
- SPA Scintillation proximity assay
- the target molecule can be bound to the scintillator plates by a variety of well known means. Scintillant plates are available that are derivatized to bind to fusion proteins such as GST, His6 or Flag fusion proteins. Where the target molecule is a protein complex or a multimer, one protein or subunit can be attached to the plate first, then the other components of the complex added later under binding conditions, resulting in a bound complex.
- the gene products in the expression pool will have been radiolabeled and added to the wells, and allowed to interact with the solid phase, which is the immobilized target molecule and scintillant coating in the wells.
- the assay can be measured immediately or allowed to reach equilibrium. Either way, when a radiolabel becomes sufficiently close to the scintillant coating, it produces a signal detectable by a device such as a TOPCOUNT NXT ® microplate scintillation counter (Packard BioScience Co., Meriden Conn ). If a radiolabeled expression product binds to the target molecule, the radiolabel remains in proximity to the scintillant long enough to produce a detectable signal.
- a number of different assays for kinase activity can be utilized for assaying for active modulators and/or determining specificity of a modulator for a particular kinase or group or kinases.
- assays for kinase activity can be utilized for assaying for active modulators and/or determining specificity of a modulator for a particular kinase or group or kinases.
- one of ordinary skill in the art will know of other assays that can be utilized and can modify an assay for a particular application. For example, numerous papers concerning kinases described assays that can be used.
- Additional alternative assays can employ binding determinations.
- this sort of assay can be formatted either in a fluorescence resonance energy transfer (FRET) format, or using an AlphaScreen (amplified /uminescent proximity homogeneous assay) format by varying the donor and acceptor reagents that are attached to streptavidin or the phospho-specific antibody.
- FRET fluorescence resonance energy transfer
- AlphaScreen amplified /uminescent proximity homogeneous assay
- carboxylic acid esters include solvated forms, different crystal forms or polymorphs, and active metabolites.
- some of the compounds according to the present disclosure may exist as stereoisomers, i.e. having the same atomic connectivity of covalently bonded atoms yet differing in the spatial orientation of the atoms.
- compounds may be optical stereoisomers, which contain one or more chiral centers, and therefore, may exist in two or more stereoisomeric forms (e.g. enantiomers or diastereomers).
- stereoisomers i.e., essentially free of other stereoisomers
- racemates e.g., essentially free of other stereoisomers
- stereoisomers include geometric isomers, such as cis- or trans- orientation of substituents on adjacent carbons of a double bond. All such single stereoisomers, racemates and mixtures thereof are intended to be within the scope of the present disclosure. Unless specified to the contrary, all such steroisomeric forms are included within the formulae provided herein.
- a chiral compound of the present disclosure is in a form that contains at least 80% of a single isomer (60% enantiomeric excess ("e.e.") or diastereomeric excess (“d.e.”)), or at least 85% (70% e.e. or d.e.), 90% (80% e.e. or d.e.), 95% (90% e.e. or d.e ), 97.5% (95% e.e or d.e ), or 99% (98% e.e. or d.e ).
- an optically pure compound having one chiral center is one that consists essentially of one of the two possible enantiomers (i.e., is enantiomerically pure), and an optically pure compound having more than one chiral center is one that is both
- the compound is present in optically pure form.
- the disclosure also includes prodrugs (generally pharmaceutically acceptable prodrugs), active metabolic derivatives (active metabolites), and their pharmaceutically acceptable salts.
- Prodrugs are compounds or pharmaceutically acceptable salts thereof which, when metabolized under physiological conditions or when converted by solvolysis, yield the desired active compound.
- Prodrugs include, without limitation, esters, amides, carbamates, carbonates, ureides, solvates, or hydrates of the active compound.
- the prodrug is inactive, or less active than the active compound, but may provide one or more of advantageous handling, administration, and/or metabolic properties.
- some prodrugs are esters of the active compound; during metabolysis, the ester group is cleaved to yield the active drug.
- some prodrugs are activated enzymatically to yield the active compound, or a compound which, upon further chemical reaction, yields the active compound.
- a common example of a prodrug is an alkyl ester of a carboxylic acid.
- all embodiments and sub-embodiments thereof including any one or more of compounds P-001-P-255, further examples include, without limitation, an amide or carbamate derivative at the pyrrole nitrogen (i.e. Nl) of the azaindole core.
- bioprecursor prodrugs can be conceptually divided into two nonexclusive categories, bioprecursor prodrugs and carrier prodrugs.
- bioprecursor prodrugs are compounds that are inactive or have low activity compared to the corresponding active drug compound, that contain one or more protective groups and are converted to an active form by metabolism or solvolysis. Both the active drug form and any released metabolic products should have acceptably low toxicity.
- the formation of active drug compound involves a metabolic process or reaction that is one of the follow types:
- Oxidative reactions are exemplified without limitation to reactions such as oxidation of alcohol, carbonyl, and acid functionalities, hydroxylation of aliphatic carbons, hydroxylation of alicyclic carbon atoms, oxidation of aromatic carbon atoms, oxidation of carbon-carbon double bonds, oxidation of nitrogen-containing functional groups, oxidation of silicon, phosphorus, arsenic, and sulfur, oxidative N-dealkylation, oxidative O- and S-dealkylation, oxidative deamination, as well as other oxidative reactions.
- Reductive reactions are exemplified without limitation to reactions such as reduction of carbonyl functionalities, reduction of alcohol functionalities and carbon-carbon double bonds, reduction of nitrogen-containing functional groups, and other reduction reactions.
- Reactions without change in the oxidation state are exemplified without limitation to reactions such as hydrolysis of esters and ethers, hydrolytic cleavage of carbon-nitrogen single bonds, hydrolytic cleavage of non-aromatic heterocycles, hydration and dehydration at multiple bonds, new atomic linkages resulting from dehydration reactions, hydrolytic dehalogenation, removal of hydrogen halide molecule, and other such reactions.
- Carrier prodrugs are drug compounds that contain a transport moiety, e.g., that improves uptake and/or localized delivery to a site(s) of action.
- a transport moiety e.g., that improves uptake and/or localized delivery to a site(s) of action.
- the linkage between the drug moiety and the transport moiety is a covalent bond
- the prodrug is inactive or less active than the drug compound
- the prodrug and any release transport moiety are acceptably non-toxic.
- the transport moiety is intended to enhance uptake
- the release of the transport moiety should be rapid.
- it is desirable to utilize a moiety that provides slow release e.g., certain polymers or other moieties, such as cyclodextrins. (See, e.g., Cheng et al., U.S. Patent Publ. No. 2004/0077595,
- carrier prodrugs are often advantageous for orally administered drugs.
- Carrier prodrugs can, for example, be used to improve one or more of the following properties: increased lipophilicity, increased duration of pharmacological effects, increased site-specificity, decreased toxicity and adverse reactions, and/or improvement in drug formulation (e.g. stability, water solubility, suppression of an undesirable organoleptic or physiochemical property).
- lipophilicity can be increased by esterification of hydroxyl groups with lipophilic carboxylic acids, or of carboxylic acid groups with alcohols, e.g., aliphatic alcohols. Wermuth, supra.
- Prodrugs may proceed from prodrug form to active form in a single step or may have one or more intermediate forms which may themselves have activity or may be inactive.
- Metabolites e.g., active metabolites
- prodrugs as described above, e.g., bioprecursor prodrugs.
- metabolites are pharmacologically active compounds or compounds that further metabolize to pharmacologically active compounds that are derivatives resulting from metabolic process in the body of a subject.
- active metabolites are such pharmacologically active derivative compounds.
- the prodrug compound is generally inactive or of lower activity than the metabolic product.
- the parent compound may be either an active compound or may be an inactive prodrug.
- Prodrugs and active metabolites may be identified using routine techniques known in the art. See, e.g., Bertolini et al., 1997, J. Med. Chem., 40:2011-2016; Shan et al, 1997, J Pharm Sci 86(7):756-757; Bagshawe, 1995, Drug Dev. Res., 34:220-230; Wermuth, supra.
- Compounds can be formulated as or be in the form of pharmaceutically acceptable salts.
- Contemplated pharmaceutically acceptable salt forms include, without limitation, mono, bis, tris, tetrakis, and so on.
- Pharmaceutically acceptable salts are non-toxic in the amounts and concentrations at which they are administered. The preparation of such salts can facilitate the pharmacological use by altering the physical characteristics of a compound without preventing it from exerting its physiological effect. Useful alterations in physical properties include lowering the melting point to facilitate transmucosal administration and increasing the solubility to facilitate administering higher concentrations of the drug.
- Pharmaceutically acceptable salts include acid addition salts such as those containing sulfate, chloride, hydrochloride, fumarate, maleate, phosphate, sulfamate, acetate, citrate, lactate, tartrate, methanesulfonate, ethanesulfonate, benzenesulfonate, ?-toluenesulfonate, cyclohexylsulfamate and quinate.
- acid addition salts such as those containing sulfate, chloride, hydrochloride, fumarate, maleate, phosphate, sulfamate, acetate, citrate, lactate, tartrate, methanesulfonate, ethanesulfonate, benzenesulfonate, ?-toluenesulfonate, cyclohexylsulfamate and quinate.
- Pharmaceutically acceptable salts can be obtained from acids such as hydrochloric acid, maleic acid, sulfuric acid, phosphoric acid, sulfamic acid, acetic acid, citric acid, lactic acid, tartaric acid, malonic acid, methanesulfonic acid, ethanesulfonic acid, benzenesulfonic acid, -toluenesulfonic acid, cyclohexyl sulfamic acid, fumaric acid, and quinic acid.
- acids such as hydrochloric acid, maleic acid, sulfuric acid, phosphoric acid, sulfamic acid, acetic acid, citric acid, lactic acid, tartaric acid, malonic acid, methanesulfonic acid, ethanesulfonic acid, benzenesulfonic acid, -toluenesulfonic acid, cyclohexyl sulfamic acid, fumaric acid, and quinic acid.
- Pharmaceutically acceptable salts also include basic addition salts such as those containing benzathine, chloroprocaine, choline, diethanolamine, ethanolamine, t-butylamine, ethylenediamine, meglumine, procaine, aluminum, calcium, lithium, magnesium, potassium, sodium, ammonium, alkylamine, and zinc, when acidic functional groups, such as carboxylic acid or phenol are present.
- basic addition salts such as those containing benzathine, chloroprocaine, choline, diethanolamine, ethanolamine, t-butylamine, ethylenediamine, meglumine, procaine, aluminum, calcium, lithium, magnesium, potassium, sodium, ammonium, alkylamine, and zinc.
- acidic functional groups such as carboxylic acid or phenol are present.
- Such salts can be prepared using the appropriate corresponding bases.
- salts can be prepared by standard techniques.
- the free-base form of a compound can be dissolved in a suitable solvent, such as an aqueous or aqueous-alcohol solution containing the appropriate acid and then isolated by evaporating the solution.
- a salt can be prepared by reacting the free base and acid in an organic solvent.
- the desired pharmaceutically acceptable salt may be prepared by any suitable method available in the art, for example, treatment of the free base with an inorganic acid, such as hydrochloric acid, hydrobromic acid, sulfuric acid, nitric acid, phosphoric acid, and the like, or with an organic acid, such as acetic acid, maleic acid, succinic acid, mandelic acid, fumaric acid, malonic acid, pyruvic acid, oxalic acid, glycolic acid, salicylic acid, a pyranosidyl acid, such as glucuronic acid or galacturonic acid, an alpha-hydroxy acid, such as citric acid or tartaric acid, an amino acid, such as aspartic acid or glutamic acid, an aromatic acid, such as benzoic acid or cinnamic acid, a sulfonic acid, such as p-toluenesulfonic acid or ethanesulfonic acid
- an inorganic acid such as hydrochloric acid, hydrobromic
- the desired pharmaceutically acceptable salt may be prepared by any suitable method, for example, treatment of the free acid with an inorganic or organic base, such as an amine (primary, secondary or tertiary), an alkali metal hydroxide or alkaline earth metal hydroxide, or the like.
- an inorganic or organic base such as an amine (primary, secondary or tertiary), an alkali metal hydroxide or alkaline earth metal hydroxide, or the like.
- suitable salts include organic salts derived from amino acids, such as L-glycine, L-lysine, and L-arginine, ammonia, primary, secondary, and tertiary amines, and cyclic amines, such as
- the pharmaceutically acceptable salt of the different compounds may be present as a complex.
- complexes include 8-chlorotheophylline complex (analogous to, e.g., dimenhydrinate: diphenhydramine 8-chlorotheophylline (1 : 1) complex; Dramamine) and various cyclodextrin inclusion complexes.
- salts are formed by acid/base addition, i.e. a free base or free acid of the compound of interest forms an acid/base reaction with a corresponding addition base or addition acid, respectively, resulting in an ionic charge interaction
- co-crystals are a new chemical species that is formed between neutral compounds, resulting in the compound and an additional molecular species in the same crystal structure.
- compounds of the disclosure are complexed with an acid or a base, including base addition salts such as ammonium, diethylamine, ethanolamine, ethylenediamine, diethanolamine, t-butylamine, piperazine, meglumine; acid addition salts, such as acetate, acetylsalicylate, besylate, camsylate, citrate, formate, fumarate, glutarate, hydrochlorate, maleate, mesylate, nitrate, oxalate, phosphate, succinate, sulfate, tartrate, thiocyanate and tosylate; and amino acids such as alanine, arginine, asparagine, aspartic acid, cysteine, glutamine, glutamic acid, glycine, histidine, isoleucine, leucine, lysine, methionine, phenylalanine, proline, serine, threonine, trypto
- base addition salts such
- an amorphous complex is formed rather than a crystalline material such as typical salt or co-crystal.
- the amorphous form of the complex is facilitated by additional processing, such as by spray-drying, mechanochemical methods such as roller compaction, or microwave irradiation of the parent compound mixed with the acid or base
- additional processing such as by spray-drying, mechanochemical methods such as roller compaction, or microwave irradiation of the parent compound mixed with the acid or base
- Such methods may also include addition of ionic and/or non-ionic polymer systems, including, but not limited to, hydroxypropyl methyl cellulose acetate succinate (HPMCAS) and methacrylic acid copolymer (e.g. Eudragit® LI 00-55), that further stabilize the amorphous nature of the complex.
- HPMCAS hydroxypropyl methyl cellulose acetate succinate
- methacrylic acid copolymer e.g. Eudragit® LI 00-55
- amorphous complexes provide several advantages. For example, lowering of the melting temperature relative to the free base facilitates additional processing, such as hot melt extrusion, to further improve the biopharmaceutical properties of the compound. Also, the amorphous complex is readily friable, which provides improved compression for loading of the solid into capsule or tablet form.
- the formulae are intended to cover hydrated or solvated as well as unhydrated or unsolvated forms of the identified structures.
- the indicated compounds include both hydrated and non-hydrated forms.
- Other examples of solvates include the structures in combination with a suitable solvent, such as isopropanol, ethanol, methanol, dimethyl sulfoxide, ethyl acetate, acetic acid, or ethanolamine.
- the methods and compounds will typically be used in therapy for human subjects. However, they may also be used to treat similar or identical indications in other animal subjects.
- the terms "subject,” "animal subject,” and the like refer to human and non- human vertebrates, e.g. mammals, such as non-human primates, sports and commercial animals, e.g., equines, bovines, porcines, ovines, rodents, and pets, e.g., canines and felines.
- Suitable dosage forms depend upon the use or the route of administration, for example, oral, transdermal, transmucosal, inhalant, or by injection (parenteral). Such dosage forms should allow the compound to reach target cells. Other factors are well known in the art, and include considerations such as toxicity and dosage forms that retard the compound or composition from exerting its effects. Techniques and formulations generally may be found in The Science and Practice of Pharmacy, 21 st edition, Lippincott, Williams and Wilkins,
- Carriers or excipients can be used to produce compositions
- the carriers or excipients can be chosen to facilitate administration of the compound.
- carriers include calcium carbonate, calcium phosphate, various sugars such as lactose, glucose, or sucrose, or types of starch, cellulose derivatives, gelatin, vegetable oils, polyethylene glycols and physiologically compatible solvents.
- physiologically compatible solvents include sterile solutions of water for injection (WFI), saline solution, and dextrose.
- the compounds can be administered by different routes including intravenous, intraperitoneal, subcutaneous, intramuscular, oral, transmucosal, rectal, transdermal, or inhalant.
- the compounds can be administered by oral administration.
- the compounds can be formulated into conventional oral dosage forms such as capsules, tablets, and liquid preparations such as syrups, elixirs, and concentrated drops.
- compounds of the disclosure may be formulated as dry powder or a suitable solution, suspension, or aerosol.
- Powders and solutions may be formulated with suitable additives known in the art.
- powders may include a suitable powder base such as lactose or starch, and solutions may comprise propylene glycol, sterile water, ethanol, sodium chloride and other additives, such as acid, alkali and buffer salts.
- suitable powders may include a suitable powder base such as lactose or starch, and solutions may comprise propylene glycol, sterile water, ethanol, sodium chloride and other additives, such as acid, alkali and buffer salts.
- Such solutions or suspensions may be administered by inhaling via spray, pump, atomizer, or nebulizer, and the like.
- the compounds of the disclosure may also be used in combination with other inhaled therapies, for example corticosteroids such as fluticasone propionate, beclomethasone dipropionate, triamcinolone acetonide, budesonide, and mometasone furoate; beta agonists such as albuterol, salmeterol, and formoterol; anticholinergic agents such as ipratropium bromide or tiotropium; vasodilators such as treprostinal and iloprost; enzymes such as DNAase; therapeutic proteins; immunoglobulin antibodies; an oligonucleotide, such as single or double stranded DNA or RNA, siRNA; antibiotics such as tobramycin; muscarinic receptor antagonists;
- corticosteroids such as fluticasone propionate, beclomethasone dipropionate, triamcinolone acetonide, budesonide, and mometasone furoate
- leukotriene antagonists include cytokine antagonists; protease inhibitors; cromolyn sodium; nedocril sodium; and sodium cromoglycate.
- compositions for oral use can be obtained, for example, by combining the active compounds with solid excipients, optionally grinding a resulting mixture, and processing the mixture of granules, after adding suitable auxiliaries, if desired, to obtain tablets or dragee cores.
- suitable excipients are, in particular, fillers such as sugars, including lactose, sucrose, mannitol, or sorbitol; cellulose preparations, for example, maize starch, wheat starch, rice starch, potato starch, gelatin, gum tragacanth, methyl cellulose, hydroxypropylmethyl- cellulose, sodium carboxymethylcellulose (CMC), and/or polyvinylpyrrolidone (PVP:
- disintegrating agents may be added, such as the cross-linked
- polyvinylpyrrolidone agar, or alginic acid, or a salt thereof such as sodium alginate.
- Dragee cores are provided with suitable coatings.
- suitable coatings may be used, which may optionally contain, for example, gum arabic, talc, polyvinylpyrrolidone, carbopol gel, polyethylene glycol (PEG), and/or titanium dioxide, lacquer solutions, and suitable organic solvents or solvent mixtures.
- Dye-stuffs or pigments may be added to the tablets or dragee coatings for identification or to characterize different
- compositions that can be used orally include push-fit capsules made of gelatin ("gelcaps”), as well as soft, sealed capsules made of gelatin, and a plasticizer, such as glycerol or sorbitol.
- the push-fit capsules can contain the active ingredients in admixture with filler such as lactose, binders such as starches, and/or lubricants such as talc or magnesium stearate and, optionally, stabilizers.
- the active compounds may be dissolved or suspended in suitable liquids, such as fatty oils, liquid paraffin, or liquid polyethylene glycols (PEGs).
- PEGs liquid polyethylene glycols
- stabilizers may be added.
- injection parenteral administration
- the compounds of the disclosure are formulated in sterile liquid solutions, such as in physiologically compatible buffers or solutions, such as saline solution, Hank's solution, or Ringer's solution.
- the compounds may be formulated in solid form and redissolved or suspended immediately prior to use. Lyophilized forms can also be produced.
- Administration can also be by transmucosal, topical, transdermal, or inhalant means.
- penetrants appropriate to the barrier to be permeated are used in the formulation.
- penetrants are generally known in the art, and include, for example, for transmucosal administration, bile salts and fusidic acid derivatives.
- detergents may be used to facilitate permeation.
- Transmucosal administration for example, may be through nasal sprays or suppositories (rectal or vaginal).
- the topical compositions of this disclosure are formulated as oils, creams, lotions, ointments, and the like by choice of appropriate carriers known in the art.
- suitable carriers include vegetable or mineral oils, white petrolatum (white soft paraffin), branched chain fats or oils, animal fats and high molecular weight alcohol (greater than Cn).
- the carriers are those in which the active ingredient is soluble.
- Emulsifiers, stabilizers, humectants and antioxidants may also be included as well as agents imparting color or fragrance, if desired.
- Creams for topical application are formulated from a mixture of mineral oil, self-emulsifying beeswax and water in which mixture the active ingredient, dissolved in a small amount solvent (e.g. an oil), is admixed.
- administration by transdermal means may comprise a transdermal patch or dressing such as a bandage impregnated with an active ingredient and optionally one or more carriers or diluents known in the art.
- the dosage administration will, of course, be continuous rather than intermittent throughout the dosage regimen.
- the amounts of various compounds to be administered can be determined by standard procedures taking into account factors such as the compound IC 50 , the biological half-life of the compound, the age, size, and weight of the subject, and the indication being treated. The importance of these and other factors are well known to those of ordinary skill in the art.
- a dose will be between about 0.01 and 50 mg/kg, or 0 1 and 20 mg/kg of the subject being treated. Multiple doses may be used.
- the compounds of the disclosure may also be used in combination with other therapies for treating the same disease.
- Such combination use includes administration of the compounds and one or more other therapeutics at different times, or co-administration of the compound and one or more other therapies.
- dosage may be modified for one or more of the compounds of the disclosure or other therapeutics used in combination, e.g., reduction in the amount dosed relative to a compound or therapy used alone, by methods well known to those of ordinary skill in the art.
- use in combination includes use with other therapies, drugs, medical procedures etc., where the other therapy or procedure may be administered at different times (e.g. within a short time, such as within hours (e.g. 1, 2, 3, 4-24 hours), or within a longer time (e.g. 1-2 days, 2-4 days, 4-7 days, 1-4 weeks)) than a compound of the present disclosure, or at the same time as a compound of the disclosure.
- Use in combination also includes use with a therapy or medical procedure that is administered once or infrequently, such as surgery, along with a compound of the disclosure administered within a short time or longer time before or after the other therapy or procedure.
- the present disclosure provides for delivery of compounds of the disclosure and one or more other drug therapeutics delivered by a different route of administration or by the same route of administration.
- the use in combination for any route of administration includes delivery of compounds of the disclosure and one or more other drug therapeutics delivered by the same route of administration together in any formulation, including formulations where the two compounds are chemically linked in such a way that they maintain their therapeutic activity when administered.
- the other drug therapy may be co-administered with one or more compounds of the disclosure.
- Use in combination by co-administration includes administration of co-formulations or formulations of chemically joined compounds, or administration of two or more compounds in separate formulations within a short time of each other (e.g.
- Co-administration of separate formulations includes co-administration by delivery via one device, for example the same inhalant device, the same syringe, etc., or administration from separate devices within a short time of each other.
- Co-formulations of compounds of the disclosure and one or more additional drug therapies delivered by the same route includes preparation of the materials together such that they can be administered by one device, including the separate compounds combined in one formulation, or compounds that are modified such that they are chemically joined, yet still maintain their biological activity.
- Such chemically joined compounds may have a linkage that is substantially maintained in vivo, or the linkage may break down in vivo, separating the two active components.
- the patient is 60 years or older and relapsed after a first line cancer therapy. In certain embodiments, the patient is 18 years or older and is relapsed or refractory after a second line cancer therapy. In certain embodiments, the patient is 60 years or older and is primary refractory to a first line cancer therapy. In certain embodiments, the patient is 70 years or older and is previously untreated. In certain embodiments, the patient is 70 years or older and is ineligible and/or unlikely to benefit from cancer therapy.
- the therapeutically effective amount used in the methods provided herein is at least 10 mg per day. In certain embodiments, the therapeutically effective amount is 10, 50, 90, 100, 135, 150, 200, 250, 300, 350, 400, 450, 500, 600, 700, 800, 900, 1000, 1200, 1300, 1400, 1500, 1600, 1700, 1800, 1900, 2000, 2200, 2500 mg per dosage.
- the therapeutically effective amount is 10, 50, 90, 100, 135, 150, 200, 250, 300, 350, 400, 450, 500, 600, 700, 800, 900, 1000, 1200, 1300, 1400, 1500, 1600, 1700, 1800, 1900, 2000, 2200, 2500, 3000, 3500, 4000, 4500, 5000 mg per day or more.
- the compound is administered continuously.
- provided herein is a method for treating a diseases or condition mediated by Flt3 or oncogenic Flt3 by administering to a mammal having a disease or condition at least 10, 50, 90, 100, 135, 150, 200, 250, 300, 350, 400, 450, 500, 600, 700, 800, 900, 1000, 1200, 1300, 1400, 1500, 1600, 1700, 1800, 1900, 2000, 2200, 2500, 3000, 3500, 4000, 4500, 5000 mg per day of a compound of any of Formula I, Formula 1(a), Formula 11(a), Formula 11(b), Formula III, Formula IV, Formula V, and all sub-embodiments described herein, and all compounds described herein, including P-001-P-255 or any of the compounds described herein or a pharmaceutically acceptable salt or solvate thereof, and wherein the compound is administered on an empty stomach.
- the disease or condition in the methods provided herein is cancer. In certain embodiments, the disease or condition in the methods provided herein is a solid tumor. In yet another embodiment, the disease or condition in the methods provided herein is a blood-borne tumor. In yet another embodiment, the disease or condition is leukemia. In certain embodiments, the leukemia is acute myeloid leukemia. In certain embodiments, the leukemia is acute lymphocytic leukemia. In still another embodiment, the leukemia is a refractory or drug resistant leukemia.
- the drug resistant leukemia is drug resistant acute myeloid leukemia.
- the mammal having the drug resistant acute myeloid leukemia has an activating FLT3 mutation.
- the drug resistant acute myeloid leukemia has a FLT3 internal tandem duplication (ITD) mutation.
- the drug resistant acute myeloid leukemia has a FLT3 internal tandem duplication (ITD) mutation and a drug resistant D835Y mutation.
- the drug resistant acute myeloid leukemia has a FLT3 internal tandem duplication (ITD) mutation and a drug resistant F691L mutation.
- the drug resistant acute myeloid leukemia has a FLT3 internal tandem duplication (ITD) mutation and drug resistant D835Y and F691L mutations.
- Each method provided herein may further comprise administering a second therapeutic agent.
- the second therapeutic agent is an anticancer agent.
- the second therapeutic agent is a protein kinase inhibitor;
- a tyrosine kinase inhibitor ; and in yet another embodiment, a second FLT3 kinase inhibitor, including, but not limiting to, sunitinib, cediranib, cabozantinib, trametinib, dabrafenib, cobimetinib, ponatinib (AP24534), PHA-665752, Dovitinib (TKI258, CHIR-258), AC220 (quizartinib), TG101209 , KW-2449, AEE788 (NVP-AEE788), MP-470 (amuvatinib), TSU-68 (SU6668, orantinib, ENMD-2076, vatalanib dihydrochloride (
- the present disclosure provides a method for treating a subject suffering from or at risk of FLT3 protein kinase mediated diseases or conditions.
- the method includes administering to the subject an effective amount of one or more compounds from Formula 1, 1(a), 11(a), 11(b), III, IV, V, P-001-P-255, or a pharmaceutically acceptable salt, a solvate, a tautomer, an isomer or a deuterated analog thereof, or a pharmaceutical composition thereof.
- the method involves administering to the subject an effective amount of any one or more compound(s) as described herein in combination with one or more other therapies for the disease or condition.
- Non-limiting examples of a disease or condition mediated by a FLT3 protein kinase comprising administering to the subject an effective amount of a compound as described herein, or a pharmaceutically acceptable salt, deuterated analog, a tautomer or an isomer thereof, or a pharmaceutical composition of said compound, wherein the disease or condition is selected from acute myeloid leukemia, stem cell ablation and myelopreparation for stem cell transplant, primary progressive multiple sclerosis, complex regional pain syndrome, reflex sympathetic dystrophy, muscular dystrophy, duchenne muscular dystrophy, causalgia, neuro-inflammation, neuroinflammatory disorders, benign forgetfulness, HIV, binswager type dementia, dementia with lewy bodie, prosencephaly, microencepahy, cerebral palsy, congenital hydrocephalus, abdominal dropsy, progressive supranuclear palsy, glaucoma, addiction disorders, dependencies, alcoholism, tremors, Wilson's disease, vascular dementias, multi infarc
- the FLT3 kinase is a mutated form.
- the FLT3 Kinase mutation is FLT3 internal tandem duplication (ITD) mutation.
- the FLT3 mutation further includes D835Y, F691L or both D835Y and F691L.
- the disease or condition is selected from acute myeloid leukemia, acute lymphocytic leukemia or chronic myelogenous leukemia.
- the present disclosure provides a method for inhibiting mutant FLT3 kinase, such as FLT3 ITD and drug resistant FLT3 mutants such as D835Y and F691L.
- the method includes contacting one or more compounds from Formula 1, 1(a), 11(a), 11(b), III, IV, V, P-001-P-255, or a pharmaceutically acceptable salt, a solvate, a tautomer, an isomer or a deuterated analog thereof, or a pharmaceutical composition thereof, with a cell or a FLT3 mutant protein kinase either in vitro or in vivo.
- the present disclosure provides use of one or more compounds from Formula 1, 1(a), 11(a), 11(b), III, IV, V, P-001-P-255, or a pharmaceutically acceptable salt, a solvate, a tautomer, an isomer or a deuterated analog thereof, or a
- the present disclosure provides a compound of any of Formula 1, 1(a), 11(a), 11(b), III, IV, V, and all sub -embodiments described herein, and all compounds described herein, including P-001-P-255, or a composition comprising any of the compounds described herein or a pharmaceutically acceptable salt or a solvate thereof for use in treating a disease or condition as described herein.
- Protein kinase modulators may be usefully combined with another pharmacologically active compound, or with two or more other pharmacologically active compounds, particularly in the treatment of cancer.
- the composition includes any one or more compound(s) as described herein along with one or more compounds that are therapeutically effective for the same disease indication, wherein the compounds have a synergistic effect on the disease indication.
- the composition includes any one or more compound(s) as described herein effective in treating a cancer and one or more other compounds that are effective in treating the same cancer, further wherein the compounds are synergistically effective in treating the cancer.
- the present disclosure provides a composition comprising one or more compounds from Formula 1, 1(a), 11(a), 11(b), III, IV, V, P-001-P-255, or a
- the one or more agents are selected from an alkylating agent, including, but not limited to, adozelesin, altretamine, bendamustine, bizelesin, busulfan, carboplatin, carboquone, carmofur, carmustine, chlorambucil, cisplatin, cyclophosphamide, dacarbazine, estramustine, etoglucid, fotemustine, hepsulfam, ifosfamide, improsulfan, irofulven, lomustine, mannosulfan, mechlorethamine, melphalan, mitobronitol, nedaplatin, nimustine, oxaliplatin, piposulfan, prednimustine, procarbazin
- an alkylating agent including, but not limited to, adozelesin, altretamine, bendamustine, bizelesin, busulfan, carboplatin,
- alpha., and interleukin-2; and other chemotherapeutics including, but not limited to 3-AP (3-amino-2- carboxyaldehyde thiosemicarbazone), altrasentan, aminoglutethimide, anagrelide, asparaginase, bryostatin-1, cilengitide, elesclomol, eribulin mesylate (E7389), ixabepilone, lonidamine, masoprocol, mitoguanazone, oblimersen, sulindac, testolactone, tiazofurin, mTOR inhibitors (e.g., 3-AP (3-amino-2- carboxyaldehyde thiosemicarbazone), altrasentan, aminoglutethimide, anagrelide, asparaginase, bryostatin-1, cilengitide, elesclomol, eribulin mesylate (E7389),
- PI3K inhibitors e.g. BEZ235, GDC-0941, XL 147, XL765
- Cdk4 inhibitors e.g. PD-332991
- Akt inhibitors e.g. Akt inhibitors
- Hsp90 inhibitors e.g. tanespimycin
- farnesyltransferase inhibitors e.g.
- MEK inhibitors e.g., AS703026, AZD6244 (selumetinib), AZD8330, BIX02188, C11040 (PD184352), D-87503, GSK1120212 (JTP- 74057), PD0325901, PD318088, PD98059, PDEA119 (BAY 869766), TAK-733).
- each method provided herein may further comprise administering a second therapeutic agent.
- the second therapeutic agent is an anticancer agent.
- the second therapeutic agent is a protein kinase inhibitor; In certain embodiments, a tyrosine kinase inhibitor; and in yet another embodiment, a second FLT3 kinase inhibitor, including, but not limiting to, Sunitinib, Cediranib, XL- 184 free base (Cabozantinib, Ponatinib (AP24534), PHA-665752, Dovitinib (TKI258, CHIR-258), AC220 (Quizartinib), TGI 01209 , KW-2449, AEE788 (NVP-AEE788), MP-470 (Amuvatinib), TSU-68 (SU6668, Orantmib, ENMD-2076, Vatalamb dihydrochloride (PTK787) and
- the present disclosure provides methods for treating a disease or condition mediated by FLT3 kinase, including mutant FLT3 kinase (such as FLT3 ITD and drug resistant FLT3 mutants such as D835Y and F691L), by administering to the subject an effective amount of a composition including any one or more compound(s) as described herein in combination with one or more other suitable therapies for treating the disease.
- FLT3 kinase including mutant FLT3 kinase (such as FLT3 ITD and drug resistant FLT3 mutants such as D835Y and F691L)
- the present disclosure provides a method of treating a cancer in a subject in need thereof by administering to the subject an effective amount of a composition including any one or more compound(s) as described herein in combination with one or more other therapies or medical procedures effective in treating the cancer.
- Other therapies or medical procedures include suitable anticancer therapy (e.g. drug therapy, vaccine therapy, gene therapy, photodynamic therapy) or medical procedure (e.g. surgery, radiation treatment, hyperthermia heating, bone marrow or stem cell transplant).
- the one or more suitable anticancer therapies or medical procedures is selected from treatment with a chemotherapeutic agent (e.g. chemotherapeutic drug), radiation treatment (e.g.
- x-ray, gamma -ray, or electron, proton, neutron, or .alpha, particle beam hyperthermia heating (e.g. microwave, ultrasound, radiofrequency ablation),
- Vaccine therapy e.g. AFP gene hepatocellular carcinoma vaccine, AFP adenoviral vector vaccine, AG-858, allogeneic GM-CSF-secretion breast cancer vaccine, dendritic cell peptide vaccines
- gene therapy e.g. Ad5CMV-p53 vector, adenovector encoding MDA7, adenovirus 5-tumor necrosis factor alpha
- photodynamic therapy e.g. aminolevulinic acid, motexatin lutetium
- kits that include one or more compounds from Formula 1, 1(a), 11(a), 11(b), III, IV, V, P-001-P-255, or a pharmaceutically acceptable salt, a solvate, a tautomer, an isomer or a deuterated analog thereof, or a pharmaceutical composition thereof.
- the compound or composition is packaged, e.g., in a vial, bottle, flask, which may be further packaged, e.g., within a box, envelope, or bag; the compound or composition is approved by the U.S.
- kits described herein may include written instructions for use and/or other indication that the compound or composition is suitable or approved for administration to a mammal, e.g., a human, for a Raf protein kinase-mediated disease or condition; and the compound or composition may be packaged in unit dose or single dose form, e.g., single dose pills, capsules, or the like.
- Another aspect of the disclosure relates to a method of (1) identifying the presence of a tumor in a patient; and (2) treating the patient, identified as needing the treatment, by administering a therapeutically effective amount of one or more compounds of Formula 1, 1(a), 11(a), 11(b), III, IV, V, P-001-P-255, or a pharmaceutically acceptable salt, a solvate, a tautomer, an isomer or a deuterated analog thereof, or a pharmaceutical composition thereof.
- the tumor can be identified by employing a tumor biomarker. Tumor biomarkers can also be useful in establishing a specific diagnosis, such as determining whether tumors are of primary or metastatic origin.
- chromosomal alterations found on cells located in the primary tumor site can be screened against those found in the secondary site. If the alterations match, the secondary tumor can be identified as metastatic; whereas if the alterations differ, the secondary tumor can be identified as a distinct primary tumor.
- the tumor can be identified by a biopsy.
- biopsies that can be employed include .fine needle aspiration biopsy, a core needle biopsy, a vacuum-assisted biopsy, an image-guided biopsy, a surgical biopsy, an incisional biopsy, an endoscopic biopsy, a bone marrow biopsy.
- the identification of tumor can be by magnetic resonance imaging (MRI) is a test that uses magnetic fields to produce detailed images of the body.
- MRI magnetic resonance imaging
- the identification of tumor can be by a bone scan.
- the identification of tumor can be a computed tomography (CT) scan, also called a CAT scan.
- CT computed tomography
- the identification of tumor can be by an integrated PET-CT scan combines images from a positron emission tomography (PET) scan and a computed tomography (CT) scan that have been performed at the same time using the same machine.
- PET positron emission tomography
- CT computed tomography
- the identification of tumor can be by an ultrasound, which is an imaging test that uses high-frequency sound waves to locate a tumor inside the body.
- companion diagnostics that can be used to help treat patients, as a form of personalized medicine can be employed by identifying a patient having a Flt3 mutant that is encoded by a Flt3 gene having an ITD mutation.
- the companion diagnostic that can be used to help treat patients, as a form of personalized medicine can be employed by identifying a patient having an oncogenic Flt3 mutant that is encoded by a Flt3 gene having an ITD mutation and a drug resistant F691L mutation.
- the companion diagnostic that can be used to help treat patients, as a form of personalized medicine can be employed by identifying a patient having an oncogenic Flt3 mutant that is encoded by a Flt3 gene having n ITD mutation and a D835Y drug resistant mutation.
- the companion diagnostic that can be used to help treat patients, as a form of personalized medicine can be employed by identifying a patient having an oncogenic Flt3 mutant that is encoded by a Flt3 gene having an ITD mutation, a drug resistant F691L mutation, and a D835Y drug resistant mutation.
- nucleic acids such as, e.g., subcloning, labeling probes (e.g. random-primer labeling using Klenow polymerase, nick translation, amplification), sequencing, hybridization and the like are well described in the scientific and patent literature, see, e.g., Sambrook, ed., Molecular Cloning: a Laboratory Manual (2nd ed ), Vols. 1-3, Cold Spring Harbor Laboratory, (1989); Current Protocols in Molecular Biology, Ausubel, ed. John Wiley & Sons, Inc., New York (1997), Laboratory Techniques in Biochemistry and Molecular Biology: Hybridization With Nucleic Acid Probes, Part I. Theory and Nucleic Acid Preparation, Tijssen, ed. Elsevier, N.Y. (1993).
- labeling probes e.g. random-primer labeling using Klenow polymerase, nick translation, amplification
- sequencing hybridization and the like
- Nucleic acid sequences can be amplified as necessary for further use using amplification methods, such as PCR, isothermal methods, rolling circle methods, etc., are well known to the skilled artisan. See, e.g., Saiki, "Amplification of Genomic DNA” in PCR
- Nucleic acids, vectors, capsids, polypeptides, and the like can be analyzed and quantified by any of a number of general means well known to those of skill in the art. These include, e.g., analytical biochemical methods such as NMR, spectrophotometry, radiography, electrophoresis, capillary electrophoresis, high performance liquid chromatography (HPLC), thin layer chromatography (TLC), and hyperdiffusion chromatography, various immunological methods, e.g.
- nucleic acids used to practice the methods of the disclosure can be performed by cloning from genomic samples, and, if desired, screening and re- cloning inserts isolated or amplified from, e g , genomic clones or cDNA clones.
- Sources of nucleic acid used in the methods of the present disclosure include genomic or cDNA libraries contained in, e.g., mammalian artificial chromosomes (MACs), see, e.g., U. S. Patent Nos. 5,721, 1 18; 6,025, 155; human artificial chromosomes, see, e.g., Rosenfeld (1997) Nat. Genet.
- MACs mammalian artificial chromosomes
- yeast artificial chromosomes YAC
- bacterial artificial chromosomes BAC
- PI artificial chromosomes see, e.g., Woon (1998) Genomics 50:306-316
- Pl-derived vectors see, e.g., Kern (1997) Biotechniques 23 : 120-124; cosmids, recombinant viruses, phages or plasmids.
- a promoter can be one motif or an array of nucleic acid control sequences which direct transcription of a nucleic acid.
- a promoter can include necessary nucleic acid sequences near the start site of transcription, such as, in the case of a polymerase II type promoter, a TATA element
- a promoter also optionally includes distal enhancer or repressor elements which can be located as much as several thousand base pairs from the start site of transcription.
- a "constitutive" promoter is a promoter which is active under most environmental and developmental conditions.
- An “inducible” promoter is a promoter which is under environmental or developmental regulation.
- tissue specific promoter is active in certain tissue types of an organism, but not in other tissue types from the same organism.
- operably linked refers to a functional linkage between a nucleic acid expression control sequence (such as a promoter, or array of transcription factor binding sites) and a second nucleic acid sequence, wherein the expression control sequence directs transcription of the nucleic acid corresponding to the second sequence.
- nucleic acids used to practice the methods of the present disclosure can also be provided in expression vectors and cloning vehicles, e.g., sequences encoding the polypeptides used to practice the methods of the present disclosure.
- Expression vectors and cloning vehicles used to practice the methods of the present disclosure can comprise viral particles, baculovirus, phage, plasmids, phagemids, cosmids, fosmids, bacterial artificial chromosomes, viral DNA (e.g.
- Vectors used to practice the methods of the present disclosure can include chromosomal, non-chromosomal and synthetic DNA sequences. Large numbers of suitable vectors are known to those of skill in the art, and are commercially available.
- nucleic acids used to practice the methods of the present disclosure can be cloned, if desired, into any of a variety of vectors using routine molecular biological methods; methods for cloning in vitro amplified nucleic acids are described, e.g. , U.S. Pat. No. 5,426,039.
- restriction enzyme sites can be "built into” a PCR primer pair.
- Vectors may be introduced into a genome or into the cytoplasm or a nucleus of a cell and expressed by a variety of conventional techniques, well described in the scientific and patent literature. See, e.g., Roberts (1987) Nature 328:731; Schneider (1995) Protein Expr. Purif.
- the vectors can be isolated from natural sources, obtained from such sources as ATCC or GenBank libraries, or prepared by synthetic or recombinant methods.
- the nucleic acids used to practice the methods of the present disclosure can be expressed in expression cassettes, vectors or viruses which are stably or transiently expressed in cells (e.g. episomal expression systems).
- Selection markers can be incorporated into expression cassettes and vectors to confer a selectable phenotype on transformed cells and sequences. For example, selection markers can code for episomal maintenance and replication such that integration into the host genome is not required.
- the nucleic acids used to practice the methods of the present disclosure are administered in vivo for in situ expression of the peptides or polypeptides used to practice the methods of the disclosure.
- the nucleic acids can be administered as "naked DNA” (see, e.g., U. S. Patent No. 5,580,859) or in the form of an expression vector, e.g., a recombinant virus.
- the nucleic acids can be administered by any route, including peri- or intra-tumorally, as described below.
- Vectors administered in vivo can be derived from viral genomes, including recombinantly modified enveloped or non-enveloped DNA and RNA viruses, selected from baculoviridiae, parvoviridiae, picornoviridiae, herpesveridiae, poxviridae, adenoviridiae, or picornnaviridiae. Chimeric vectors may also be employed which exploit advantageous merits of each of the parent vector properties (See e.g., Feng (1997) Nature Biotechnology 15:866-870). Such viral genomes may be modified by recombinant DNA techniques to include the nucleic acids used to practice the methods of the present disclosure; and may be further engineered to be replication deficient, conditionally replicating or replication competent.
- vectors are derived from the adenoviral (e.g. replication incompetent vectors derived from the human adenovirus genome, see, e.g., U.S. Patent os. 6,096,718; 6,110,458; 6,113,913;
- Retroviral vectors can include those based upon murine leukemia virus (MuLV), gibbon ape leukemia virus (GaLV), Simian Immuno deficiency virus (SIV), human immuno deficiency virus (HIV), and combinations thereof; see, e.g., U.S. Patent Nos. 6,117,681; 6,107,478; 5,658,775; 5,449,614; Buchscher (1992) J. Virol. 66:2731-2739; Johann (1992) J. Virol. 66: 1635-1640).
- MuLV murine leukemia virus
- GaLV gibbon ape leukemia virus
- SIV Simian Immuno deficiency virus
- HAV human immuno deficiency virus
- Adeno-associated virus (AAV)-based vectors can be used to transduce cells with target nucleic acids, e.g., in the in vitro production of nucleic acids and peptides, and in in vivo and ex vivo gene therapy procedures, see, e.g., U. S. Patent Nos. 6, 1 10,456; 5,474,935; Okada (1996) Gens Ther. 3 :957-964.
- the present disclosure also relates to use of fusion proteins, and nucleic acids encoding them.
- a polypeptide used to practice the methods of the present disclosure can be fused to a heterologous peptide or polypeptide, such as N-terminal identification peptides which impart desired characteristics, such as increased stability or simplified purification.
- Peptides and polypeptides used to practice the methods of the present disclosure can also be synthesized and expressed as fusion proteins with one or more additional domains linked thereto for, e.g., producing a more immunogenic peptide, to more readily isolate a recombinantly synthesized peptide, to identify and isolate antibodies and antibody-expressing B cells, and the like.
- Detection and purification facilitating domains include, e.g., metal chelating peptides such as polyhistidine tracts and histidine-tryptophan modules that allow purification on immobilized metals, protein A domains that allow purification on immobilized immunoglobulin, and the domain utilized in the FLAGS extension/affinity purification system (Immunex Corp, Seattle WA).
- metal chelating peptides such as polyhistidine tracts and histidine-tryptophan modules that allow purification on immobilized metals
- protein A domains that allow purification on immobilized immunoglobulin
- the domain utilized in the FLAGS extension/affinity purification system Immunex Corp, Seattle WA.
- the inclusion of a cleavable linker sequences such as Factor Xa or enterokinase
- an expression vector can include an epitope- encoding nucleic acid sequence linked to six histidine residues followed by a thioredoxin and an enterokinase cleavage site (see e.g., Williams (1995) Biochemistry 34: 1787-1797; Dobeli (1998) Protein Expr. Purif. 12:404-414).
- the histidine residues facilitate detection and purification while the enterokinase cleavage site provides a means for purifying the epitope from the remainder of the fusion protein.
- a nucleic acid encoding a polypeptide used to practice the methods of the present disclosure is assembled in appropriate phase with a leader sequence capable of directing secretion of the translated polypeptide or fragment thereof.
- nucleic acids and polypeptides used to practice the methods of the present disclosure can be bound to a solid support, e.g., for use in screening and diagnostic methods.
- Solid supports can include, e.g., membranes (e.g. nitrocellulose or nylon), a microtiter dish (e.g. PVC, polypropylene, or polystyrene), a test tube (glass or plastic), a dip stick (e.g.
- One solid support uses a metal (e.g. cobalt or nickel)-comprising column which binds with specificity to a histidine tag engineered onto a peptide.
- a metal e.g. cobalt or nickel
- Adhesion of molecules to a solid support can be direct (i.e., the molecule contacts the solid support) or indirect (a "linker” is bound to the support and the molecule of interest binds to this linker).
- Molecules can be immobilized either covalently (e.g. utilizing single reactive thiol groups of cysteine residues (see, e.g., Colliuod (1993) Bioconjugate Chem. 4:528-536) or non- covalently but specifically (e.g. via immobilized antibodies (see, e.g., Schuhmann (1991) Adv. Mater. 3 :388-391; Lu (1995) Anal. Chem.
- Indirect binding can be achieved using a variety of linkers which are commercially available.
- the reactive ends can be any of a variety of functionalities including, but not limited to: amino reacting ends such as N-hydroxysuccinimide (NHS) active esters, imidoesters, aldehydes, epoxides, sulfonyl halides, isocyanate, isothiocyanate, and nitroaryl halides; and thiol reacting ends such as pyridyl disulfides, maleimides, thiophthalimides, and active halogens.
- NHS N-hydroxysuccinimide
- thiol reacting ends such as pyridyl disulfides, maleimides, thiophthalimides, and active halogens.
- heterobifunctional crosslinking reagents have two different reactive ends, e.g., an amino- reactive end and a thiol -reactive end, while homobifunctional reagents have two similar reactive ends, e.g., bismaleimidohexane ( ⁇ ) which permits the cross-linking of sulfhydryl- containing compounds.
- the spacer can be of varying length and be aliphatic or aromatic.
- homobifunctional cross-linking reagents include, but are not limited to, the imidoesters such as dimethyl adipimidate dihydrochloride (DMA); dimethyl pimelimidate dihydrochloride (DMP); and dimethyl suberimidate dihydrochloride (DMS).
- DMA dimethyl adipimidate dihydrochloride
- DMP dimethyl pimelimidate dihydrochloride
- DMS dimethyl suberimidate dihydrochloride
- Heterobifunctional reagents include commercially available active halogen-NHS active esters coupling agents such as N-succinimidyl bromoacetate and N-succinimidyl (4- iodoacetyl)aminobenzoate (SIAB) and the sulfosuccinimidyl derivatives such as
- sulfosuccinimidyl(4-iodoacetyl)aminobenzoate (sulfo-SIAB) (Pierce).
- Another group of coupling agents is the heterobifunctional and thiol cleavable agents such as N-succinimidyl 3- (2-pyridyidithio)propionate (SPDP) (Pierce Chemicals, Rockford, IL).
- Antibodies can also be used for binding polypeptides and peptides used to practice the methods of the present disclosure to a solid support. This can be done directly by binding peptide-specific antibodies to the column or it can be done by creating fusion protein chimeras comprising motif-containing peptides linked to, e.g., a known epitope (e.g. a tag (e.g. FLAG, myc) or an appropriate immunoglobulin constant domain sequence (an "immunoadhesin,” see, e.g., Capon (1989) Nature 377:525-531 (1989).
- a known epitope e.g. a tag (e.g. FLAG, myc)
- an appropriate immunoglobulin constant domain sequence an "immunoadhesin," see, e.g., Capon (1989) Nature 377:525-531 (1989).
- Nucleic acids or polypeptides used to practice the methods of the present disclosure can be immobilized to or applied to an array.
- Arrays can be used to screen for or monitor libraries of compositions (e.g. small molecules, antibodies, nucleic acids, etc.) for their ability to bind to or modulate the activity of a nucleic acid or a polypeptide used to practice the methods of the present disclosure.
- a monitored parameter is transcript expression of a gene comprising a nucleic acid used to practice the methods of the present disclosure.
- One or more, or all the transcripts of a cell can be measured by hybridization of a sample comprising transcripts of the cell, or nucleic acids representative of or
- arrays complementary to transcripts of a cell, by hybridization to immobilized nucleic acids on an array, or "biochip.”
- arrays comprising genomic nucleic acid can also be used to determine the genotype of a newly engineered strain made by the methods of the present disclosure.
- Polypeptide arrays can also be used to simultaneously quantify a plurality of proteins.
- array or “microarray” or “biochip” or “chip” as used herein is a plurality of target elements, each target element comprising a defined amount of one or more
- any known array and/or method of making and using arrays can be incorporated in whole or in part, or variations thereof, as described, for example, in U.S. Patent Nos. 6,277,628; 6,277,489; 6,261,776; 6,258,606; 6,054,270; 6,048,695; 6,045,996; 6,022,963; 6,013,440; 5,965,452; 5,959,098; 5,856, 174;
- the present disclosure also provides a transformed cell comprising a nucleic acid sequence used to practice the methods of the present disclosure, e.g., a sequence encoding a polypeptide used to practice the methods of the present disclosure, or a vector used to practice the methods of the present disclosure.
- the host cell may be any of the host cells familiar to those skilled in the art, including prokaryotic cells, eukaryotic cells, such as bacterial cells, fungal cells, yeast cells, mammalian cells, insect cells, or plant cells.
- Exemplary bacterial cells include E. coll, Streptomyces, Bacillus subtilis, Salmonella typhimurium and various species within the genera Pseudomonas, Streptomyces, and Staphylococcus.
- Exemplary insect cells include Drosophila S2 and Spodoptera Sf9.
- Exemplary animal cells include CHO, COS or Bowes melanoma or any mouse or human cell line. The selection of an appropriate host is within the abilities of those skilled in the
- Vectors may be introduced into the host cells using any of a variety of techniques, including transformation, transfection, transduction, viral infection, gene guns, or Ti-mediated gene transfer. Particular methods include calcium phosphate transfection, DEAE-Dextran mediated transfection, lipofection, or electroporation.
- Engineered host cells can be cultured in conventional nutrient media modified as appropriate for activating promoters, selecting transformants or amplifying the genes used to practice the methods of the present disclosure Following transformation of a suitable host strain and growth of the host strain to an appropriate cell density, the selected promoter may be induced by appropriate means (e.g. temperature shift or chemical induction) and the cells may be cultured for an additional period to allow them to produce the desired polypeptide or fragment thereof.
- appropriate means e.g. temperature shift or chemical induction
- Cells can be harvested by centrifugation, disrupted by physical or chemical means, and the resulting crude extract is retained for further purification.
- Microbial cells employed for expression of proteins can be disrupted by any convenient method, including freeze-thaw cycling, sonication, mechanical disruption, or use of cell lysing agents. Such methods are well known to those skilled in the art.
- the expressed polypeptide or fragment can be recovered and purified from recombinant cell cultures by methods including ammonium sulfate or ethanol precipitation, acid extraction, anion or cation exchange chromatography, phosphocellulose chromatography, hydrophobic interaction chromatography, affinity chromatography, hydroxylapatite chromatography and lectin chromatography. Protein refolding steps can be used, as necessary, in completing configuration of the polypeptide. If desired, high performance liquid chromatography (HPLC) can be employed for final purification steps.
- HPLC high performance liquid chromatography
- mammalian cell culture systems can also be employed to express recombinant protein.
- mammalian expression systems include the COS-7 lines of monkey kidney fibroblasts and other cell lines capable of expressing proteins from a compatible vector, such as the CI 27, 3T3, CHO, HeLa and BHK cell lines.
- the constructs in host cells can be used in a conventional manner to produce the gene product encoded by the recombinant sequence.
- the polypeptides produced by host cells containing the vector may be glycosylated or may be non-glycosylated.
- Polypeptides used to practice the methods of the present disclosure may or may not also include an initial methionine amino acid residue.
- Cell-free translation systems can also be employed to produce a polypeptide used to practice the methods of the present disclosure.
- Cell-free translation systems can use mRNAs transcribed from a DNA construct comprising a promoter operably linked to a nucleic acid encoding the polypeptide or fragment thereof.
- the DNA construct may be linearized prior to conducting an in vitro transcription reaction.
- the transcribed mRNA is then incubated with an appropriate cell-free translation extract, such as a rabbit reticulocyte extract, to produce the desired polypeptide or fragment thereof.
- the expression vectors can contain one or more selectable marker genes to provide a phenotypic trait for selection of transformed host cells such as dihydrofolate reductase or neomycin resistance for eukaryotic cell culture, or such as tetracycline or ampicillin resistance in E. coli.
- cDNA encoding a polypeptide of interest may be incorporated into a mammalian expression vector, e.g. pcDNAl, which is available commercially from Invitrogen Corporation (San Diego, Calif, U.S.A.; catalogue number V490- 20).
- a polylinker is located appropriately downstream of the CMV promoter (and 3' of the T7 promoter).
- the cDNA insert may be first released from the above phagemid incorporated at appropriate restriction sites in the pcDNAI polylinker. Sequencing across the junctions may be performed to confirm proper insert orientation in pcDNAI. The resulting plasmid may then be introduced for transient expression into a selected mammalian cell host, for example, the monkey-derived, fibroblast like cells of the COS-1 lineage (available from the American Type Culture Collection, ockville, Md. as ATCC CRL 1650).
- COS-1 cells may be transfected with approximately 8 ⁇ g DNA per 10 6 COS cells, by DEAE-mediated DNA transfection and treated with chloroquine according to the procedures described by Sambrook et al, Molecular Cloning: A Laboratory Manual, 1989, Cold Spring Harbor Laboratory Press, Cold Spring Harbor N.Y, pp. 16 30-16.37.
- An exemplary method is as follows. Briefly, COS-1 cells are plated at a density of 5 x 10 6 cells/dish and then grown for 24 hours in FBS-supplemented DMEM F12 medium. Medium is then removed and cells are washed in PBS and then in medium.
- a transfection solution containing DEAE dextran (0.4 mg/mL), 100 uM chloroquine, 10% NuSerum, DNA (0.4 mg/mL) in DMEM/F12 medium is then applied on the cells 10 mL volume. After incubation for 3 hours at 37 °C, cells are washed in PBS and medium as just described and then shocked for 1 minute with 10% DMSO in DMEM F12 medium. Cells are allowed to grow for 2-3 days in 10% FBS-supplemented medium, and at the end of incubation dishes are placed on ice, washed with ice cold PBS and then removed by scraping. Cells are then harvested by centrifugation at 1000 rpm for 10 minutes and the cellular pellet is frozen in liquid nitrogen, for subsequent use in protein expression. Northern blot analysis of a thawed aliquot of frozen cells may be used to confirm expression of receptor-encoding cDNA in cells under storage.
- stably transfected cell lines can also prepared, for example, using two different cell types as host: CHO Kl and CHO Pro5.
- cDNA coding for the relevant protein may be incorporated into the mammalian expression vector pRC/CMV (Invitrogen), which enables stable expression. Insertion at this site places the cDNA under the expression control of the cytomegalovirus promoter and upstream of the polyadenylation site and terminator of the bovine growth hormone gene, and into a vector background comprising the neomycin resistance gene (driven by the SV40 early promoter) as selectable marker.
- An exemplary protocol to introduce plasmids constructed as described above is as follows.
- the host CHO cells are first seeded at a density of 5xl0 5 in 10% FBS-supplemented MEM medium. After growth for 24 hours, fresh medium is added to the plates and three hours later, the cells are transfected using the calcium phosphate-DNA co-precipitation procedure (Sambrook et al, supra). Briefly, 3 ⁇ g of DNA is mixed and incubated with buffered calcium solution for 10 minutes at room temperature. An equal volume of buffered phosphate solution is added and the suspension is incubated for 15 minutes at room temperature. Next, the incubated suspension is applied to the cells for 4 hours, removed and cells were shocked with medium containing 15% glycerol.
- MS mass spectra
- ESI electrospray ionization
- Preparative reverse phase HPLC was typically performed using a Varian HPLC system equipped with a Phenomenex phenylhexyl, a Phenomenex Luna CI 8, or a Varian Pursuit diphenyl reverse phase column.
- Typical elution conditions utilized a gradient containing an increasing composition of organic cosolvent (0.05% ACOH/CH 3 CN, 0.05% AcOH/MeOH, 0.05% HC0 2 H/CH 3 CN, or 0.05% HC0 2 H/MeOH) to aqueous cosolvent (0.05% aq AcOH or 0.05% aq HC0 2 H).
- Silica gel chromatography was either performed manually using methodology analogous to the published procedure for flash chromatography (Still et al. (1978) J. Org. Chem. 43 :2923), or on an automated system (for example, Biotage SP instrument) using pre-packed silica gel columns.
- the functional groups of intermediate compounds may need to be protected by suitable protecting groups.
- suitable protecting groups include hydroxy, amino, mercapto and carboxylic acid.
- Suitable protecting groups for hydroxy include trialkylsilyl or diarylalkylsilyl ⁇ e.g., t- butyldimethylsilyl, ⁇ -butyldiphenylsilyl or trimethylsilyl), tetrahydropyranyl, benzyl, and the like.
- Suitable protecting groups for amino, amidino and guanidino include ?-butoxycarbonyl, benzyloxycarbonyl, and the like.
- Suitable protecting groups for mercapto include -C(0)-R (where R is alkyl, aryl or aralkyl), /?-methoxybenzyl, trityl and the like.
- Suitable protecting groups for carboxylic acid include alkyl, aryl or aralkyl esters.
- Protecting groups may be added or removed in accordance with standard techniques, which are well-known to those skilled in the art and as described herein. The use of protecting groups is described in detail in Green, T.W. and P.G.M. Wutz, Protective Groups in Organic Synthesis (1991), 2nd Ed., Wiley-Interscience.
- the biaryl acetamide compounds of Formula I may be routinely prepared according to the synthetic route outlined in Scheme 1, wherein the variables G and W are leaving groups, which can include but are not limited to halo or sulfonate groups and the remaining variables are as defined for compounds of Formula I.
- the halogen/sulfonate- substituted compounds 1 can participate in Suzuki couplings with 4,4,4',4',5,5,5',5'-octamethyl- 2,2'-bi(l,3,2-dioxaborolane) in a reaction promoted by a catalyst such as, but not limited to, tetrakis(triphenylphosphine)palladium or [1, 1 - bis(diphenylphosphino)ferrocene]dichloropalladium(II), and promoted by a base such as, but not limited to, KOAc or NaOAc, in a solvent such as, but not limited to, DMF or 1,4-dioxane to give the aryl acetic acid boronic ester derivatives 2.
- a catalyst such as, but not limited to, tetrakis(triphenylphosphine)palladium or [1, 1 - bis(diphenylphosphino)ferrocene]dichlor
- the optionally substituted aryl or heteroaryl amines 3 can be condensed with the dioxaborolane-substituted phenylacetic acids 2 using an amide coupling reagent such as, but not limited to, T3P, EDCI or HATU, to give the phenyl acetamide derivatives 4.
- the condensation can be conducted in a solvent such as, but not limited to, EtOAc, THF or DMF, and is promoted with a base such as, but not limited to, pyridine, DIEA or DMAP, and by heating as necessary at an elevated temperature.
- the resulting boronic esters 4 can then be coupled with halogen/sulfonate-substituted azines 5 using a Pd- catalyzed Suzuki coupling protocol to give the biaryl acetamide derivatives 6a.
- the coupling reaction can be promoted with a catalyst such as, but not limited to, Pd(PPh 3 ) 4 or Pd(dppf)Cl 2 , can be conducted in a solvent such as, but not limited to, CH 3 CN or 1,4-dioxane, and can be promoted with a base such as, but not limited to, aq Na 2 CC>3 or CsF, and by heating as necessary at an elevated temperature either with an oil bath or in a microwave reactor.
- a catalyst such as, but not limited to, Pd(PPh 3 ) 4 or Pd(dppf)Cl 2
- a solvent such as, but not limited to, CH 3 CN or 1,4-dioxane
- a base such as,
- Biaryl acetamide derivatives 6a can also be converted to the corresponding biaryl thioamide derivatives 6b in the presence of a thionating reagent, including but not limited to Lawesson's reagent.
- R 2 may contain protecting groups such as, but not limited to, Boc group for amines, or acyl or silyl groups for alcohol. When present, these protecting groups can be removed using standard deprotecting procedures such as, but not limited to, TFA/DCM for removing the Boc group, NaOH in MeOH for removing acyl groups, or TBAF in THF for the removal of sily protecting groups.
- the biaryl acetamide and biaryl thioamide compounds of Formula I may be routinely prepared according to the synthetic route outlined in Scheme 2, wherein the variables G and W are leaving groups, which can include but are not limited to halo or sulfonate groups and the remaining variables are as defined for compounds of Formula I
- Phenylacetic acids 1 can be converted to the corresponding acid chlorides 7 using a reagent such as, but not limited to, SOCI 2 or (COCl) 2 .
- the reaction can be conducted in a solvent such as, but not limited to, DCM or benzene, and promoted with a catalyst such as, but not limited to, DMF or DMA, and by heating as necessary at an elevated temperature.
- the optionally substituted aryl or heteroaryl amines 3 can be condensed with phenylacetyl chlorides 7 to afford phenyl acetamides 8 in the presence of a base such as, but not limited to, pyridine, lutidine, or DEEA.
- a base such as, but not limited to, pyridine, lutidine, or DEEA.
- the reaction can be conducted in a solvent such as, but not limited to, DCM, THF, or C3 ⁇ 4CN and promoted with a catalyst such as, but not limited to, DMAP, and by heating as necessary at elevated temperatures.
- halogen/sulfonate-substituted azines 5 can be converted to boronic ester derivatives 9 using a Pd-catalyzed Suzuki coupling protocol as described in Scheme 1.
- halogen-substituted azine derivatives 5 may be routinely prepared according to the synthetic routes outlined in Scheme 3, wherein Z is halo, and the remainder of the variables are as delineated for compounds of Formula I.
- the halo substituted azines 10 could undergo nucleophilic substitution with aryl or heteroaryl amines 11 to give azines 5.
- the reaction can be conducted in solvents such as, but not limited to, DMSO or DMF, promoted with base such as, but not limited to, DIEA or NaH or NaiCC , and can be promoted by heating at elevated temperatures using an oil bath or in a microwave reactor.
- nucleophilic substitution could be promoted with acid such as, but not limited to, HC1 or TFA, in solvent such as, but not limited to, z ' -PrOH or 1,4-dioxane, with heating.
- acid such as, but not limited to, HC1 or TFA
- solvent such as, but not limited to, z ' -PrOH or 1,4-dioxane
- halo substituted azine derivatives 12 could be coupled with aryl or heteroaryl amines 11 using Buchwald-Hartwig coupling conditions to give azine derivatives 13.
- the coupling reaction can be catalyzed with catalysts such as, but not limited to, Pd(OAc)2 or Pd2(dba)3, promoted by ligands such as, but not limited to, 2-(di-t-butylphosphino)biphenyl, 2-diphenylphosphino-2'- (N,N-dimethylamino)biphenyl, or 4,5-Bis(diphenylphosphino)-9,9-dimethylxanthene.
- catalysts such as, but not limited to, Pd(OAc)2 or Pd2(dba)3, promoted by ligands such as, but not limited to, 2-(di-t-butylphosphino)biphenyl, 2-diphenylphosphino-2'- (N,N-dimethylamino)biphenyl, or 4,5-Bis(diphenylphosphino)-9,9-dimethylxanthene.
- the coupling reaction can be conducted in solvents such as, but not limited to, toluene or 1,4- dioxane, promoted with bases such as, but not limited to, K 3 PO 4 or sodium feri-butoxide, and by heating as necessary at elevated temperatures.
- the azine derivatives 13 can be halogenated using appropriate halogenation reagents such as, but not limited to, N-chlorosuccinimide, N- bromosuccinimide, or N-iodosuccinimide, to afford 5-halogen substituted-azine-2-amine derivatives 5.
- the biaryl acetamide or biaryl thioamide compounds 6 can be realized by coupling azine derivatives 5 with the boronate esters 4 using a Pd-catalyzed Suzuki coupling protocol, as detailed in Scheme 1.
- the biaryl acetamide compounds of Formula I may be routinely prepared according to the synthetic route outlined in Scheme 4, wherein R can be groups including but not limited to alkyl or aryl, Z is halo, and the remainder of the variables are as delineated for compounds of Formula I.
- Carboxylic acid 14 could undergo Curtis rearrangement in the presence of alcohols such as, but not limited to, t-BuOH or benzyl alcohol, to give carbamates 15.
- the reaction could be carried out using reagents such as, but not limited to, diphenyl phosphorus azide, promoted with bases such as, but not limited to, DEEA or Et3N, and by heating at elevated temperatures using an oil bath or in a microwave reactor.
- reagents such as, but not limited to, diphenyl phosphorus azide, promoted with bases such as, but not limited to, DEEA or Et3N, and by heating at elevated temperatures using an oil bath or in a microwave reactor.
- the protecting group could be removed with acid such as, but not limited to, TFA or HC1, in solvent such as, but not limited to, DCM or EtOAc to afford aryl or heteroaryl amines 16.
- the biaryl acetamide compounds of Formula I may be routinely prepared according to the synthetic route outlined in Scheme 5, wherein Z is halo, and the remainder of the variables are as delineated for compounds of Formula I. It can be advantageous to protect the azine derivatives 17 (prepared as described in Scheme 4) with a protecting group (PG) such as, but not limited to, SEM, Boc, or THP, to give corresponding protected azines 21.
- PG protecting group
- the protect ion reaction may be carried out using reagents such as SEM-Cl in the presence of a base such as, but not limited to, sodium hydride; B0C 2 O in the presence of a base such as, but not limited to, TEA; DHP in the presence of an acid such as, but not limited to, p-toluenesulfonic acid; in a solvent such as, but not limited to, DMF or THF.
- a base such as, but not limited to, sodium hydride
- B0C 2 O in the presence of a base such as, but not limited to, TEA
- DHP in the presence of an acid such as, but not limited to, p-toluenesulfonic acid
- a solvent such as, but not limited to, DMF or THF.
- Suzuki coupling of 21 with boronate esters 4 as described in Scheme 1 provides compounds 22.
- the protecting group may be removed using acid such as, but not limited to, TFA or HC1,
- the biaryl acetamide compounds of Formula I may be routinely prepared according to the synthetic route outlined in Scheme 6, wherein the variable G is a leaving group, which can include but are not limited to halo or sulfonate groups and the remaining variables are as defined for compounds of Formula I.
- the aryl acetic acid boronic ester derivatives 2 (from Scheme 1) could be coupled with halogen/sulfonate-substituted azines 5 using a Pd-catalyzed Suzuki coupling protocol as described in Scheme 1 to give the biaryl derivatives 23.
- the aminopyrazole-containing biaryl acetamide compounds of formula (I) may be routinely prepared according to the synthetic route outlined in Scheme 7, wherein EWG refers to an electron withdrawing group, W is a leaving group (which can include but is not limited to halo or sulfonate groups), Z is halo, and the remainder of the variables are as delineated for compounds of Formula I.
- the nitropyrazoles 24 could be alkylated with halides/sulfonates, epoxides, or carbene insertion to give regioisomers 25a and 25b.
- the reaction could be promoted with base such as, but not limited to, K 2 C0 3 or DIEA or NaH, in solvent such as, but not limited to, DMF or CH 3 CN, with heating if necessary.
- the nitropyrazoles 24 could also be alkylated using a Michael addition protocol to give 25a and 25b.
- the reaction could be promoted with base such as, but not limited to, K 2 CO 3 or DIEA, in a solvent such as, but not limited to, DMF or CH 3 CN, with heating if necessary.
- the nitropyrazoles 24 could also be alkylated using a Mitsunobu reaction protocol to give 25a and 25b.
- the reaction is carried out using reagents such as, but not limited to, diisopropyl azodicarboxylate (DIAD) and triphenylphosphine, in a solvent such as, but not limited to, THF or DCM.
- reagents such as, but not limited to, diisopropyl azodicarboxylate (DIAD) and triphenylphosphine
- a solvent such as, but not limited to, THF or DCM.
- the alkylated nitropyrazoles 25 could be reduced under hydrogenation conditions using catalyst such as, but not limited to, Pd on carbon, in solvent such as, but not limited to, MeOH or EtOAc to give aminopyrazoles 26.
- the reaction can be done using a hydrogen balloon or high-pressure hydrogen in a Parr shaker, promoted with heating if necessary. Nucleophilic substitution of 26 with azines 10 as described in Scheme 3 provided amino azine derivatives 27.
- the regioisomers of 27 could be separated to their regiochemically pure forms using standard silica gel flash column chromatography or preparative HPLC using a chiral column.
- the azines 27 could be converted to the aminopyrazole-containing biaryl acetamides 28a and 28b using a Suzuki coupling protocol as described in Scheme 1, and biaryl acetamides 28a and 28b can undergo thionation as described in Scheme 1 to provide biaryl thioamides 28c and 28d.
- the aminoimidazole-containing biaryl acetamide compounds of Formula I may be routinely prepared according to the synthetic routes outlined in Scheme 8, wherein Z is halo, and the remaining variables are as delineated for compounds of Formula I.
- the 1, 2, 5-substituted imidazoles 31 substituted may be prepared as described in Eicher and Hauptmann, "The Chemistry of Heterocycles” (2003), Chapter 5, for example by condensation of appropriately substituted amino aldehydes 29 and amides 30.
- Imidazoles 31 can then be subjected to known aromatic nitration conditions such as, but not limited to, HNO 3 H 2 SO 4 , to afford nitroimidazoles 32.
- Nitro imidazoles 32 are then converted to biaryl acetamides 35a by procedures analogous to those used in Scheme 7 for conversion of 25 to 28, whereby the stability of intermediate aminoimidazoles may be enhanced by use of protonating conditions or amino protecting groups where applicable.
- biaryl acetamides 42a are prepared from alternatively substituted amino aldehydes 36 and amides 37
- Biarcyl thioamides 35b and 42b can be prepared as described in Scheme 1 from biaryl acetamdies 35a and 42b, respectively.
- Step 1 To a mixture of 2-(4-bromo-2-fluorophenyl)acetic acid (5.0 g, 21.5 mmol), 4,4,4' ,4',5,5,5',5'-octamethyl-2,2'-bi(l,3,2-dioxaborolane) (6.54 g, 25.6 mmol), and potassium acetate (8.4 g, 85.6 mmol) in a pressure tube was added DMF (50 mL). The mixture was flushed thoroughly with argon while [l,l '-bis(diphenylphosphino)ferrocene] dichloropalladium(II) dichloromethane complex (880 mg, 1.08 mmol) was added.
- Step 2 To a stirred solution of 5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3-amine (4.0 g, 20.8 mmol), 2-(2-fluoro-4-(4,4,5,5-tetramethyl-l,3,2-dioxaborolan-2-yl)phenyl)acetic acid (6.4 g, 22.8 mmol), and pyridine (5.1 mL, 63.1 mmol) in EtOAc (10 mL) at 0 °C was added T3P (50% in EtOAc, 24.8 mL, 42.1 mmol) slowly over 20 min.
- T3P 50% in EtOAc, 24.8 mL, 42.1 mmol
- Step 3 A mixture of l,3-dimethyl-lH-pyrazol-4-amine (453 mg, 4.66 mmol), 5- bromo-2-fluoropyrimidine (750 mg, 4.24 mmol) and DIEA (1.62 mL, 21.8 mmol) in DMSO (5 mL) was heated with at 120 °C for 2 h. The resulting mixture was cooled to rt and quenched with water. The yellow solid was collected via filtration, washed with water, and dried in vacuum oven to give 5-bromo-N-(l,3-dimethyl-lH-pyrazol-4-yl)pyrimidin-2-amine (1.08 g, 99%). LC-MS (ESI) m/z 268, 270 (M+H) + .
- Step 4 To a pressure vessel were added 2-(2-fluoro-4-(4 ,4,5, 5-tetramethyl- 1,3,2- dioxaborolan-2-yl)phenyl)-N-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide (358 mg, 0.79 mmol), 5-bromo-N-(l,3-dimethyl-lH-pyrazol-4-yl)pyrimidin-2-amine (200 mg, 0.79 mmol), 2M Na 2 C0 3 (1.18 mL, 2.36 mmol), Pd(dppf)Cl2-CH 2 Cl 2 (64 mg, 0.079 mmol), and CH3CN (3 mL).
- Step 1 To a solution of 5-bromo-2-chloropyrimidine (2.3 g, 11.9 mmol) and aniline (1.5 mL, 16.1 mmol) in n-BuOH (20 mL) was added DIEA (2 mL, 12 8 mmol). The mixture was stirred at 110-120 °C overnight, then cooled to rt and concentrated to dryness to afford 5- bromo-N-phenylpyrimidin-2-amine as a brown solid (2.0 g, 70%).
- Step 2 To a solution of 5-bromo-2-chloropyrimidine (2.3 g, 11.9 mmol) and aniline (1.5 mL, 16.1 mmol) in n-BuOH (20 mL) was added DIEA (2 mL, 12 8 mmol). The mixture was stirred at 110-120 °C overnight, then cooled to rt and concentrated to dryness to afford 5- bromo-N-phenylpyrimidin-2-amine as a brown solid (2.0
- Step 2 To a mixture of 5-bromo-N-phenylpyrimidin-2-amine (230 mg, 0.71 mmol), 2-(2-fluoro-4-(4,4,5,5-tetramethyl-l,3,2-dioxaborolan-2-yl)phenyl)acetic acid (200 mg, 1.0 mmol) in acetonitrile (16 mL) and water (8 mL) were added PdCl 2 (dppf) dichloromethane adduct (54 mg, 0.071 mmol) and N 2CC>3 (254 mg, 2.4 mmol). The resulting mixture was degassed with N 2 and stirred at 90 °C overnight.
- Step 3 To a stirred mixture of 2-(2-fluoro-4-(2-(phenylamino)pyrimidin-5- yl)phenyl)acetic acid (100 mg, 0.31 mmol) and 5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3- amine (60 mg, 0.31 mmol) in dry EtOAc (5 mL) were added pyridine (74 mg, 0.93 mmol) and T3P (50 wt% in EtOAc, 985 mg, 1.55 mmol). The mixture was stirred at 60 °C for 1 h.
- Step 1 To a stirred mixture of 4-nitro-lH-pyrazole (250 mg, 2.2 mmol) and K 2 CO3 (915 mg, 6.6 mmol) in DMF (3 mL) was added vinyl sulfone (213 ⁇ , 2.4 mmol). The resulting mixture was heated at 120 °C for 30 min, cooled to rt, quenched with water, and extracted with EtOAc (2 x 25 mL). The combined organic layers were washed with brine, dried over Na 2 SC>4, and concentrated under reduced pressure to give crude l-(2-(methylsulfonyl)ethyl)-4-nitro-lH- pyrazole, which was used directly for the next step . LC-MS (ESI) m/z 220 (M+H) + .
- Step 2 To a stirred mixture of l-(2-(methylsulfonyl)ethyl)-4-nitro-lH-pyrazole and 10% Pd on carbon (50 mg) was added MeOH (5 mL). The mixture was hydrogenated at rt under a hydrogen balloon for 4 days. The reaction mixture was filtered through Celite washing with MeOH. The filtrate was evaporated under reduced pressure to give l-(2-(m ethyl sulfonyl)ethyl)- lH-pyrazol-4-amine as a purplish oil, which was used directly for the next step. LC-MS (ESI) /;/ .- 190 (M +H) + .
- Step 3 2-(2-Fluoro-4-(2-((l-(2-(methylsulfonyl)ethyl)-lH-pyrazol-4- yl)amino)pyrimidin-5-yl)phenyl)-N-(5-(l-(trifluoromo)-2-(2-Fluoro-4-(2-((l-(2-(methylsulfonyl)ethyl)-lH-pyrazol-4- yl)amino)pyrimidin-5-yl)phenyl)-N-(5-(l-(trifluorom
- Step 1 To a solution of thiazol-2-amine (500.0 mg, 5.0 mmol) in pyridine (5 mL) was added B0C2O (1.3 g, 6.0 mmol). The resulting mixture was stirred at rt for 2 h. The mixture was concentrated under reduced pressure and the residue was purified by silica gel chromatography, eluting with petroleum ether/EtOAc (4: 1), to afford fer ⁇ -butyl thiazol-2-ylcarbamate as a solid (280 mg, 28%).
- Step 2 A mixture of 5-bromo-2-fiuoropyrimidine (239 mg, 1.35 mmol), tert-butyl thiazol-2-ylcarbamate (180 mg, 0.9 mmol) and K 2 C0 3 (621 mg, 4.5 mmol) in DMF (8 mL) was stirred at 100 °C overnight. After cooling to rt, the mixture was poured into cold water and extracted with EtOAc (2x 50 mL). The combined extracts were washed with water and brine, dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure.
- Step 3 To a mixture of tert-butyl (5-bromopyrimidin-2-yl)(thiazol-2-yl)carbamate (110 mg, 0.28 mmol) and 2-(2-fluoro-4-(4,4,5,5-tetramethyl-l,3,2-dioxaborolan-2-yl)phenyl)-N- (5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide (128 mg, 0.28 mmol) in acetonitrile (6 mL) and water (3 mL) were added PdCl 2 (dppf) dichloromethane adduct (23 mg, 0.028 mmol) and aiCC (89 mg, 0.84 mmol).
- Step 4 To a solution of tert-butyl (5-(3-fluoro-4-(2-oxo-2-((5-(l- (trifluoromethyl)cyclopropyl)isoxazol-3-yl)amino)ethyl)phenyl)pyrimidin-2-yl)(thiazol-2- yl)carbamate (120 mg, 0.198 mmol) in DCM (2 mL) was added TFA (1 mL). The mixture was stirred at rt for 2 h and concentrated under reduced pressure. The residue was treated with saturated aq NaHCC>3 to pH about 8, and concentrated to dryness.
- Step 1 To a solution of 1 -methyl- lH-imidazole-5-carboxylic acid (1.00 g, 7.9 mmol) in i-BuOH (15 mL) and toluene (50 mL) were added diphenylphosphoryl azide (2.4 g, 8.7 mmol) and Et 3 N (1.2 g, 12 mmol). The mixture was heated at 70 °C for 2 h, then 100 °C for 2 h. The mixture was concentrated under reduced pressure, then water (20 mL) was added, and the mixture was extracted with EtOAc (3 x20 mL).
- Step 2 To a solution of 2,5-dibromopyrimidine (605 mg, 2.54 mmol) and tert-butyl (l-methyl-lH-imidazol-5-yl)carbamate (500 mg, 2.54 mmol) in DMF (10 mL) was added CS2CO3 (1.66 g, 5.09 mmol). The mixture was heated at 60 °C overnight under nitrogen, cooled to rt, and added to water (10 mL). The mixture was extracted with EtOAc (3 > ⁇ 10 mL) and the combined organic layers were washed with brine (5 mL), dried over anhydrous Na 2 SC)4, filtered and concentrated under reduced pressure.
- Step 3 To a solution of 2-(2-fluoro-4-(4,4,5,5-tetramethyl-l,3,2-dioxaborolan-2- yl)phenyl)-N-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide (100 mg, 0.22 mmol) and tert-butyl (5-bromopyrimidin-2-yl)(l-methyl-lH-imidazol-5-yl)carbamate (78 mg, 0.22 mmol) in CH 3 CN (3 mL) and H 2 0 (0.5 mL) were added Na 2 C0 3 (47 mg, 0.44 mmol) and PdCl 2 (dppf) DCM (18 mg, 0.022 mmol).
- Step 4 To a solution of fert-butyl (5-(3-fluoro-4-(2-oxo-2-((5-(l- (trifluoromethyl)cyclopropyl)isoxazol-3-yl)amino)ethyl)phenyl)pyrimidin-2-yl)(l-methyl-lH- imidazol-5-yl)carbamate (80 mg, 0.13 mmol) in DCM (2 niL) was added TFA (1 niL). The mixture was stirred at rt overnight and concentrated under reduced pressure. The residue was treated with saturated aq NaHC(3 ⁇ 4 until pH about 8 to about 9 and extracted with EtOAc (3> ⁇ 10 mL). The combined organic layers were washed with brine (5 niL), dried over anhydrous
- Step 1 To a solution of methyl l-methyl-4-nitro-lH-pyrazole-3-carboxylate (3.70 g, 20 mmol) in THF (120 mL) was added dropwise DIBAL-H (1 M in hexane, 50 mL, 50 mmol) at -30 °C and the mixture was stirred at rt overnight. To the reaction mixture was added 0.5 N HCl (100 mL) and the mixture was extracted with EtOAc. The combined organic layers were dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure.
- Step 2 To a solution of (l-methyl-4-nitro-lH-pyrazol-3-yl)methanol (629 mg, 4.00 mmol) in DCM (60 mL) was added Dess-Martin periodinane (2.04 g, 4.81 mmol). The mixture was stirred at rt for 3 h and quenched with 1M aq NaOH. The organic layer was separated and the aqueous layer was extracted with DCM. The combined organic layers were dried over anhydrous Na 2 S0 4 , filtered and concentrated under reduced pressure.
- Step 3 To a solution of l-methyl-4-nitro-lH-pyrazole-3-carbaldehyde (310 mg, 2.00 mmol) in DCM (20 mL) was added dropwise DAST (0.70 mL, 5.3 mmol) at -50 °C. The mixture was warmed to it, stirred overnight and quenched with saturated aq. aHC0 3 . The organic layer was separated and the aqueous layer was extracted with DCM. The combined organic layers were dried over anhydrous Na 2 S0 4 , filtered and concentrated under reduced pressure to afford crude 3-(difluoromethyl)-l-methyl-4-nitro-lH-pyrazole as a yellow oil (355 mg crude, 100 %).
- Step 4 To a solution of 3-(difluoromethyl)-l-methyl-4-nitro-lH-pyrazole (355 mg, 2.00 mmol) in MeOH (10 mL) was added 10% Pd/C (60 mg). The mixture was stirred under a H 2 balloon at rt overnight, filtered through Celite, and concentrated under reduced pressure. The residue was purified by preparative TLC, eluting with EtO Ac/petroleum ether/DCM (1 :2: 1, v/v/v) to afford 3-(difluoromemyl)-l-methyl-lH-pyrazol-4-amine as a purple oil (139 mg, 47%).
- Step 5 A mixture of 3-(difluoromethyl)-l-methyl-lH-pyrazol-4-amine (139 mg, 0.94 mmol), 5-bromo-2-chloropyrimidine (167 mg, 0.86 mmol) and DIEA (1 mL) in DMSO (5 mL) was stirred at 120 °C for 2 h. The mixture was cooled to rt and purified by reverse phase flash chromatography (Welch Ultimate XB-C18, 40-70 ⁇ ), eluting with a gradient of 15-95% acetonitrile in water, and then further purified by preparative TLC, eluting with
- Step 6 A mixture of 5-bromo-N-(3-(difluoromethyl)-l-methyl-lH-pyrazol-4- yl)pyrimidin-2-amine (38 mg, 0.12 mmol), 2-(2-fluoro-4-(4,4,5,5-tetramethyl-l,3,2- dioxaborolan-2-yl)phenyl)-N-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide (57 mg, 0.12 mmol), Na 2 C0 3 (56 mg, 0.53 mmol) and PdCl 2 (dppf) DCM (14 mg, 0.017 mmol) in CH 3 CN H 2 0 (10 mL/1 mL) was stirred at 75 °C for 3 h under nitrogen.
- Step 1 To a mixture of 2-ethoxymethylenemalonic acid diethyl ester (10 g, 46.3 mmol) in EtOH (100 mL) was added N 2 H 4 HC1 (3.3 g, 48.2 mmol). The mixture was heated at 80 °C for 16 h before it was concentrated and diluted with H 2 0 (150 mL). The mixture was extracted with DCM (3 ⁇ 100 mL). The combined organic layers were washed with brine, dried over anhydrous a 2 S0 4 , filtered and concentrated under reduced pressure to afford 3-ethoxy- lH-pyrazole-4-carboxylic acid ethyl ester as a brown oil (3.6 g 42%).
- Step 2 A solution of 3-ethoxy-lH-pyrazole-4-carboxylic acid ethyl ester (3 6 g, 19.6 mmol) in 6M HC1 (50 mL) was heated to 100 °C for 16 h and concentrated under reduced pressure. The residue was adjusted to pH about 7 with saturated aq. NaHCC and extracted with EtOAc (3 x 100 mL). The combined organic layers were washed with brine, dried over anhydrous Na 2 S ( 3 ⁇ 4, filtered and concentrated under reduced pressure to afford 3-ethoxy-lH-pyrazole as brown oil (1.50 g, 65%).
- Step 3 To a solution of 3-ethoxy-lH-pyrazole (1.4 g, 12.5 mmol) in concentrated H 2 SO 4 (5 mL) at -10 °C was added KNO3 (1.33 g, 13.1 mmol) portionwise. The suspension was stirred at - 10 °C for 2 h before it was poured into ice-water and extracted with DCM (3 50 mL). The combined organic layers were dried over Na 2 SC>4, filtered and concentrated under reduced pressure to afford 3-ethoxy-4-nitro-lH-pyrazole as a yellow solid (1.2 g, 61%).
- Step 4 To a solution of 3-ethoxy-4-nitro-lH-pyrazole (1.2 g, 7.6 mmol) in DMF (15 mL) were added iodomethane (5.40 g, 38 mmol) and K 2 CO 3 (3.20 g, 22.8 mmol). The suspension was stirred at 20 °C for 16 h before it was diluted with H 2 0 (20 mL) and extracted with EtOAc (3 x20 mL). The combined organic layers were washed with brine, dried over anhydrous Na 2 SC>4, filtered and concentrated under reduced pressure to afford 3-ethoxy-l- methyl-4-nitro-lH-pyrazole as a yellow solid (950 mg, 73%).
- Step 5 To a solution of 3-ethoxy-l-methyl-4-nitro-lH-pyrazole (500 mg, 2.90 mmol) in EtOH (20 mL) was added 10% Pd/C (100 mg). The mixture was stirred at 20 °C for 16 h under H 2 . The mixture was filtered and concentrated under reduced pressure. The residue was purified by column chromatography on silica gel, eluting with DCM/MeOH (300: 1, v/v) to afford 3-ethoxy-l-methyl-lH-pyrazol-4-ylamine as a brown oil (0.40 g, 95%).
- Step 6 To a solution of 3-ethoxy-l-methyl-lH-pyrazol-4-ylamine (370 mg, 2.60 mmol) in DMSO (8 mL) were added DIEA (670 mg, 5.20 mmol) and 5-bromo-2- chloropyrimidine (604 mg, 3.12 mmol). The suspension was heated at 120 °C for 4 h. The mixture was diluted with H 2 0 (20 mL) and extracted with EtOAc (3 30 mL). The combined organic layers were washed with brine (20 mL), dried over anhydrous Na 2 S0 4 , filtered and concentrated under reduced pressure.
- Step 7 To a solution of 2-(2-fluoro-4-(4,4,5,5-tetramethyl-l,3,2-dioxaborolan-2- yl)phenyl)-N-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide (182 mg, 0.40 mmol) and (5-bromo-pyrimidin-2-yl)-(3-ethoxy-l-methyl-lH-pyrazol-4-yl)-amine (120 mg, 0.40 mmol) in CH 3 CN (10 mL) and H 2 0 (2 mL) were added Na 2 C0 3 (127 mg, 1.20 mmol) and PdCl 2 (dppf) DCM (30 mg, 0.04 mmol).
- Step 1 A mixture of l,3-dimethyl-lH-pyrazol-4-amine dihydrochloride (184 mg, 1.00 mmol), 5-bromo-2-chloro-4-methoxypyrimidine (223 mg, 1.00 mmol) and DIEA (1.5 mL) in DMSO (5 mL) was stirred at 120 °C for 2 h.
- Step 2 A mixture of 5-bromo-N-(l,3-dimethyl-lH-pyrazol-4-yl)-4- methoxypyrimidin-2-amine (72 mg, 0.24 mmol) in concentrated HCI (2 mL) was heated at 120 °C in a microwave reactor for 1 h. The mixture was cooled to rt and concentrated to afford 5- bromo-2-((l,3-dimethyl-lH-pyrazol-4-yl)amino)pyrimidin-4-ol hydrochloride (88 mg, 100%).
- Step 3 A mixture of 5-bromo-N-(l,3-dimethyl-lH-pyrazol-4-yl)-4- methoxypyrimidin-2-amine (72 mg, 0.24 mmol) in concentrated HCI (2 mL) was heated at 120 °C in a microwave reactor for 1 h. The mixture was cooled to rt and concentrated to afford 5- bromo-2-((l,3-dimethyl-lH-pyr
- Step 3 A mixture of 5-bromo-2-((l ,3-dimethyl- lH-pyrazol-4-yl)amino)pyrimidin-4-ol hydrochloride (88 mg, ca. 0.24 mmol), 2-(2-fluoro-4-(4,4,5,5-tetramethyl-l,3,2-dioxaborolan-2- yl)phenyl)-N-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide (1 10 mg, 0.24 mmol), Na 2 C0 3 (100 mg, 0.94 mmol) and Pd(dppf)Cl 2 CH 2 C1 2 (20 mg, 0.024 mmol) in
- Step 4 To a mixture of 2-(4-(2-((l,3-dimethyl-lH-pyrazol-4-yl)amino)-4- hydroxypyrimidin-5-yl)-2-fluorophenyl)-N-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3- yl)acetamide (30 mg, 0.057 mmol) in THF (5 mL) was added POC (0.2 mL). The mixture was stirred at it for 2 d and then quenched with saturated aq NaHC0 3 . The aqueous layer was extracted with EtOAc.
- Step 1 To a solution of 3-nitro-lH-pyrazole (3.16 g, 28 mmol) in acetic acid (50 mL) at 0 °C was added dropwise fuming ⁇ 3 (2.6 mL, c.a. 58 mmol). Acetic anhydride (6.6 mL, 70 mmol) was added and the mixture was stirred at rt for 3h. The mixture was cooled to 0 °C and another portion of fuming ⁇ 3 (0.5 mL, c.a. 11 mmol) was added and the mixture was stirred at rt for 2h. The mixture was poured into water, stirred at rt overnight, and extracted with EtOAc.
- Step 2 A mixture of 1,3-dinitro-lH-pyrazole (3.56 g, 22.5 mmol) in benzonitrile (45 mL) was stirred at 180 °C for 3h. The mixture was cooled to rt and poured into a mixture of n- hexane and IN aq NaOH. The precipitate was collected by filtration to afford the first batch of 3,5-dinitro-lH-pyrazole as a pale-yellow solid (1.87 g, crude 53%). The aqueous layer of the filtrate was separated, neutralized with aq HCl and concentrated under reduced pressure.
- Step 3 To a solution of 3,5-dinitro-lH-pyrazole (3.63 g, 23 mmol) in DMF (30 mL) were added K 2 CO 3 (9.55 g, 69 mmol) and CH 3 I (1.5 mL, 24 mmol) and the mixture was stirred at rt overnight. The mixture was poured into water and extracted with EtOAc. The combined organic layers were dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography, eluting with 10% EtOAc in petroleum ether, to afford l-methyl-3,5-dinitro-lH-pyrazole as a pale-yellow solid
- Step 4 Sodium (276 mg, 12 mmol) was added to EtOH (12 mL) and the mixture was stirred at rt for 0.5 h. l-Methyl-3,5-dinitro-lH-pyrazole (522 mg, 3 mmol) was added and the mixture was stirred at 65 °C for 0.5 h. The mixture was cooled to rt and concentrated under reduced pressure. The residue was purified by silica gel chromatography eluting with 20% EtOAc in petroleum ether to afford 3-ethoxy-l-methyl-5-nitro-lH-pyrazole as a pale-yellow solid (354 mg, 68 %).
- Step 5 To a solution of 3-ethoxy-l-methyl-5-nitro-lH-pyrazole (257 mg, 1.5 mmol) in EtOH (10 mL) was added 10% Pd/C (wet, 95 mg). The mixture was stirred under a hydrogen balloon at rt overnight. The mixture was filtered through Celite and the filtrate was concentrated under reduced pressure to afford 3-ethoxy-l-methyl-lH-pyrazol-5-amine as a white solid (210 mg, 99%).
- Step 6 A mixture of 3 -ethoxy-1 -methyl- lH-pyrazol-5 -amine (210 mg, 1.49 mmol), 5- bromo-2-fluoropyrimidine (270 mg, 1.53 mmol), and DIEA (1.5 mL) in DMSO (5 mL) was stirred at 80 °C for 3 h. The mixture was cooled to rt and purified by flash column
- Step 7 A mixture of 5-bromo-N-(3-ethoxy-l-methyl-lH-pyrazol-5-yl)pyrimidin-2- amine (66 mg, 0.22 mmol), 2-(2-fluoro-4-(4,4,5,5-tetramethyl-l,3,2-dioxaborolan-2-yl)phenyl)- N-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide (102 mg, 0.22 mmol), Na 2 C03 (85 mg, 0.80 mmol), and Pd(dppf)Cl 2 CH 2 C1 2 (25 mg, 0.031 mmol) in CH 3 CN/H 2 0 (8 mL/1.5 mL) was stirred under N 2 at 75 °C overnight.
- Step 1 A mixture of 3-methyl-but-l-yne (0.40 g, 5.88 mmol) in trimethylsilanyl- methanediazonium (3 mL) was heated at 135 °C for 1 h in a microwave reactor. The mixture was concentrated at low temperature to afford 3-isopropyl-lH-pyrazole as a yellow oil (380 mg 50%).
- Step 2 To a solution of 3-isopropyl-lH-pyrazole (380 mg, 3.45 mmol) in DMF (8 mL) were added iodomethane (2.50 g, 17.3 mmol) and K 2 CO 3 (1.40 g, 10.4 mmol). The suspension was stirred at 20 °C for 16 h before it was diluted with H 2 0 (20 mL) and extracted with Et20 (3 ⁇ 20 mL).
- Step 3 To a solution of 3 -isopropyl-1 -methyl- lH-pyrazole and 5-isopropyl-l-methyl- lH-pyrazole (350 mg, 2.80 mmol) from Step 2 of this example in concentrated H 2 S0 4 (2 mL) at -10 °C was added KNO 3 (297 mg, 2.94 mmol) portion wise. The suspension was stirred at -10 °C for 2 h before it was poured into ice-water and extracted with DCM (3 > ⁇ 50 mL). The combined organic layers were dried over Na 2 S0 4 , filtered and concentrated under reduced pressure.
- Step 4 To a solution of 3-isopropyl-l-methyl-4-nitro-lH-pyrazole and 5-isopropyl-l- methyl-4-nitro-lH-pyrazole (150 mg, 0.88 mmol) in EtOH (10 mL) was added Pd/C (20 mg). The suspension was stirred at 20 °C for 3 h under a 3 ⁇ 4 balloon. The mixture was filtered and concentrated under reduced pressure. The residue was purified by preparative TLC, eluting with DCM/MeOH (19: 1, v/v) to afford 3-isopropyl-l-methyl-lH-pyrazol-4-ylamine as brown oil (55 mg, 44%).
- Step 5 To a solution of 3 -isopropyl-1 -methyl- lH-pyrazol-4-yl amine (55 mg, 0.39 mmol) in DMSO (3 mL) were added DIEA (101 mg, 0.78 mmol) and 5-bromo-2- chloropyrimidine (98 mg, 0.51 mmol). The suspension was heated at 120 °C for 2 h. The mixture was diluted with H 2 0 (20 mL) and extracted with EtOAc (3 > ⁇ 30 mL). The combined organic layers were washed with brine (20 mL), dried over anhydrous Na2S04, filtered and concentrated under reduced pressure.
- Step 6 To a solution of 2-(2-fluoro-4-(4,4,5,5-tetramethyl-l,3,2-dioxaborolan-2- yl)phenyl)-N-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide (69 mg, 0.15 mmol) and (5-bromo-pyrimidin-2-yl)-(3-isopropyl-l-methyl-lH-pyrazol-4-yl)-amine (45 mg, 0.15 mmol) in CH 3 CN (5 mL) and H 2 0 (1 mL) were added Na 2 C0 3 (48 mg, 0.45mmol) and
- Step 1
- Step 1 A mixture of 5-bromo-2-((l,3-dimethyl-lH-pyrazol-4-yl)amino)pyrimidin-4-ol hydrochloride from Step 1 of Example 8 (285 mg, c.a. 0.77 mmol) in POCl 3 (5 mL) was stirred at 60 °C for 3h. The mixture was concentrated under reduced pressure and the residue was dissolved in EtOAc. The solution was washed with saturated aq.
- Step 2 A mixture of 5-bromo-4-chloro-N-(l,3-dimethyl-lH-pyrazol-4-yl)pyrimidin-2- amine (152 mg, 0.50 mmol), KF (580 mg, 10 mmol), and 18-crown-6 (140 mg, 0.53 mmol) in DMF (5 mL) was stirred 120 °C for 2h. The mixture was partitioned between EtOAc and water, and the aqueous layer was further extracted with EtOAc. The combined organic layers were dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure.
- Step 3 A mixture of 5-bromo-N-(l,3-dimethyl-lH-pyrazol-4-yl)-4-fluoropyrimidin-2- amine (46.5 mg, 0.16 mmol), 2-(2-fluoro-4-(4,4,5,5-tetramethyl-l,3,2-dioxaborolan-2- yl)phenyl)-N-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide (82 mg, 0.18 mmol), Na 2 C0 3 (58mg, 0.55 mmol), and Pd(dppf)Cl 2 CH 2 C1 2 (16 mg, 0.020 mmol) in CH 3 CN/H 2 0 (5 mL/0.8 mL) was stirred under N 2 at 75 °C for 3h.
- Step 1
- Step 1 To a suspension of methyltriphenylphosphonium bromide (714 mg, 2.00 mmol) in THF (10 mL) was added a solution of «-BuLi in w-hexane (2.5 M, 0.80 mL, 2.0 mmol) at 0 °C, and the mixture was stirred at 0 °C for 1 h. To the mixture was added a solution of 1- methyl-4-nitro-lH-pyrazole-3-carbaldehyde from Step 2 of example 6 (287 mg, 1.85 mmol) in THF (10 mL). The mixture was stirred at rt for 3 h and partitioned between EtOAc and brine.
- Step 2 To a solution of l-methyl-4-nitro-3-vinyl-lH-pyrazole (100 mg, 0.65 mmol) in EtOH (10 mL) was added 10% Pd/C (30 mg). The mixture was stirred under 3 ⁇ 4 (50 psi) at 50 °C for 24 h. The mixture was filtered through Celite and the filtrate was concentrated under reduced pressure to afford 3-ethyl-l-methyl-lH-pyrazol-4-amine as a brown solid (75 mg crude, 92%).
- Step 3 A mixture of 3-ethyl-l-methyl-lH-pyrazol-4-amine (75 mg, 0.60 mmol), 5- bromo-2-chloropyrimidine (124 mg, 0.64 mmol) and DIEA (0.8 mL) in DMSO (5 mL) was stirred at 120 °C for 2 h.
- Step 4 A mixture of 5-bromo-N-(3-ethyl-l-methyl-lH-pyrazol-4-yl)pyrimidin-2- amine (58 mg, 0.21 mmol), 2-(2-fluoro-4-(4,4,5,5-tetramethyl-l,3,2-dioxaborolan-2-yl)phenyl)- N-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide (101 mg, 0.22 mmol), Na2C03 (71 mg, 0.67 mmol) and PdCl 2 (dppf) DCM (23 mg, 0.028 mmol) in CH 3 CN/H 2 0 (8 mL/1 mL) was stirred at 75 °C for 3 h under nitrogen.
- Step 1 To a solution of dimethyl cyclopropane-l, l-dicarboxylate (6.32 g, 40 mmol) in anhydrous THF (120 mL) was added a solution of lithium tri-fert-butoxyaluminum hydride in THF (1M, 88 mL) and the mixture was stirred at 65 °C overnight. To the mixture were added H 2 0 (4 mL) and 15% aq NaOH (4 mL). The mixture was dried over drying agent and filtered. The filtrate was concentrated under reduced pressure to afford methyl 1 - (hydroxymethyl)cyclopropane-l-carboxylate as a yellow oil (3.11 g, 60%).
- Step 2 To a solution of methyl l-(hydroxymethyl)cyclopropane-l-carboxylate (3.11 g, 23.9 mmol) in DCM (80 mL) was added Dess-Martin periodinane (15.6 g, 36.8 mmol) and the mixture was stirred at rt overnight. The reaction was quenched with a solution of Na 2 S 2 (3 ⁇ 4 (17.5 g) and saturated aqueous NaHC0 3 (80 mL). The organic layer was separated and the aqueous layer was further extracted with DCM. The combined organic layers were washed with saturated aq. NaHCC , dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure to afford methyl 1-formylcyclopropane-l-carboxylate as yellow oil (3.20 g, crude 100%).
- Step 3 To a solution of methyl 1-formylcyclopropane-l-carboxylate (3.20 g, crude, 23.9 mmol) in DCM (70 mL) at 0 °C was added dropwise DAST (6 5 mL, 49.3 mmol) The mixture was stirred at rt overnight. The mixture was cooled to 0 °C and treated with saturated aq NaHC0 3 . The organic layer was separated and the aqueous layer was further extracted with DCM.
- Step 4 To a stirred solution of methyl l-(difluoromethyl)cyclopropane-l-carboxylate (4.0 g, 26.7 mmol) and CH 3 CN (2 8 mL, 67 mmol) in anhydrous THF (120 mL) was added dropwise a solution of LDA in THF/heptane/PhCiHs (2 M, 35 mL) at -78 °C under nitrogen. The mixture was stirred at -78 °C for 2h before it was allowed to warm to rt and stir overnight. The mixture was partitioned between EtOAc and water. The organic layer was separated and the aqueous layer was further extracted with EtOAc.
- Step 5 A mixture of 3-(l-(difluoromethyl)cyclopropyl)-3-oxopropanenitrile (2.236 g, 14.1 mmol), hydroxylamine sulfate (2.82 g, 17.2 mmol), and NaHC0 3 (2.31 g, 27.5 mmol) in MeOH H20 (20 mL/100 mL) was stirred at 85 °C overnight. The mixture was acidified to pH lwith concentrated HC1 (2 mL) and heated in a microwave reactor at 140 °C for 25 min (8 batches). The mixture was basified with 2 N aq NaOH to pH 8 and extracted with EtOAc. The organic extract was washed with brine, dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The residue was purified by silica gel flash
- Step 6 To a stirred mixture of 2-(2-fluoro-4-(4,4,5,5-tetramethyl-l,3,2-dioxaborolan- 2-yl)phenyl)acetic acid (1.54 g, 5.5 mmol), 5-(l-(difluoromethyl)cyclopropyl)isoxazol-3-amine (956 mg, 5.5 mmol) in anhydrous EtOAc (50 mL) were added T3P solution (50% in EtOAc, 10 mL, 16.8 mmol) and pyridine (1.3 mL , 16.5 mmol) and the mixture was stirred at 60 °C overnight.
- Step 7 A mixture of l,3-dimethyl-lH-pyrazol-4-amine dihydrochloride (184 mg, 1 mmol), 5-bromo-2-chloropyrimidine (195 mg, 1 mmol), and DIEA (1 mL) in DMSO (5 mL) was stirred at 120 °C for 2 h.
- Step 8 A mixture of 5-bromo-N-(l,3-dimethyl-lH-pyrazol-4-yl)pyrimidin-2-amine (53 mg, 0.198 mmol), N-(5-(l-(difluoromethyl)cyclopropyl)isoxazol-3-yl)-2-(2-fluoro-4- (4,4,5,5-tetramethyl-l,3,2-dioxaborolan-2-yl)phenyl)acetamide (87 mg, 0.20 mmol), Na2CC>3 (70 mg, 0.66 mmol), and Pd(dppf)Cl 2 CH 2 C1 2 (16 mg, 0.020 mmol) in CH 3 CN H 2 0 (8 mL/1.5 mL) was stirred under nitrogen at 75 °C for 4 h.
- Step 1 To a mixture of l-methyl-lH-pyrazol-3-ylamine (5.0 g, 51.5 mmol) and Et3N (15.6 g, 154 mmol) in toluene (50 mL) was added dropwise Ac 2 0 (7.90 g, 77.4 mmol) at 20 °C and the mixture was stirred at 40 °C for 2 h. After cooling to rt and concentrated under reduced pressure. The residue was suspended in DCM (130 mL) and the solid was collected by filtration to afford N-(l-methyl-lH-pyrazol-3-yl)acetamide as a white solid (4.2 g, 59%).
- Step 2 To a solution of N-(l -methyl- lH-pyrazol-3-yl)acetamide (2.0 g, 14 mmol) in concentrated H 2 SO 4 (5 mL) at -10 °C was added ⁇ 3 (1.53 g, 15.1 mmol) portion wise. The suspension was stirred at -10 °C for 2 h, and then poured into ice-water and extracted with DCM (3 x50 mL). The combined organic layers were dried over anhydrous NazSOzt, filtered and concentrated under reduced pressure.
- Step 3 To a solution of N-(l-methyl-4-nitro-lH-pyrazol-3-yl)acetamide (600 mg, 3.26 mmol) in EtOH (20 mL) was added Pd/C (60 mg). The suspension was stirred at 20 °C for 16 h under 3 ⁇ 4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography on silica gel eluting with DCM/MeOH (50: 1, v/v) to afford N-(4-amino- 1 - methyl-lH-pyrazol-3-yl)acetamide as a brown oil (500 mg, 100%)
- Step 4 To a solution of N-(4-amino-l-methyl-lH-pyrazol-3-yl)acetamide (200 mg, 1.30 mmol) in DMSO (10 mL) were added DIEA (340 mg, 2.63 mmol) and 5-bromo-2- chloropyrimidine (315 mg, 1.63 mmol). The suspension was heated at 120 °C for 1.5 h. The mixture was diluted with water (20 mL) and extracted with EtOAc (3 30 mL). The combined organic layers were washed with water (2x20 mL), brine (20 mL), dried over anhydrous Na 2 S0 4 , filtered and concentrated under reduced pressure.
- Step 5 To a solution of N-(4-((5-bromopyrimidin-2-yl)amino)-l-methyl-lH-pyrazol- 3-yl)acetamide (120 mg, 0.39 mmol) in dioxane (5 mL) was added 6 M HC1 (25 mL). The suspension was heated at 60 °C for 2.5 h and concentrated under reduced pressure. The residue was adjusted to pH about 7 with saturated aq. NaHC0 3 and extracted with EtOAc (3 x 10 mL). The combined organic layers were washed with brine, dried over anhydrous a 2 S0 4 , filtered and concentrated under reduced pressure.
- Step 6 To a solution of 2-(2-fluoro-4-(4,4,5,5-tetramethyl-l,3,2-dioxaborolan-2- yl)phenyl)-N-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide (136 mg, 0.30 mmol) and N 4 -(5-bromopyrimidin-2-yl)-l-methyl-lH-pyrazole-3,4-diamine (80 mg, 0.30 mmol) in C3 ⁇ 4CN (10 mL) and H 2 0 (2 mL) were added Na 2 C0 3 (95 mg, 0.90 mmol) and
Landscapes
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Epidemiology (AREA)
- Life Sciences & Earth Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- General Health & Medical Sciences (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
Abstract
Compounds of Formula (I) or a pharmaceutically acceptable salt, a solvate, a tautomer, an isomer or a deuterated analog thereof, wherein A, J, R1, R2, R3, R4, R5, R6, R7, R9, X, m and n are as described herein, compositions thereof, and methods and uses thereof.
Description
COMPOUNDS AND METHODS FOR KINASE MODULATION,
AND INDICATIONS THEREFOR
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application claims the benefit under 35 U. S.C. § 1 19(e) to U.S. Provisional Application Serial No. 62/198,092 filed on July 28, 2015, which is hereby incorporated by reference in its entirety.
FIELD
[0002] The present disclosure relates to protein kinases and compounds which selectively modulate kinases, and uses therefor. Particular embodiments contemplate disease indications which are amenable to treatment by modulation of kinase activity by the compounds of the present disclosure.
BACKGROUND
[0003] FMS-like tyrosine kinase 3 (FLT3) is mutated in about one third of acute myeloid leukemia cases. The most frequent FLT3 mutations in acute myeloid leukemia are internal tandem duplication (ITD) mutations in the juxtamembrane domain (23%) and point mutations in the tyrosine kinase domain (10%). The most frequent kinase domain mutation is the substitution of aspartic acid at position 838 (equivalent to the human aspartic acid residue at position 835) with a tyrosine (FLT3/D835Y), converting aspartic acid to tyrosine. Even though both of these mutations constitutively activate FLT3, patients with an ITD mutation have a much poorer prognosis. It has been previously demonstrated that the FLT3/D835Y knock-in mice survive significantly longer than FLT3/ITD knock-in mice. The majority of these mice develop myeloproliferative neoplasms with a less-aggressive phenotype.
[0004] Secondary mutations in the tyrosine kinase domain (KD) is one of the most common causes of acquired clinical resistance to small molecule tyrosine kinase inhibitors (TKIs) in human cancer. Recent pharmaceutical efforts have focused on the development of "type IT' kinase inhibitors, which bind to a relatively non-conserved inactive kinase conformation and exploit an allosteric site adjacent to the ATP -binding pocket as a potential means to increase kinase selectivity. Mutations in FLT3 are the common genetic alteration in patients with acute myeloid leukemia (AML) (TCGA, N Engl J Med. 2013, 368: 2059-74) and are primarily comprised of constitutively activating internal tandem duplication (ITD) mutations (of 1-100
amino acids) in the juxtamembrane domain, and to a lesser extent, point mutations, typically within the kinase activation loop. Secondary KD mutations in FLT3-ITD that can cause resistance to the highly potent type II FLT3 inhibitors, such as, quizartinib, which achieved a composite complete remission (CRc) rate of about 50% in relapsed or chemotherapy-refractory FLT3-ITD+ AML patients treated in large phase II monotherapy studies (Tallman et al, Blood, 2013;122:494). An in vitro saturation mutagenesis screen of FLT3-ITD identified five quizartinib-resistant KD mutations at three residues: the "gatekeeper" F691 residue, and two amino acid positions within the kinase activation loop (D835 and Y842), a surprisingly limited spectrum of mutations for a type II inhibitor. Mutations at two of these residues (F691L and D835V/Y/F) were subsequently identified in each of eight samples analyzed at the time of acquired clinical resistance to quizartinib (Smith et al., Nature, 2012;485:260-3). This finding validated FLT3 as a therapeutic target in AML. The type II multikinase inhibitor sorafenib, which also has some clinical activity in FLT3-ITD+ AML, is ineffective against all identified quizartinib resistance-causing mutants, in addition to other mutant isoforms (Smith et al). The type I inhibitor crenolanib has been identified a type I inhibitor of quizartinib-resistant D835 mutants (Zimmerman et al. Blood, 2013; 122:3607-15); however, no FLT3 inhibitor has demonstrated equipotent inhibition of the F691L mutant, including the ABL/FLT3 inhibitor ponatinib, which was designed to retain activity against the problematic gatekeeper T3151 mutant in BCR-ABL (Smith et al., Blood, 2013; 121 :3165-71).
[0005] Accordingly there is a long felt need for new FLT3 inhibitors that overcome the drawbacks of the FLT3 inhibitors known in the art.
SUMMARY
[0006] The present disclosure relates to protein kinases and compounds which selectively modulate kinases, and uses therefor. Particular embodiments contemplate disease indications which are amenable to treatment by modulation of kinase activity by the compounds of the present disclosure.
[0007] This disclosure relates to novel compounds, as described in any of the embodiments herein, or a pharmaceutically acceptable salt, a solvate, a tautomer, an isomer or a deuterated analog thereof, wherein these novel compounds can modulate FLT3. In another embodiment the compounds described herein further modulate c-Kit, CSF-1R, or both c-Kit and CSF-1R. In another embodiment, the compounds described herein can further modulate FLT3 having an ITD mutation and optionally an F691L mutation and/or D835Y mutation.
[0008] The compounds of this disclosure are novel in structure and unexpectedly advantageous in function. The compounds of this disclosure overcome the deficiencies of past FLT3 inhibitors, including those disclosed in WO 2011/022473. More specifically, the compounds of this disclosure is a selection invention of WO 2011/022473 and have a novel structural motif and a moiety not specifically disclosed in WO 201 1/022473. This novel structural motif is a cyclic group, as defined by R2 herein, attached directly to an amino group that is attached to a heteroaryl moiety on the right hand side of the compounds as described herein. The novel compounds of this disclosure exhibit superior and unexpectedly better potency against the mutated forms of the FLT3 tyrosine kinase enzymes, particularly the F691L mutation and/or D835Y mutation when compared to the compounds in WO 2011/022473.
[0009] One aspect of the disclosure relates to a compound having Formula I:
Formula I;
or a pharmaceutically acceptable salt, a solvate, a tautomer, an isomer or a deuterated analog thereof, wherein:
Ring A is a 5 or 6 membered aryl or heteroaryl ring;
J is O or S;
X is S, O, -N=C(H , -C(H)=N-, or -C(R9) =C(R9)-;
R1 is hydrogen or alkyl;
R2 is
B is a fused 5- or 6-membered saturated or unsaturated ring having 0-3 heteroatoms selected from O, N, or S;
each Q is independently hydrogen, alkyl, halo, cyano, deuteroalkyl, haloalkyl, cycloalkyl, cycloalkylalkyl, heterocycloalkyl, heterocyclylalkyl,
oxo, -R^OR^, -RuORvORx', -RuOC(0)Rx', -R,1C(0)ORx', -RuC(0)N(Ry)(Rz),
-RuS(0)tRx", -RuN(Ry)(Rz), -R¾(Ry)C(0)Rx, or RvC(0)N(Ry)(Rz), wherein the alkyl, cycloalkyl, cycloalkylalkyl, heterocycloalkyl or heterocyclylalkyl is each independently optionally substituted with 1 to 3 groups each independently halo, oxo, - ¼, alkyl, haloalkyl or -RuORx , provided that when Q is attached to nitrogen, Q is not halo or cyano;
Q1 is hydrogen, alkyl, deuteroalkyl, haloalkyl, cycloalkyl, cycloalkylalkyl,
heterocycloalkyl,
heterocyclylalkyl, -RuORx , -RuORvORx, -RuC(0)Rx', -RuN(Ry)(Rz), -RuOC(0)Rx',
-RuC(0)ORx, -RuC(0)N(Ry)(Rz), or -RuS(0)tRx", wherein the alkyl, cycloalkyl, cycloalkylalkyl,
heterocycloalkyl or heterocyclylalkyl is each independently optionally substituted with 1 to 3 groups each independently halo, oxo, amino, alkyl, haloalkyl or - uORx ;
Q2 is hydrogen, methoxyethoxy, ethoxymethoxy, cyclopropyl, or C1-C2 alkyl optionally subsiuted with 1-3 substituents each independently halo, hydroxyl or methoxy;
each Q3 is independently hydrogen, cyano, -OH, -S(Ci-C2alkyl), halo, C2-C3alkenyl, C2- C3alkynyl, Ci-C3alkoxy, cyclopropyl, - H2, -N(H)(Ci-C3alkyl), -N(H)C(0)C(H)=CH2, or C C3 alkyl, wherein each Q3 is optionally substituted with 1-3 substituents each independently halo, hydroxyl or methoxy;
Q4 is hydrogen, cyclopropyl, or C1-C2 alkyl optionally subsiuted with 1-3 substituents each independently halo, hydroxyl or methoxy;
R3 is hydrogen, alkyl or haloalkyl;
R4 and R5 are each independently hydrogen, deuterium, halo, alkyl, haloalkyl, hydroxy, alkoxy or amino;
each R6 is independently deuterium, halo or alkyl;
each R7 is independently deuterium, halo, alkyl, haloalkyl, cycloalkyl, cycloalkylalkyl, aryl, aralkyl, heterocycloalkyl, heterocyclylalkyl, heteroaryl, heteroarylalkyl, or -RuORx , wherein the alkyl, cycloalkyl, heterocycloalkyl, and heterocyclylalkyl moieties are each independently optionally substituted with 1 to 5 groups each independently halo, alkyl, or haloalkyl;
each R9 is independently hydrogen, halo, -NH2, alkyl, haloalkyl, alkoxy, or cyano; each t is independently 0, 1 or 2;
each Ru is independently alkylene, alkenylene, alkynylene or a direct bond;
each Rx is independently hydrogen, alkyl, haloalkyl, alkenyl, alkynyl or cycloalkyl; each Rx is independently alkyl, haloalkyl, alkenyl, alkynyl or cycloalkyl;
each Rv is independently alkylene, alkenylene or alkynylene wherein the alkylene, alkenylene or alkynylene are each optionally substituted with one or more deuterium atoms;
Ry and Rz are each independently hydrogen or alkyl,
a O, 1, 2, or 3,
m is 1 or 2, and
n is 0, 1 or 2.
[0010] Other embodiments and subembodiments of Formula I are further described herein.
[0011] Another aspect of the disclosure relates to a pharmaceutical composition comprising a compound according to Formula I, or any embodiment and sub-embodiment of Formula I described herein, or a pharmaceutically acceptable salt, a solvate, a tautomer, an isomer or a
deuterated analog of any of these compounds, and a pharmaceutically acceptable carrier or excipient.
[0012] Another aspect of the disclosure relates to a pharmaceutical composition comprising a compound according to Formula I, or any embodiment and sub-embodiment of Formula I herein, or a pharmaceutically acceptable salt, a solvate, a tautomer, an isomer or a deuterated analog of any of these compounds, and another therapeutic agent.
[0013] Another aspect of the disclosure relates to a method for treating a subject with a disease or condition mediated by FLT3, CSF1R or c-kit, said method comprising administering to the subject an effective amount of a compound according to Formula I, or any embodiment and sub- embodiment of Formula I described herein, or a pharmaceutically acceptable salt, a solvate, a tautomer, an isomer or a deuterated analog of any of these compounds, wherein the disease or condition is acute myeloid leukemia, stem cell ablation and myelopreparation for stem cell transplant, primary progressive multiple sclerosis, traumatic brain injury, epilepsy, tauopathies, Erdheim-Chester Disease, Langerhans cell histocytosis, hairy cell leukemia, HIV, glioblastoma, scleroderma, anterior or posterior eye disease, lysosomal storage diseases, complex regional pain syndrome, reflex sympathetic dystrophy, muscular dystrophy, duchenne muscular dystrophy, causalgia, neuro-inflammation, neuroinflammatory disorders, benign forgetfulness, HIV, binswager type dementia, dementia with lewy bodie, prosencephaly, microencepahy, cerebral palsy, congenital hydrocephalus, abdominal dropsy, progressive supranuclear palsy, glaucoma, addiction disorders, dependencies, alcoholism, tremors, Wilson's disease, vascular dementias, multi infarct dementia, fronto temporal dementia, pseudo-dementia, bladder cancer, basal cell carcinoma, cholangiocarcinoma, colon cancer, endometrial cancer, esophageal cancer, Ewing's sarcoma, gastric cancer, glioma, hepatocellular carcinoma, Hodgkin lymphoma, laryngeal carcinoma, leukemia, liver cancer, lung cancer, melanoma, mesothelioma, pancreatic cancer, rectal cancer, renal cancer, squamous cell carcinoma, T cell lymphoma, thyroid cancer, monocytic leukemia, pheochromocytoma, malignant peripheral nerve cell tumors, malignant peripheral nerve sheath tumors (MPNST), cutaneous and plexiform neurofibromas,
leiomyoadenomatoid tumor, fibroids, uterine fibroids, leiomyosarcoma, papillary thyroid cancer, anaplastic thyroid cancer, medullary thyroid cancer, follicular thyroid cancer, hurthle cell carcinoma, thyroid cancer, ascites, malignant ascites, mesothelioma, salivary gland tumors, mucoepidermoid carcinoma of the salivary gland, acinic cell carcinoma of the salivary gland, gastrointestinal stromal tumors (GIST), tumors that cause effusions in potential spaces of the body, pleural effusions, pericardial effusions, peritoneal effusions aka ascites, giant cell tumors (GCT), GCT of bone other sarcomas, tumor angiogenesis, paracrine tumor growth or tumors
that express aberrantly or otherwise a FLT3 ligand, or activating mutations or translocations of any of the foregoing.
[0014] Another aspect of the disclosure relates to a method for treating a subject with a disease or condition mediated by FLT3, CSF1R or c-kit, said method comprising administering to the subject an effective amount of a compound according to Formula I, or any embodiment and sub- embodiment of Formula I described herein, or a pharmaceutically acceptable salt, a solvate, a tautomer, an isomer or a deuterated analog of any of these compounds, wherein the disease or condition is wherein the disease or condition is alysosomal storage disease selected from the group consisting of mucolipodosis, alpha-mannosidosis; aspartylglucosaminuria; Batten disease; beta-mannosidosis; cystinosis; Danon disease; Fabry disease; Farber disease; fucosidosis;
galactosialidosis; Gaucher disease; gangliosidosis; Krabbe disease; metachromatic
leukodystrophy; mucopolysaccharidoses disorders; aspartylglucosaminuria; Batten disease; beta-mannosidosis; cystinosis; Danon disease; Fabry disease; Farber disease; fucosidosis;
galactosialidosis; Gaucher disease; gangliosidosis; Krabbe disease; metachromatic
leukodystrophy; mucopolysaccharidoses disorders; mucolipidosis type I (Sialidosis);
Mucolipidosis type II (I-Cell disease); Mucolipidosis type III (Pseudo-Hurl er polydystrophy); Mucolipidosis type IV; multiple sulfatase deficiency; Niemann-Pick types A, B, C; Pompe disease (glycogen storage disease); pycnodysostosis; Sandhoff disease; Schindler disease; Salla disease/sialic acid storage disease; Tay-Sachs; and Wolman disease.
[0015] Another aspect of the disclosure relates to a method for treating a subject suffering from a disease or condition as described herein, said method comprising administering to the subject a pharmaceutical composition comprising a compound according to Formula I, or any embodiment and sub -embodiment of Formula I described herein, or a pharmaceutically acceptable salt, a solvate, a tautomer, an isomer or a deuterated analog of any of these compounds, and another therapeutic agent, wherein the other therapeutic agent is selected from: i) an alkylating agent selected from adozelesin, altretamine, bizelesin, busulfan, carboplatin, carboquone, carmustine, chlorambucil, cisplatin, cyclophosphamide, dacarbazine, estramustine, fotemustine, hepsulfam, ifosfamide, improsulfan, irofulven, lomustine, mechlorethamine, melphalan, oxaliplatin, piposulfan, semustine, streptozocin, temozolomide, thiotepa, and treosulfan; ii) an antibiotic selected from bleomycin, dactinomycin, daunorubicin, doxorubicin, epirubicin, idarubicin, menogaril, mitomycin, mitoxantrone, neocarzinostatin, pentostatin, and plicamycin; iii) an antimetabolite selected from the group consisting of azacitidine, capecitabine, cladribine, clofarabine, cytarabine, decitabine, floxuridine, fludarabine, 5-fluorouracil, ftorafur, gemcitabine, hydroxyurea, mercaptopurine, methotrexate, nelarabine, pemetrexed, raltitrexed,
thioguanine, and trimetrexate; iv) an antibody therapy agent selected from alemtuzumab, bevacizumab, cetuximab, galiximab, gemtuzumab, nivolumab, panitumumab, pembrolizumab, pertuzumab, rituximab, tositumomab, trastuzumab, and 90 Y ibritumomab tiuxetan; v) a hormone or hormone antagonist selected from the group consisting of anastrozole, androgens, buserelin, diethylstilbestrol, exemestane, flutamide, fulvestrant, goserelin, idoxifene, letrozole, leuprolide, magestrol, raloxifene, tamoxifen, and toremifene; vi) a taxane selected from DJ-927, docetaxel, TPI 287, paclitaxel and DHA-paclitaxel; vii) a retinoid selected from alitretinoin, bexarotene, fenretinide, isotretinoin, and tretinoin; viii) an alkaloid selected from etoposide, homoharringtonine, teniposide, vinblastine, vincristine, vindesine, and vinorelbine; ix) an antiangiogenic agent selected from AE-941 (GW786034, Neovastat), ABT-510, 2- methoxyestradiol, lenalidomide, and thalidomide; x) a topoisomerase inhibitor selected from amsacrine, edotecarin, exatecan, irinotecan, SN-38 (7-ethyl-lO-hydroxy-camptothecin), rubitecan, topotecan, and 9-aminocamptothecin; xi) a kinase inhibitor selected from erlotinib, gefitinib, flavopiridol, imatinib mesylate, lapatmib, sorafenib, sunitinib malate, AEE-788, AG- 013736, AMG 706, AMN107, BMS-354825, BMS-599626, UCN-01 (7-hydroxystaurosporine), vemurafenib, dabrafenib, trametinib, cobimetinib selumetinib and vatalanib; xii) a targeted signal transduction inhibitor selected from bortezomib, geldanamycin, and rapamycin; xiii) a biological response modifier selected from imiquimod, interferon-a and interleukin-2; xiv) an IDO inhibitor, and xv) a chemotherapeutic agent selected from 3-AP (3-amino-2- carboxyaldehyde thiosemicarbazone), altrasentan, aminoglutethimide, anagrelide, asparaginase, bryostatin-1, cilengitide, elesclomol, eribulin mesylate (E7389), ixabepilone, lonidamine, masoprocol, mitoguanazone, oblimersen, sulindac, testolactone, tiazofurin, a mTOR inhibitor, a PI3K inhibitor, a Cdk4 inhibitor, an Akt inhibitor, a Hsp90 inhibitor, a farnesyltransferase inhibitor or an aromatase inhibitor (anastrozole letrozole exemestane); xvi) a Mek inhibitor; xvii) a tyrosine kinase inhibitor; or xviii) an EGFR inhibitor.
[0016] Another aspect of the disclosure relates to a method of (1) identifying the presence of a tumor in a patient; and (2) treating the patient, identified as needing the treatment, by administering a therapeutically effective amount of a compound according to Formula I, or any embodiment and sub -embodiment of Formula I described herein, or a pharmaceutically acceptable salt, a solvate, a tautomer, an isomer or a deuterated analog of any of these compounds, or any composition thereof as described in the specificiation, wherein the step of identifying the patient includes identifying a patient having an oncogenic Flt3 mutant that is encoded by a Flt3 gene having an ITD mutation and optionally an F691L mutation and/or D835Y mutation.
DETAILED DESCRIPTION
I. Definitions
[0017] As used herein the following definitions apply unless clearly indicated otherwise:
[0018] It is noted here that as used herein and the appended claims, the singular forms "a," "an," and "the" include plural reference unless the context clearly dictates otherwise.
[0019] Unless a point of attachment indicates otherwise, the chemical moieties listed in the definitions of the variables of formula (I), and all the embodiments thereof, are to be read from left to right, wherein the right hand side is directly attached to the parent strucuture as defined. However, if a point of attachment is shown on the left hand side of the chemical moiety (e.g., -alkyloxy-(Ci-C25)alkyl), then the left hand side of this chemical moiety is attached directly to the parent moiety as defined. It is assumed that when considering generic descriptions of compounds of the described herein for the purpose of constructing a compound, such construction results in the creation of a stable structure. That is, one of ordinary skill in the art would recognize that theoretically some constructs which would not normally be considered as stable compounds (that is, sterically practical and/or synthetically feasible).
[0020] "Halogen" or "halo" refers to all halogens, that is, chloro (CI), fluoro (F), bromo (Br), or iodo (I).
[0021] "Hydroxyl" or "hydroxy" refers to the group -OH. The term "oxo" refers to C(O) or -0-.
[0022] "Heteroatom" is meant to include oxygen (O), nitrogen (N), and sulfur (S).
[0023] The term "alkyl," by itself or as part of another substituent, means, unless otherwise stated, a straight or branched chain hydrocarbon, having the number of carbon atoms designated (i.e. Ci-6 means one to six carbons). Representative alkyl groups include straight and branched chain alkyl groups having 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 or 12 carbon atoms. Further representative alkyl groups include straight and branched chain alkyl groups having 1, 2, 3, 4, 5, 6, 7 or 8 carbon atoms. Examples of alkyl groups include methyl, ethyl, n-propyl, isopropyl, n- butyl, t-butyl, isobutyl, sec-butyl, n-pentyl, n-hexyl, n-heptyl, n-octyl, and the like. For each of the definitions herein (e.g., alkyl, alkoxy, arylalkyl, cycloalkylalkyl, heterocycloalkylalkyl, heteroarylalkyl, etc.), when a prefix is not included to indicate the number of carbon atoms in an alkyl portion, the alkyl moiety or portion thereof will have 12 or fewer main chain carbon atoms or 8 or fewer main chain carbon atoms or 6 or fewer main chain carbon atoms. For example, Ci_ 6 alkyl refers to a straight or branched hydrocarbon having 1, 2, 3, 4, 5 or 6 carbon atoms and includes, but is not limited to, C1-2 alkyl, C .4 alkyl, C2-6 alkyl, C2- alkyl, C -5 alkyl, C2-8 alkyl,
Ci-7 alkyl, C2-7 alkyl and C3.6 alkyl. The term "deuteroalkyl" refers to a deuterated analog of an alkyl group. The term "haloalkyl" refers to an alkykl substituted by one to seven halogen atoms. Haloalkyl includes monohaloalkyl or polyhaloalkyl. For example, the term "Ci.
6haloalkyl" is mean to include trifluoromethyl, difluoromethyl, 2,2,2-trifluoroethyl, 4- chlorobutyl, 3 )romopropoyl, and the like. While it is understood that substitutions are attached at any available atom to produce a stable compound, when optionally substituted alkyl is an R group of a moiety such as -OR (e.g. alkoxy), -SR (e.g. thioalkyl), - HR (e.g.
alkylamino), -C(0)NHR, and the like, substitution of the alkyl R group is such that substitution of the alkyl carbon bound to any O, S, or N of the moiety (except where N is a heteroaryl ring atom) excludes substituents that would result in any O, S, or N of the substituent (except where N is a heteroaryl ring atom) being bound to the alkyl carbon bound to any O, S, or N of the moiety. The term alkyl is meant to encompass alkenyl and alkynyl as defined herein.
[0024] The term "alkylene" by itself or as part of another substituent means a linear or branched saturated divalent hydrocarbon moiety derived from an alkane having the number of carbon atoms indicated in the prefix. For example, (i.e., Ci_6 means one to six carbons; Ci-s alkylene is meant to include methylene, ethylene, propylene, 2-methylpropylene, pentylene, hexylene and the like). CL-4 alkylene includes methylene -CH2-, ethylene -CH2CH2-, propylene -CH2CH2CH2-, and isopropylene -CH(C¾)CH2- , -CH2CH(CH3)-, -CH2-(CH2)2CH2-, -CH2-CH(CH3)CH2-, -CH2-C(CH3)2~CH2-CH2CH(CH3)- . Typically, an alkyl (or alkylene) group will have from 1 to 24 carbon atoms, with those groups having 10 or fewer, 8 or fewer, or 6 or fewer carbon atoms. When a prefix is not included to indicate the number of carbon atoms in an alkylene portion, the alkylene moiety or portion thereof will have 12 or fewer main chain carbon atoms or 8 or fewer main chain carbon atoms, 6 or fewer main chain carbon atoms, or 4 or fewer main chain carbon atoms, or 3 or fewer main chain carbon atoms, or 2 or fewer main chain carbon atoms, or 1 carbon atom.
[0025] The term "alkenyl" refers to a linear monovalent hydrocarbon radical or a branched monovalent hydrocarbon radical having the number of carbon atoms indicated in the prefix and containing at least one double bond. For example, (C2-Ce)alkenyl is meant to include ethenyl, propenyl, and the like. The term "alkynyl" refers to a monoradical of an unsaturated
hydrocarbon, in some embodiments, having from 2 to 20 carbon atoms (in some embodiments, from 2 to 10 carbon atoms, e.g. 2 to 6 carbon atoms) and having from 1 to 6 carbon-carbon triple bonds e.g. 1, 2 or 3 carbon-carbon triple bonds. In some embodiments, alkynyl groups include ethynyl (-C≡CH), propargyl (or propynyl, i.e -C≡CCH3), and the like. When a prefix is not included to indicate the number of carbon atoms in an alkenyl or alkynyl portion, the alkenyl or
alkynyl moiety or portion thereof will have 12 or fewer main chain carbon atoms or 8 or fewer main chain carbon atoms, 6 or fewer main chain carbon atoms or 4 or fewer main chain carbon atoms. The term "alkenylene" refers to a linear monovalent hydrocarbon radical or a branched monovalent hydrocarbon radical containing at least one double bond and having the number of carbon atoms indicated in the prefix. The term "alkynylene" refers to a linear monovalent hydrocarbon radical or a branched monovalent hydrocarbon radical containing at least one triple bond and having the number of carbon atoms indicated in the prefix. Examples of such unsaturated alkyl groups include vinyl, 2-propenyl, crotyl, 2-isopentenyl, 2-(butadienyl), 2,4- pentadienyl, 3-(l,4-pentadienyl), ethynyl, 1 - and 3-propynyl, 3-butynyl, and the higher homologs and isomers
[0026] "Cycloalkyl" or "Carbocycle" by itself or as part of another substituent, refers to saturated or unsaturated, non-aromatic monocyclic, bicyclic or tricyclic carbon ring systems having the number of carbon atoms indicated in the prefix or if unspecified having 3-10, also 3-8, and also 3-6, ring members per ring, such as cyclopropyl, cyclopentyl, cyclohexyl, 1- cyclohexenyl, adamantyl, and the like, where one or two ring carbon atoms may optionally be replaced by a carbonyl. Cycloalkyl refers to hydrocarbon rings having the indicated number of ring atoms (e.g., C3-8 cycloalkyl means three to eight ring carbon atoms). "Cycloalkyl" or "carbocycle" may form a bridged ring or a spiro ring. The cycloalkyl group may have one or more double or triple bond(s), in which case they would be termed cycloalkenyl and cycloalkynyl respectively. The term "cycloalkylcarbonyl" refers to a -cycloalkyl-C(O)- group, wherein cycloalkyl is as defined herein. The term "alkylcarbonyl" refers to -alkyl-C(O)-, wherein alkyl is as defined herein.
[0027] "Cycloalkylalkyl" refers to an -(alkylene)-cycloalkyl group where alkylene as defined herein has the indicated number of carbon atoms or if unspecified having six or fewer, or four or fewer main chain carbon atoms; and cycloalkyl is as defined herein has the indicated number of carbon atoms or if unspecified having 3-10, also 3-8, and also 3-6, ring members per ring. C3. 8cycloalkyl-Ci.2alkyl is meant to have 3 to 8 ring carbon atoms and 1 to 2 alkylene chain carbon atoms. Exemplary cycloalkylalkyl includes, e.g., cyclopropylmethylene, cyclobutylethylene, cyclobutylmethylene, and the like.
[0028] "Cycloalkenyl" by itself or as part of another substituent, refers to a non-aromatic monocyclic, bicyclic or tricyclic carbon ring system having the number of carbon atoms indicated in the prefix or if unspecified having 3-10, also 3-8, and also 3-6, ring members per ring, which contains at least one carbon-carbon double bond. Exemplary cycloalkenyl includes, e.g., 1-cyclohexenyl, 4-cyclohexenyl, 1 -cyclopentenyl, 2-cyclopentenyl and the like.
[0029] "Alkoxy" or "alkoxyl"refers to a -O-alkyl group, where alkyl is as defined herein. "Cycloalkoxy" refers to a -O-cycloalkyl group, where cycloalkyl is as defined herein. While it is understood that substitutions on alkoxy are attached at any available atom to produce a stable compound, substitution of alkoxy is such that O, S, or N (except where N is a heteroaryl ring atom), are not bound to the alkyl carbon bound to the alkoxy O. Further, where alkoxy is described as a substituent of another moiety, the alkoxy oxygen is not bound to a carbon atom that is bound to an O, S, or N of the other moiety (except where N is a heteroaryl ring atom), or to an alkene or alkyne carbon of the other moiety. The term "hydroxyalkyl" refers to an alkyl as defined herein substituted by at least one hydroxyl group as defined herein. The term "carboxylalkyl" refers to -C(0)-alkyl group, wherein alkyl is as defined herein. The term "alkoxycarbonyl" refers to a -C(0)-alkoxy group, wherein alkoxy is as defined herein.
[0030] "Amino" or "amine" denotes the group -NH2. The term "cyano" refers to the group - CN.
[0031] "Alkylamino" refers to a -NH-alkyl group, where alkyl is as defined herein.
Exemplary alkylamino groups include CH3 H-, ethylamino, and the like.
[0032] "Dialkylamino" refers to a -N(alkyl)(alkyl) group, where each alkyl is independently as defined herein. Exemplary dialkylamino groups include dimethylamino, diethylamino, ethylmethylamino, and the like. "Cycloalkylamino" denotes the group -NRddRee, where Rdd and Ree combine with the nitrogen to form a 5-7 membered heterocycloalkyl ring, where the heterocycloalkyl may contain an additional heteroatom within the ring, such as O, N, or S, and may also be further substituted with alkyl. Alternatively, "cycloalkylamino" refers to a -NH- cycloalkyl group, where cycloalkyl is as defined herein. The term "cycloalkylaminocarbonyl" refers to a cycloalkylamino-C(O) group, where cycloalkylamino is as defined herein.
[0033] "Aryl" by itself or as part of another substituent refers to a monocyclic, bicyclic or polycyclic polyunsaturated aromatic hydrocarbon radical containing 6 to 14 ring carbon atoms, which can be a single ring or multiple rings (up to three rings) which are fused together or linked covalently. Non-limiting examples of unsubstituted aryl groups include phenyl, 1-naphthyl and 2-naphthyl. The term "arylene" refers to a divalent aryl, wherein the aryl is as defined herein.
[0034] "Arylalkyl" or "aralkyl" refers to -(alkylene)-aryl, where the alkylene group is as defined herein and has the indicated number of carbon atoms, or if unspecified having six or fewer main chain carbon atoms or four or fewer main chain carbon atoms; and aryl is as defined herein. Examples of arylalkyl include benzyl, phenethyl, 1-methylbenzyl, and the like.
[0035] "Heteroaryl" by itself or as part of another substituent refers to a monocyclic aromatic ring radical containing 5 or 6 ring atoms, or a bicyclic aromatic radical having 8 to 10 atoms, containing one or more, 1-4, 1-3, or 1-2, heteroatoms independently selected from the group consisting of O, S, and . Heteroaryl is also intended to include oxidized S or , such as sulfinyl, sulfonyl and N-oxide of a tertiary ring nitrogen. A carbon or nitrogen atom is the point of attachment of the heteroaryl ring structure such that a stable compound is produced.
Examples of heteroaryl groups include, but are not limited to, pyridinyl, pyridazinyl, pyrazinyl, indolizinyl, benzo[b]thienyl, quinazolinyl, purinyl, indolyl, quinolinyl, pyrimidinyl, pyrrolyl, pyrazolyl, oxazolyl, thiazolyl, thienyl, isoxazolyl, oxathiadiazolyl, isothiazolyl, tetrazolyl, imidazolyl, triazolyl, furanyl, benzofuryl, indolyl, triazinyl, quinoxalinyl, cinnolinyl, phthalaziniyl, benzotriazinyl, benzimidazolyl, benzopyrazolyl, benzotriazolyl, benzisoxazolyl, isobenzofuryl, isoindolyl, indolizinyl, benzotriazinyl, thienopyridinyl, thienopyrimidinyl, pyrazolopyrimidinyl, imidazopyridines, benzothiaxolyl, benzothienyl, quinolyl, isoquinolyl, indazolyl, pteridinyl and thiadiazolyl. "Nitrogen containing heteroaryl" refers to heteroaryl wherein any of the heteroatoms is N.
[0036] "Heterocycloalkyl" refers to a saturated or unsaturated non-aromatic cycloalkyl group that contains from one to five heteroatoms selected from N, O, and S, wherein the nitrogen and sulfur atoms are optionally oxidized, and the nitrogen atom(s) are optionally quaternized, the remaining ring atoms being C, where one or two C atoms may optionally be replaced by a carbonyl. The heterocycloalkyl may be a monocyclic, a bicyclic or a polycylic ring system of 3 to 12, or 4 to 10 ring atoms, or 5 to 8 ring atoms in which one to five ring atoms are heteroatoms selected from -N= -N-, -0-, -S-, -S(O)-, or -S(0)2- and further wherein one or two ring atoms are optionally replaced by a -C(O)- group. The heterocycloalkyl can also be a heterocyclic alkyl ring fused with a cycloalkyl, an aryl or a heteroaryl ring. Non limiting examples of
heterocycloalkyl groups include pyrrolidinyl, piperidinyl, imidazolidinyl, benzofuranyl, pyrazolidinyl, morpholinyl, and the like. A heterocycloalkyl group can be attached to the remainder of the molecule through a ring carbon or a heteroatom. The term
"heterocycloalkylene" refers to a divalent heterocycloalkyl, wherein the heterocycloalkyl is as defined herein. The term "heterocycloalkylsulfonyl" refers to a -S(0)2-heterocycloalkyl group where heterocycloalkyl is as defined herein.
[0037] "Heterocycloalkylalkyl" or "heterocyclylalkyl " refers to -(alkylene)-heterocycloalkyl, where the alkylene group is as defined herein and has the indicated number of carbon atoms, or if unspecified having six or fewer main chain carbon atoms or four or fewer main chain carbon atoms; and heterocycloalkyl is as defined herein.
[0038] "Protecting group" refers to a grouping of atoms that when attached to a reactive group in a molecule masks, reduces or prevents that reactivity. Examples of protecting groups can be found in T.W. Greene and P.G. Wuts, PROTECTIVE GROUPS IN ORGANIC CHEMISTRY, (Wiley, 4th ed. 2006), Beaucage and Iyer, Tetrahedron 48:2223-2311 (1992), and Harrison and Harrison et al , COMPENDIUM OF SYNTHETIC ORGANIC METHODS, Vols. 1-8 (John Wiley and Sons. 1971- 1996). Representative amino protecting groups include formyl, acetyl, trifluoroacetyl, benzyl, benzyloxycarbonyl (CBZ), fert-butoxycarbonyl (Boc), trimethyl silyl (TMS), 2-trimethylsilyl- ethanesulfonyl (SES), trityl and substituted trityl groups, allyloxycarbonyl, 9- fluorenylmethyloxycarbonyl (FMOC), nitro-veratiyloxycarbonyl ( VOC), tri-isopropylsilyl (TIPS), phenylsulphonyl and the like (see also, Boyle, A. L (Editor), carbamates, amides, N- sulfonyl derivatives, groups of formula -C(0)OR, wherein R is, for example, methyl, ethyl, t- butyl, benzyl, phenylethyl, CH2=CHCH2-, and the like, groups of the formula -C(0)R', wherein R' is, for example, methyl, phenyl, trifluoromethyl, and the like, groups of the formula -SO2R", wherein R" is, for example, tolyl, phenyl, trifluoromethyl, 2,2,5,7,8-pentamethylchroman-6-yl, 2,3,6-trimethyl-4-methoxyphenyl, and the like, and silanyl containing groups, such as
2-trimethylsilylethoxymethyl, t-butyldimethylsilyl, triisopropylsilyl, and the like, CURRENT PROTOCOLS IN NUCLEIC ACID CHEMISTRY, John Wiley and Sons, New York, Volume 1, 2000).
[0039] "Optional" or "Optionally" as used throughout the disclosure means that the subsequently described event or circumstance may or may not occur, and that the description includes instances where the event or circumstance occurs and instances in which it does not. For example, the phrase "the aromatic group is optionally substituted with one or two alkyl substituents" means that the alkyl may but need not be present, and the description includes situations where the aromatic group is substituted with an alkyl group and situations where the aromatic group is not substituted with the alkyl group.
[0040] As used herein, the term "composition" refers to a formulation suitable for administration to an intended animal subject for therapeutic purposes that contains at least one pharmaceutically active compound and at least one pharmaceutically acceptable carrier or excipient.
[0041] The term "pharmaceutically acceptable" indicates that the indicated material does not have properties that would cause a reasonably prudent medical practitioner to avoid administration of the material to a patient, taking into consideration the disease or conditions to be treated and the respective route of administration. For example, it is commonly required that such a material be essentially sterile, e.g., for injectables.
[0042] "Pharmaceutically acceptable salt" refers to a salt which is acceptable for
administration to a patient, such as a mammal (e.g., salts having acceptable mammalian safety for a given dosage regime). Such salts can be derived from pharmaceutically acceptable inorganic or organic bases and from pharmaceutically-acceptable inorganic or organic acids, depending on the particular substituents found on the compounds described herein. When compounds of the present disclosure contain relatively acidic functionalities, base addition salts can be obtained by contacting the neutral form of such compounds with a sufficient amount of the desired base, either neat or in a suitable inert solvent. Salts derived from pharmaceutically acceptable inorganic bases include aluminum, ammonium, calcium, copper, ferric, ferrous, lithium, magnesium, manganic, manganous, potassium, sodium, zinc and the like. Salts derived from pharmaceutically acceptable organic bases include salts of primary, secondary, tertiary and quaternary amines, including substituted amines, cyclic amines, naturally-occurring amines and the like, such as arginine, betaine, caffeine, choline, N, N'- dibenzylethylenediamine, diethylamine, 2-diethylaminoethanol, 2- dimethylaminoethanol, ethanolamine, ethylenediamine, N-ethylmorpholine, N-ethylpiperidine, glucamine, glucosamine, histidine, hydrabamine, isopropylamine, lysine, methylglucamine, morpholine, piperazine, piperidine, polyamine resins, procaine, purines, theobromine, triethylamine, trimethylamine, tripropylamine, tromethamine, Ν,Ν'-dibenzylethylenediamine, chloroprocaine, choline, diethanolamine, meglumine (N-methyl- glucamine) and the like. When compounds of the present disclosure contain relatively basic functionalities, acid addition salts can be obtained by contacting the neutral form of such compounds with a sufficient amount of the desired acid, either neat or in a suitable inert solvent. Salts derived from pharmaceutically acceptable acids include acetic, trifluoroacetic, propionic, ascorbic, benzenesulfonic, benzoic, camphosulfonic, citric, ethanesulfonic, fumaric, glycolic, gluconic, glucoronic, glutamic, hippuric, hydrobromic, hydrochloric, isethionic, lactic, lactobionic, maleic, malic, mandelic, methanesulfonic, mucic, naphthalenesulfonic, nicotinic, nitric, pamoic, pantothenic, phosphoric, succinic, sulfuric, hydroiodic, carbonic, tartaric, p- toluenesulfonic, pyruvic, aspartic, benzoic, anthranilic, mesylic, salicylic, p-hydroxybenzoic, phenylacetic, embonic (pamoic), ethanesulfonic, benzenesulfonic, 2-hydroxyethanesulfonic, sulfanilic, stearic, cyclohexylaminosulfonic, algenic, hydroxybutyric, galactaric and galacturonic acid and the like.
[0043] Also included are salts of amino acids such as arginate and the like, and salts of organic acids like glucuronic or galactunoric acids and the like (see, for example, Berge, S. M. et al, "Pharmaceutical Salts", J. Pharmaceutical Science, 1977, 66: 1-19). Certain specific compounds of the present disclosure contain both basic and acidic functionalities that allow the compounds to be converted into either base or acid addition salts.
[0044] The neutral forms of the compounds may be regenerated by contacting the salt with a base or acid and isolating the parent compound in the conventional manner. The parent form of the compound differs from the various salt forms in certain physical properties, such as solubility in polar solvents, but otherwise the salts are equivalent to the parent form of the compound for the purposes of the present disclosure.
[0045] In the present context, the term "therapeutically effective" or "effective amount" indicates that a compound or material or amount of the compound or material when
administered is sufficient or effective to prevent, alleviate, or ameliorate one or more symptoms of a disease, disorder or medical condition being treated, and/or to prolong the survival of the subject being treated. The therapeutically effective amount will vary depending on the compound, the disease, disorder or condition and its severity and the age, weight, etc., of the mammal to be treated. In general, satisfactory results in subjects are indicated to be obtained at a daily dosage of from about 0.1 to about 10 g/kg subject body weight. In some embodiments, a daily dose ranges from about 0.10 to 10.0 mg/kg of body weight, from about 1.0 to 3.0 mg/kg of body weight, from about 3 to 10 mg/kg of body weight, from about 3 to 150 mg/kg of body weight, from about 3 to 100 mg/kg of body weight, from about 10 to 100 mg/kg of body weight, from about 10 to 150 mg/kg of body weight, or from about 150 to 1000 mg/kg of body weight. The dosage can be conveniently administered, e.g., in divided doses up to four times a day or in sustained-release form.
[0046] By "assaying" is meant the creation of experimental conditions and the gathering of data regarding a particular result of the exposure to specific experimental conditions. For example, enzymes can be assayed based on their ability to act upon a detectable substrate. A compound can be assayed based on its ability to bind to a particular target molecule or molecules.
[0047] As used herein, the terms "ligand" and "modulator" are used equivalently to refer to a compound that changes (/'. e., increases or decreases) the activity of a target biomolecule, e.g. , an enzyme such as a kinase. Generally a ligand or modulator will be a small molecule, where "small molecule refers to a compound with a molecular weight of 1500 Daltons or less, 1000 Daltons or less, 800 Daltons or less, or 600 Daltons or less. Thus, an "improved ligand" is one that possesses better pharmacological and/or pharmacokinetic properties than a reference compound, where "better" can be defined by one skilled in the relevant art for a particular biological system or therapeutic use.
[0048] The term "binds" in connection with the interaction between a target and a potential binding compound indicates that the potential binding compound associates with the target to a
statistically significant degree as compared to association with proteins generally {i.e., nonspecific binding). Thus, the term "binding compound" refers to a compound that has a statistically significant association with a target molecule. In some embodiments, a binding compound interacts with a specified target with a dissociation constant (KD) of 1 mM or less, 1 μΜ or less, 100 nM or less, 10 nM or less, or 1 nM or less. In the context of compounds binding to a target, the terms "greater affinity" and "selective" indicates that the compound binds more tightly than a reference compound, or than the same compound in a reference condition, i.e., with a lower dissociation constant. In some embodiments, the greater affinity is at least 2, 3, 4, 5, 8, 10, 50, 100, 200, 400, 500, 1000, or 10,000-fold greater affinity.
[0049] As used herein in connection with compounds of the disclosure, the term
"synthesizing" and like terms means chemical synthesis from one or more precursor materials.
[0050] As used herein, the term "modulating" or "modulate" or the like refers to an effect of altering a biological activity, especially a biological activity associated with a particular biomolecule such as a protein kinase. For example, an agonist or antagonist of a particular biomolecule modulates the activity of that biomolecule, e.g., an enzyme, by either increasing (e.g. agonist, activator), or decreasing (e.g. antagonist, inhibitor) the activity of the biomolecule, such as an enzyme. Such activity is typically indicated in terms of an inhibitory concentration (IC50) or excitation concentration (EC50) of the compound for an inhibitor or activator, respectively, with respect to, for example, an enzyme.
[0051] "Prodrugs" means any compound which releases an active parent drug according to Formula I in vivo when such prodrug is administered to a mammalian subject. Prodrugs of a compound of Formula I are prepared by modifying functional groups present in the compound of Formula I in such a way that the modifications may be cleaved in vivo to release the parent compound. Prodrugs may be prepared by modifying functional groups present in the compounds in such a way that the modifications are cleaved, either in routine manipulation or in vivo, to the parent compounds. Prodrugs include compounds of Formula I wherein a hydroxy, amino, carboxyl or sulfhydryl group in a compound of Formula I is bonded to any group that may be cleaved in vivo to regenerate the free hydroxyl, amino, or sulfhydryl group, respectively. Examples of prodrugs include, but are not limited to esters {e.g., acetate, formate, and benzoate derivatives), amides, guanidines, carbamates (e.g. , Ν,Ν-dimethylaminocarbonyl) of hydroxy functional groups in compounds of Formula I, and the like. Preparation, selection, and use of prodrugs is discussed in T. Higuchi and V. Stella, "Pro-drugs as Novel Delivery Systems," Vol. 14 of the A C S. Symposium Series; "Design of Prodrugs", ed. H. Bundgaard, Elsevier, 1985; and in Bioreversible Carriers in Drug Design, ed. Edward B. Roche, American Pharmaceutical
Association and Pergamon Press, 1 87, each of which are hereby incorporated by reference in their entirety.
[0052] "Tautomer" means compounds produced by the phenomenon wherein a proton of one atom of a molecule shifts to another atom. See, Jerry March, Advanced Organic Chemistry: Reactions, Mechanisms and Structures, Fourth Edition, John Wiley & Sons, pages 69-74 (1992). The tautomers also refer to one of two or more structural isomers that exist in equilibrium and are readily converted from one isomeric form to another. Examples of include keto-enol tautomers, such as acetone/propen-2-ol, imine-enamine tautomers and the like, ring-chain tautomers, such as glucose/2,3,4,5, 6-pentahydroxy-hexanal and the like, the tautomeric forms of heteroaryl groups containing a -N=C(H)- H- ring atom arrangement, such as pyrazoles, imidazoles, benzimidazoles, triazoles, and tetrazoles. Where the compound contains, for example, a keto or oxime group or an aromatic moiety, tautomeric isomerism ('tautomerism') can occur. The compounds described herein may have one or more tautomers and therefore include various isomers. A person of ordinary skill in the art would recognize that other tautomeric ring atom arrangements are possible. All such isomeric forms of these compounds are expressly included in the present disclosure.
[0053] "Isomers" mean compounds having identical molecular formulae but differ in the nature or sequence of bonding of their atoms or in the arrangement of their atoms in space. Isomers that differ in the arrangement of their atoms in space are termed "stereoisomers" .
"Stereoisomer" and "stereoisomers" refer to compounds that exist in different stereoisomeric forms if they possess one or more asymmetric centers or a double bond with asymmetric substitution and, therefore, can be produced as individual stereoisomers or as mixtures.
Stereoisomers include enantiomers and diastereomers. Stereoisomers that are not mirror images of one another are termed "diastereomers" and those that are non-superimposable mirror images of each other are termed "enantiomers" When a compound has an asymmetric center, for example, it is bonded to four different groups, a pair of enantiomers is possible. An enantiomer can be characterized by the absolute configuration of its asymmetric center and is described by the R- and S-sequencing rules of Cahn and Prelog, or by the manner in which the molecule rotates the plane of polarized light and designated as dextrorotatory or levorotatory (i.e., as (+) or (-)-isomers respectively). A chiral compound can exist as either individual enantiomer or as a mixture thereof. A mixture containing equal proportions of the enantiomers is called a "racemic mixture". Unless otherwise indicated, the description is intended to include individual stereoisomers as well as mixtures. The methods for the determination of stereochemistry and the separation of stereoisomers are well-known in the art (see discussion in Chapter 4 of
ADVANCED ORGANIC CHEMISTRY, 6th edition J. March, John Wiley and Sons, New York, 2007) differ in the chirality of one or more stereocenters.
[0054] Certain compounds of the present disclosure can exist in unsolvated forms as well as solvated forms, including hydrated forms. "Hydrate" refers to a complex formed by combination of water molecules with molecules or ions of the solute. "Solvate" refers to a complex formed by combination of solvent molecules with molecules or ions of the solute. The solvent can be an organic compound, an inorganic compound, or a mixture of both. Solvate is meant to include hydrate. Some examples of solvents include, but are not limited to, methanol, Ν,Ν-dimethylformamide, tetrahydrofuran, dimethylsulfoxide, and water. In general, the solvated forms are equivalent to unsolvated forms and are encompassed within the scope of the present disclosure. Certain compounds of the present disclosure may exist in multiple crystalline or amorphous forms. In general, all physical forms are equivalent for the uses contemplated by the present disclosure and are intended to be within the scope of the present disclosure.
[0055] In the context of the use, testing, or screening of compounds that are or may be modulators, the term "contacting" means that the compound(s) are caused to be in sufficient proximity to a particular molecule, complex, cell, tissue, organism, or other specified material that potential binding interactions and/or chemical reaction between the compound and other specified material can occur.
[0056] As used herein, the term "subject" refers to a living organism that is treated with compounds as described herein, including, but not limited to, any mammal, such as a human, other primates, sports animals, animals of commercial interest such as cattle, farm animals such as horses, or pets such as dogs and cats.
[0057] The term "administering" refers to oral administration, administration as a suppository, topical contact, intravenous, intraperitoneal, intramuscular, intralesional, intranasal or subcutaneous administration, or the implantation of a slow-release device e.g., a mini-osmotic pump, to a subject. Administration is by any route, including parenteral and transmucosal (e.g., buccal, sublingual, palatal, gingival, nasal, vaginal, rectal, or transdermal). Parenteral administration includes, e.g., intravenous, intramuscular, intra-arteriole, intradermal, subcutaneous, intraperitoneal, intraventricular, and intracranial. Other modes of delivery include, but are not limited to, the use of liposomal formulations, intravenous infusion, transdermal patches, etc.
[0058] "Solid form" refers to a solid preparation (i.e. a preparation that is neither gas nor liquid) of a pharmaceutically active compound that is suitable for administration to an intended animal subject for therapeutic purposes. The solid form includes any complex, such as a salt, co-crystal or an amorphous complex, as well as any polymorph of the compound. The solid form may be substantially crystalline, semi-crystalline or substantially amorphous. The solid form may be administered directly or used in the preparation of a suitable composition having improved pharmaceutical properties. For example, the solid form may be used in a formulation comprising at least one pharmaceutically acceptable carrier or excipient.
[0059] The terms "prevent," "preventing", "prevention" and grammatical variations thereof as used herein, refers to a method of partially or completely delaying or precluding the onset or recurrence of a disease, disorder or condition and/or one or more of its attendant symptoms or barring a subject from acquiring or reacquiring a disorder or condition or reducing a subject's risk of acquiring or requiring a disorder or condition or one or more of its attendant symptoms.
[0060] "Unit dosage form" refers to a composition intended for a single administration to treat a subject suffering from a disease or medical condition. Each unit dosage form typically comprises each of the active ingredients of this disclosure plus pharmaceutically acceptable excipients. Examples of unit dosage forms are individual tablets, individual capsules, bulk powders, liquid solutions, ointments, creams, eye drops, suppositories, emulsions or suspensions. Treatment of the disease or condition may require periodic administration of unit dosage forms, for example: one unit dosage form two or more times a day, one with each meal, one every four hours or other interval, or only one per day. The expression "oral unit dosage form" indicates a unit dosage form designed to be taken orally.
[0061] The compounds of the present disclosure may also contain unnatural proportions of atomic isotopes at one or more of the atoms that constitute such compounds. For example, the compounds may be radiolabeled with radioactive isotopes, such as for example tritium (3H), iodine-125 (12 I), carbon-14 (14C), carbon-11 (UC) or fluorine-18 (18F). All isotopic variations of the compounds of the present disclosure, whether radioactive or not, are intended to be encompassed within the scope of the present disclosure.
[0062] As used herein in connection with amino acid or nucleic acid sequence, the term "isolate" indicates that the sequence is separated from at least a portion of the amino acid and/or nucleic acid sequences with which it would normally be associated.
[0063] In connection with amino acid or nucleic sequences, the term "purified" indicates that the subject molecule constitutes a significantly greater proportion of the biomolecules in a
composition than the proportion observed in a prior composition, e.g., in a cell culture. The greater proportion can be 2-fold, 5-fold, 10-fold, or more than 10-fold, with respect to the proportion found in the prior composition.
[0064] The term "deuterated" as used herein alone or as part of a group, means substituted deuterium atoms. The term "deuterated analog" as used herein alone or as part of a group, means substituted deuterium atoms in place of hydrogen. The deuterated analog of the disclosure may be a fully or partially deuterium substituted derivative. In some embodiments, the deuterium substituted derivative of the disclosure holds a fully or partially deuterium substituted alkyl, aryl or heteroaryl group.
[0065] The disclosure also embraces isotopically-labeled compounds of the present disclosure which are identical to those recited herein, but for the fact that one or more atoms are replaced by an atom having an atomic mass or mass number different from the atomic mass or mass number usually found in nature. Examples of isotopes that can be incorporated into compounds of the disclosure include isotopes of hydrogen, carbon, nitrogen, oxygen, phosphorous, fluorine, and chlorine, such as, but not limited to 2H (deuterium, D), 3H (tritium), nC, 1 C, L4C, 15N, L8F, 31P, 32P, 35S, 36C1, and 125I. Unless otherwise stated, when a position is designated specifically as "H" or "hydrogen", the position is understood to have hydrogen at its natural abundance isotopic composition or its isotopes, such as deuterium (D) or tritium (3H). Certain isotopically-labeled compounds of the present disclosure (e.g., those labeled with 3H and 14C) are useful in compound and/or substrate tissue distribution assays. Tritiated (i.e., H) and carbon-14 (i.e., 14C) and fluorine-18 (L8F) isotopes are useful for their ease of preparation and detectability. Further, substitution with heavier isotopes such as deuterium (i.e., 2H) may afford certain therapeutic advantages resulting from greater metabolic stability (e.g., increased in vivo half-life or reduced dosage requirements) and hence may be preferred in some circumstances.
Isotopically labeled compounds of the present disclosure can generally be prepared by following procedures analogous to those described in the Schemes and in the Examples herein below, by substituting an isotopically labeled reagent for a non-isotopically labeled reagent.
[0066] In addition, abbreviations as used herein have respective meanings as follows:
ATP
tert-Butoxycarbonyl
BOC or Boc
BociO di-ter/-butyl dicarbonate
Bovine serum albumin
BSA
Butyl
Bu
Cbz Carbobenzyloxy
DAST diethylaminosulfur trifluoride db Dib enzy li deneacetone
DCM Di chl oromethane
DEAE Di ethyl aminoethy 1
3,4-dihydro-2H-pyran
DHP
DIAD diisopropyl azodicarboxylate
DH3AL-H Diisobutylaluminium hydride
DIEA Dii sopropyl ethyl amine
DMA Dimethylacetamide
DMAP 4-Dimethylaminopyridine
DMEM Dulbecco's Modified Eagle's Medium
Dimethylformamide
DMF
Diphenylphosphryl azide
DPPA
Dimethylsulf oxide
DMSO
dppf (diphenylphosphino)ferrocene
Dithiothreitol
DTT
EDCI N-(3 -dimethylaminopropyl)-N'- ethylcarbodiimide hydrochloride
EDTA Ethylenediaminetetraacetic acid
Εΐ Ethyl
EtOAc ethyl acetate
EtOH Ethanol
Fetal bovine serum
FBS
Gram
8
Hour
h
HATU 0-(7-azabenzotriazol-lyl)-N,N,N\N'- tetramethyluronium hexafluorophosphate
4-(2-hy droxyethyl)- 1 -
HEPES piperazineethanesulfonic acid
isopropyl
i'-Pr
LC-MS (tandem) liquid chromatography-mass spectrometry
Molar
M
Mass-to- charge ratio m/z
Methyl
Me
MeOH Methanol
Minimum essential medium
MEM
Milligram
Mg
Milliliter
mL
Millimolar
mM
mmol Millimole
Mole
mol
Mass spectrometry electrospray ionization
MS ESI
Normal
N
Nanometers
nm
Nanomolar
nM
Acetate
OAc
?-toluenesulfonic acid
ρ-ΎαΟΗ
Phosphate buffered saline
PBS
Phenyl
Ph
Room temperature
rt
2-trimethylsilylethoxymethoxy
SEM
Tert-butyl alcohol
t-BuOH
t-BuOK potassium fe/ -butoxide
T3P 1-propanephosphonic anhydride
TBAF tetra-w-butyl ammonium fluoride
TEA Trimethylamine
Trifluoroacetic acid
TFA
Tetrahydrofuran
THF
Tetrahydropyran
THP
Triisopropylsilyl
TIPS
Thin layer chromatography
TLC
Volume
V
Microgram
Microliter
μL·
Micromolar
μΜ
Π. Compounds
or a pharmaceutically acceptable salt, a solvate, a tautomer, an isomer or a deuterated analog thereof, wherein:
Ring A is a 5 or 6 membered aryl or heteroaryl ring;
J is O or S;
X is S, 0, -N=C(H , -C(H)=N-, or -C(R9)=C(R9)-;
R1 is hydrogen or alkyl;
2 is
B is a fused 5- or 6-membered saturated or unsaturated ring having 0-3 heteroatoms selected from O, N, or S;
each Q is independently hydrogen, alkyl, halo, cyano, deuteroalkyl, haloalkyl, cycloalkyl, cycloalkylalkyl, heterocycloalkyl, heterocyclylalkyl,
oxo, -FTOR ', -RuORvORx', -RuOC(0)Rx', -R'lC(0)ORx', -RuC(0)N(Ry)(Rz),
-RuS(0)tRx", -RuN(Ry)(Rz), -R¾(Ry)C(0)Rx, or RvC(0)N(Ry)(Rz), wherein the alkyl, cycloalkyl, cycloalkylalkyl, heterocycloalkyl or heterocyclylalkyl is each independently optionally substituted with 1 to 3 groups each independently halo, oxo, -M¾, alkyl, haloalkyl or -RuORx , provided that when Q is attached to nitrogen, Q is not halo or cyano ;
Q1 is hydrogen, alkyl, deuteroalkyl, haloalkyl, cycloalkyl, cycloalkylalkyl,
heterocycloalkyl,
heterocyclylalkyl, -RuORx', -RuORvORx, -RuC(0)Rx', -RuN(Ry)(Rz), -RuOC(0)Rx',
-RuC(0)ORx', -RuC(0)N(Ry)(Rz), or -RuS(0)tRx", wherein the alkyl, cycloalkyl, cycloalkylalkyl, heterocycloalkyl or heterocyclylalkyl is each independently optionally substituted with 1 to 3 groups each independently halo, oxo, amino, alkyl, haloalkyl or -RuORx ;
Q2 is hydrogen, methoxyethoxy, ethoxymethoxy, cyclopropyl, or C1-C2 alkyl optionally subsiuted with 1-3 substituents each independently halo, hydroxyl or methoxy;
each Q3 is independently hydrogen, cyano, -OH, -S(Ci-C2alkyl), halo, C2-C3 lkenyl, C2- Cjalkynyl, Ci-C3alkoxy, cyclopropyl, - H2, -N(H)(Ci-C3alkyl), -N(H)C(0)C(H)=CH2, or d- C3alkyl, wherein each Q3 is optionally substituted with 1-3 substituents each independently halo, hydroxyl or methoxy;
Q4 is hydrogen, cyclopropyl, or C1-C2 alkyl optionally subsiuted with 1-3 substituents each independently halo, hydroxyl or methoxy;
R3 is hydrogen, alkyl or haloalkyl;
R4 and R5 are each independently hydrogen, deuterium, halo, alkyl, haloalkyl, hydroxy, alkoxy or amino;
each R6 is independently deuterium, halo or alkyl;
each R7 is independently deuterium, halo, alkyl, haloalkyl, cycloalkyl, cycloalkylalkyl, aryl, aralkyl, heterocycloalkyl, heterocyclylalkyl, heteroaryl, heteroarylalkyl, or -RuORx, wherein the alkyl, cycloalkyl, heterocycloalkyl, and heterocyclylalkyl moieties are each independently optionally substituted with 1 to 5 groups each independently halo, alkyl, or haloalkyl;
each R9 is independently hydrogen, halo, -NH2, alkyl, haloalkyl, alkoxy, or cyano;
each t is independently 0, 1 or 2;
each Ru is independently alkylene, alkenylene, alkynylene or a direct bond;
each Rx is independently hydrogen, alkyl, haloalkyl, alkenyl, alkynyl or cycloalkyl; each Rx is independently alkyl, haloalkyl, alkenyl, alkynyl or cycloalkyl;
each Rv is independently alkylene, alkenylene or alkynylene wherein the alkylene, alkenylene or alkynylene are each optionally substituted with one or more deuterium atoms;
Ry and Rz are each independently hydrogen or alkyl,
a is 0, 1 , 2, or3 ;
m is 1 or 2, and
n is 0, 1 or 2.
[0068] Embodiment 1(a) of this disclosure relates to a compound of Formula 1(a): R2
or a pharmaceutically acceptable salt, a solvate, a tautomer, an isomer or a deuterated analog thereof, wherein:
Ring A is a 5 or 6 membered aryl or heteroaryl ring;
J is O or S;
X is N=C(H) or C(R9) =C(R9); or
X is S;
R1 is hydrogen or alkyl;
R2 is
B is a fused 5- or 6-membered saturated or unsaturated ring having 0-3 heteroatoms selected from O, N, or S;
Q is hydrogen, alkyl, halo, cyano, deuteroalkyl, haloalkyl, cycloalkyl, cycloalkylalkyl, heterocycloalkyl, heterocyclylalkyl,
oxo, -FTOR ', -RuORvORx', -RuOC(0)Rx', -R'lC(0)ORx', -RuC(0)N(Ry)(Rz),
-RuS(0)tRx", -RuN(Ry)(Rz), -R¾(Ry)C(0)Rx, or RvC(0)N(Ry)(Rz), wherein the alkyl, cycloalkyl, cycloalkylalkyl, heterocycloalkyl or heterocyclylalkyl is each independently optionally substituted with 1 to 3 groups each independently halo, oxo, amino, alkyl, haloalkyl or -RuORx',
Q1 is hydrogen, alkyl, halo, cyano, oxo, alkyl, deuteroalkyl, haloalkyl, cycloalkyl, cycloalkylalkyl, heterocycloalkyl,
heterocyclylalkyl, -R\)RX', -R\)RvORx, -RttC(0)Rx', -RuN(Ry)(Rz), -RuOC(0)Rx',
-RuC(0)ORx', -RuC(0)N(Ry)(Rz), or -RuS(0)tRx", wherein the alkyl, cycloalkyl, cycloalkylalkyl, heterocycloalkyl or heterocyclylalkyl is each independently optionally substituted with 1 to 3 groups each independently halo, oxo, amino, alkyl, haloalkyl or -RuORx ;
Q2 is hydrogen, methoxyethoxy, ethoxymethoxy, cyclopropyl, or C1-C2 alkyl optionally subsiuted with 1-3 substituents each independently halo, hydroxyl or methoxy;
Q3 is hydrogen, cyano, -S(Ci-C2alkyl), halo, C2-C3alkenyl, C2-C3alkynyl, Ci-Csalkoxy, cyclopropyl, -NH2, -N(H)(Ci-C3alkyl), -N(H)C(0)C(H)=CH2, or C1-C3 alkyl, wherein each Q3 is optionally substituted with 1-3 substituents each independently halo, hydroxyl or methoxy;
Q4 is hydrogen, cyclopropyl, or C1-C2 alkyl optionally subsiuted with 1-3 substituents each independently halo, hydroxyl or methoxy;
R3 is hydrogen, alkyl or haloalkyl;
R4 and R5 are each independently hydrogen, deuterium, halo, alkyl, haloalkyl, hydroxy, alkoxy or amino;
each R6 is independently deuterium, halo or alkyl;
each R7 is independently deuterium, halo, alkyl, haloalkyl, cycloalkyl, cycloalkylalkyl, aryl, aralkyl, heterocycloalkyl, heterocycloalkylalkyl, heteroaryl, heteroarylalkyl, or -R'tJR5', wherein the alkyl, cycloalkyl and heterocycloalkyl moieties are each independently optionally substituted with 1 to 5 groups each independently halo, alkyl, or haloalkyl;
each R9 is independently hydrogen, halo, amino, alkyl, haloalkyl or alkoxy;
each t is independently 0, 1 or 2;
each Ru is independently alkylene, alkenylene, alkynylene or a direct bond;
each Rx is independently hydrogen, alkyl, haloalkyl, alkenyl, alkynyl or cycloalkyl; each Rx is independently alkyl, haloalkyl, alkenyl, alkynyl or cycloalkyl;
each Rv is independently alkylene, alkenylene or alkynylene wherein the alkylene, alkenylene or alkynylene are each optionally substituted with one or more deuterium atoms;
Ry and Rz are each independently hydrogen or alkyl,
a is an integer from 0 to 3;
m is 1 or 2, and
n is 1 or 2.
[0069] Embodiment 1(b) of this disclosure relates to Embodiment 1 or 1(a) wherein J is O.
[0070] Embodiment 1(c) of this disclosure relates to Embodiment 1, 1(a), or 1(b) wherein X is -C(R9)=C(R9)-.
[0071] Embodiment 1(d) of this disclosure relates to Embodiment 1, 1(a), or 1(b) wherein X is -N=C(H or -C(H)=N-.
[0072] Embodiment 1(e) of this disclosure relates to Embodiment 1, 1(a), or 1(b) wherein X is
[0073] Embodiment 1(f) of this disclosure relates to Embodiment 1, 1(a), or 1(b) wherein X is
S.
[0074] Embodiment 2 of this disclosure relates to Formula I in embodiment 1 having Formula 11(a) or 11(b):
or a pharmaceutically acceptable salt, a solvate, a tautomer, an isomer or a deuterated analog thereof, wherein:
ring A is phenyl or isoxazolyl;
Y is N or CR9;
R1 is hydrogen;
R3 is hydrogen or alkyl;
R4 and R5 are each independently hydrogen or deuterium;
each R6 is independently deuterium, halo or alkyl;
each R7 is independently alkyl, haloalkyl, cycloalkyl, heterocycloalkyl, cycloalkylalkyl, or heterocyclylalkyl, wherein the alkyl, haloalkyl, cycloalkyl, heterocycloalkyl, cycloalkylalkyl, or heterocyclylalkyl are each independently optionally substituted with 1 to 3 groups each independently halo, alkyl or haloalkyl;
R10 is hydrogen, halo, -NH2, alkyl, haloalkyl or alkoxy;
m is 1 or 2; and
n is 0, 1 or 2.
[0075] Embodiment 3 of this disclosure relates to Formulae I in embodiment 1 and Formulae 11(a) or 11(b) in embodiment 2, wherein:
R1 is hydrogen;
R3 is hydrogen;
R4 and R5 are each hydrogen or deuterium;
R6 is deuterium, halo or alkyl;
R7 is alkyl, haloalkyl, cycloalkyl, heterocycloalkyl, where the alkyl, cycloalkyl and heterocycloalkyl are each independently optionally substituted with 1 to 3 groups each independently halo, alkyl and haloalkyl;
R9 or R10 is hydrogen;
m is 1, and
n is 0 or 1.
[0076] Embodiment 4 relates to embodiments of Formulae 1, 1(a), 11(a) or 11(b), R6 is fluoro; and n is 1.
[0077] Embodiment 5 of this disclosure relates to embodiments 1-4, wherein: Ring A is phen l or isoxazolyl; and J is O.
[007
and Rxis as defined in any of the embodiments described herein.
or a pharmaceutically acceptable salt, a solvate, a tautomer, an isomer or a deuterated analog thereof, wherein:
Y is N or CH;
R7 is alkyl, haloalkyl or cyclopropyl, where the alkyl, haloalkyl or cyclopropyl are each independently optionally substituted with 1 to 3 groups each independently halo, alkyl or haloalkyl; and
R1 and R2 are as defined in any one of embodiments 1-6.
[0080] Embodiment 7(a) of this disclosure relates to embodiment 7 wherein R1 and R2 are as defined in embodiment 6.
[0081] Embodiment 7(b) of this disclosure relates to embodiment 7 wherein R2 is as defined in embodiment 6.
[0082] Embodiment 8 of this disclosure relates to embodiments 7, 7(a) or 7(b) having Formula IV or V:
or a pharmaceutically acceptable salt, a solvate, a tautomer, an isomer or a deuterated analog thereof.
[0083] Embodiment 9 of this disclosure relates to any one of embodiments 1-8, wherein R7 is
[0086] Embodiment 12(a) of this disclosure relates to any one of embodiments 1-10, wherein
R2 is:
[0088] Embodiment 12(b)(i) of this disclosure relates to embodiment 12(b), wherein:
each Q is independently hydrogen, C1-C3 alkyl, C1-C3 haloalkyl, or C1-C3 deuteroalkyl; and
Q3 is hydrogen or C1-C2 alkyl optionally substituted with 1-3 halo.
[0090] Embodiment 12(c)(i) of this disclosure relates to embodiment 12(c), wherein:
each Q is independently hydrogen, C1-C3 alkyl, C1-C3 haloalkyl, or C1-C3 deuteroalkyl; and
Q3 is hydrogen or C1-C2 alkyl optionally substituted with 1 -3 halo.
[0091] Embodiment 12(d) of this disclosure relates to any one of embodiments 1 - 10, wherein
[0092] Embodiment 12(d)(i) of this disclosure relates to embodiment 12(d), wherein:
Q is hydrogen, C1-C3 alkyl, C1-C3 haloalkyl, or C1-C3 deuteroalkyl;
Q3 is hydrogen or C1-C2 alkyl optionally substituted with 1 -3 halo; and
Q4 is hydrogen or C1-C2 alkyl optionally substituted with 1 -3 halo.
[0093] Embodiment 12(e) of this disclosure relates to any one of embodiments 1 -10, wherein
[0094] Embodiment 12(e)(i) of this disclosure relates to embodiment 12(e), wherein:
Q is hydrogen, C1-C3 alkyl, C1-C3 haloalkyl, or C1-C3 deuteroalkyl;
Q1 is hydrogen, C1-C3 alkyl, C1-C3 haloalkyl, or C1-C3 deuteroalkyl, and
Q3 is hydrogen or Ci-C2 alkyl optionally substituted with 1 -3 halo.
[0095] Embodiment 12(f) of this disclosure relates to any one of embodiments 1- 10, wherein
[0096] Embodiment 12(f)(i) of this disclosure relates to embodiment 12(f), wherein:
Q is hydrogen or C1-C2 alkyl optionally substituted with 1-3 halo; and Q4 is hydrogen or C1-C2 alkyl optionally substituted with 1-3 halo.
Embodiment 12(g) of this disclosure relates to any one of embodiments 1-10, wherein
[0098] Embodiment 12(g)(i) of this disclosure relates to embodiment 12(g), wherein:
Q1 is hydrogen, C1-C3 alkyl, C1-C3 haloalkyl, or C1-C3 deuteroalkyl, and
each Q3 is independently hydrogen or C1-C2 alkyl optionally substituted with 1-3 halo.
[0099] Embodiment 13 of this disclosure relates to any one of embodiments 1-10 or 12(a)- 12(g)(i), wherein
each Q is independently hydrogen, C1-C3 alkyl, C1-C3 haloalkyl, C1-C3 deuteroalkyl, C3-6 cycloalkyl, or a 4-6 membered heterocycloalkyl, wherein the C1-C3 alkyl, C1-C3 haloalkyl, Ci- C3 deuteroalkyl, C3.6 cycloalkyl, or 4-6 membered heterocycloalkyl are each independently optionally substituted with 1 to 3 groups each independently halo or -OH;
Q1 is hydrogen, C1-C3 alkyl, C1-C3 haloalkyl, C1-C3 deuteroalkyl, C3.6 cycloalkyl, or a 4- 6 membered heterocycloalkyl, wherein the C3 alkyl, C1-C3 haloalkyl, C1-C3 deuteroalkyl, C3- 6 cycloalkyl, or 4-6 membered heterocycloalkyl are each independently optionally substituted with 1 to 3 groups each independently halo or -OH;
each Q3 is independently hydrogen, - H2, -NHCH3, -S-CH3, -CH=CH2, ethynyl, cyano, -OH, halo, C2-C3alkenyl, C2-C3alkynyl, Ci-C2alkoxy, or Ci-C2alkyl, wherein each C2-C3alkenyl, C2-C3alkynyl, Ci-C2alkoxy, or Ci-C2 alkyl is optionally substituted with 1-3 substituents each independently halo, hydroxyl or methoxy; and
Q4 is hydrogen or C1-C2 alkyl optionally substituted with 1-3 substituents each independently halo, hydroxyl or methoxy.
[0100] Embodiment 14 of this disclosure relates to any one of embodiments 1-10, wherein R2 is:
[0101] Embodiment 15 of this disclosure relates to one of compounds P-001 - P-255 of this disclosure, or a pharmaceutically acceptable salt, a solvate, a tautomer, an isomer or a deuterated analog of one of compounds P-001 - P-255.
[0102] Embodiment 16 of this disclosure relates to a pharmaceutical composition comprising a compound of any of embodiments 1-15 and a pharmaceutically acceptable carrier.
[0103] Embodiment 17 of this disclosure relates to a pharmaceutical composition of embodiment 16 further comprising a second pharmaceutical agent selected from the group consisting of an anti-proliferative agent, an anti-inflammatory agent, an immunomodulatory agent and an immunosuppressive agent.
[0104] Embodiment 18 of this disclosure relates to a pharmaceutical composition of embodiment 17, wherein the second pharmaceutical agent is i) an alkylating agent selected from adozelesin, altretamine, bizelesin, busulfan, carboplatin, carboquone, carmustine, chlorambucil, cisplatin, cyclophosphamide, dacarbazine, estramustine, fotemustine, hepsulfam, ifosfamide, improsulfan, irofulven, lomustine, mechlorethamine, melphalan, oxaliplatin, piposulfan, semustine, streptozocin, temozolomide, thiotepa, and treosulfan; ii) an antibiotic selected from bleomycin, dactinomycin, daunorubicin, doxorubicin, epirubicin, idarubicin, menogaril, mitomycin, mitoxantrone, neocarzinostatin, pentostatin, and plicamycin; iii) an antimetabolite selected from the group consisting of azacitidine, capecitabine, cladribine, clofarabine, cytarabine, decitabine, floxuridine, fludarabine, 5-fluorouracil, ftorafur, gemcitabine, hydroxyurea, mercaptopurine, methotrexate, nelarabine, pemetrexed, raltitrexed, thioguanine, and trimetrexate; iv) an antibody therapy agent selected from alemtuzumab, bevacizumab, cetuximab, galiximab, gemtuzumab, nivolumab, panitumumab, pembrolizumab, pertuzumab, rituximab, tositumomab, trastuzumab, and 90 Y ibritumomab tiuxetan; v) a hormone or hormone antagonist selected from the group consisting of anastrozole, androgens, buserelin,
diethylstilbestrol, exemestane, flutamide, fulvestrant, goserelin, idoxifene, letrozole, leuprolide, magestrol, raloxifene, tamoxifen, and toremifene; vi) a taxane selected from DJ-927, docetaxel, TPI 287, paclitaxel and DHA-paclitaxel; vii) a retinoid selected from alitretinoin, bexarotene, fenretinide, isotretinoin, and tretinoin; viii) an alkaloid selected from etoposide,
homoharringtonine, teniposide, vinblastine, vincristine, vindesine, and vinorelbine; ix) an antiangiogenic agent selected from AE-941 (GW786034, Neovastat), ABT-510, 2- methoxyestradiol, lenalidomide, and thalidomide; x) a topoisomerase inhibitor selected from amsacrine, edotecarin, exatecan, irinotecan, SN-38 (7-ethyl-lO-hydroxy-camptothecin), rubitecan, topotecan, and 9-aminocamptothecin; xi) a kinase inhibitor selected from erlotinib, gefitinib, flavopiridol, imatinib mesylate, lapatinib, sorafenib, sunitinib malate, AEE-788, AG-
013736, AMG 706, AMN107, BMS-354825, BMS-599626, UCN-01 (7-hydroxystaurosporine), vemurafenib, dabrafenib, trametinib, cobimetinib selumetinib and vatalanib; xii) a targeted signal transduction inhibitor selected from bortezomib, geldanamycin, and rapamycin; xiii) a biological response modifier selected from imiquimod, interferon-a and interleukin-2; xiv) an IDO inhibitor; and xv) a chemotherapeutic agent selected from 3-AP (3-amino-2- carboxyaldehyde thiosemicarbazone), altrasentan, aminoglutethimide, anagrelide, asparaginase, bryostatin-1, cilengitide, elesclomol, eribulin mesylate (E7389), ixabepilone, lonidamine, masoprocol, mitoguanazone, oblimersen, sulindac, testolactone, tiazofurin, a mTOR inhibitor, a PI3K inhibitor, a Cdk4 inhibitor, an Akt inhibitor, a Hsp90 inhibitor, a farnesyltransferase inhibitor or an aromatase inhibitor (anastrozole letrozole exemestane); xvi) a Mek inhibitor; xvii) a tyrosine kinase inhibitor; or xviii) an EGFR inhibitor.
[0105] Embodiment 18(a) of this disclosure relates to a pharmaceutical composition of embodiment 17, wherein the second pharmaceutical agent is i) an alkylating agent selected from adozelesin, altretamine, bizelesin, busulfan, carboplatin, carboquone, carmustine, chlorambucil, cisplatin, cyclophosphamide, dacarbazine, estramustine, fotemustine, hepsulfam, ifosfamide, improsulfan, irofulven, lomustine, mechlorethamine, melphalan, oxaliplatin, piposulfan, semustine, streptozocin, temozolomide, thiotepa, and treosulfan; ii) an antibiotic selected from bleomycin, dactinomycin, daunorubicin, doxorubicin, epirubicin, idarubicin, menogaril, mitomycin, mitoxantrone, neocarzinostatin, pentostatin, and plicamycin; an antimetabolite, including, but not limited to, azacitidine, capecitabine, cladribine, clofarabine, cytarabine, decitabine, floxuridine, fludarabine, 5-f uorouracil, ftorafur, gemcitabine, hydroxyurea, mercaptopurine, methotrexate, nelarabine, pemetrexed, raltitrexed, thioguanine, and trimetrexate; iii) an antibody therapy agent selected from alemtuzumab, bevacizumab, cetuximab, galiximab, gemtuzumab, panitumumab, pertuzumab, rituximab, tositumomab, trastuzumab, and 90 Y ibritumomab tiuxetan; a hormone or hormone antagonist, including, but not limited to, anastrozole, androgens, buserelin, diethylstilbestrol, exemestane, flutamide, fulvestrant, goserelin, idoxifene, letrozole, leuprolide, magestrol, raloxifene, tamoxifen, and toremifene; iv) a taxane selected from DJ-927, docetaxel, TPI 287, paclitaxel and DHA- paclitaxel; v) a retinoid selected from alitretinoin, bexarotene, fenretinide, isotretinoin, and tretinoin; vi) an alkaloid selected from etoposide, homoharringtonine, teniposide, vinblastine, vincristine, vindesine, and vinorelbine; vii) an antiangiogenic agent selected from AE-941 (GW786034, Neovastat), ABT-510, 2-methoxyestradiol, lenalidomide, and thalidomide; viii) a topoisomerase inhibitor selected from amsacrine, edotecarin, exatecan, irinotecan (also active metabolite SN-38 (7-ethyl-lO-hydroxy-camptothecin)), rubitecan, topotecan, and 9- aminocamptothecin; ix) a kinase inhibitor selected from erlotinib, gefitinib, flavopiridol,
imatinib mesylate, lapatinib, sorafenib, sunitinib malate, AEE-788, AG-013736, AMG 706, AMN107, BMS-354825, BMS-599626, UCN-01 (7-hydroxystaurosporine), vemurafenib, dabrafenib, trametinib, cobimetinib selumetinib and vatalanib; x) a targeted signal transduction inhibitor selected from bortezomib, geldanamycin, and rapamycin; xi) a biological response modifier selected from imiquimod, interferon-. alpha., and interleukin-2; and xii) a
chemotherapeutic agent selected from 3-AP (3-amino-2-carboxyaldehyde thiosemicarbazone), altrasentan, aminoglutethimide, anagrelide, asparaginase, bryostatin-1, cilengitide, elesclomol, eribulin mesylate (E7389), ixabepilone, lonidamine, masoprocol, mitoguanazone, oblimersen, sulindac, testolactone, tiazofurin, mTOR inhibitors (e.g. sirolimus, temsirolimus, everolimus, deforolimus), PI3K inhibitors (e.g. BEZ235, GDC-0941, XL147, XL765), Cdk4 inhibitors (e.g. PD-332991), Akt inhibitors, Hsp90 inhibitors (e.g. geldanamycin, radicicol, tanespimycin), farnesyltransferase inhibitors (e.g. tipifarnib) and Aromatase inhibitors (anastrozole letrozole exemestane); xiii) a Mek inhibitor; xiv) a tyrosine kinase inhibitor as described herein; or xv) an EGFR inhibitor.
[0106] Embodiment 19 of this disclosure relates to a method for treatment of a disease modulated by FLT3, CSF1R, or c-kit„ wherein the disease is an inflammatory disease, an inflammatory condition, an autoimmune disease or cancer, said method comprising administering to a subject suffering from the disease a therapeutically effective amount of a compound of any of embodiments 1-15, or a pharmaceutical composition of any of embodiments 16-18.
[0107] Embodiment 19(a) of this disclosure relates to a method for treatment of a disease modulated by a FLT3 protein kinase, wherein the disease is an inflammatory disease, an inflammatory condition, an autoimmune disease or cancer, said method comprising administering to a subject suffering from the disease a therapeutically effective amount of a compound of any of embodiments 1-15, or a pharmaceutical composition of any of embodiments 16-18.
[0108] Embodiment 20 of this disclosure relates to a method for treating a subj ect with a disease or condition mediated by FLT3, CSF1R, or c-kit, said method comprising administering to the subject an effective amount of a compound according to any of embodiments 1-15, or a pharmaceutically acceptable salt, deuterated analog, a tautomer or an isomer thereof, or a pharmaceutical composition according to any of embodiments 16-18, wherein the disease or condition is acute myeloid leukemia, stem cell ablation and myelopreparation for stem cell transplant, primary progressive multiple sclerosis, traumatic brain injury, epilepsy, tauopathies, Erdheim-Chester Disease, Langerhans cell histocytosis, hairy cell leukemia, HIV, glioblastoma,
scleroderma, anterior or posterior eye disease, lysosomal storage diseases, complex regional pain syndrome, reflex sympathetic dystrophy, muscular dystrophy, duchenne muscular dystrophy, causalgia, neuro-inflammation, neuroinflammatory disorders, benign forgetfulness, HIV, binswager type dementia, dementia with lewy bodie, prosencephaly, microencepahy, cerebral palsy, congenital hydrocephalus, abdominal dropsy, progressive supranuclear palsy, glaucoma, addiction disorders, dependencies, alcoholism, tremors, Wilson's disease, vascular dementias, multi infarct dementia, fronto temporal dementia, pseudo-dementia, bladder cancer, basal cell carcinoma, cholangiocarcinoma, colon cancer, endometrial cancer, esophageal cancer, Ewing's sarcoma, gastric cancer, glioma, hepatocellular carcinoma, Hodgkin lymphoma, laryngeal carcinoma, leukemia, liver cancer, lung cancer, melanoma, mesothelioma, pancreatic cancer, rectal cancer, renal cancer, squamous cell carcinoma, T cell lymphoma, thyroid cancer, monocytic leukemia, pheochromocytoma, malignant peripheral nerve cell tumors, malignant peripheral nerve sheath tumors (MPNST), cutaneous and plexiform neurofibromas,
leiomyoadenomatoid tumor, fibroids, uterine fibroids, leiomyosarcoma, papillary thyroid cancer, anaplastic thyroid cancer, medullary thyroid cancer, follicular thyroid cancer, hurthle cell carcinoma, thyroid cancer, ascites, malignant ascites, mesothelioma, salivary gland tumors, mucoepidermoid carcinoma of the salivary gland, acinic cell carcinoma of the salivary gland, gastrointestinal stromal tumors (GIST), tumors that cause effusions in potential spaces of the body, pleural effusions, pericardial effusions, peritoneal effusions aka ascites, giant cell tumors (GCT), GCT of bone other sarcomas, tumor angiogenesis, paracrine tumor growth or tumors that express aberrantly or otherwise a FLT3 ligand, or activating mutations or translocations of any of the foregoing.
[0109] Embodiment 20(a) of this disclosure relates to a method for treating a subject with a disease or condition mediated by a FLT3 protein kinase, said method comprising administering to the subject an effective amount of a compound according to any of embodiments 1-15, or a pharmaceutically acceptable salt, deuterated analog, a tautomer or an isomer thereof, or a pharmaceutical composition according to any of embodiments 16-18, wherein the disease or condition is acute myeloid leukemia, stem cell ablation and myelopreparation for stem cell transplant, primary progressive multiple sclerosis, complex regional pain syndrome, reflex sympathetic dystrophy, muscular dystrophy, duchenne muscular dystrophy, causalgia, neuro- inflammation, neuroinflammatory disorders, benign forgetfulness, HIV, binswager type dementia, dementia with lewy bodie, prosencephaly, microencepahy, cerebral palsy, congenital hydrocephalus, abdominal dropsy, progressive supranuclear palsy, glaucoma, addiction disorders, dependencies, alcoholism, tremors, Wilson's disease, vascular dementias, multi infarct dementia, fronto temporal dementia, pseudo-dementia, bladder cancer, basal cell carcinoma,
cholangiocarcinoma, colon cancer, endometrial cancer, esophageal cancer, Ewing's sarcoma, gastric cancer, glioma, hepatocellular carcinoma, Hodgkin lymphoma, laryngeal carcinoma, leukemia, liver cancer, lung cancer, melanoma, mesothelioma, pancreatic cancer, rectal cancer, renal cancer, squamous cell carcinoma, t cell lymphoma, thyroid cancer, monocytic leukemia, pheochromocytoma, malignant peripheral nerve cell tumors, malignant peripheral nerve sheath tumors (MPNST), cutaneous and plexiform neurofibromas, leiomyoadenomatoid tumor, fibroids, uterine fibroids, leiomyosarcoma, papillary thyroid cancer, anaplastic thyroid cancer, medullary thyroid cancer, follicular thyroid cancer, hurthle cell carcinoma, thyroid cancer, ascites, malignant ascites, mesothelioma, salivary gland tumors, mucoepidermoid carcinoma of the salivary gland, acinic cell carcinoma of the salivary gland, gastrointestinal stromal tumors (GIST), tumors that cause effusions in potential spaces of the body, pleural effusions, pericardial effusions, peritoneal effusions aka ascites, giant cell tumors (GCT), GCT of bone other sarcomas, tumor angiogenesis, paracrine tumor growth or tumors that express aberrantly or otherwise Fms, CSF 1R, CSF1 or IL-34, or activating mutations or translocations of any of the foregoing.
[0110] Embodiment 21 of this disclosure relates to a method for treating a subj ect with a disease or condition mediated by FLT3, CSF1R, or c-kit, said method comprising administering to the subject an effective amount of a compound according to any of embodiments 1-15, or a pharmaceutically acceptable salt, deuterated analog, a tautomer or an isomer thereof, or a pharmaceutical composition according to any of embodiments 16-18, wherein the disease or condition is a lysosomal storage disease selected from the group consisting of mucolipodosis, alpha-mannosidosis; aspartylglucosaminuria; Batten disease; beta-mannosidosis; cystinosis; Danon disease; Fabry disease; Farber disease; fucosidosis; galactosialidosis; Gaucher disease; gangliosidosis; Krabbe disease; metachromatic leukodystrophy; mucopolysaccharidoses disorders; aspartylglucosaminuria; Batten disease; beta-mannosidosis; cystinosis; Danon disease; Fabry disease; Farber disease; fucosidosis; galactosialidosis; Gaucher disease;
gangliosidosis; Krabbe disease; metachromatic leukodystrophy; mucopolysaccharidoses disorders; mucolipidosis type I (Sialidosis); Mucolipidosis type II (I-Cell disease);
Mucolipidosis type III (Pseudo-Hurler polydystrophy); Mucolipidosis type IV; multiple sulfatase deficiency; emann-Pick types A, B, C; Pompe disease (glycogen storage disease); pycnodysostosis; Sandhoff disease; Schindler disease; Salla disease/sialic acid storage disease; Tay-Sachs; and Wolman disease.
[0111] Embodiment 22 of this disclosure relates to a method according to any of
embodiments 20-21, wherein FLT3 kinase is a mutated form comprising a FLT3 internal tandem duplication (ITD) mutation.
[0112] Embodiment 23 of this disclosure relates to a method according embodiment 22, wherein mutated FLT3 kinase futher comprises a D835Y mutation, a F691L mutation, or both D835Y and F691L mutations.
[0113] "Selected from one or more of a group of specific Formulae" for purposes of this disclosure is intended to have the following meaning:
[0114] When any selection from any particular group in any embodiment described this disclosure, this embodiment includes embodiments where the selection can be from all listed groups in the paritucular embodiment as well as all possible subgroups of of this embodiment.
[0115] For illustrative purposes, in any embodiment that would include Formulae 1, 1(a), 11(a), 11(b), III, IV, or V, this embodiment is meant to include all of the following groups from which the Formula is selected from:
1. one of Formula 1, 1(a), 11(a), 11(b), III, IV, or V;
2. one of Formula I or 1(a);
3. one of Formula I or 11(a);
4. one of Formula I or 11(b);
5. one of Formula I or III;
6. one of Formula I or IV;
7. one of Formula I or V:
8. Formula I;
9. Formula 1(a);
10. Formula 11(a);
11. Formula 11(b);
12. Formula III;
13. Formula IV; or
14. Formula V.
[0116] Another embodiment of this disclosure relates to one or more compounds P-001 to P- 255, or a pharmaceutically acceptable salt, a solvate, a tautomer, an isomer or a deuterated analog thereof.
ΠΙ. General
[0117] In one aspect, the present disclosure relates to compounds of Formula I, all embodiments and sub-embodiments thereof including any one or more of compounds P-001-P- 255, and any other compounds as described herein, that are useful as inhibitors of an oncogenic Flt3 or a Flt3 mutant, and the use of the compounds in treating a subject suffering from diseases that are mediated by a mutated Flt3 kinase.
[0118] FLT3 kinase is a tyrosine kinase receptor involved in the regulation and stimulation of cellular proliferation. See e.g., Gilliland et al, Blood 100: 1532-42 (2002). The FLT3 kinase is a member of the class III receptor tyrosine kinase (RTKIII) receptor family and belongs to the same subfamily of tyrosine kinases as c-kit, c-fms, and the platelet-derived growth factor a and β receptors. See e.g., Lyman et al., FLT3 Ligand in THE CYTOKINE HANDBOOK 989 (Thomson et al., eds. 4th Ed.) (2003). The FLT3 kinase has five immunoglobulin-like domains in its extracellular region as well as an insert region of 75-100 amino acids in the middle of its cytoplasmic domain. FLT3 kinase is activated upon the binding of the FLT3 ligand, which causes receptor dimerization. Dimerization of the FLT3 kinase by FLT3 ligand activates the intracellular kinase activity as well as a cascade of downstream substrates including Stat5, Ras, phosphatidylinositol-3 -kinase (PI3K), PLCy , Erk2, Akt, MAPK, SHC, SHP2, and SHIP. See e.g., Rosnet et al., Acta Haematol. 95: 218 (1996); Hayakawa et al., Oncogene 19: 624 (2000); Mizuki et al., Blood 96: 3907 (2000); and Gilliand et al., Curr. Opin. Hematol. 9: 274-81 (2002). Both membrane-bound and soluble FLT3 ligand bind, dimerize, and subsequently activate the FLT3 kinase.
[0119] In normal cells, immature hematopoietic cells, typically CD34+ cells, placenta, gonads, and brain express FLT3 kinase. See, e.g., Rosnet, et al., Blood 82: 1110-19 (1993); Small et al., Proc. Natl. Acad. Sci. U.S.A. 91 : 459-63 (1994); and Rosnet et al., Leukemia 10: 238-48 (1996). However, efficient stimulation of proliferation via FLT3 kinase typically requires other hematopoietic growth factors or interleukins. FLT3 kinase also plays a critical role in immune function through its regulation of dendritic cell proliferation and differentiation See e.g., McKenna et al., Blood 95: 3489-97 (2000).
[0120] Numerous hematologic malignancies express FLT3 kinase, the most prominent of which is AML. See e.g., Yokota et al., Leukemia 11 : 1605-09 (1997). Other FLT3 expressing
malignancies include B-precursor cell acute lymphoblastic leukemias, myelodysplastic leukemias, T-cell acute lymphoblastic leukemias, and chronic myelogenous leukemias. See e.g., Rasko et al., Leukemia 9: 2058-66 (1995).
[0121] FLT3 kinase mutations associated with hematologic malignancies are activating mutations. In other words, the FLT3 kinase is constitutively activated without the need for binding and dimerization by FLT3 ligand, and therefore stimulates the cell to grow
continuously.
[0122] Several studies have identified inhibitors of FLT3 kinase activity that also inhibit the kinase activity of related receptors, e.g., VEGF receptor (VEGFR), PDGF receptor (PDGFR), and kit receptor kinases. See e.g., Mendel et al., Clin. Cancer Res. 9: 327-37 (2003); O'Farrell et al, Blood 101 : 3597-605 (2003); and Sun et al., J. Med. Chem. 46: 1116-19 (2003). Such compounds effectively inhibit FLT3 kinase-mediated phosphorylation, cytokine production, cellular proliferation, resulting in the induction of apoptosis. See e.g., Spiekermann et al., Blood 101 : 1494-1504 (2003). Moreover, such compounds have potent antitumor activity in vitro and in vivo.
[0123] In some embodiments, the oncogenic Flt3 or Flt3 mutant is encoded by a Flt3 gene with an internal tandem duplication (ITD) mutation in the juxtamembrane as described in U.S. Patent No. 6,846,630, which is herein incorporated by reference. In certain embodiments, the oncogenic Flt3 or Flt3 mutant encoded by flt3 with ITD mutations has one or more mutations at residues F691, D835, Y842 or combinations thereof. In some embodiments, the oncogenic Flt3 or Flt3 mutant has one or more mutations selected from F691L, D835V/Y, Y842C H or combinations thereof.
[0124] In some embodiments, the subject has a Flt3 gene mutation encoding an Flt3 mutant having an amino acid substitution at residues F691, D835, Y842 or combinations thereof. In certain instances, the amino acid substitution is selected from F691L, D835V/Y, Y842C/H or combinations thereof.
[0125] In some embodiments, the disclosure provides a method of inhibiting an oncogenic Flt3 or a mutant Flt3. The method includes contacting the Flt3 kinase with a compound as described herein. In some embodiments, the oncogenic Flt3 or Flt3 mutant is encoded by a Flt3 gene having an ITD mutation. In some embodiments, the oncogenic Flt3 or Flt3 mutant encoded by an Flt3 gene with an ITD mutation has one or more mutations at residues F691, D835, Y842 or combinations thereof. In some embodiments, the oncogenic Flt3 or Flt3 mutant has one or more mutations are selected from F691L, D835V/Y, Y842C/H or combinations thereof. In
another embodiment, the oncogenic Flt3 mutant is encoded by a Flt3 gene having an ITD mutation. In another embodiment, the oncogenic Flt3 mutant is encoded by a Flt3 gene having an ITD mutation and a F691L mutation. In another embodiment, the oncogenic Flt3 mutant is encoded by a Flt3 gene having an ITD mutation and a D835Y mutation. In another
embodiment, the oncogenic Flt3 mutant is encoded by a Flt3 gene having an ITD mutation, a F691L mutation, and a D835Y mutation.
[0126] Hematologic cancers, also known as hematologic or hematopoietic malignancies, are cancers of the blood or bone marrow; including leukemia and lymphoma. Acute myelogenous leukemia (AML) is a clonal hematopoietic stem cell leukemia that represents about 90% of all acute leukemias in adults with an incidence of 3.9 per 100,000 (See e.g., Lowenberg et al., N. Eng. J. Med. 341 : 1051 -62 (1999) and Lopesde Menezes, et al, Clin. Cancer Res. (2005), 1 1 (14) 5281-5291). While chemotherapy can result in complete remissions, the long term disease-free survival rate for AML is about 14% with about 7,400 deaths from AML each year in the United States. Approximately 70% of AML blasts express wild type FLT3 and about 25% to about 35% express FLT3 kinase receptor mutations which result in constitutively active FLT3. Two types of activating mutations have been identified, in AML patients: internal tandem duplications (ITDs) and point mutation in the activating loop of the kinase domain FLT3-ITD mutations in AML patients is indicative of a poor prognosis for survival, and in patients who are in remission, FLT3-ITD mutations are the most significant factor adversely affecting relapse rate with 64% of patients having the mutation relapsing within 5 years (see Current Pharmaceutical Design (2005), 1 1 :3449-3457. The prognostic significance of FLT3 mutations in clinical studies suggests that FLT3 plays a driving role in AML and may be necessary for the development and maintenance of the disease. Mixed Lineage Leukemia (MLL) involve translocations of chromosome 1 1 band q23 (1 l q23) and occur in approximately 80% of infant hematological malignancies and 10% of adult acute leukemias. Although certain 1 l q23 translocation have been shown to be essential to immortalization of hematopoietic progenitors in vitro, a secondary genotoxic event is required to develop leukemia. There is a strong concordance between FLT3 and MLL fusion gene expression, and the most consistently overexpressed gene in MLL is FLT3. Moreover, it has been shown that activated FLT3 together with MLL fusion gene expression induces acute leukemia with a short latency period (see Ono, et al., I. of Clinical Investigation (2005), 115 :919-929). Therefore, it is believed that FLT3 signally is involved in the development and maintenance of MLL (see Armstrong, et al, Cancer Cell (2003), 3 : 173- 183)
[0127] The FLT3-ITD mutation is also present in about 3% of cases of adult myelodysplastic syndrome and some cases of acute lymphocytic leukemia (ALL) (Current Pharmaceutical Design (2005), 11 :3449-3457).
[0128] FLT3 has been shown to be a client protein of Hsp90, and 17AAG, a benzoquinone ansamycin antibiotic that inhibits Hsp90 activity, has been shown to disrupts the association of Flt3 with Hsp90. The growth of leukemia cell that express either wild type FLT3 or FLT3-ITD mutations was found to be inhibited by treatment with 17"AAG (Yao, et al., Clinical Cancer Research (2003), 9:4483-4493).
[0129] The compounds as described herein are useful for the treatment or prevention of haematological malignancies, including, but not limiting to, acute myeloic leukemia (AML); mixed lineage leukemia (MLL); acute promyelocytic leukemia; acute lymphocytic leukemia, acute lymphoblastic leukemia, myeloid sarcoma; T-cell type acute lymphocytic leukemia (T- ALL); B-cell type acute lymphocytic leukemia (B-ALL); chronic myelomonocytic leukemia (CMML); myelodysplastic syndrome; myeloproliferative disorders; other proliferative disorders, including, but not limiting to, cancer; autoimmune disorders; and skin disorders, such as psoriasis and atopic dermatitis.
[0130] In another aspect, the present disclosure also provides a method for modulating Flt3 activity by contacting a Flt3 or a mutant Flt3 with administering an effective amount of compounds of Formula I, all embodiments and sub-embodiments thereof including Formula 1(a), Formula 11(a), Formula 11(b), Formula ΠΙ, Formula IV, Formula V, and any one or more of compounds P-001-P-255, and any other compounds as described herein. The compound is, in some embodiments, provided at a level sufficient to modulate the activity of the Flt3 by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90%, or greater than 90%. In many embodiments, the compound will be at a concentration of about 1 μΜ, 100 μΜ, or 1 mM, or in a range of 1-100 nM, 100-500 nM, 500-1000 nM, 1-100 μΜ, 100-500 μΜ, or 500-1000 μΜ. In some embodiments, the contacting is carried out in vitro. In other embodiments, the contacting is carried out in vivo.
[0131] As used herein, the term "Flt3 mediated disease or condition" refers to a disease or condition in which the biological function of Flt3 affects the development and/or course of the disease or condition, and/or in which modulation of Flt3 alters the development, course, and/or symptoms. These mutations attenuate the intrinsic tyrosine kinase activity of the receptor to different degrees and are models for the effect of modulation of Flt3 activity. A Flt3 mediated disease or condition includes a disease or condition for which Flt3 inhibition provides a therapeutic benefit, e.g. wherein treatment with Flt3 inhibitors, including compounds described
herein, provides a therapeutic benefit to the subject suffering from or at risk of the disease or condition.
[0132] Reference to particular amino acid residues in human Flt3 polypeptide is defined by the numbering corresponding to the Flt3 sequence in GenBank NP0041 10.2 (SEQ ID NO: l). Reference to particular nucleotide positions in a nucleotide sequence encoding all or a portion of Flt3 is defined by the numbering corresponding to the sequence provided in GenBank
NM_44119 (SEQ ID NO:2).
[0133] The terms "Flt3" (also referred to herein as FLT3 or flt3) mean an enzymatically active kinase that contains a portion with greater than 90% amino acid sequence identity to amino acid residues including the ATP binding site of full-length Flt3 (e.g., human Flt3, e.g., the sequence NP 004110.2 , SEQ ED NO: 1), for a maximal alignment over an equal length segment; or that contains a portion with greater than 90% amino acid sequence identity to at least 200 contiguous amino acids of native Flt3 and retains kinase activity. In some embodiments, the sequence identity is at least 95, 97, 98, 99, or even 100%. In some embodiments, the specified level of sequence identity is over a sequence at least 100-500, at least 200-400, or at least 300 contiguous amino acid residues in length. Unless indicated to the contrary, the term includes reference to wild-type c- Flt3, allelic variants, and mutated forms (e.g., having activating mutations).
[0134] The terms "Flt3 -mediated diseases or disorders" shall include diseases associated with or implicating Flt3 activity, for example, the overactivity of Flt3, and conditions that accompany with these diseases. The term "overactivity of Flt3" refers to either 1) Flt3 expression in cells which normally do not express Flt3; 2) Flt3 expression by cells which normally do not express v; 3) increased Flt3 expression leading to unwanted cell proliferation; or 4) mutations leading to constitutive activation of Flt3. Examples of "Flt3-mediated diseases or disorders" include disorders resulting from over stimulation of Flt3 or from abnormally high amount of Flt3 activity, due to abnormally high amount of Flt3 or mutations in Flt3. It is known that overactivity of Flt3 has been implicated in the pathogenesis of a number of diseases, including inflammatory and autoimmune diseases, cell proliferative disorders, neoplastic disorders and cancers as described herein.
[0135] The term "Flt3-ITD allelic ratio" refers to the percentage of tumor DNA alleles harboring the Flt3-ITD mutation normalized to the percent blast cells in a patient sample. In one embodiment, a low Flt3-ITD allelic ratio is where less than 25% of normalized tumor DNA alleles is a Flt3-ITD allele. In certain embodiments, an intermediate Flt3-ITD allelic ratio is where between 25% and 50% of normalized tumor DNA alleles is a Flt3-ITD allele. In certain
embodiments, a high FU3-ITD allelic ratio is where greater than 50% of normalized tumor DNA alleles is a Flt3-ITD allele.
[0136] The "Flt3/ITD mutation-containing cells" include any of cells having tandem duplication mutation absent in healthy humans in a region of exons 14 to 15 in a juxtamembrane region of Flt3, that is, cells highly expressing mRNA derived from the mutation, cells having increased Flt3-derived growth signals caused by the mutation, cells highly expressing the mutant Flt3 protein, etc. The "Flt3/ITD mutation-containing cancerous cells" include any of cancerous cells having tandem duplication mutation absent in healthy humans in a region of exons 14 to 15 in a juxtamembrane region of Flt3, that is, cancerous cells highly expressing mRNA derived from the mutation, cancerous cells having increased Flt3 -derived growth signals caused by the mutation, cancerous cells highly expressing the mutant Flt3 protein, etc. The "Flt3/ITD mutation-containing leukemic cells" include any of leukemic cells having tandem duplication mutation absent in healthy humans in a region of exons 14 to 15 in a juxtamembrane region of Flt3, that is, leukemic cells highly expressing mRNA derived from the mutation, leukemic cells having increased Flt3 -derived growth signals caused by the mutation, leukemic cells highly expressing the mutant Flt3 protein, etc.
[0137] As used herein, the term "c-Kit mediated disease or condition" refers to a disease or condition in which the biological function of c-Kit affects the development and/or course of the disease or condition, and/or in which modulation of c-Kit alters the development, course, and/or symptoms. These mutations attenuate the intrinsic tyrosine kinase activity of the receptor to different degrees and are models for the effect of modulation of c-Kit activity. A c-Kit mediated disease or condition includes a disease or condition for which c-Kit inhibition provides a therapeutic benefit, e.g. wherein treatment with c-Kit inhibitors, including compounds described herein, provides a therapeutic benefit to the subject suffering from or at risk of the disease or condition.
[0138] Reference to particular amino acid residues in human c-kit polypeptide is defined by the numbering corresponding to the Kit sequence in GenBank NP 000213 (1). Reference to particular nucleotide positions in a nucleotide sequence encoding all or a portion of c-kit is defined by the numbering corresponding to the sequence provided in GenBank NM_000222.
[0139] The terms "kit", "c-kit", and "c-Kit" mean an enzymatically active kinase that contains a portion with greater than 90% amino acid sequence identity to amino acid residues including the ATP binding site of full-length c-kit (e.g., human c-kit, e.g., the sequence NP 000213), for a maximal alignment over an equal length segment; or that contains a portion with greater than 90% amino acid sequence identity to at least 200 contiguous amino acids of native c-kit and
retains kinase activity. Preferably the sequence identity is at least 95, 97, 98, 99, or even 100%. Preferably the specified level of sequence identity is over a sequence at least 100-500, at least 200-400, or at least 300 contiguous amino acid residues in length. Unless indicated to the contrary, the term includes reference to wild-type c-kit, allelic variants, and mutated forms (e.g., having activating mutations).
[0140] Target kinase Fms (i.e., feline McDonough sarcoma) is a member of the family of genes originally isolated from the Susan McDonough strain of feline sarcoma viruses. Fms is a transmembrane tyrosine kinase of 108.0 kDa coded by chromosome 5q33.2-q33.3 (symbol: CSF IR). The structure of the transmembrane receptor Fms comprises two Ig-like domains, a IgC2~iike domain, two additional Ig-like domains, a TM domain, and the T domain. Fms is the receptor for the macrophage colony-stimulating factor (M-CSF), and is crucial for the growth and differentiation of the monocyte-macrophage lineage. Upon binding of M-CSF to the extracellular domain of Fms, the receptor dimerizes and trans-autophosphorylates cytoplasmic tyrosine residues.
[0141] M-CSF, first described by Robinson and co-workers (Blood. 1969, 33 :396-9), is a cytokine that controls the production, differentiation, and function of macrophages. M-CSF stimulates differentiation of progenitor cells to mature monocytes, and prolongs the survival of monocytes. Furthermore, M-CSF enhances cytotoxicity, superoxide production, phagocytosis, chemotaxis, and secondary cytokine production of additional factors in monocytes and macrophages. Examples of such additional factors include granulocyte colony stimulating factor (G-CSF), interleukin-6 (IL-6), and interleukm-8 (IL-8). M-CSF stimulates hematopoiesis, promotes differentiation and proliferation of osteoclast progenitor cells, and has profound effects on lipid metabolism.
[0142] As used herein, the term "CSF 1R mediated disease or condition" refers to a disease or condition in which the biological function of CSF1R affects the development and/or course of the disease or condition, and/or in which modulation of CSF1R alters the development, course, and/or symptoms. These mutations attenuate the intrinsic tyrosine kinase activity of the receptor to different degrees and are models for the effect of modulation of CSF1R activity. A CSF1R mediated disease or condition includes a disease or condition for which CSF 1R inhibition provides a therapeutic benefit, e.g. wherein treatment with CSF 1R inhibitors, including compounds described herein, provides a therapeutic benefit to the subject suffering from or at risk of the disease or condition.
[0143] The terms "modulate," "modulation" and the like refer to the ability of a compound to increase or decrease the function and/or expression of a protein kinase such as Flt3, where such
function may include transcription regulatory activity and/or protein-binding. Modulation may occur in vitro or in vivo. Modulation, as described herein, includes the inhibition, antagonism, partial antagonism, activation, agonism or partial agonism of a function or characteristic associated with Flt3, either directly or indirectly, and/or the upregulation or downregulation of the expression of Flt3, either directly or indirectly. In another embodiment, the modulation is direct Inhibitors or antagonists are compounds that, e.g., bind to, partially or totally block stimulation, decrease, prevent, inhibit, delay activation, inactivate, desensitize, or downregulate signal transduction. Activators or agonists are compounds that, e.g., bind to, stimulate, increase, open, activate, facilitate, enhance activation, activate, sensitize or upregulate signal transduction.
[0144] The ability of a compound to inhibit the function of Flt3 can be demonstrated in a biochemical assay, e.g., binding assay, or a cell-based assay.
[0145] Also in the context of compounds binding to a biomolecular target, the term "greater specificity" indicates that a compound binds to a specified target to a greater extent than to another biomolecule or biomolecules that may be present under relevant binding conditions, where binding to such other biomolecules produces a different biological activity than binding to the specified target. Typically, the specificity is with reference to a limited set of other biomolecules, e.g., in the case of Flt3, other tyrosine kinases or even other type of enzymes. In particular embodiments, the greater specificity is at least 2, 3, 4, 5, 8, 10, 50, 100, 200, 400, 500, or 1000-fold greater specificity.
[0146] As used herein in connection with binding compounds or ligands, the term "specific for Flt3 kinase", "specific for Flt3", and terms of like import mean that a particular compound binds to Flt3 to a statistically greater extent than to other kinases that may be present in a particular sample. Also, where biological activity other than binding is indicated, the term "specific for Flt3" indicates that a particular compound has greater biological effect associated with binding Flt3 than to other tyrosine kinases, e.g., kinase activity inhibition. The specificity is also with respect to other biomolecules (not limited to tyrosine kinases) that may be present in a particular sample. The term "specific for Flt3 kinase", "specific for Flt3", and terms of like import mean that a particular compound binds to Flt3 to a statistically greater extent than to other kinases that may be present in a particular sample. Also, where biological activity other than binding is indicated, the term "specific for Flt3" indicates that a particular compound has greater biological effect associated with binding Flt3than to other tyrosine kinases, e.g., kinase activity inhibition. The specificity is also with respect to other biomolecules (not limited to tyrosine kinases) that may be present in a particular sample.
[0147] The term "first line cancer therapy" refers to therapy administered to a subject as an initial regimen to reduce the number of cancer cells. First line therapy is also referred to as induction therapy, primary therapy and primary treatment. Commonly administered first-line therapy for AML is cytarabine-based therapy in which cytarabine is administered often in combination with one or more agents selected from daunorubicin, idarubicin, doxorubicin, mitoxantrone, tipifarnib, thioguanine or gemtuzumab ozogamicin. Common regimens used in cytarabine-based therapy include the "7 + 3" or "5 + 2" therapy comprising administration of cytarabine with an anthracycline such as daunorubicin or idarubicin. Another first-line therapy is clofarabine-based therapy in which clofarabine is administered, often in combination with an anthracycline such as daunorubicin, idarubicin or doxorubicin. Other first-line therapy for AML are etoposide-based therapy in which etoposide is administered, often in combination with mitoxantrone, and optionally, with cytarabine. Another first- line therapy for AML (for subtype M3, also called acute promyelocytic leukemia) is all-trans-retinoic acid (ATRA). It is recognized that what is considered "first line therapy" by those of ordinary skill in the art will continue to evolve as new anti -cancer agents are developed and tested in the clinics. A summary of the currently accepted approaches to first line treatment is described in NCCN Clinical Practice Guidelines in Oncology for acute myeloid leukemia and the NCI guidelines on acute myeloid leukemia treatment (see, e.g.,
http://www.cancer.gov/cancertopics/pdq/treatment/adultAML HealthProfessional/page7).
[0148] The term "second line cancer therapy" refers to a cancer treatment that is administered to a subject who does not respond to first line therapy, that is, often first line therapy is administered or who has a recurrence of cancer after being in remission. In certain
embodiments, second line therapy that may be administered includes a repeat of the initial successful cancer therapy, which may be any of the treatments described under "first line cancer therapy" . In certain embodiments, second line therapy is the administration of gemtuzumab ozogamicin. In certain embodiments, investigational drugs may also be administered as second line therapy in a clinical trial setting. A summary of the currently accepted approaches to second line treatment is described in the NCCN Clinical Practice Guidelines in Oncology for acute myeloid leukemia and the NCI guidelines on acute myeloid leukemia treatment (see, e.g., http://www.cancer.gov/cancertopics/pdq/treatment/adultAML/HealthProfessional/page5).
[0149] The term "refractory" refers to wherein a subject fails to respond or is otherwise resistant to cancer therapy or treatment. The cancer therapy may be first-line, second-line or any subsequently administered treatment. In certain embodiments, refractory refers to a condition where a subject fails to achieve complete remission after two induction attempts. A subject may
be refractory due to a cancer cell's intrinsic resistance to a particular therapy, or the subject may be refractory due to an acquired resistance that develops during the course of a particular therapy.
IV. Binding Assays
[0150] The methods of the present disclosure can involve assays that are able to detect the binding of compounds to a target molecule. Such binding is at a statistically significant level, with a confidence level of at least 90%, or at least 95, 97, 98, 99% or greater confidence level that the assay signal represents binding to the target molecule, i.e., is distinguished from background. In some embodiments, controls are used to distinguish target binding from nonspecific binding. A large variety of assays indicative of binding are known for different target types and can be used for this disclosure.
[0151] Binding compounds can be characterized by their effect on the activity of the target molecule. Thus, a "low activity" compound has an inhibitory concentration (IC50) or effective concentration (EC50) of greater than 1 uM under standard conditions. By "very low activity" is meant an IC50 or EC50 of above 100 uM under standard conditions. By "extremely low activity" is meant an IC50 or EC50 of above 1 mM under standard conditions. By "moderate activity" is meant an IC50 or EC50 of 200 nM to 1 uM under standard conditions. By "moderately high activity" is meant an IC50 or EC50 of 1 nM to 200 nM. By "high activity" is meant an IC50 or EC50 of below 1 nM under standard conditions The IC50 or EC50 is defined as the concentration of compound at which 50% of the activity of the target molecule (e.g. enzyme or other protein) activity being measured is lost or gained relative to the range of activity observed when no compound is present. Activity can be measured using methods known to those of ordinary skill in the art, e.g., by measuring any detectable product or signal produced by occurrence of an enzymatic reaction, or other activity by a protein being measured.
[0152] By "background signal" in reference to a binding assay is meant the signal that is recorded under standard conditions for the particular assay in the absence of a test compound, molecular scaffold, or ligand that binds to the target molecule. Persons of ordinary skill in the art will realize that accepted methods exist and are widely available for determining background signal.
[0153] By "standard deviation" is meant the square root of the variance. The variance is a measure of how spread out a distribution is. It is computed as the average squared deviation of each number from its mean. For example, for the numbers 1, 2, and 3, the mean is 2 and the variance is:
σ2 = (l-2)2 + (2-2) 2 + (3-2 2 = 0.667 .
3
Surface Plasmon Resonance
[0154] Binding parameters can be measured using surface plasmon resonance, for example, with a BIAcore® chip (Biacore, Japan) coated with immobilized binding components. Surface plasmon resonance is used to characterize the microscopic association and dissociation constants of reaction between an sFv or other ligand directed against target molecules. Such methods are generally described in the following references which are incorporated herein by reference. Vely F. et al., (2000) BIAcore® analysis to test phosphopeptide-SH2 domain interactions, Methods in Molecular Biology 121 :313-21, Liparoto et al., (1999) Biosensor analysis of the interleukin-2 receptor complex, Journal of Molecular Recognition. 12:316-21; Lipschultz et al., (2000) Experimental design for analysis of complex kinetics using surface plasmon resonance, Methods. 20(3):310-8, Malmqvist, (1999) BIACORE: an affinity biosensor system for characterization of biomolecular interactions, Biochemical Society Transactions 27:335-40; Alfthan, (1998) Surface plasmon resonance biosensors as a tool in antibody engineering, Biosensors & Bioelectronics. 13 :653-63; Fivash et al., (1998) BIAcore for macromolecular interaction, Current Opinion in Biotechnology. 9:97-101; Price et al.; (1998) Summary report on the ISOBM TD-4 Workshop: analysis of 56 monoclonal antibodies against the MUC1 mucin. Tumour Biology 19 Suppl 1 : 1-20; Malmqvist et al, (1997) Biomolecular interaction analysis: affinity biosensor technologies for functional analysis of proteins, Current Opinion in Chemical Biology. 1 :378-83; O' Shannessy et al., (1996) Interpretation of deviations from pseudo-first- order kinetic behavior in the characterization of ligand binding by biosensor technology, Analytical Biochemistry. 236:275-83; Malmborg et al., (1995) BIAcore as a tool in antibody engineering, Journal of Immunological Methods. 183 :7-13; Van Regenmortel, (1994) Use of biosensors to characterize recombinant proteins, Developments in Biological Standardization. 83 : 143-51; and O'Shannessy, (1994) Determination of kinetic rate and equilibrium binding constants for macromolecular interactions: a critique of the surface plasmon resonance literature, Current Opinions in Biotechnology. 5:65-71.
[0155] BIAcore® uses the optical properties of surface plasmon resonance (SPR) to detect alterations in protein concentration bound to a dextran matrix lying on the surface of a gold/glass sensor chip interface, a dextran biosensor matrix. In brief, proteins are covalently bound to the dextran matrix at a known concentration and a ligand for the protein is injected through the dextran matrix. Near infrared light, directed onto the opposite side of the sensor chip surface is reflected and also induces an evanescent wave in the gold film, which in turn, causes an
intensity dip in the reflected light at a particular angle known as the resonance angle. If the refractive index of the sensor chip surface is altered (e.g. by ligand binding to the bound protein) a shift occurs in the resonance angle. This angle shift can be measured and is expressed as resonance units (RUs) such that 1000 RUs is equivalent to a change in surface protein concentration of 1 ng/mm2 These changes are displayed with respect to time along the y-axis of a sensorgram, which depicts the association and dissociation of any biological reaction
High Throughput Screening (HTS) Assays
[0156] HTS typically uses automated assays to search through large numbers of compounds for a desired activity. Typically HTS assays are used to find new drugs by screening for chemicals that act on a particular enzyme or molecule. For example, if a chemical inactivates an enzyme it might prove to be effective in preventing a process in a cell which causes a disease. High throughput methods enable researchers to assay thousands of different chemicals against each target molecule very quickly using robotic handling systems and automated analysis of results.
[0157] As used herein, "high throughput screening" or "HTS" refers to the rapid in vitro screening of large numbers of compounds (libraries); generally tens to hundreds of thousands of compounds, using robotic screening assays. Ultra high-throughput Screening (uHTS) generally refers to the high-throughput screening accelerated to greater than 100,000 tests per day.
[0158] To achieve high-throughput screening, it is advantageous to house samples on a multicontainer carrier or platform. A multicontainer carrier facilitates measuring reactions of a plurality of candidate compounds simultaneously. Multi-well microplates may be used as the carrier. Such multi-well microplates, and methods for their use in numerous assays, are both known in the art and commercially available.
[0159] Screening assays may include controls for purposes of calibration and confirmation of proper manipulation of the components of the assay. Blank wells that contain all of the reactants but no member of the chemical library are usually included. As another example, a known inhibitor (or activator) of an enzyme for which modulators are sought, can be incubated with one sample of the assay, and the resulting decrease (or increase) in the enzyme activity used as a comparator or control. It will be appreciated that modulators can also be combined with the enzyme activators or inhibitors to find modulators which inhibit the enzyme activation or repression that is otherwise caused by the presence of the known the enzyme modulator.
Measuring Enzymatic and Binding Reactions During Screening Assays
[0160] Techniques for measuring the progression of enzymatic and binding reactions, e.g., in multicontainer carriers, are known in the art and include, but are not limited to, the following.
[0161] Spectrophotometric and spectrofluorometric assays are well known in the art.
Examples of such assays include the use of colorimetric assays for the detection of peroxides, as described in Gordon, A. J and Ford, R. A., (1972) The Chemist's Companion: A Handbook Of Practical Data, Techniques, And References, John Wiley and Sons, N.Y., Page 437.
[0162] Fluorescence spectrometry may be used to monitor the generation of reaction products. Fluorescence methodology is generally more sensitive than the absorption methodology. The use of fluorescent probes is well known to those skilled in the art. For reviews, see Bashford et al, (1987) Spectrophotometry and Spectrofluorometry: A Practical Approach, pp. 91-114, IRL Press Ltd.; and Bell, (1981) Spectroscopy In Biochemistry, Vol. I, pp. 155-194, CRC Press.
[0163] In spectrofluorometric methods, enzymes are exposed to substrates that change their intrinsic fluorescence when processed by the target enzyme. Typically, the substrate is nonfluorescent and is converted to a fluorophore through one or more reactions. As a non- limiting example, SMase activity can be detected using the Amplex® Red reagent (Molecular Probes, Eugene, OR). In order to measure sphingomyelinase activity using Amplex® Red, the following reactions occur. First, SMase hydrolyzes sphingomyelin to yield ceramide and phosphorylcholine. Second, alkaline phosphatase hydrolyzes phosphorylcholine to yield choline. Third, choline is oxidized by choline oxidase to betaine. Finally, H2O2, in the presence of horseradish peroxidase, reacts with Amplex® Red to produce the fluorescent product, Resorufin, and the signal therefrom is detected using spectrofluorometry.
[0164] Fluorescence polarization (FP) is based on a decrease in the speed of molecular rotation of a fluorophore that occurs upon binding to a larger molecule, such as a receptor protein, allowing for polarized fluorescent emission by the bound ligand. FP is empirically determined by measuring the vertical and horizontal components of fluorophore emission following excitation with plane polarized light. Polarized emission is increased when the molecular rotation of a fluorophore is reduced. A fluorophore produces a larger polarized signal when it is bound to a larger molecule (i.e. a receptor), slowing molecular rotation of the fluorophore. The magnitude of the polarized signal relates quantitatively to the extent of fluorescent ligand binding. Accordingly, polarization of the "bound" signal depends on maintenance of high affinity binding.
[0165] FP is a homogeneous technology and reactions are very rapid, taking seconds to minutes to reach equilibrium. The reagents are stable, and large batches may be prepared, resulting in high reproducibility. Because of these properties, FP has proven to be highly automatable, often performed with a single incubation with a single, premixed, tracer-receptor reagent. For a review, see Owickiet al., (1997), Application of Fluorescence Polarization Assays in High-Throughput Screening, Genetic Engineering News, 17:27.
[0166] FP is particularly desirable since its readout is independent of the emission intensity (Checovich, W. I, et al., (1995) Nature 375:254-256; Dandliker, W B , et al., (1981) Methods in Enzymology 74:3-28) and is thus insensitive to the presence of colored compounds that quench fluorescence emission. FP and FRET (see below) are well-suited for identifying compounds that block interactions between sphingolipid receptors and their ligands. See, for example, Parker et al., (2000) Development of high throughput screening assays using fluorescence polarization: nuclear receptor-ligand-binding and kinase/phosphatase assays, J Biomol Screen 5:77-88.
[0167] Fluorophores derived from sphingolipids that may be used in FP assays are commercially available. For example, Molecular Probes (Eugene, OR) currently sells sphingomyelin and one ceramide flurophores. These are, respectively, N-(4,4-difluoro-5,7- dimethyl-4-bora-3a,4a-diaza-s-indacene- 3-pentanoyl)sphingosyl phosphocholine (BODIPY® FL C5-sphingomyelin); N-(4,4-difluoro-5,7-dimethyl-4-bora-3a,4a-diaza-s-indacene- 3- dodecanoyl)sphingosyl phosphocholine (BODIPY® FL C12-sphingomyelin); and N-(4,4- difluoro-5,7-dimethyl-4-bora-3a,4a-diaza-s-indacene- 3-pentanoyl)sphingosine (BODIPY® FL C5-ceramide). U.S. Patent No. 4, 150,949, (Immunoassay for gentamicin), discloses fluorescein- labelled gentamicins, including fluoresceinthiocarbanyl gentamicin. Additional fluorophores may be prepared using methods well known to the skilled artisan.
[0168] Exemplary normal-and-polarized fluorescence readers include the POLARION® fluorescence polarization system (Tecan AG, Hombrechtikon, Switzerland). General multiwell plate readers for other assays are available, such as the VERSAMAX® reader and the
SPECTRAMAX® multiwell plate spectrophotometer (both from Molecular Devices).
[0169] Fluorescence resonance energy transfer (FRET) is another useful assay for detecting interaction and has been described. See, e.g., Heim et al., (1996) Curr. Biol. 6: 178-182; Mitra et al., (1996) Gene 173 : 13-17; and Selvin et al., (1995) Meth. Enzymol. 246:300-345. FRET detects the transfer of energy between two fluorescent substances in close proximity, having known excitation and emission wavelengths. As an example, a protein can be expressed as a fusion protein with green fluorescent protein (GFP). When two fluorescent proteins are in
proximity, such as when a protein specifically interacts with a target molecule, the resonance energy can be transferred from one excited molecule to the other. As a result, the emission spectrum of the sample shifts, which can be measured by a fluorometer, such as a fJV!AX multiwell fluorometer (Molecular Devices, Sunnyvale Calif).
[0170] Scintillation proximity assay (SPA) is a particularly useful assay for detecting an interaction with the target molecule. SPA is widely used in the pharmaceutical industry and has been described (Hanselman et al., (1997) J. Lipid Res. 38:2365-2373; Kahl et al., (1996) Anal. Biochem. 243 :282-283; Undenfriend et al, (1987) Anal. Biochem. 161 :494-500). See also U.S. Patent Nos. 4,626,513 and 4,568,649, and European Patent No. 0,154,734. One commercially available system uses FLASHPLATE® scintillant-coated plates (NEN Life Science Products, Boston, MA).
[0171] The target molecule can be bound to the scintillator plates by a variety of well known means. Scintillant plates are available that are derivatized to bind to fusion proteins such as GST, His6 or Flag fusion proteins. Where the target molecule is a protein complex or a multimer, one protein or subunit can be attached to the plate first, then the other components of the complex added later under binding conditions, resulting in a bound complex.
[0172] In a typical SPA assay, the gene products in the expression pool will have been radiolabeled and added to the wells, and allowed to interact with the solid phase, which is the immobilized target molecule and scintillant coating in the wells. The assay can be measured immediately or allowed to reach equilibrium. Either way, when a radiolabel becomes sufficiently close to the scintillant coating, it produces a signal detectable by a device such as a TOPCOUNT NXT® microplate scintillation counter (Packard BioScience Co., Meriden Conn ). If a radiolabeled expression product binds to the target molecule, the radiolabel remains in proximity to the scintillant long enough to produce a detectable signal.
[0173] In contrast, the labeled proteins that do not bind to the target molecule, or bind only briefly, will not remain near the scintillant long enough to produce a signal above background. Any time spent near the scintillant caused by random Brownian motion will also not result in a significant amount of signal. Likewise, residual unincorporated radiolabel used during the expression step may be present, but will not generate significant signal because it will be in solution rather than interacting with the target molecule These non-binding interactions will therefore cause a certain level of background signal that can be mathematically removed. If too many signals are obtained, salt or other modifiers can be added directly to the assay plates until the desired specificity is obtained (Nichols et al., (1998) Anal. Biochem. 257: 112-1 19).
V. Kinase Activity Assays
[0174] A number of different assays for kinase activity can be utilized for assaying for active modulators and/or determining specificity of a modulator for a particular kinase or group or kinases. In addition to the assay mentioned in the Examples below, one of ordinary skill in the art will know of other assays that can be utilized and can modify an assay for a particular application. For example, numerous papers concerning kinases described assays that can be used.
[0175] Additional alternative assays can employ binding determinations. For example, this sort of assay can be formatted either in a fluorescence resonance energy transfer (FRET) format, or using an AlphaScreen (amplified /uminescent proximity homogeneous assay) format by varying the donor and acceptor reagents that are attached to streptavidin or the phospho-specific antibody.
VI. Alternative Compound Forms or Derivatives
(a) Isomers, Prodrugs, and Active Metabolites
[0176] Compounds contemplated herein are described with reference to both generic formulae and specific compounds. In addition, the compounds described herein may exist in a number of different forms or derivatives, all within the scope of the present disclosure. These include, for example, tautomers, stereoisomers, racemic mixtures, regioisomers, salts, prodrugs (e.g.
carboxylic acid esters), solvated forms, different crystal forms or polymorphs, and active metabolites.
(b) Tautomers, Stereoisomers, Regioisomers, and Solvated Forms
[0177] It is understood that some compounds may exhibit tautomerism. In such cases, the formulae provided herein expressly depict only one of the possible tautomeric forms. It is therefore to be understood that the formulae provided herein are intended to represent any tautomeric form of the depicted compounds and are not to be limited merely to the specific tautomeric form depicted by the drawings of the formulae.
[0178] Likewise, some of the compounds according to the present disclosure may exist as stereoisomers, i.e. having the same atomic connectivity of covalently bonded atoms yet differing in the spatial orientation of the atoms. For example, compounds may be optical stereoisomers, which contain one or more chiral centers, and therefore, may exist in two or more stereoisomeric forms (e.g. enantiomers or diastereomers). Thus, such compounds may be present as single stereoisomers {i.e., essentially free of other stereoisomers), racemates, and/or mixtures of enantiomers and/or diastereomers. As another example, stereoisomers include geometric
isomers, such as cis- or trans- orientation of substituents on adjacent carbons of a double bond. All such single stereoisomers, racemates and mixtures thereof are intended to be within the scope of the present disclosure. Unless specified to the contrary, all such steroisomeric forms are included within the formulae provided herein.
[0179] In some embodiments, a chiral compound of the present disclosure is in a form that contains at least 80% of a single isomer (60% enantiomeric excess ("e.e.") or diastereomeric excess ("d.e.")), or at least 85% (70% e.e. or d.e.), 90% (80% e.e. or d.e.), 95% (90% e.e. or d.e ), 97.5% (95% e.e or d.e ), or 99% (98% e.e. or d.e ). As generally understood by those skilled in the art, an optically pure compound having one chiral center is one that consists essentially of one of the two possible enantiomers (i.e., is enantiomerically pure), and an optically pure compound having more than one chiral center is one that is both
diastereomerically pure and enantiomerically pure. In some embodiments, the compound is present in optically pure form.
[0180] For compounds in which synthesis involves addition of a single group at a double bond, particularly a carbon-carbon double bond, the addition may occur at either of the double bond-linked atoms. For such compounds, the present disclosure includes both such
regioisomers.
(c) Prodrugs and Metabolites
[0181] In addition to the present formulae and compounds described herein, the disclosure also includes prodrugs (generally pharmaceutically acceptable prodrugs), active metabolic derivatives (active metabolites), and their pharmaceutically acceptable salts.
[0182] Prodrugs are compounds or pharmaceutically acceptable salts thereof which, when metabolized under physiological conditions or when converted by solvolysis, yield the desired active compound. Prodrugs include, without limitation, esters, amides, carbamates, carbonates, ureides, solvates, or hydrates of the active compound. Typically, the prodrug is inactive, or less active than the active compound, but may provide one or more of advantageous handling, administration, and/or metabolic properties. For example, some prodrugs are esters of the active compound; during metabolysis, the ester group is cleaved to yield the active drug. Also, some prodrugs are activated enzymatically to yield the active compound, or a compound which, upon further chemical reaction, yields the active compound.
[0183] In this context, a common example of a prodrug is an alkyl ester of a carboxylic acid. Relative to compounds of Formula I, all embodiments and sub-embodiments thereof including
any one or more of compounds P-001-P-255, further examples include, without limitation, an amide or carbamate derivative at the pyrrole nitrogen (i.e. Nl) of the azaindole core.
[0184] As described in The Practice of Medicinal Chemistry, Ch. 31-32 (Ed. Wermuth, Academic Press, San Diego, CA, 2001), prodrugs can be conceptually divided into two nonexclusive categories, bioprecursor prodrugs and carrier prodrugs. Generally, bioprecursor prodrugs are compounds that are inactive or have low activity compared to the corresponding active drug compound, that contain one or more protective groups and are converted to an active form by metabolism or solvolysis. Both the active drug form and any released metabolic products should have acceptably low toxicity. Typically, the formation of active drug compound involves a metabolic process or reaction that is one of the follow types:
[0185] Oxidative reactions: Oxidative reactions are exemplified without limitation to reactions such as oxidation of alcohol, carbonyl, and acid functionalities, hydroxylation of aliphatic carbons, hydroxylation of alicyclic carbon atoms, oxidation of aromatic carbon atoms, oxidation of carbon-carbon double bonds, oxidation of nitrogen-containing functional groups, oxidation of silicon, phosphorus, arsenic, and sulfur, oxidative N-dealkylation, oxidative O- and S-dealkylation, oxidative deamination, as well as other oxidative reactions.
[0186] Reductive reactions: Reductive reactions are exemplified without limitation to reactions such as reduction of carbonyl functionalities, reduction of alcohol functionalities and carbon-carbon double bonds, reduction of nitrogen-containing functional groups, and other reduction reactions.
[0187] Reactions without change in the oxidation state: Reactions without change in the state of oxidation are exemplified without limitation to reactions such as hydrolysis of esters and ethers, hydrolytic cleavage of carbon-nitrogen single bonds, hydrolytic cleavage of non-aromatic heterocycles, hydration and dehydration at multiple bonds, new atomic linkages resulting from dehydration reactions, hydrolytic dehalogenation, removal of hydrogen halide molecule, and other such reactions.
[0188] Carrier prodrugs are drug compounds that contain a transport moiety, e.g., that improves uptake and/or localized delivery to a site(s) of action. Desirably for such a carrier prodrug, the linkage between the drug moiety and the transport moiety is a covalent bond, the prodrug is inactive or less active than the drug compound, the prodrug and any release transport moiety are acceptably non-toxic. For prodrugs where the transport moiety is intended to enhance uptake, typically the release of the transport moiety should be rapid. In other cases, it is desirable to utilize a moiety that provides slow release, e.g., certain polymers or other moieties,
such as cyclodextrins. (See, e.g., Cheng et al., U.S. Patent Publ. No. 2004/0077595,
incorporated herein by reference.) Such carrier prodrugs are often advantageous for orally administered drugs. Carrier prodrugs can, for example, be used to improve one or more of the following properties: increased lipophilicity, increased duration of pharmacological effects, increased site-specificity, decreased toxicity and adverse reactions, and/or improvement in drug formulation (e.g. stability, water solubility, suppression of an undesirable organoleptic or physiochemical property). For example, lipophilicity can be increased by esterification of hydroxyl groups with lipophilic carboxylic acids, or of carboxylic acid groups with alcohols, e.g., aliphatic alcohols. Wermuth, supra.
[0189] Prodrugs may proceed from prodrug form to active form in a single step or may have one or more intermediate forms which may themselves have activity or may be inactive.
[0190] Metabolites, e.g., active metabolites, overlap with prodrugs as described above, e.g., bioprecursor prodrugs. Thus, such metabolites are pharmacologically active compounds or compounds that further metabolize to pharmacologically active compounds that are derivatives resulting from metabolic process in the body of a subject. Of these, active metabolites are such pharmacologically active derivative compounds. For prodrugs, the prodrug compound is generally inactive or of lower activity than the metabolic product. For active metabolites, the parent compound may be either an active compound or may be an inactive prodrug.
[0191] Prodrugs and active metabolites may be identified using routine techniques known in the art. See, e.g., Bertolini et al., 1997, J. Med. Chem., 40:2011-2016; Shan et al, 1997, J Pharm Sci 86(7):756-757; Bagshawe, 1995, Drug Dev. Res., 34:220-230; Wermuth, supra.
(d) Pharmaceutically acceptable salts
[0192] Compounds can be formulated as or be in the form of pharmaceutically acceptable salts. Contemplated pharmaceutically acceptable salt forms include, without limitation, mono, bis, tris, tetrakis, and so on. Pharmaceutically acceptable salts are non-toxic in the amounts and concentrations at which they are administered. The preparation of such salts can facilitate the pharmacological use by altering the physical characteristics of a compound without preventing it from exerting its physiological effect. Useful alterations in physical properties include lowering the melting point to facilitate transmucosal administration and increasing the solubility to facilitate administering higher concentrations of the drug.
[0193] Pharmaceutically acceptable salts include acid addition salts such as those containing sulfate, chloride, hydrochloride, fumarate, maleate, phosphate, sulfamate, acetate, citrate, lactate, tartrate, methanesulfonate, ethanesulfonate, benzenesulfonate, ?-toluenesulfonate,
cyclohexylsulfamate and quinate. Pharmaceutically acceptable salts can be obtained from acids such as hydrochloric acid, maleic acid, sulfuric acid, phosphoric acid, sulfamic acid, acetic acid, citric acid, lactic acid, tartaric acid, malonic acid, methanesulfonic acid, ethanesulfonic acid, benzenesulfonic acid, -toluenesulfonic acid, cyclohexyl sulfamic acid, fumaric acid, and quinic acid.
[0194] Pharmaceutically acceptable salts also include basic addition salts such as those containing benzathine, chloroprocaine, choline, diethanolamine, ethanolamine, t-butylamine, ethylenediamine, meglumine, procaine, aluminum, calcium, lithium, magnesium, potassium, sodium, ammonium, alkylamine, and zinc, when acidic functional groups, such as carboxylic acid or phenol are present. For example, see Remington's Pharmaceutical Sciences, 19th ed., Mack Publishing Co., Easton, PA, Vol. 2, p. 1457, 1995. Such salts can be prepared using the appropriate corresponding bases.
[0195] Pharmaceutically acceptable salts can be prepared by standard techniques. For example, the free-base form of a compound can be dissolved in a suitable solvent, such as an aqueous or aqueous-alcohol solution containing the appropriate acid and then isolated by evaporating the solution. In another example, a salt can be prepared by reacting the free base and acid in an organic solvent.
[0196] Thus, for example, if the particular compound is a base, the desired pharmaceutically acceptable salt may be prepared by any suitable method available in the art, for example, treatment of the free base with an inorganic acid, such as hydrochloric acid, hydrobromic acid, sulfuric acid, nitric acid, phosphoric acid, and the like, or with an organic acid, such as acetic acid, maleic acid, succinic acid, mandelic acid, fumaric acid, malonic acid, pyruvic acid, oxalic acid, glycolic acid, salicylic acid, a pyranosidyl acid, such as glucuronic acid or galacturonic acid, an alpha-hydroxy acid, such as citric acid or tartaric acid, an amino acid, such as aspartic acid or glutamic acid, an aromatic acid, such as benzoic acid or cinnamic acid, a sulfonic acid, such as p-toluenesulfonic acid or ethanesulfonic acid, or the like.
[0197] Similarly, if the particular compound is an acid, the desired pharmaceutically acceptable salt may be prepared by any suitable method, for example, treatment of the free acid with an inorganic or organic base, such as an amine (primary, secondary or tertiary), an alkali metal hydroxide or alkaline earth metal hydroxide, or the like. Illustrative examples of suitable salts include organic salts derived from amino acids, such as L-glycine, L-lysine, and L-arginine, ammonia, primary, secondary, and tertiary amines, and cyclic amines, such as
hydroxyethylpyrrolidme, piperidine, morpholine or piperazine, and inorganic salts derived from sodium, calcium, potassium, magnesium, manganese, iron, copper, zinc, aluminum and lithium.
[0198] The pharmaceutically acceptable salt of the different compounds may be present as a complex. Examples of complexes include 8-chlorotheophylline complex (analogous to, e.g., dimenhydrinate: diphenhydramine 8-chlorotheophylline (1 : 1) complex; Dramamine) and various cyclodextrin inclusion complexes.
[0199] Unless specified to the contrary, specification of a compound herein includes pharmaceutically acceptable salts of such compound.
(e) Other Compound Forms
[0200] In the case of agents that are solids, it is understood by those skilled in the art that the compounds and salts may exist in different crystal or polymorphic forms, or may be formulated as co-crystals, or may be in an amorphous form, or may be any combination thereof (e.g.
partially crystalline, partially amorphous, or mixtures of polymorphs) all of which are intended to be within the scope of the present disclosure and specified formulae. Whereas salts are formed by acid/base addition, i.e. a free base or free acid of the compound of interest forms an acid/base reaction with a corresponding addition base or addition acid, respectively, resulting in an ionic charge interaction, co-crystals are a new chemical species that is formed between neutral compounds, resulting in the compound and an additional molecular species in the same crystal structure.
[0201] In some instances, compounds of the disclosure are complexed with an acid or a base, including base addition salts such as ammonium, diethylamine, ethanolamine, ethylenediamine, diethanolamine, t-butylamine, piperazine, meglumine; acid addition salts, such as acetate, acetylsalicylate, besylate, camsylate, citrate, formate, fumarate, glutarate, hydrochlorate, maleate, mesylate, nitrate, oxalate, phosphate, succinate, sulfate, tartrate, thiocyanate and tosylate; and amino acids such as alanine, arginine, asparagine, aspartic acid, cysteine, glutamine, glutamic acid, glycine, histidine, isoleucine, leucine, lysine, methionine, phenylalanine, proline, serine, threonine, tryptophan, tyrosine or valine. In combining the compound of the disclosure with the acid or base, an amorphous complex is formed rather than a crystalline material such as typical salt or co-crystal. In some instances, the amorphous form of the complex is facilitated by additional processing, such as by spray-drying, mechanochemical methods such as roller compaction, or microwave irradiation of the parent compound mixed with the acid or base Such methods may also include addition of ionic and/or non-ionic polymer systems, including, but not limited to, hydroxypropyl methyl cellulose acetate succinate (HPMCAS) and methacrylic acid copolymer (e.g. Eudragit® LI 00-55), that further stabilize the amorphous nature of the complex. Such amorphous complexes provide several advantages. For example, lowering of the melting temperature relative to the free base facilitates additional
processing, such as hot melt extrusion, to further improve the biopharmaceutical properties of the compound. Also, the amorphous complex is readily friable, which provides improved compression for loading of the solid into capsule or tablet form.
[0202] Additionally, the formulae are intended to cover hydrated or solvated as well as unhydrated or unsolvated forms of the identified structures. For example, the indicated compounds include both hydrated and non-hydrated forms. Other examples of solvates include the structures in combination with a suitable solvent, such as isopropanol, ethanol, methanol, dimethyl sulfoxide, ethyl acetate, acetic acid, or ethanolamine.
VII. Formulations and Administration
[0203] The methods and compounds will typically be used in therapy for human subjects. However, they may also be used to treat similar or identical indications in other animal subjects. In this context, the terms "subject," "animal subject," and the like refer to human and non- human vertebrates, e.g. mammals, such as non-human primates, sports and commercial animals, e.g., equines, bovines, porcines, ovines, rodents, and pets, e.g., canines and felines.
[0204] Suitable dosage forms, in part, depend upon the use or the route of administration, for example, oral, transdermal, transmucosal, inhalant, or by injection (parenteral). Such dosage forms should allow the compound to reach target cells. Other factors are well known in the art, and include considerations such as toxicity and dosage forms that retard the compound or composition from exerting its effects. Techniques and formulations generally may be found in The Science and Practice of Pharmacy, 21st edition, Lippincott, Williams and Wilkins,
Philadelphia, PA, 2005 (hereby incorporated by reference herein).
[0205] Compounds of the present disclosure (i.e. Formula I, Formula 1(a), Formula 11(a), Formula 11(b), Formula III, Formula IV, Formula V, and all sub-embodiments described herein, and all compounds described herein, including P-001-P-255) can be formulated as
pharmaceutically acceptable salts.
[0206] Carriers or excipients can be used to produce compositions The carriers or excipients can be chosen to facilitate administration of the compound. Examples of carriers include calcium carbonate, calcium phosphate, various sugars such as lactose, glucose, or sucrose, or types of starch, cellulose derivatives, gelatin, vegetable oils, polyethylene glycols and physiologically compatible solvents. Examples of physiologically compatible solvents include sterile solutions of water for injection (WFI), saline solution, and dextrose.
[0207] The compounds can be administered by different routes including intravenous, intraperitoneal, subcutaneous, intramuscular, oral, transmucosal, rectal, transdermal, or inhalant.
In some embodiments, the compounds can be administered by oral administration. For oral administration, for example, the compounds can be formulated into conventional oral dosage forms such as capsules, tablets, and liquid preparations such as syrups, elixirs, and concentrated drops.
[0208] For inhalants, compounds of the disclosure may be formulated as dry powder or a suitable solution, suspension, or aerosol. Powders and solutions may be formulated with suitable additives known in the art. For example, powders may include a suitable powder base such as lactose or starch, and solutions may comprise propylene glycol, sterile water, ethanol, sodium chloride and other additives, such as acid, alkali and buffer salts. Such solutions or suspensions may be administered by inhaling via spray, pump, atomizer, or nebulizer, and the like. The compounds of the disclosure may also be used in combination with other inhaled therapies, for example corticosteroids such as fluticasone propionate, beclomethasone dipropionate, triamcinolone acetonide, budesonide, and mometasone furoate; beta agonists such as albuterol, salmeterol, and formoterol; anticholinergic agents such as ipratropium bromide or tiotropium; vasodilators such as treprostinal and iloprost; enzymes such as DNAase; therapeutic proteins; immunoglobulin antibodies; an oligonucleotide, such as single or double stranded DNA or RNA, siRNA; antibiotics such as tobramycin; muscarinic receptor antagonists;
leukotriene antagonists; cytokine antagonists; protease inhibitors; cromolyn sodium; nedocril sodium; and sodium cromoglycate.
[0209] Pharmaceutical preparations for oral use can be obtained, for example, by combining the active compounds with solid excipients, optionally grinding a resulting mixture, and processing the mixture of granules, after adding suitable auxiliaries, if desired, to obtain tablets or dragee cores. Suitable excipients are, in particular, fillers such as sugars, including lactose, sucrose, mannitol, or sorbitol; cellulose preparations, for example, maize starch, wheat starch, rice starch, potato starch, gelatin, gum tragacanth, methyl cellulose, hydroxypropylmethyl- cellulose, sodium carboxymethylcellulose (CMC), and/or polyvinylpyrrolidone (PVP:
povidone). If desired, disintegrating agents may be added, such as the cross-linked
polyvinylpyrrolidone, agar, or alginic acid, or a salt thereof such as sodium alginate.
[0210] Dragee cores are provided with suitable coatings. For this purpose, concentrated sugar solutions may be used, which may optionally contain, for example, gum arabic, talc, polyvinylpyrrolidone, carbopol gel, polyethylene glycol (PEG), and/or titanium dioxide, lacquer solutions, and suitable organic solvents or solvent mixtures. Dye-stuffs or pigments may be added to the tablets or dragee coatings for identification or to characterize different
combinations of active compound doses.
[0211] Pharmaceutical preparations that can be used orally include push-fit capsules made of gelatin ("gelcaps"), as well as soft, sealed capsules made of gelatin, and a plasticizer, such as glycerol or sorbitol. The push-fit capsules can contain the active ingredients in admixture with filler such as lactose, binders such as starches, and/or lubricants such as talc or magnesium stearate and, optionally, stabilizers. In soft capsules, the active compounds may be dissolved or suspended in suitable liquids, such as fatty oils, liquid paraffin, or liquid polyethylene glycols (PEGs). In addition, stabilizers may be added.
[0212] Alternatively, injection (parenteral administration) may be used, e.g., intramuscular, intravenous, intraperitoneal, and/or subcutaneous. For injection, the compounds of the disclosure are formulated in sterile liquid solutions, such as in physiologically compatible buffers or solutions, such as saline solution, Hank's solution, or Ringer's solution. In addition, the compounds may be formulated in solid form and redissolved or suspended immediately prior to use. Lyophilized forms can also be produced.
[0213] Administration can also be by transmucosal, topical, transdermal, or inhalant means. For transmucosal, topical or transdermal administration, penetrants appropriate to the barrier to be permeated are used in the formulation. Such penetrants are generally known in the art, and include, for example, for transmucosal administration, bile salts and fusidic acid derivatives. In addition, detergents may be used to facilitate permeation. Transmucosal administration, for example, may be through nasal sprays or suppositories (rectal or vaginal).
[0214] The topical compositions of this disclosure are formulated as oils, creams, lotions, ointments, and the like by choice of appropriate carriers known in the art. Suitable carriers include vegetable or mineral oils, white petrolatum (white soft paraffin), branched chain fats or oils, animal fats and high molecular weight alcohol (greater than Cn). In another embodiment, the carriers are those in which the active ingredient is soluble. Emulsifiers, stabilizers, humectants and antioxidants may also be included as well as agents imparting color or fragrance, if desired. Creams for topical application are formulated from a mixture of mineral oil, self-emulsifying beeswax and water in which mixture the active ingredient, dissolved in a small amount solvent (e.g. an oil), is admixed. Additionally, administration by transdermal means may comprise a transdermal patch or dressing such as a bandage impregnated with an active ingredient and optionally one or more carriers or diluents known in the art. To be administered in the form of a transdermal delivery system, the dosage administration will, of course, be continuous rather than intermittent throughout the dosage regimen.
[0215] The amounts of various compounds to be administered can be determined by standard procedures taking into account factors such as the compound IC50, the biological half-life of the
compound, the age, size, and weight of the subject, and the indication being treated. The importance of these and other factors are well known to those of ordinary skill in the art.
Generally, a dose will be between about 0.01 and 50 mg/kg, or 0 1 and 20 mg/kg of the subject being treated. Multiple doses may be used.
[0216] The compounds of the disclosure may also be used in combination with other therapies for treating the same disease. Such combination use includes administration of the compounds and one or more other therapeutics at different times, or co-administration of the compound and one or more other therapies. In some embodiments, dosage may be modified for one or more of the compounds of the disclosure or other therapeutics used in combination, e.g., reduction in the amount dosed relative to a compound or therapy used alone, by methods well known to those of ordinary skill in the art.
[0217] It is understood that use in combination includes use with other therapies, drugs, medical procedures etc., where the other therapy or procedure may be administered at different times (e.g. within a short time, such as within hours (e.g. 1, 2, 3, 4-24 hours), or within a longer time (e.g. 1-2 days, 2-4 days, 4-7 days, 1-4 weeks)) than a compound of the present disclosure, or at the same time as a compound of the disclosure. Use in combination also includes use with a therapy or medical procedure that is administered once or infrequently, such as surgery, along with a compound of the disclosure administered within a short time or longer time before or after the other therapy or procedure. In some embodiments, the present disclosure provides for delivery of compounds of the disclosure and one or more other drug therapeutics delivered by a different route of administration or by the same route of administration. The use in combination for any route of administration includes delivery of compounds of the disclosure and one or more other drug therapeutics delivered by the same route of administration together in any formulation, including formulations where the two compounds are chemically linked in such a way that they maintain their therapeutic activity when administered. In one aspect, the other drug therapy may be co-administered with one or more compounds of the disclosure. Use in combination by co-administration includes administration of co-formulations or formulations of chemically joined compounds, or administration of two or more compounds in separate formulations within a short time of each other (e.g. within an hour, 2 hours, 3 hours, up to 24 hours), administered by the same or different routes. Co-administration of separate formulations includes co-administration by delivery via one device, for example the same inhalant device, the same syringe, etc., or administration from separate devices within a short time of each other. Co-formulations of compounds of the disclosure and one or more additional drug therapies delivered by the same route includes preparation of the materials together such that they can be
administered by one device, including the separate compounds combined in one formulation, or compounds that are modified such that they are chemically joined, yet still maintain their biological activity. Such chemically joined compounds may have a linkage that is substantially maintained in vivo, or the linkage may break down in vivo, separating the two active components.
[0218] In certain embodiments, the patient is 60 years or older and relapsed after a first line cancer therapy. In certain embodiments, the patient is 18 years or older and is relapsed or refractory after a second line cancer therapy. In certain embodiments, the patient is 60 years or older and is primary refractory to a first line cancer therapy. In certain embodiments, the patient is 70 years or older and is previously untreated. In certain embodiments, the patient is 70 years or older and is ineligible and/or unlikely to benefit from cancer therapy.
[0219] In certain embodiments, the therapeutically effective amount used in the methods provided herein is at least 10 mg per day. In certain embodiments, the therapeutically effective amount is 10, 50, 90, 100, 135, 150, 200, 250, 300, 350, 400, 450, 500, 600, 700, 800, 900, 1000, 1200, 1300, 1400, 1500, 1600, 1700, 1800, 1900, 2000, 2200, 2500 mg per dosage. In other embodiments, the therapeutically effective amount is 10, 50, 90, 100, 135, 150, 200, 250, 300, 350, 400, 450, 500, 600, 700, 800, 900, 1000, 1200, 1300, 1400, 1500, 1600, 1700, 1800, 1900, 2000, 2200, 2500, 3000, 3500, 4000, 4500, 5000 mg per day or more. In certain embodiments, the compound is administered continuously.
[0220] In certain embodiments, provided herein is a method for treating a diseases or condition mediated by Flt3 or oncogenic Flt3 by administering to a mammal having a disease or condition at least 10, 50, 90, 100, 135, 150, 200, 250, 300, 350, 400, 450, 500, 600, 700, 800, 900, 1000, 1200, 1300, 1400, 1500, 1600, 1700, 1800, 1900, 2000, 2200, 2500, 3000, 3500, 4000, 4500, 5000 mg per day of a compound of any of Formula I, Formula 1(a), Formula 11(a), Formula 11(b), Formula III, Formula IV, Formula V, and all sub-embodiments described herein, and all compounds described herein, including P-001-P-255 or any of the compounds described herein or a pharmaceutically acceptable salt or solvate thereof, and wherein the compound is administered on an empty stomach.
[0221] In certain embodiments, the disease or condition in the methods provided herein is cancer. In certain embodiments, the disease or condition in the methods provided herein is a solid tumor. In yet another embodiment, the disease or condition in the methods provided herein is a blood-borne tumor. In yet another embodiment, the disease or condition is leukemia. In certain embodiments, the leukemia is acute myeloid leukemia. In certain embodiments, the
leukemia is acute lymphocytic leukemia. In still another embodiment, the leukemia is a refractory or drug resistant leukemia.
[0222] In certain embodiments, the drug resistant leukemia is drug resistant acute myeloid leukemia. In certain embodiments, the mammal having the drug resistant acute myeloid leukemia has an activating FLT3 mutation. In still another embodiment, the drug resistant acute myeloid leukemia has a FLT3 internal tandem duplication (ITD) mutation. In still another embodiment, the drug resistant acute myeloid leukemia has a FLT3 internal tandem duplication (ITD) mutation and a drug resistant D835Y mutation In still another embodiment, the drug resistant acute myeloid leukemia has a FLT3 internal tandem duplication (ITD) mutation and a drug resistant F691L mutation. In still another embodiment, the drug resistant acute myeloid leukemia has a FLT3 internal tandem duplication (ITD) mutation and drug resistant D835Y and F691L mutations.
[0223] Each method provided herein may further comprise administering a second therapeutic agent. In certain embodiments, the second therapeutic agent is an anticancer agent. In certain embodiments, the second therapeutic agent is a protein kinase inhibitor; In certain embodiments, a tyrosine kinase inhibitor; and in yet another embodiment, a second FLT3 kinase inhibitor, including, but not limiting to, sunitinib, cediranib, cabozantinib, trametinib, dabrafenib, cobimetinib, ponatinib (AP24534), PHA-665752, Dovitinib (TKI258, CHIR-258), AC220 (quizartinib), TG101209 , KW-2449, AEE788 (NVP-AEE788), MP-470 (amuvatinib), TSU-68 (SU6668, orantinib, ENMD-2076, vatalanib dihydrochloride (PTK787) and tandutinib
(MLN518).
VIII. Methods for Treating Conditions Mediated by FLT3 Kinases
[0224] In another aspect, the present disclosure provides a method for treating a subject suffering from or at risk of FLT3 protein kinase mediated diseases or conditions. The method includes administering to the subject an effective amount of one or more compounds from Formula 1, 1(a), 11(a), 11(b), III, IV, V, P-001-P-255, or a pharmaceutically acceptable salt, a solvate, a tautomer, an isomer or a deuterated analog thereof, or a pharmaceutical composition thereof. In certain embodiments, the method involves administering to the subject an effective amount of any one or more compound(s) as described herein in combination with one or more other therapies for the disease or condition. Non-limiting examples of a disease or condition mediated by a FLT3 protein kinase, said method comprising administering to the subject an effective amount of a compound as described herein, or a pharmaceutically acceptable salt, deuterated analog, a tautomer or an isomer thereof, or a pharmaceutical composition of said compound, wherein the disease or condition is selected from acute myeloid leukemia, stem cell
ablation and myelopreparation for stem cell transplant, primary progressive multiple sclerosis, complex regional pain syndrome, reflex sympathetic dystrophy, muscular dystrophy, duchenne muscular dystrophy, causalgia, neuro-inflammation, neuroinflammatory disorders, benign forgetfulness, HIV, binswager type dementia, dementia with lewy bodie, prosencephaly, microencepahy, cerebral palsy, congenital hydrocephalus, abdominal dropsy, progressive supranuclear palsy, glaucoma, addiction disorders, dependencies, alcoholism, tremors, Wilson's disease, vascular dementias, multi infarct dementia, fronto temporal dementia, pseudo-dementia, bladder cancer, basal cell carcinoma, cholangiocarcinoma, colon cancer, endometrial cancer, esophageal cancer, Ewing's sarcoma, gastric cancer, glioma, hepatocellular carcinoma, Hodgkin lymphoma, laryngeal carcinoma, leukemia, liver cancer, lung cancer, melanoma, mesothelioma, pancreatic cancer, rectal cancer, renal cancer, squamous cell carcinoma, t cell lymphoma, thyroid cancer, monocytic leukemia, pheochromocytoma, malignant peripheral nerve cell tumors, malignant peripheral nerve sheath tumors (MPNST), cutaneous and plexiform neurofibromas, leiomyoadenomatoid tumor, fibroids, uterine fibroids, leiomyosarcoma, papillary thyroid cancer, anaplastic thyroid cancer, medullary thyroid cancer, follicular thyroid cancer, hurthle cell carcinoma, thyroid cancer, ascites, malignant ascites, mesothelioma, salivary gland tumors, mucoepidermoid carcinoma of the salivary gland, acinic cell carcinoma of the salivary gland, gastrointestinal stromal tumors (GIST), tumors that cause effusions in potential spaces of the body, pleural effusions, pericardial effusions, peritoneal effusions aka ascites, giant cell tumors (GCT), GCT of bone other sarcomas, tumor angiogenesis, paracrine tumor growth or tumors that express aberrantly or otherwise Fms, CSF1R, CSF1 or IL-34, or activating mutations or translocations of any of the foregoing.
[0225] In another embodiment, the FLT3 kinase is a mutated form. In another embodiment, the FLT3 Kinase mutation is FLT3 internal tandem duplication (ITD) mutation. In another embodiment, the FLT3 mutation further includes D835Y, F691L or both D835Y and F691L. In another embodiment, the disease or condition is selected from acute myeloid leukemia, acute lymphocytic leukemia or chronic myelogenous leukemia.
[0226] In some embodiments, the present disclosure provides a method for inhibiting mutant FLT3 kinase, such as FLT3 ITD and drug resistant FLT3 mutants such as D835Y and F691L. The method includes contacting one or more compounds from Formula 1, 1(a), 11(a), 11(b), III, IV, V, P-001-P-255, or a pharmaceutically acceptable salt, a solvate, a tautomer, an isomer or a deuterated analog thereof, or a pharmaceutical composition thereof, with a cell or a FLT3 mutant protein kinase either in vitro or in vivo.
[0227] In certain embodiments, the present disclosure provides use of one or more compounds from Formula 1, 1(a), 11(a), 11(b), III, IV, V, P-001-P-255, or a pharmaceutically acceptable salt, a solvate, a tautomer, an isomer or a deuterated analog thereof, or a
pharmaceutical composition thereof, in the manufacture of a medicament for the treatment of a disease or condition as described herein. In other embodiments, the present disclosure provides a compound of any of Formula 1, 1(a), 11(a), 11(b), III, IV, V, and all sub -embodiments described herein, and all compounds described herein, including P-001-P-255, or a composition comprising any of the compounds described herein or a pharmaceutically acceptable salt or a solvate thereof for use in treating a disease or condition as described herein.
VII. Combination Therapy
[0228] Protein kinase modulators may be usefully combined with another pharmacologically active compound, or with two or more other pharmacologically active compounds, particularly in the treatment of cancer. In one embodiment, the composition includes any one or more compound(s) as described herein along with one or more compounds that are therapeutically effective for the same disease indication, wherein the compounds have a synergistic effect on the disease indication. In one embodiment, the composition includes any one or more compound(s) as described herein effective in treating a cancer and one or more other compounds that are effective in treating the same cancer, further wherein the compounds are synergistically effective in treating the cancer.
[0229] In some embodiments, the present disclosure provides a composition comprising one or more compounds from Formula 1, 1(a), 11(a), 11(b), III, IV, V, P-001-P-255, or a
pharmaceutically acceptable salt, a solvate, a tautomer, an isomer or a deuterated analog thereof, or a pharmaceutical composition thereof, and one or more agents. In some embodiments, the one or more agents are selected from an alkylating agent, including, but not limited to, adozelesin, altretamine, bendamustine, bizelesin, busulfan, carboplatin, carboquone, carmofur, carmustine, chlorambucil, cisplatin, cyclophosphamide, dacarbazine, estramustine, etoglucid, fotemustine, hepsulfam, ifosfamide, improsulfan, irofulven, lomustine, mannosulfan, mechlorethamine, melphalan, mitobronitol, nedaplatin, nimustine, oxaliplatin, piposulfan, prednimustine, procarbazine, ranimustinc, satraplatin, semustine, streptozocin, temozolomide, thiotepa, treosulfan, triaziquone, triethylenemelamine, triplatin tetranitrate, trofosphamide, and uramustine; an antibiotic, including, but not limited to, aclarubicin, amrubicin, bleomycin, dactinomycin, daunorubicin, doxorubicin, elsamitrucin, epirubicin, idarubicin, menogaril, mitomycin, neocarzinostatin, pentostatin, pirarubicin, plicamycin, valrubicin, and zorubicin; an antimetabolite, including, but not limited to, aminopterin, azacitidine, azathioprine, capecitabine,
cladribine, clofarabine, cytarabine, decitabine, floxuridine, fludarabine, 5-fluorouracil, gemcitabine, hydroxyurea, mercaptopurine, methotrexate, nelarabine, pemetrexed, azathioprine, raltitrexed, tegafur-uracil, thioguanine, trimethoprim, trimetrexate, and vidarabine; an immunotherapy, including, but not limited to, alemtuzumab, bevacizumab, cetuximab, galiximab, gemtuzumab, panitumumab, pertuzumab, rituximab, tositumomab, trastuzumab, 90 Y ibritumomab tiuxetan, ipilimumab, and tremelimumab; a hormone or hormone antagonist, including, but not limited to, anastrozole, androgens, buserelin, diethylstilbestrol, exemestane, flutamide, fulvestrant, goserelin, idoxifene, letrozole, leuprolide, magestrol, raloxifene, tamoxifen, and toremifene, a taxane, including, but not limited to, DJ-927, docetaxel, TPI 287, larotaxel, ortataxel, paclitaxel, DHA-paclitaxel, and tesetaxel; a retinoid, including, but not limited to, alitretinoin, bexarotene, fenretinide, isotretinoin, and tretinoin; an alkaloid, including, but not limited to, demecolcine, homoharringtonine, vinblastine, vincristine, vindesine, vinflunine, and vinorelbine; an antiangiogenic agent, including, but not limited to, AE-941 (GW786034, Neovastat), ABT-510, 2-methoxy estradiol, lenalidomide, and thalidomide; a topoisomerase inhibitor, including, but not limited to, amsacrine, belotecan, edotecarin, etoposide, etoposide phosphate, exatecan, irinotecan (also active metabolite SN-38 (7-ethyl-10- hydroxy-camptothecin)), lucanthone, mitoxantrone, pixantrone, rubitecan, teniposide, topotecan, and 9-aminocamptothecin; a kinase inhibitor, including, but not limited to, axitinib (AG
013736), dasatinib (BMS 354825), erlotinib, gefitinib, flavopiridol, imatinib mesylate, lapatinib, motesanib diphosphate (AMG 706), nilotinib (AMN107), seliciclib, sorafenib, sunitinib malate, AEE-788, BMS-599626, UCN-01 (7-hydroxystaurosporine), and vatalanib; a targeted signal transduction inhibitor including, but not limited to bortezomib, geldanamycin, and rapamycin; a biological response modifier, including, but not limited to, imiquimod, interferon-. alpha., and interleukin-2; and other chemotherapeutics, including, but not limited to 3-AP (3-amino-2- carboxyaldehyde thiosemicarbazone), altrasentan, aminoglutethimide, anagrelide, asparaginase, bryostatin-1, cilengitide, elesclomol, eribulin mesylate (E7389), ixabepilone, lonidamine, masoprocol, mitoguanazone, oblimersen, sulindac, testolactone, tiazofurin, mTOR inhibitors (e.g. temsirolimus, everolimus, deforolimus), PI3K inhibitors (e.g. BEZ235, GDC-0941, XL 147, XL765), Cdk4 inhibitors (e.g. PD-332991), Akt inhibitors, Hsp90 inhibitors (e.g. tanespimycin) and farnesyltransferase inhibitors (e.g. tipifarnib); MEK inhibitors (e.g., AS703026, AZD6244 (selumetinib), AZD8330, BIX02188, C11040 (PD184352), D-87503, GSK1120212 (JTP- 74057), PD0325901, PD318088, PD98059, PDEA119 (BAY 869766), TAK-733).
[0230] In another embodiment, each method provided herein may further comprise administering a second therapeutic agent. In certain embodiments, the second therapeutic agent is an anticancer agent. In certain embodiments, the second therapeutic agent is a protein kinase
inhibitor; In certain embodiments, a tyrosine kinase inhibitor; and in yet another embodiment, a second FLT3 kinase inhibitor, including, but not limiting to, Sunitinib, Cediranib, XL- 184 free base (Cabozantinib, Ponatinib (AP24534), PHA-665752, Dovitinib (TKI258, CHIR-258), AC220 (Quizartinib), TGI 01209 , KW-2449, AEE788 (NVP-AEE788), MP-470 (Amuvatinib), TSU-68 (SU6668, Orantmib, ENMD-2076, Vatalamb dihydrochloride (PTK787) and
Tandutinib (MLN518).
[0231] In one embodiment, the present disclosure provides methods for treating a disease or condition mediated by FLT3 kinase, including mutant FLT3 kinase (such as FLT3 ITD and drug resistant FLT3 mutants such as D835Y and F691L), by administering to the subject an effective amount of a composition including any one or more compound(s) as described herein in combination with one or more other suitable therapies for treating the disease.
[0232] In another embodiment, the present disclosure provides a method of treating a cancer in a subject in need thereof by administering to the subject an effective amount of a composition including any one or more compound(s) as described herein in combination with one or more other therapies or medical procedures effective in treating the cancer. Other therapies or medical procedures include suitable anticancer therapy (e.g. drug therapy, vaccine therapy, gene therapy, photodynamic therapy) or medical procedure (e.g. surgery, radiation treatment, hyperthermia heating, bone marrow or stem cell transplant). In one embodiment, the one or more suitable anticancer therapies or medical procedures is selected from treatment with a chemotherapeutic agent (e.g. chemotherapeutic drug), radiation treatment (e.g. x-ray, gamma -ray, or electron, proton, neutron, or .alpha, particle beam), hyperthermia heating (e.g. microwave, ultrasound, radiofrequency ablation), Vaccine therapy (e.g. AFP gene hepatocellular carcinoma vaccine, AFP adenoviral vector vaccine, AG-858, allogeneic GM-CSF-secretion breast cancer vaccine, dendritic cell peptide vaccines), gene therapy (e.g. Ad5CMV-p53 vector, adenovector encoding MDA7, adenovirus 5-tumor necrosis factor alpha), photodynamic therapy (e.g. aminolevulinic acid, motexatin lutetium), surgery, or bone marrow and stem cell transplantation.
IX. Kits
[0233] In another aspect, the present disclosure provides kits that include one or more compounds from Formula 1, 1(a), 11(a), 11(b), III, IV, V, P-001-P-255, or a pharmaceutically acceptable salt, a solvate, a tautomer, an isomer or a deuterated analog thereof, or a pharmaceutical composition thereof. In some embodiments, the compound or composition is packaged, e.g., in a vial, bottle, flask, which may be further packaged, e.g., within a box, envelope, or bag; the compound or composition is approved by the U.S. Food and Drug Administration or similar regulatory agency for administration to a mammal, e.g., a human; the
compound or composition is approved for administration to a mammal, e.g., a human, for a protein kinase mediated disease or condition; the kits described herein may include written instructions for use and/or other indication that the compound or composition is suitable or approved for administration to a mammal, e.g., a human, for a Raf protein kinase-mediated disease or condition; and the compound or composition may be packaged in unit dose or single dose form, e.g., single dose pills, capsules, or the like.
X. Companion Diagnostics
[0234] Another aspect of the disclosure relates to a method of (1) identifying the presence of a tumor in a patient; and (2) treating the patient, identified as needing the treatment, by administering a therapeutically effective amount of one or more compounds of Formula 1, 1(a), 11(a), 11(b), III, IV, V, P-001-P-255, or a pharmaceutically acceptable salt, a solvate, a tautomer, an isomer or a deuterated analog thereof, or a pharmaceutical composition thereof. In one embodiment, the tumor can be identified by employing a tumor biomarker. Tumor biomarkers can also be useful in establishing a specific diagnosis, such as determining whether tumors are of primary or metastatic origin. To make this distinction, chromosomal alterations found on cells located in the primary tumor site can be screened against those found in the secondary site. If the alterations match, the secondary tumor can be identified as metastatic; whereas if the alterations differ, the secondary tumor can be identified as a distinct primary tumor.
[0235] In another embodiment, the tumor can be identified by a biopsy. Non-limiting examples of biopsies that can be employed include .fine needle aspiration biopsy, a core needle biopsy, a vacuum-assisted biopsy, an image-guided biopsy, a surgical biopsy, an incisional biopsy, an endoscopic biopsy, a bone marrow biopsy.
[0236] In another embodiment, the identification of tumor can be by magnetic resonance imaging (MRI) is a test that uses magnetic fields to produce detailed images of the body.
[0237] In another embodiment, the identification of tumor can be by a bone scan. In another embodiment, the identification of tumor can be a computed tomography (CT) scan, also called a CAT scan.
[0238] In another embodiment, the identification of tumor can be by an integrated PET-CT scan combines images from a positron emission tomography (PET) scan and a computed tomography (CT) scan that have been performed at the same time using the same machine.
[0239] In another embodiment, the identification of tumor can be by an ultrasound, which is an imaging test that uses high-frequency sound waves to locate a tumor inside the body.
[0240] In more specific embodiments, companion diagnostics that can be used to help treat patients, as a form of personalized medicine, can be employed by identifying a patient having a Flt3 mutant that is encoded by a Flt3 gene having an ITD mutation. In another embodiment, the companion diagnostic that can be used to help treat patients, as a form of personalized medicine, can be employed by identifying a patient having an oncogenic Flt3 mutant that is encoded by a Flt3 gene having an ITD mutation and a drug resistant F691L mutation. In another embodiment, the companion diagnostic that can be used to help treat patients, as a form of personalized medicine, can be employed by identifying a patient having an oncogenic Flt3 mutant that is encoded by a Flt3 gene having n ITD mutation and a D835Y drug resistant mutation. In another embodiment, the companion diagnostic that can be used to help treat patients, as a form of personalized medicine, can be employed by identifying a patient having an oncogenic Flt3 mutant that is encoded by a Flt3 gene having an ITD mutation, a drug resistant F691L mutation, and a D835Y drug resistant mutation.
XI. Manipulation of FLT3
[0241] Techniques for the manipulation of nucleic acids, such as, e.g., subcloning, labeling probes (e.g. random-primer labeling using Klenow polymerase, nick translation, amplification), sequencing, hybridization and the like are well described in the scientific and patent literature, see, e.g., Sambrook, ed., Molecular Cloning: a Laboratory Manual (2nd ed ), Vols. 1-3, Cold Spring Harbor Laboratory, (1989); Current Protocols in Molecular Biology, Ausubel, ed. John Wiley & Sons, Inc., New York (1997), Laboratory Techniques in Biochemistry and Molecular Biology: Hybridization With Nucleic Acid Probes, Part I. Theory and Nucleic Acid Preparation, Tijssen, ed. Elsevier, N.Y. (1993).
[0242] Nucleic acid sequences can be amplified as necessary for further use using amplification methods, such as PCR, isothermal methods, rolling circle methods, etc., are well known to the skilled artisan. See, e.g., Saiki, "Amplification of Genomic DNA" in PCR
Protocols, Innis et al., Eds., Academic Press, San Diego, CA 1990, pp 13-20; Wharam et al., Nucleic Acids Res. 2001 Jun 1;29(11):E54-E54; Hafner et al., Biotechniques 2001
Apr;30(4): 852-6, 858, 860 passim; Zhong et al, Biotechniques 2001 Apr;30(4):852-6, 858, 860 passim.
[0243] Nucleic acids, vectors, capsids, polypeptides, and the like can be analyzed and quantified by any of a number of general means well known to those of skill in the art. These include, e.g., analytical biochemical methods such as NMR, spectrophotometry, radiography, electrophoresis, capillary electrophoresis, high performance liquid chromatography (HPLC), thin layer chromatography (TLC), and hyperdiffusion chromatography, various immunological
methods, e.g. fluid or gel precipitin reactions, immunodiffusion, immuno-electrophoresis, radioimmunoassays (RIAs), enzyme-linked immunosorbent assays (ELISAs), immuno- fluorescent assays, Southern analysis, Northern analysis, dot-blot analysis, gel electrophoresis (e.g. SDS-PAGE), nucleic acid or target or signal amplification methods, radiolabeling, scintillation counting, and affinity chromatography.
[0244] Obtaining and manipulating nucleic acids used to practice the methods of the disclosure can be performed by cloning from genomic samples, and, if desired, screening and re- cloning inserts isolated or amplified from, e g , genomic clones or cDNA clones. Sources of nucleic acid used in the methods of the present disclosure include genomic or cDNA libraries contained in, e.g., mammalian artificial chromosomes (MACs), see, e.g., U. S. Patent Nos. 5,721, 1 18; 6,025, 155; human artificial chromosomes, see, e.g., Rosenfeld (1997) Nat. Genet. 15 :333-335; yeast artificial chromosomes (YAC); bacterial artificial chromosomes (BAC); PI artificial chromosomes, see, e.g., Woon (1998) Genomics 50:306-316; Pl-derived vectors (PACs), see, e.g., Kern (1997) Biotechniques 23 : 120-124; cosmids, recombinant viruses, phages or plasmids.
[0245] The nucleic acids used to practice the methods of the present disclosure can be operatively linked to a promoter. A promoter can be one motif or an array of nucleic acid control sequences which direct transcription of a nucleic acid. A promoter can include necessary nucleic acid sequences near the start site of transcription, such as, in the case of a polymerase II type promoter, a TATA element A promoter also optionally includes distal enhancer or repressor elements which can be located as much as several thousand base pairs from the start site of transcription. A "constitutive" promoter is a promoter which is active under most environmental and developmental conditions. An "inducible" promoter is a promoter which is under environmental or developmental regulation. A "tissue specific" promoter is active in certain tissue types of an organism, but not in other tissue types from the same organism. The term "operably linked" refers to a functional linkage between a nucleic acid expression control sequence (such as a promoter, or array of transcription factor binding sites) and a second nucleic acid sequence, wherein the expression control sequence directs transcription of the nucleic acid corresponding to the second sequence.
[0246] The nucleic acids used to practice the methods of the present disclosure can also be provided in expression vectors and cloning vehicles, e.g., sequences encoding the polypeptides used to practice the methods of the present disclosure. Expression vectors and cloning vehicles used to practice the methods of the present disclosure can comprise viral particles, baculovirus, phage, plasmids, phagemids, cosmids, fosmids, bacterial artificial chromosomes, viral DNA
(e.g. vaccinia, adenovirus, foul pox virus, pseudorabies and derivatives of SV40), PI -based artificial chromosomes, yeast plasmids, yeast artificial chromosomes, and any other vectors specific for specific hosts of interest (such as bacillus, Aspergillus and yeast). Vectors used to practice the methods of the present disclosure can include chromosomal, non-chromosomal and synthetic DNA sequences. Large numbers of suitable vectors are known to those of skill in the art, and are commercially available.
[0247] The nucleic acids used to practice the methods of the present disclosure can be cloned, if desired, into any of a variety of vectors using routine molecular biological methods; methods for cloning in vitro amplified nucleic acids are described, e.g. , U.S. Pat. No. 5,426,039. To facilitate cloning of amplified sequences, restriction enzyme sites can be "built into" a PCR primer pair. Vectors may be introduced into a genome or into the cytoplasm or a nucleus of a cell and expressed by a variety of conventional techniques, well described in the scientific and patent literature. See, e.g., Roberts (1987) Nature 328:731; Schneider (1995) Protein Expr. Purif. 6435: 10; Sambrook, Tijssen or Ausubel. The vectors can be isolated from natural sources, obtained from such sources as ATCC or GenBank libraries, or prepared by synthetic or recombinant methods. For example, the nucleic acids used to practice the methods of the present disclosure can be expressed in expression cassettes, vectors or viruses which are stably or transiently expressed in cells (e.g. episomal expression systems). Selection markers can be incorporated into expression cassettes and vectors to confer a selectable phenotype on transformed cells and sequences. For example, selection markers can code for episomal maintenance and replication such that integration into the host genome is not required.
[0248] In one aspect, the nucleic acids used to practice the methods of the present disclosure are administered in vivo for in situ expression of the peptides or polypeptides used to practice the methods of the disclosure. The nucleic acids can be administered as "naked DNA" (see, e.g., U. S. Patent No. 5,580,859) or in the form of an expression vector, e.g., a recombinant virus. The nucleic acids can be administered by any route, including peri- or intra-tumorally, as described below. Vectors administered in vivo can be derived from viral genomes, including recombinantly modified enveloped or non-enveloped DNA and RNA viruses, selected from baculoviridiae, parvoviridiae, picornoviridiae, herpesveridiae, poxviridae, adenoviridiae, or picornnaviridiae. Chimeric vectors may also be employed which exploit advantageous merits of each of the parent vector properties (See e.g., Feng (1997) Nature Biotechnology 15:866-870). Such viral genomes may be modified by recombinant DNA techniques to include the nucleic acids used to practice the methods of the present disclosure; and may be further engineered to be replication deficient, conditionally replicating or replication competent. In alternative aspects,
vectors are derived from the adenoviral (e.g. replication incompetent vectors derived from the human adenovirus genome, see, e.g., U.S. Patent os. 6,096,718; 6,110,458; 6,113,913;
5,631,236); adeno-associated viral and retroviral genomes. Retroviral vectors can include those based upon murine leukemia virus (MuLV), gibbon ape leukemia virus (GaLV), Simian Immuno deficiency virus (SIV), human immuno deficiency virus (HIV), and combinations thereof; see, e.g., U.S. Patent Nos. 6,117,681; 6,107,478; 5,658,775; 5,449,614; Buchscher (1992) J. Virol. 66:2731-2739; Johann (1992) J. Virol. 66: 1635-1640). Adeno-associated virus (AAV)-based vectors can be used to transduce cells with target nucleic acids, e.g., in the in vitro production of nucleic acids and peptides, and in in vivo and ex vivo gene therapy procedures, see, e.g., U. S. Patent Nos. 6, 1 10,456; 5,474,935; Okada (1996) Gens Ther. 3 :957-964.
[0249] The present disclosure also relates to use of fusion proteins, and nucleic acids encoding them. A polypeptide used to practice the methods of the present disclosure can be fused to a heterologous peptide or polypeptide, such as N-terminal identification peptides which impart desired characteristics, such as increased stability or simplified purification. Peptides and polypeptides used to practice the methods of the present disclosure can also be synthesized and expressed as fusion proteins with one or more additional domains linked thereto for, e.g., producing a more immunogenic peptide, to more readily isolate a recombinantly synthesized peptide, to identify and isolate antibodies and antibody-expressing B cells, and the like.
Detection and purification facilitating domains include, e.g., metal chelating peptides such as polyhistidine tracts and histidine-tryptophan modules that allow purification on immobilized metals, protein A domains that allow purification on immobilized immunoglobulin, and the domain utilized in the FLAGS extension/affinity purification system (Immunex Corp, Seattle WA). The inclusion of a cleavable linker sequences such as Factor Xa or enterokinase
(Invitrogen, San Diego CA) between a purification domain and the motif-comprising peptide or polypeptide to facilitate purification. For example, an expression vector can include an epitope- encoding nucleic acid sequence linked to six histidine residues followed by a thioredoxin and an enterokinase cleavage site (see e.g., Williams (1995) Biochemistry 34: 1787-1797; Dobeli (1998) Protein Expr. Purif. 12:404-414). The histidine residues facilitate detection and purification while the enterokinase cleavage site provides a means for purifying the epitope from the remainder of the fusion protein. In one aspect, a nucleic acid encoding a polypeptide used to practice the methods of the present disclosure is assembled in appropriate phase with a leader sequence capable of directing secretion of the translated polypeptide or fragment thereof.
Technology pertaining to vectors encoding fusion proteins and application of fusion proteins are well described in the scientific and patent literature, see e.g., Kroll (1993) DNA Cell. Biol. 12:441-53.
[0250] The nucleic acids and polypeptides used to practice the methods of the present disclosure can be bound to a solid support, e.g., for use in screening and diagnostic methods. Solid supports can include, e.g., membranes (e.g. nitrocellulose or nylon), a microtiter dish (e.g. PVC, polypropylene, or polystyrene), a test tube (glass or plastic), a dip stick (e.g. glass, PVC, polypropylene, polystyrene, latex and the like), a microfuge tube, or a glass, silica, plastic, metallic or polymer bead or other substrate such as paper. One solid support uses a metal (e.g. cobalt or nickel)-comprising column which binds with specificity to a histidine tag engineered onto a peptide.
[0251] Adhesion of molecules to a solid support can be direct (i.e., the molecule contacts the solid support) or indirect (a "linker" is bound to the support and the molecule of interest binds to this linker). Molecules can be immobilized either covalently (e.g. utilizing single reactive thiol groups of cysteine residues (see, e.g., Colliuod (1993) Bioconjugate Chem. 4:528-536) or non- covalently but specifically (e.g. via immobilized antibodies (see, e.g., Schuhmann (1991) Adv. Mater. 3 :388-391; Lu (1995) Anal. Chem. 67:83-87; the biotin/strepavidin system (see, e.g., Iwane (1997) Biophys. Biochem. Res. Comm. 230:76-80); metal chelating, e.g., Langmuir- Blodgett films (see, e.g., Ng (1995) Langmuir 11 :4048-55); metal-chelating self-assembled monolayers (see, e.g., Sigal (1996) Anal Chem. 68:490-497) for binding of polyhistidine fusions.
[0252] Indirect binding can be achieved using a variety of linkers which are commercially available. The reactive ends can be any of a variety of functionalities including, but not limited to: amino reacting ends such as N-hydroxysuccinimide (NHS) active esters, imidoesters, aldehydes, epoxides, sulfonyl halides, isocyanate, isothiocyanate, and nitroaryl halides; and thiol reacting ends such as pyridyl disulfides, maleimides, thiophthalimides, and active halogens. The heterobifunctional crosslinking reagents have two different reactive ends, e.g., an amino- reactive end and a thiol -reactive end, while homobifunctional reagents have two similar reactive ends, e.g., bismaleimidohexane (ΒΜΉ) which permits the cross-linking of sulfhydryl- containing compounds. The spacer can be of varying length and be aliphatic or aromatic.
Examples of commercially available homobifunctional cross-linking reagents include, but are not limited to, the imidoesters such as dimethyl adipimidate dihydrochloride (DMA); dimethyl pimelimidate dihydrochloride (DMP); and dimethyl suberimidate dihydrochloride (DMS). Heterobifunctional reagents include commercially available active halogen-NHS active esters coupling agents such as N-succinimidyl bromoacetate and N-succinimidyl (4- iodoacetyl)aminobenzoate (SIAB) and the sulfosuccinimidyl derivatives such as
sulfosuccinimidyl(4-iodoacetyl)aminobenzoate (sulfo-SIAB) (Pierce). Another group of
coupling agents is the heterobifunctional and thiol cleavable agents such as N-succinimidyl 3- (2-pyridyidithio)propionate (SPDP) (Pierce Chemicals, Rockford, IL).
[0253] Antibodies can also be used for binding polypeptides and peptides used to practice the methods of the present disclosure to a solid support. This can be done directly by binding peptide-specific antibodies to the column or it can be done by creating fusion protein chimeras comprising motif-containing peptides linked to, e.g., a known epitope (e.g. a tag (e.g. FLAG, myc) or an appropriate immunoglobulin constant domain sequence (an "immunoadhesin," see, e.g., Capon (1989) Nature 377:525-531 (1989).
[0254] Nucleic acids or polypeptides used to practice the methods of the present disclosure can be immobilized to or applied to an array. Arrays can be used to screen for or monitor libraries of compositions (e.g. small molecules, antibodies, nucleic acids, etc.) for their ability to bind to or modulate the activity of a nucleic acid or a polypeptide used to practice the methods of the present disclosure. For example, in one aspect of the disclosure, a monitored parameter is transcript expression of a gene comprising a nucleic acid used to practice the methods of the present disclosure. One or more, or all the transcripts of a cell can be measured by hybridization of a sample comprising transcripts of the cell, or nucleic acids representative of or
complementary to transcripts of a cell, by hybridization to immobilized nucleic acids on an array, or "biochip." By using an "array" of nucleic acids on a microchip, some or all of the transcripts of a cell can be simultaneously quantified. Alternatively, arrays comprising genomic nucleic acid can also be used to determine the genotype of a newly engineered strain made by the methods of the present disclosure. Polypeptide arrays" can also be used to simultaneously quantify a plurality of proteins.
[0255] The terms "array" or "microarray" or "biochip" or "chip" as used herein is a plurality of target elements, each target element comprising a defined amount of one or more
polypeptides (including antibodies) or nucleic acids immobilized onto a defined area of a substrate surface. In practicing the methods of the present disclosure, any known array and/or method of making and using arrays can be incorporated in whole or in part, or variations thereof, as described, for example, in U.S. Patent Nos. 6,277,628; 6,277,489; 6,261,776; 6,258,606; 6,054,270; 6,048,695; 6,045,996; 6,022,963; 6,013,440; 5,965,452; 5,959,098; 5,856, 174;
5,830,645; 5,770,456; 5,632,957; 5,556,752; 5,143,854; 5,807,522; 5,800,992; 5,744,305;
5,700,637; 5,556,752; 5,434,049; see also, e.g., WO 99/51773; WO 99/09217; WO 97/46313; WO 96/17958; see also, e.g., Johnston (1998) Curr. Biol. 8:R171-R174; Schummer (1997) Biotechniques 23 : 1087-1092; Kern (1997) Biotechniques 23 : 120-124; Solinas-Toldo (1997) Genes, Chromosomes & Cancer 20:399-407; Bowtell (1999) Nature Genetics Supp. 21 :25-32.
See also published U.S. patent application Nos. 20010018642; 20010019827; 20010016322; 20010014449; 20010014448; 20010012537; 20010008765.
Host Cells and Transformed Cells
[0256] The present disclosure also provides a transformed cell comprising a nucleic acid sequence used to practice the methods of the present disclosure, e.g., a sequence encoding a polypeptide used to practice the methods of the present disclosure, or a vector used to practice the methods of the present disclosure. The host cell may be any of the host cells familiar to those skilled in the art, including prokaryotic cells, eukaryotic cells, such as bacterial cells, fungal cells, yeast cells, mammalian cells, insect cells, or plant cells. Exemplary bacterial cells include E. coll, Streptomyces, Bacillus subtilis, Salmonella typhimurium and various species within the genera Pseudomonas, Streptomyces, and Staphylococcus. Exemplary insect cells include Drosophila S2 and Spodoptera Sf9. Exemplary animal cells include CHO, COS or Bowes melanoma or any mouse or human cell line. The selection of an appropriate host is within the abilities of those skilled in the art.
[0257] Vectors may be introduced into the host cells using any of a variety of techniques, including transformation, transfection, transduction, viral infection, gene guns, or Ti-mediated gene transfer. Particular methods include calcium phosphate transfection, DEAE-Dextran mediated transfection, lipofection, or electroporation.
[0258] Engineered host cells can be cultured in conventional nutrient media modified as appropriate for activating promoters, selecting transformants or amplifying the genes used to practice the methods of the present disclosure Following transformation of a suitable host strain and growth of the host strain to an appropriate cell density, the selected promoter may be induced by appropriate means (e.g. temperature shift or chemical induction) and the cells may be cultured for an additional period to allow them to produce the desired polypeptide or fragment thereof.
[0259] Cells can be harvested by centrifugation, disrupted by physical or chemical means, and the resulting crude extract is retained for further purification. Microbial cells employed for expression of proteins can be disrupted by any convenient method, including freeze-thaw cycling, sonication, mechanical disruption, or use of cell lysing agents. Such methods are well known to those skilled in the art. The expressed polypeptide or fragment can be recovered and purified from recombinant cell cultures by methods including ammonium sulfate or ethanol precipitation, acid extraction, anion or cation exchange chromatography, phosphocellulose chromatography, hydrophobic interaction chromatography, affinity chromatography,
hydroxylapatite chromatography and lectin chromatography. Protein refolding steps can be used, as necessary, in completing configuration of the polypeptide. If desired, high performance liquid chromatography (HPLC) can be employed for final purification steps.
[0260] Various mammalian cell culture systems can also be employed to express recombinant protein. Examples of mammalian expression systems include the COS-7 lines of monkey kidney fibroblasts and other cell lines capable of expressing proteins from a compatible vector, such as the CI 27, 3T3, CHO, HeLa and BHK cell lines.
[0261] The constructs in host cells can be used in a conventional manner to produce the gene product encoded by the recombinant sequence. Depending upon the host employed in a recombinant production procedure, the polypeptides produced by host cells containing the vector may be glycosylated or may be non-glycosylated. Polypeptides used to practice the methods of the present disclosure may or may not also include an initial methionine amino acid residue.
[0262] Cell-free translation systems can also be employed to produce a polypeptide used to practice the methods of the present disclosure. Cell-free translation systems can use mRNAs transcribed from a DNA construct comprising a promoter operably linked to a nucleic acid encoding the polypeptide or fragment thereof. In some aspects, the DNA construct may be linearized prior to conducting an in vitro transcription reaction. The transcribed mRNA is then incubated with an appropriate cell-free translation extract, such as a rabbit reticulocyte extract, to produce the desired polypeptide or fragment thereof.
[0263] The expression vectors can contain one or more selectable marker genes to provide a phenotypic trait for selection of transformed host cells such as dihydrofolate reductase or neomycin resistance for eukaryotic cell culture, or such as tetracycline or ampicillin resistance in E. coli.
[0264] For transient expression in mammalian cells, cDNA encoding a polypeptide of interest may be incorporated into a mammalian expression vector, e.g. pcDNAl, which is available commercially from Invitrogen Corporation (San Diego, Calif, U.S.A.; catalogue number V490- 20). This is a multifunctional 4.2 kb plasmid vector designed for cDNA expression in eukaryotic systems, and cDNA analysis in prokaryotes, incorporated on the vector are the CMV promoter and enhancer, splice segment and polyadenylation signal, an SV40 and Polyoma virus origin of replication, and Ml 3 origin to rescue single strand DNA for sequencing and mutagenesis, Sp6 and T7 RNA promoters for the production of sense and anti-sense RNA
transcripts and a Col El-like high copy plasmid origin. A polylinker is located appropriately downstream of the CMV promoter (and 3' of the T7 promoter).
[0265] The cDNA insert may be first released from the above phagemid incorporated at appropriate restriction sites in the pcDNAI polylinker. Sequencing across the junctions may be performed to confirm proper insert orientation in pcDNAI. The resulting plasmid may then be introduced for transient expression into a selected mammalian cell host, for example, the monkey-derived, fibroblast like cells of the COS-1 lineage (available from the American Type Culture Collection, ockville, Md. as ATCC CRL 1650).
[0266] For transient expression of the protein-encoding DNA, for example, COS-1 cells may be transfected with approximately 8 μg DNA per 106 COS cells, by DEAE-mediated DNA transfection and treated with chloroquine according to the procedures described by Sambrook et al, Molecular Cloning: A Laboratory Manual, 1989, Cold Spring Harbor Laboratory Press, Cold Spring Harbor N.Y, pp. 16 30-16.37. An exemplary method is as follows. Briefly, COS-1 cells are plated at a density of 5 x 106 cells/dish and then grown for 24 hours in FBS-supplemented DMEM F12 medium. Medium is then removed and cells are washed in PBS and then in medium. A transfection solution containing DEAE dextran (0.4 mg/mL), 100 uM chloroquine, 10% NuSerum, DNA (0.4 mg/mL) in DMEM/F12 medium is then applied on the cells 10 mL volume. After incubation for 3 hours at 37 °C, cells are washed in PBS and medium as just described and then shocked for 1 minute with 10% DMSO in DMEM F12 medium. Cells are allowed to grow for 2-3 days in 10% FBS-supplemented medium, and at the end of incubation dishes are placed on ice, washed with ice cold PBS and then removed by scraping. Cells are then harvested by centrifugation at 1000 rpm for 10 minutes and the cellular pellet is frozen in liquid nitrogen, for subsequent use in protein expression. Northern blot analysis of a thawed aliquot of frozen cells may be used to confirm expression of receptor-encoding cDNA in cells under storage.
[0267] In a like manner, stably transfected cell lines can also prepared, for example, using two different cell types as host: CHO Kl and CHO Pro5. To construct these cell lines, cDNA coding for the relevant protein may be incorporated into the mammalian expression vector pRC/CMV (Invitrogen), which enables stable expression. Insertion at this site places the cDNA under the expression control of the cytomegalovirus promoter and upstream of the polyadenylation site and terminator of the bovine growth hormone gene, and into a vector background comprising the neomycin resistance gene (driven by the SV40 early promoter) as selectable marker.
[0268] An exemplary protocol to introduce plasmids constructed as described above is as follows. The host CHO cells are first seeded at a density of 5xl05 in 10% FBS-supplemented
MEM medium. After growth for 24 hours, fresh medium is added to the plates and three hours later, the cells are transfected using the calcium phosphate-DNA co-precipitation procedure (Sambrook et al, supra). Briefly, 3 μg of DNA is mixed and incubated with buffered calcium solution for 10 minutes at room temperature. An equal volume of buffered phosphate solution is added and the suspension is incubated for 15 minutes at room temperature. Next, the incubated suspension is applied to the cells for 4 hours, removed and cells were shocked with medium containing 15% glycerol. Three minutes later, cells are washed with medium and incubated for 24 hours at normal growth conditions. Cells resistant to neomycin are selected in 10% FBS- supplemented alpha-MEM medium containing G418 (1 mg/mL). Individual colonies of G418- resistant cells are isolated about 2-3 weeks later, clonally selected and then propagated for assay purposes.
EXAMPLES
[0269] The examples below depict the general synthetic procedure for the compounds described herein. Synthesis of the compounds described herein is not limited by these examples and schemes. One skilled in the art will know that other procedures can be used to synthesize the compounds described herein, and that the procedures described in the examples and schemes is only one such procedure. In the descriptions below, one of ordinary skill in the art would recognize that specific reaction conditions, added reagents, solvents, and reaction temperatures can be modified for the synthesis of specific compounds that fall within the scope of this disclosure. Unless otherwise specified, intermediate compounds in the examples below, that do not contain a description of how they are made, are either commercially available to one skilled in the art, or can otherwise be synthesized by the skilled artisan using commercially available precursor molecules and synthetic methods known in the art.
[0270] Unless otherwise specified, intermediate compounds in the examples below, that do not contain a description of how they are made, are either commercially available to one skilled in the art, or can otherwise be synthesized by the skilled artisan using knowledge and techniques known in the art. In most cases, alternative techniques can be used. The examples are intended to be illustrative and are not limiting or restrictive to the scope of the disclosure.
[0271] Starting materials in the synthesis examples provided herein are either available from commercial sources or via literature procedures (e.g. , March Advanced Organic Chemistry: Reactions, Mechanisms, and Structure, (1992) 4th Ed.; Wiley Interscience, New York). All commercially available compounds were used without further purification unless otherwise indicated. NMR spectra are reported according to the significant peaks observed, and typically include multiplicity (s, singlet; d, double; t, triplet; q, quartet; m, multiplet; br s, broad singlet)
and number of protons and may also include coupling constants for certain multiplets. Chemical shifts are reported as parts per million (δ) relative to tetramethylsilane. Low resolution mass spectra (MS) were obtained as electrospray ionization (ESI) mass spectra, which were recorded on a Shimadzu HPLC/MS instrument using reverse-phase conditions (acetonitrile/water, 0.05% HCO2H or 0.05% AcOH). Preparative reverse phase HPLC was typically performed using a Varian HPLC system equipped with a Phenomenex phenylhexyl, a Phenomenex Luna CI 8, or a Varian Pursuit diphenyl reverse phase column. Typical elution conditions utilized a gradient containing an increasing composition of organic cosolvent (0.05% ACOH/CH3CN, 0.05% AcOH/MeOH, 0.05% HC02H/CH3CN, or 0.05% HC02H/MeOH) to aqueous cosolvent (0.05% aq AcOH or 0.05% aq HC02H). Silica gel chromatography was either performed manually using methodology analogous to the published procedure for flash chromatography (Still et al. (1978) J. Org. Chem. 43 :2923), or on an automated system (for example, Biotage SP instrument) using pre-packed silica gel columns.
[0272] It is understood that in the following description, combinations of substituents and/or variables of the depicted formulae are permissible only if such contributions result in stable compounds under standard conditions.
[0273] It will also be appreciated by those skilled in the art that in the process described below, the functional groups of intermediate compounds may need to be protected by suitable protecting groups. Such functional groups include hydroxy, amino, mercapto and carboxylic acid. Suitable protecting groups for hydroxy include trialkylsilyl or diarylalkylsilyl {e.g., t- butyldimethylsilyl, ί-butyldiphenylsilyl or trimethylsilyl), tetrahydropyranyl, benzyl, and the like. Suitable protecting groups for amino, amidino and guanidino include ?-butoxycarbonyl, benzyloxycarbonyl, and the like. Suitable protecting groups for mercapto include -C(0)-R (where R is alkyl, aryl or aralkyl), /?-methoxybenzyl, trityl and the like. Suitable protecting groups for carboxylic acid include alkyl, aryl or aralkyl esters.
[0274] Protecting groups may be added or removed in accordance with standard techniques, which are well-known to those skilled in the art and as described herein. The use of protecting groups is described in detail in Green, T.W. and P.G.M. Wutz, Protective Groups in Organic Synthesis (1991), 2nd Ed., Wiley-Interscience.
[0275] One of ordinary skill in the art could readily ascertain which choices of protecting group are possible for the reaction conditions of each Scheme. Moreover, the substituents are selected from components as indicated in the specification heretofore, and may be attached to starting materials, intermediates, and/or final products according to schemes known to those of ordinary skill in the art.
[0276] Also it will be apparent that the compounds provided herein could exist as one or more isomers, that is, E/Z isomers, enantiomers and/or diastereomers.
[0277] Compounds of Formula (I) may be generally prepared as depicted in the following schemes, and unless otherwise noted, the various substituents are as defined elsewhere herein.
General Synthetic Schemes
[0278] In an illustrative method, the biaryl acetamide compounds of Formula I may be routinely prepared according to the synthetic route outlined in Scheme 1, wherein the variables G and W are leaving groups, which can include but are not limited to halo or sulfonate groups and the remaining variables are as defined for compounds of Formula I. The halogen/sulfonate- substituted compounds 1 can participate in Suzuki couplings with 4,4,4',4',5,5,5',5'-octamethyl- 2,2'-bi(l,3,2-dioxaborolane) in a reaction promoted by a catalyst such as, but not limited to, tetrakis(triphenylphosphine)palladium or [1, 1 - bis(diphenylphosphino)ferrocene]dichloropalladium(II), and promoted by a base such as, but not limited to, KOAc or NaOAc, in a solvent such as, but not limited to, DMF or 1,4-dioxane to give the aryl acetic acid boronic ester derivatives 2. The optionally substituted aryl or heteroaryl amines 3 can be condensed with the dioxaborolane-substituted phenylacetic acids 2 using an amide coupling reagent such as, but not limited to, T3P, EDCI or HATU, to give the phenyl acetamide derivatives 4. The condensation can be conducted in a solvent such as, but not limited to, EtOAc, THF or DMF, and is promoted with a base such as, but not limited to, pyridine, DIEA or DMAP, and by heating as necessary at an elevated temperature. The resulting boronic esters 4 can then be coupled with halogen/sulfonate-substituted azines 5 using a Pd- catalyzed Suzuki coupling protocol to give the biaryl acetamide derivatives 6a. The coupling reaction can be promoted with a catalyst such as, but not limited to, Pd(PPh3)4 or Pd(dppf)Cl2, can be conducted in a solvent such as, but not limited to, CH3CN or 1,4-dioxane, and can be promoted with a base such as, but not limited to, aq Na2CC>3 or CsF, and by heating as necessary at an elevated temperature either with an oil bath or in a microwave reactor. Biaryl acetamide derivatives 6a can also be converted to the corresponding biaryl thioamide derivatives 6b in the presence of a thionating reagent, including but not limited to Lawesson's reagent. In certain cases, R2 may contain protecting groups such as, but not limited to, Boc group for amines, or acyl or silyl groups for alcohol. When present, these protecting groups can be removed using standard deprotecting procedures such as, but not limited to, TFA/DCM for removing the Boc group, NaOH in MeOH for removing acyl groups, or TBAF in THF for the removal of sily protecting groups.
[0279] In an illustrative method, the biaryl acetamide and biaryl thioamide compounds of Formula I may be routinely prepared according to the synthetic route outlined in Scheme 2, wherein the variables G and W are leaving groups, which can include but are not limited to halo or sulfonate groups and the remaining variables are as defined for compounds of Formula I Phenylacetic acids 1 can be converted to the corresponding acid chlorides 7 using a reagent such as, but not limited to, SOCI2 or (COCl)2. The reaction can be conducted in a solvent such as, but not limited to, DCM or benzene, and promoted with a catalyst such as, but not limited to, DMF or DMA, and by heating as necessary at an elevated temperature. The optionally substituted aryl or heteroaryl amines 3 can be condensed with phenylacetyl chlorides 7 to afford phenyl acetamides 8 in the presence of a base such as, but not limited to, pyridine, lutidine, or DEEA. The reaction can be conducted in a solvent such as, but not limited to, DCM, THF, or C¾CN and promoted with a catalyst such as, but not limited to, DMAP, and by heating as necessary at elevated temperatures. Meanwhile, halogen/sulfonate-substituted azines 5 can be converted to boronic ester derivatives 9 using a Pd-catalyzed Suzuki coupling protocol as described in Scheme 1. Subsequent coupling between acetamides 8 and boronic esters 9 using a Pd-catalyzed
Suzuki coupling protocol as described in Scheme 1 affords biaryl acetamides 6a and thionation of biaryl acetamides 6a as described in Scheme 1 affords biaryl thioamides 6b.
Scheme 2: General synthesis of biaryl acetamides and biaryl thioamides.
[0280] In an illustrative method, halogen-substituted azine derivatives 5 may be routinely prepared according to the synthetic routes outlined in Scheme 3, wherein Z is halo, and the remainder of the variables are as delineated for compounds of Formula I. The halo substituted azines 10 could undergo nucleophilic substitution with aryl or heteroaryl amines 11 to give azines 5. The reaction can be conducted in solvents such as, but not limited to, DMSO or DMF, promoted with base such as, but not limited to, DIEA or NaH or NaiCC , and can be promoted by heating at elevated temperatures using an oil bath or in a microwave reactor. Alternatively, the nucleophilic substitution could be promoted with acid such as, but not limited to, HC1 or TFA, in solvent such as, but not limited to, z'-PrOH or 1,4-dioxane, with heating. Additionaly, halo substituted azine derivatives 12 could be coupled with aryl or heteroaryl amines 11 using Buchwald-Hartwig coupling conditions to give azine derivatives 13. The coupling reaction can
be catalyzed with catalysts such as, but not limited to, Pd(OAc)2 or Pd2(dba)3, promoted by ligands such as, but not limited to, 2-(di-t-butylphosphino)biphenyl, 2-diphenylphosphino-2'- (N,N-dimethylamino)biphenyl, or 4,5-Bis(diphenylphosphino)-9,9-dimethylxanthene. The coupling reaction can be conducted in solvents such as, but not limited to, toluene or 1,4- dioxane, promoted with bases such as, but not limited to, K3PO4 or sodium feri-butoxide, and by heating as necessary at elevated temperatures. The azine derivatives 13 can be halogenated using appropriate halogenation reagents such as, but not limited to, N-chlorosuccinimide, N- bromosuccinimide, or N-iodosuccinimide, to afford 5-halogen substituted-azine-2-amine derivatives 5. Subsequently, the biaryl acetamide or biaryl thioamide compounds 6 can be realized by coupling azine derivatives 5 with the boronate esters 4 using a Pd-catalyzed Suzuki coupling protocol, as detailed in Scheme 1.
Scheme 3: General synthesis of Azine Derivatives 5.
I halogenation
[0281] In an illustrative method, the biaryl acetamide compounds of Formula I may be routinely prepared according to the synthetic route outlined in Scheme 4, wherein R can be groups including but not limited to alkyl or aryl, Z is halo, and the remainder of the variables are as delineated for compounds of Formula I. Carboxylic acid 14 could undergo Curtis rearrangement in the presence of alcohols such as, but not limited to, t-BuOH or benzyl alcohol, to give carbamates 15. The reaction could be carried out using reagents such as, but not limited to, diphenyl phosphorus azide, promoted with bases such as, but not limited to, DEEA or Et3N, and by heating at elevated temperatures using an oil bath or in a microwave reactor. When the resulting carbamates 15 were t-butyl carbamates, the protecting group could be removed with acid such as, but not limited to, TFA or HC1, in solvent such as, but not limited to, DCM or EtOAc to afford aryl or heteroaryl amines 16. When the resulting carbamates 15 were benzyl
carbamates, deprotection was realized under a hydrogen atmosphere with Pd on carbon as catalyst and using solvent such as, but not limited to, MeOH or EtOAc to provide aryl or heteroaryl amines 16. Nucleophilic substitution with azines 10 as described in Scheme 3 provided amino azine derivatives 17, which could be converted to the biaryl acetamides 20 using a Suzuki coupling protocol as described in Scheme 1. Alternatively, it can be advantageous to retain the carbamate group of 15 for the nucleophilic substitution with azines 10 to yield azines 18, which could be coupled with boronate esters 4 to give compounds 19. The carbamate groups can be removed as described earlier in this scheme to generate biaryl acetamides 20.
Scheme 4: General synthesis of biaryl acetamides.
[0282] In an illustrative method, the biaryl acetamide compounds of Formula I may be routinely prepared according to the synthetic route outlined in Scheme 5, wherein Z is halo, and the remainder of the variables are as delineated for compounds of Formula I. It can be advantageous to protect the azine derivatives 17 (prepared as described in Scheme 4) with a protecting group (PG) such as, but not limited to, SEM, Boc, or THP, to give corresponding
protected azines 21. The protect ion reaction may be carried out using reagents such as SEM-Cl in the presence of a base such as, but not limited to, sodium hydride; B0C2O in the presence of a base such as, but not limited to, TEA; DHP in the presence of an acid such as, but not limited to, p-toluenesulfonic acid; in a solvent such as, but not limited to, DMF or THF. Subsequent Suzuki coupling of 21 with boronate esters 4 as described in Scheme 1 provides compounds 22. The protecting group may be removed using acid such as, but not limited to, TFA or HC1, with or without a solvent such as, but not limited to, DCM or 1,4-dioxane, to afford the biaryl acetamides 20.
[0283] In an illustrative method, the biaryl acetamide compounds of Formula I may be routinely prepared according to the synthetic route outlined in Scheme 6, wherein the variable G is a leaving group, which can include but are not limited to halo or sulfonate groups and the remaining variables are as defined for compounds of Formula I. The aryl acetic acid boronic ester derivatives 2 (from Scheme 1) could be coupled with halogen/sulfonate-substituted azines 5 using a Pd-catalyzed Suzuki coupling protocol as described in Scheme 1 to give the biaryl derivatives 23. Subsequent condensation of biaryl derivatives 23 with the optionally substituted aryl or heteroaryl amines 3 using an amide coupling reagent as described in Scheme 1 provides the biaryl acetamides 6a, which can undergo thionation as described in Scheme 1 to provide biaryl thioamides 6b.
Scheme 6: General synthesis of biaryl acetamides and biaryl thioamides.
6a 6b
[0284] In an illustrative method, the aminopyrazole-containing biaryl acetamide compounds of formula (I) may be routinely prepared according to the synthetic route outlined in Scheme 7, wherein EWG refers to an electron withdrawing group, W is a leaving group (which can include but is not limited to halo or sulfonate groups), Z is halo, and the remainder of the variables are as delineated for compounds of Formula I. The nitropyrazoles 24 could be alkylated with halides/sulfonates, epoxides, or carbene insertion to give regioisomers 25a and 25b. The reaction could be promoted with base such as, but not limited to, K2C03 or DIEA or NaH, in solvent such as, but not limited to, DMF or CH3CN, with heating if necessary. Alternatively, the nitropyrazoles 24 could also be alkylated using a Michael addition protocol to give 25a and 25b. The reaction could be promoted with base such as, but not limited to, K2CO3 or DIEA, in a solvent such as, but not limited to, DMF or CH3CN, with heating if necessary. Alternatively, the nitropyrazoles 24 could also be alkylated using a Mitsunobu reaction protocol to give 25a and 25b. The reaction is carried out using reagents such as, but not limited to, diisopropyl azodicarboxylate (DIAD) and triphenylphosphine, in a solvent such as, but not limited to, THF or DCM. The alkylated nitropyrazoles 25 could be reduced under hydrogenation conditions using catalyst such as, but not limited to, Pd on carbon, in solvent such as, but not limited to, MeOH or EtOAc to give aminopyrazoles 26. The reaction can be done using a hydrogen balloon or high-pressure hydrogen in a Parr shaker, promoted with heating if necessary. Nucleophilic substitution of 26 with azines 10 as described in Scheme 3 provided amino azine derivatives 27. The regioisomers of 27 could be separated to their regiochemically pure forms using standard silica gel flash column chromatography or preparative HPLC using a chiral column. The azines 27 could be converted to the aminopyrazole-containing biaryl acetamides 28a and 28b using a
Suzuki coupling protocol as described in Scheme 1, and biaryl acetamides 28a and 28b can undergo thionation as described in Scheme 1 to provide biaryl thioamides 28c and 28d.
Scheme 7: General synthesis of aminopyrazole-containing biaryl acetamides and biaryl thioamides.
[0285] In an illustrative method, the aminoimidazole-containing biaryl acetamide compounds of Formula I may be routinely prepared according to the synthetic routes outlined in Scheme 8,
wherein Z is halo, and the remaining variables are as delineated for compounds of Formula I. The 1, 2, 5-substituted imidazoles 31 substituted may be prepared as described in Eicher and Hauptmann, "The Chemistry of Heterocycles" (2003), Chapter 5, for example by condensation of appropriately substituted amino aldehydes 29 and amides 30. Imidazoles 31 can then be subjected to known aromatic nitration conditions such as, but not limited to, HNO3 H2SO4, to afford nitroimidazoles 32. Nitro imidazoles 32 are then converted to biaryl acetamides 35a by procedures analogous to those used in Scheme 7 for conversion of 25 to 28, whereby the stability of intermediate aminoimidazoles may be enhanced by use of protonating conditions or amino protecting groups where applicable. Similarly, biaryl acetamides 42a are prepared from alternatively substituted amino aldehydes 36 and amides 37 Biarcyl thioamides 35b and 42b can be prepared as described in Scheme 1 from biaryl acetamdies 35a and 42b, respectively.
Scheme 8: General synthesis of aminoimidazole-containing biaryl acetamides and biaryl thioamides.
Example 1
Preparation of 2-(2-fluoro-4-(2-((l-methyl-lH-pyrazol-4-yl)amino)pyrimidin-5-yl)phenyl)- N-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide (P-238)
[0286] Step 1: To a mixture of 2-(4-bromo-2-fluorophenyl)acetic acid (5.0 g, 21.5 mmol), 4,4,4' ,4',5,5,5',5'-octamethyl-2,2'-bi(l,3,2-dioxaborolane) (6.54 g, 25.6 mmol), and potassium acetate (8.4 g, 85.6 mmol) in a pressure tube was added DMF (50 mL). The mixture was flushed thoroughly with argon while [l,l '-bis(diphenylphosphino)ferrocene] dichloropalladium(II) dichloromethane complex (880 mg, 1.08 mmol) was added. The mixture was then capped and heated at 90 °C overnight. After cooling to rt, the mixture was diluted with water (50 mL), and the pH was adjusted to about 5 with 3N HCl. The resulting mixture was extracted with EtOAc (2 x 75 mL). The combined organic layers were washed with brine, dried over MgSC>4, and concentrated under reduced pressure. The residue was purified by silica gel flash column chromatography, eluting with 0-35% EtOAc in hexanes to give 2-(2-fluoro-4-(4,4,5,5- tetramethyl-l,3,2-dioxaborolan-2-yl)phenyl)acetic acid (5.7 g, 95%) as an off-white solid. lH MR (300 MHz, DMSO-afe) δ 12.49 (br s, 1H), 7.41 - 7.48 (m, 1H), 7.38 (d, J= 7.2 Hz, 1H), 7.32 (d, J= 10.4 Hz, 1H), 3.66 (s, 2H), 1.30 (s, 12H). LC-MS (ESI) m/z 279 (M-H)".
Step 2:
[0287] Step 2: To a stirred solution of 5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3-amine (4.0 g, 20.8 mmol), 2-(2-fluoro-4-(4,4,5,5-tetramethyl-l,3,2-dioxaborolan-2-yl)phenyl)acetic acid (6.4 g, 22.8 mmol), and pyridine (5.1 mL, 63.1 mmol) in EtOAc (10 mL) at 0 °C was added T3P (50% in EtOAc, 24.8 mL, 42.1 mmol) slowly over 20 min. The resulting mixture was then stirred at rt for 1 h, heated at 60 °C for 3 h, then stirred at rt overnight. The reaction mixture was partitioned between EtOAc (50 mL) and saturated aq. NH4CI (25 mL). The organic layer was washed with brine, dried over a2S04, and evaporated under reduced pressure. The solid residue was triturated with hexanes (along with a small amount of Et20) assisted with sonication. The resulting solid was collected via filtration and air-dried to give 2-(2-fluoro-4-(4,4,5,5- tetramethyl-l,3,2-dioxaborolan-2-yl)phenyl)-N-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3- yl)acetamide (9.24 g, 98%) as a tan solid. ^ MVIR (300 MHz, DMSO-t¾) δ 8.40 (br s, 1H), 7.59 (d, J= 7.5 Hz, 1H), 7.53 (d, J= 10.0 Hz, 1H), 7.33 (t, J= 7.3 Hz, 1H), 7.04 (s, 1H), 3.80 (s, 2H), 1.47 (d, J= 4.3 Hz, 2H), 1.40 (br s, 2H), 1.34 (s, 12H). LC-MS (ESI) m/z 455 (M +H)+.
Step 3:
[0288] Step 3: A mixture of l,3-dimethyl-lH-pyrazol-4-amine (453 mg, 4.66 mmol), 5- bromo-2-fluoropyrimidine (750 mg, 4.24 mmol) and DIEA (1.62 mL, 21.8 mmol) in DMSO (5 mL) was heated with at 120 °C for 2 h. The resulting mixture was cooled to rt and quenched with water. The yellow solid was collected via filtration, washed with water, and dried in vacuum oven to give 5-bromo-N-(l,3-dimethyl-lH-pyrazol-4-yl)pyrimidin-2-amine (1.08 g, 99%). LC-MS (ESI) m/z 268, 270 (M+H)+.
[0289] Step 4: To a pressure vessel were added 2-(2-fluoro-4-(4 ,4,5, 5-tetramethyl- 1,3,2- dioxaborolan-2-yl)phenyl)-N-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide (358 mg, 0.79 mmol), 5-bromo-N-(l,3-dimethyl-lH-pyrazol-4-yl)pyrimidin-2-amine (200 mg, 0.79 mmol), 2M Na2C03 (1.18 mL, 2.36 mmol), Pd(dppf)Cl2-CH2Cl2 (64 mg, 0.079 mmol), and CH3CN (3 mL). Argon was bubbled through the stirred solution for 10 min before the vessel was sealed and heated in an oil bath at 90 °C for 3 h. After cooling to rt, the mixture was diluted with MeOH and DMSO and purified by reverse phase preparative HPLC using a mixture of water (5%, CH3CN, 0.05% HCOOH) and C¾CN (0.05% HCOOH) as the mobile phase and Varian Pursuit XRs C-18 column as the stationary phase to afford 2-(2-fluoro-4-(2-((l-methyl- lH-pyrazol-4-yl)amino)pyrimidin-5-yl)phenyl)-]Sf-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol- 3-yl)acetamide (101 mg, 25%) as a white powder. ¾ NMR (500 MHz, DMSO-C&) δ 1 1.39 (s, 1H), 9.63 (s, 1H), 8.79 (s, 2H), 7.92 (s, 1H), 7.56 (d, J = 11.5 Hz, 1H), 7.47-7.53 (m, 2H), 7.37 - 7.46 (m, 1H), 6.92 (s, 1H), 3.81 (s, 3H), 3.81 (br s, 2H), 1.41-1.56 (m, 4H). LC-MS (ESI) m/z 502 (M+H)+.
Example 2
Preparation of 2-(2-Fluoro-4-(2-(phenylamino)pyrimidin-5-yl)phenyl)-N-(5-(l- (trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetaniide (P-239)
[0290] Step 1: To a solution of 5-bromo-2-chloropyrimidine (2.3 g, 11.9 mmol) and aniline (1.5 mL, 16.1 mmol) in n-BuOH (20 mL) was added DIEA (2 mL, 12 8 mmol). The mixture was stirred at 110-120 °C overnight, then cooled to rt and concentrated to dryness to afford 5- bromo-N-phenylpyrimidin-2-amine as a brown solid (2.0 g, 70%).
Step 2:
[0291] Step 2: To a mixture of 5-bromo-N-phenylpyrimidin-2-amine (230 mg, 0.71 mmol), 2-(2-fluoro-4-(4,4,5,5-tetramethyl-l,3,2-dioxaborolan-2-yl)phenyl)acetic acid (200 mg, 1.0 mmol) in acetonitrile (16 mL) and water (8 mL) were added PdCl2(dppf) dichloromethane adduct (54 mg, 0.071 mmol) and N 2CC>3 (254 mg, 2.4 mmol). The resulting mixture was degassed with N2 and stirred at 90 °C overnight. After cooling to it, the mixture was filtered through Celite washing with water and EtOAc. The filtrate was concentrated under reduced pressure and the aqueous residue was washed with EtOAc (50 mL), acidified with concentrated HCl to pH about 2, and concentrated to dryness. The residue was dissolved in 10% MeOH/DCM and filtered, and the filtrate was concentrated to afford 2-(2-fluoro-4-(2- (phenylamino)pyrimidin-5-yl)phenyl)acetic acid as a brown solid (200 mg, 80%).
Step 3:
[0292] Step 3: To a stirred mixture of 2-(2-fluoro-4-(2-(phenylamino)pyrimidin-5- yl)phenyl)acetic acid (100 mg, 0.31 mmol) and 5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3- amine (60 mg, 0.31 mmol) in dry EtOAc (5 mL) were added pyridine (74 mg, 0.93 mmol) and T3P (50 wt% in EtOAc, 985 mg, 1.55 mmol). The mixture was stirred at 60 °C for 1 h. After cooling to rt, the mixture was diluted with EtOAc (50 mL), washed with saturated aq NH4CI, water, and brine, dried over anhydrous sodium sulfate, and concentrated. The residue was purified by preparative TLC (DCM/EtOAc 10: 1, v/v) then further purified by reverse phase column chromatography (Welch Ultimate XB-C 18, 40-70 μιη) eluting with 40-95% acetonitrile in water, to afford 2-(2-fluoro-4-(2-(phenylamino)pyrimidin-5-yl)phenyl)-N-(5-(l- (trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide as a white solid (55 mg, 35%). LH NMR (400 MHz, CD3OD) δ 8.74 (s, 2H), 7.72 (dd, J = 8.8, 1.2 Hz, 2H), 7.50-7.43 (m, 3 H), 7.33 (t, J = 8.0 Hz, 2H), 7.04 (t, J = 7.2 Hz, 1H) , 6.93 (s, 1H), 3.86 (s, 2H), 1.58-1 53 (m, 2H), 1.49-1 43 (m, 2H). LCMS (ESI) m/z 498.
Example 3
Preparation of 2-(2-fluoro-4-(2-((l-(2-(methylsulfonyl)ethyl)-lH-pyrazol-4- yl)amino)pyrimidin-5-yl)phenyl)-N-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3- yl)acetamide (P-240)
120 °C, 30 min
[0293] Step 1: To a stirred mixture of 4-nitro-lH-pyrazole (250 mg, 2.2 mmol) and K2CO3 (915 mg, 6.6 mmol) in DMF (3 mL) was added vinyl sulfone (213 μί, 2.4 mmol). The resulting mixture was heated at 120 °C for 30 min, cooled to rt, quenched with water, and extracted with EtOAc (2 x 25 mL). The combined organic layers were washed with brine, dried over Na2SC>4, and concentrated under reduced pressure to give crude l-(2-(methylsulfonyl)ethyl)-4-nitro-lH- pyrazole, which was used directly for the next step . LC-MS (ESI) m/z 220 (M+H)+.
[0294] Step 2: To a stirred mixture of l-(2-(methylsulfonyl)ethyl)-4-nitro-lH-pyrazole and 10% Pd on carbon (50 mg) was added MeOH (5 mL). The mixture was hydrogenated at rt under a hydrogen balloon for 4 days. The reaction mixture was filtered through Celite washing with MeOH. The filtrate was evaporated under reduced pressure to give l-(2-(m ethyl sulfonyl)ethyl)- lH-pyrazol-4-amine as a purplish oil, which was used directly for the next step. LC-MS (ESI) /;/ .- 190 (M +H)+.
[0295] Step 3: 2-(2-Fluoro-4-(2-((l-(2-(methylsulfonyl)ethyl)-lH-pyrazol-4- yl)amino)pyrimidin-5-yl)phenyl)-N-(5-(l-(trifluorom
(77 mg) was obtained as a tan powder using procedures analogous to those described in the Steps 3-4 of Example 1, substituting 1 -(2 -(methyl sulfonyl)ethyl)-lH-pyrazol-4-amine from Step 2 of this example for l,3-dimethyl-lH-pyrazol-4-amine used in Example 1. ¾ MR (500 MHz, DMSO-c 6) 5 11.40 (br s, 1H), 9.73 (s, 1H), 8.80 (s, 2H), 8.06 (s, 1H), 7.62 (s, 1H), 7.57 (d, J = 11 0 Hz, 1H), 7.47 - 7.53 (m, 1H), 7 38 - 7 47 (m, 1H), 6.92 (s, 1H), 4.52 (t, J= 6.9 Hz, 2H), 3.81 (s, 2H), 3.68 (t, J= 6.9 Hz, 2H), 2.86 (s, 3H), 1.39 - 1.58 (m, 4H). LC-MS (ESI) m/z 594 (M+H)+.
Example 4
Preparation of 2-(2-Fluoro-4-(2-(thiazol-2-ylamino)pyrimidin-5-yl)phenyl)-N-(5-(l- (trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide (P-241)
[0296] Step 1: To a solution of thiazol-2-amine (500.0 mg, 5.0 mmol) in pyridine (5 mL) was added B0C2O (1.3 g, 6.0 mmol). The resulting mixture was stirred at rt for 2 h. The mixture was concentrated under reduced pressure and the residue was purified by silica gel chromatography, eluting with petroleum ether/EtOAc (4: 1), to afford fer^-butyl thiazol-2-ylcarbamate as a solid (280 mg, 28%). ¾ NMR (300 MHz, DMSO-ak) δ 11.38 (br s, 1 H), 7.35 (d, J= 3.6 Hz, 1H), 7.14 (d, J= 3.6 Hz, 1H), 1.44 (s, 9H).
[0297] Step 2: A mixture of 5-bromo-2-fiuoropyrimidine (239 mg, 1.35 mmol), tert-butyl thiazol-2-ylcarbamate (180 mg, 0.9 mmol) and K2C03 (621 mg, 4.5 mmol) in DMF (8 mL) was stirred at 100 °C overnight. After cooling to rt, the mixture was poured into cold water and extracted with EtOAc (2x 50 mL). The combined extracts were washed with water and brine, dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The residue was triturated with EtOH to afford tert-butyl (5-bromopyrimidin-2-yl)(thiazol-2- yl)carbamate as a solid (220 mg, 44% yield). H NMR (400 MHz, DMSO-< ) δ 9.22 (s, 2H), 7.60 (d, J= 4.4 Hz, 1H), 7.03 (d, J= 4.4 Hz, 1H), 1.40 (s, 9H).
Step 3:
[0298] Step 3: To a mixture of tert-butyl (5-bromopyrimidin-2-yl)(thiazol-2-yl)carbamate (110 mg, 0.28 mmol) and 2-(2-fluoro-4-(4,4,5,5-tetramethyl-l,3,2-dioxaborolan-2-yl)phenyl)-N- (5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide (128 mg, 0.28 mmol) in acetonitrile (6 mL) and water (3 mL) were added PdCl2(dppf) dichloromethane adduct (23 mg, 0.028 mmol) and aiCC (89 mg, 0.84 mmol). The resulting mixture was degassed with N2 and stirred at 75 °C overnight After cooling to rt, the mixture was diluted with 10% MeOH/DCM (50 mL), washed with water and brine, dried over anhydrous sodium sulfate, filtered and concentrated. The residue was purified by preparative TLC (petroleum ether/EtOAc 1 : 1) to afford tert-butyl (5-(3-fluoro-4-(2-oxo-2-((5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3- yl)amino)ethyl)phenyl)pyrimidin-2-yl)(thiazol-2-yl)carbamate as a solid (120 mg, 64%).
Step
[0299] Step 4: To a solution of tert-butyl (5-(3-fluoro-4-(2-oxo-2-((5-(l- (trifluoromethyl)cyclopropyl)isoxazol-3-yl)amino)ethyl)phenyl)pyrimidin-2-yl)(thiazol-2- yl)carbamate (120 mg, 0.198 mmol) in DCM (2 mL) was added TFA (1 mL). The mixture was
stirred at rt for 2 h and concentrated under reduced pressure. The residue was treated with saturated aq NaHCC>3 to pH about 8, and concentrated to dryness. The residue was purified by preparative TLC (7% MeOH/DCM) to afford 2-(2-fluoro-4-(2-(thiazol-2-ylamino)pyrimidin-5- yl)phenyl)-N-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide as a solid (80 mg, 80%). LH NMR (400 MHz, DMSO-de) δ 11.42 (s, IH), 9.73 (br s, IH), 9.19 (s, 2H), 7.72 (dd, J = 1 1.2, 1.6 Hz, IH), 7.68-7.63 (m, 2H), 7.52 (t, J= 8.0 Hz, IH), 6.91 (s, IH), 6.47 (d, J= 5.6 Hz, IH), 3.84 (s, 2H), 1.54-1.45 (m, 4H). LCMS (ESI) m/z 505.0.
Example 5
Preparation of 2-(2-fluoro-4-(2-((l-methyl-lH-imidazol-5-yl)amino)pyriinidin-5- acetamide (P-242)
[0300] Step 1: To a solution of 1 -methyl- lH-imidazole-5-carboxylic acid (1.00 g, 7.9 mmol) in i-BuOH (15 mL) and toluene (50 mL) were added diphenylphosphoryl azide (2.4 g, 8.7 mmol) and Et3N (1.2 g, 12 mmol). The mixture was heated at 70 °C for 2 h, then 100 °C for 2 h. The mixture was concentrated under reduced pressure, then water (20 mL) was added, and the mixture was extracted with EtOAc (3 x20 mL). The combined organic layers were washed with brine (10 mL), dried over anhydrous a2S04, filtered and concentrated under reduced pressure. The residue was purified by reverse phase flash chromatography (Welch Ultimate XB-C 18, 40- 70 μπι) eluting with a gradient of 10-95% acetonitrile in water to afford tert-butyl ( 1 -methyl- 1H- imidazol-5-yl)carbamate as a yellow solid (500 mg, 32%).
Step 2:
[0301] Step 2: To a solution of 2,5-dibromopyrimidine (605 mg, 2.54 mmol) and tert-butyl (l-methyl-lH-imidazol-5-yl)carbamate (500 mg, 2.54 mmol) in DMF (10 mL) was added CS2CO3 (1.66 g, 5.09 mmol). The mixture was heated at 60 °C overnight under nitrogen, cooled to rt, and added to water (10 mL). The mixture was extracted with EtOAc (3 >< 10 mL) and the combined organic layers were washed with brine (5 mL), dried over anhydrous Na2SC)4, filtered and concentrated under reduced pressure. The residue was purified by reverse phase flash chromatography (Welch Ultimate XB-C18, 40-70 μιη) eluting with a gradient of 10-95% acetonitrile in water to afford tert-butyl (5-bromopyrimidin-2-yl)(l-methyl-lH-imidazol-5- yl)carbamate as a yellow solid (180 mg, 20%).
Step 3:
[0302] Step 3: To a solution of 2-(2-fluoro-4-(4,4,5,5-tetramethyl-l,3,2-dioxaborolan-2- yl)phenyl)-N-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide (100 mg, 0.22 mmol) and tert-butyl (5-bromopyrimidin-2-yl)(l-methyl-lH-imidazol-5-yl)carbamate (78 mg, 0.22 mmol) in CH3CN (3 mL) and H20 (0.5 mL) were added Na2C03 (47 mg, 0.44 mmol) and PdCl2(dppf) DCM (18 mg, 0.022 mmol). The mixture was heated under nitrogen at 75 °C for 5 h, cooled to rt and concentrated under reduced pressure. The residue was poured into water (10 mL) and extracted with EtOAc (3 >< 10 mL). The combined organic layers were washed with brine (5 mL), dried over anhydrous Na2SC>4, filtered and concentrated under reduced pressure. The residue was purified by reverse phase flash chromatography (Welch Ultimate XB-C 18, 40- 70 μηι) eluting with a gradient of 40-95% acetonitrile in water to afford tert-butyl (5-(3-fluoro- 4-(2-oxo-2-((5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3-yl)amino)ethyl)phenyl)pyrimidin-2- yl)(l-methyl-lH-imidazol-5-yl)carbamate as a white solid (80 mg, 60%).
Step
[0303] Step 4: To a solution of fert-butyl (5-(3-fluoro-4-(2-oxo-2-((5-(l- (trifluoromethyl)cyclopropyl)isoxazol-3-yl)amino)ethyl)phenyl)pyrimidin-2-yl)(l-methyl-lH- imidazol-5-yl)carbamate (80 mg, 0.13 mmol) in DCM (2 niL) was added TFA (1 niL). The mixture was stirred at rt overnight and concentrated under reduced pressure. The residue was treated with saturated aq NaHC(¾ until pH about 8 to about 9 and extracted with EtOAc (3>< 10 mL). The combined organic layers were washed with brine (5 niL), dried over anhydrous
Na2SC>4, filtered and concentrated under reduced pressure. The residue was purified by reverse phase flash chromatography (Welch Ultimate XB-C18, 40-70 μηι) eluting with 20-95% acetonitrile in water, then further purified by preparative TLC eluting with DCM/MeOH (15: 1, v/v) to afford 2-(2-fluoro-4-(2-((l -methyl- lH-imidazol-5-yl)amino)pyrimidin-5-yl)phenyl)-N- (5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide as an off-white solid (30 mg, 45%). ^ MVIR (400 MHz, DMSO-d¾) δ 11.43 (br s, 1H), 9.34 (br s, 1H), 8.80 (s, 2H), 7.71 (s, 1H), 7.60-7.53 (m, 1H), 7.52-7.41 (m, 2H), 6.91 (s, 1H), 6.86 (s, 1H), 3.81 (s, 2H), 3.50 (s, 3H), 1.57- 1.50 (m, 2H), 1.50-1.44 (m, 2H). LCMS (ESI) mlz 501.8 (M+H)+.
Example 6
Preparation of 2-(4-(2-((3-(difluoromethyl)-l-methyl-lH-pyrazol-4-yl)amino)pyrimidin-5- yl)-2-fluorophenyl)-A'-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide (P-243)
Step 1:
[0304] Step 1: To a solution of methyl l-methyl-4-nitro-lH-pyrazole-3-carboxylate (3.70 g, 20 mmol) in THF (120 mL) was added dropwise DIBAL-H (1 M in hexane, 50 mL, 50 mmol) at -30 °C and the mixture was stirred at rt overnight. To the reaction mixture was added 0.5 N HCl (100 mL) and the mixture was extracted with EtOAc. The combined organic layers were dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The residue
was purified by silica gel chromatography eluting with 60% EtOAc in petroleum ether to afford (l-methyl-4-nitro-lH-pyrazol-3-yl)methanol as a yellow solid (3.22 g, 89.2%).
Step 2:
[0305] Step 2: To a solution of (l-methyl-4-nitro-lH-pyrazol-3-yl)methanol (629 mg, 4.00 mmol) in DCM (60 mL) was added Dess-Martin periodinane (2.04 g, 4.81 mmol). The mixture was stirred at rt for 3 h and quenched with 1M aq NaOH. The organic layer was separated and the aqueous layer was extracted with DCM. The combined organic layers were dried over anhydrous Na2S04, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography eluting with 30% EtOAc in petroleum ether to afford l-methyl-4- nitro-lH-pyrazole-3-carbaldehyde as a white solid (608 mg, 98%).
Step 3:
[0306] Step 3: To a solution of l-methyl-4-nitro-lH-pyrazole-3-carbaldehyde (310 mg, 2.00 mmol) in DCM (20 mL) was added dropwise DAST (0.70 mL, 5.3 mmol) at -50 °C. The mixture was warmed to it, stirred overnight and quenched with saturated aq. aHC03. The organic layer was separated and the aqueous layer was extracted with DCM. The combined organic layers were dried over anhydrous Na2S04, filtered and concentrated under reduced pressure to afford crude 3-(difluoromethyl)-l-methyl-4-nitro-lH-pyrazole as a yellow oil (355 mg crude, 100 %).
[0307] Step 4: To a solution of 3-(difluoromethyl)-l-methyl-4-nitro-lH-pyrazole (355 mg, 2.00 mmol) in MeOH (10 mL) was added 10% Pd/C (60 mg). The mixture was stirred under a
H2 balloon at rt overnight, filtered through Celite, and concentrated under reduced pressure. The residue was purified by preparative TLC, eluting with EtO Ac/petroleum ether/DCM (1 :2: 1, v/v/v) to afford 3-(difluoromemyl)-l-methyl-lH-pyrazol-4-amine as a purple oil (139 mg, 47%).
Step 5:
[0308] Step 5: A mixture of 3-(difluoromethyl)-l-methyl-lH-pyrazol-4-amine (139 mg, 0.94 mmol), 5-bromo-2-chloropyrimidine (167 mg, 0.86 mmol) and DIEA (1 mL) in DMSO (5 mL) was stirred at 120 °C for 2 h. The mixture was cooled to rt and purified by reverse phase flash chromatography (Welch Ultimate XB-C18, 40-70 μιη), eluting with a gradient of 15-95% acetonitrile in water, and then further purified by preparative TLC, eluting with
EtOAc/petroleum ether/DCM (1 :5: 1, , v/v/v) to afford 5-bromo-N-(3-(difluoromethyl)-l -methyl - lH-pyrazol-4-yl)pyrimidin-2-amine as a light purple solid (40 mg, 14%).
Step 6:
[0309] Step 6: A mixture of 5-bromo-N-(3-(difluoromethyl)-l-methyl-lH-pyrazol-4- yl)pyrimidin-2-amine (38 mg, 0.12 mmol), 2-(2-fluoro-4-(4,4,5,5-tetramethyl-l,3,2- dioxaborolan-2-yl)phenyl)-N-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide (57 mg, 0.12 mmol), Na2C03 (56 mg, 0.53 mmol) and PdCl2(dppf) DCM (14 mg, 0.017 mmol) in CH3CN H20 (10 mL/1 mL) was stirred at 75 °C for 3 h under nitrogen. The mixture was cooled to rt and partitioned between EtO Ac and water. The aqueous layer was separated and further extracted with EtOAc. The combined organic layers were dried over anhydrous Na2S04, filtered and concentrated under reduced pressure. The residue was purified by preparative TLC, eluting with EtOAc/petroleum ether/MeOH/DCM (20:30: 1 :50, v/v/v/v) to afford 2-(4-(2-((3- (difluoromethyl)-l-methyl-lH-pyrazol-4-yl)amino)pyrimidin-5-yl)-2-fluorophenyl)-N-(5-(l-
(trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide as a light yellow solid (62 mg, 90%). H NMR (400 MHz, DMSO-£¾) δ 11.44 (br s, 1H), 9.29 (s, 1H), 8.81 (s, 2H), 8.10 (s, 1H), 7.61- 7.55 (m, 1H), 7.53-7.49 (m, 1H), 7.48-7.42 (m, 1H), 7.15 (t, J= 53.8 Hz, 1H), 6.92 (s, 1H), 3.89 (s, 3H), 3.81 (s, 2H), 1.56-1.51 (m, 2H), 1.50-1.44 (m, 2H). LCMS (ES+APCI) m/z 552.1 (M+H)+.
Example 7
Preparation of 2-{4-[2-(3-Ethoxy-l-methyl-lH-pyrazol-4-ylamino)-pyrimidin-5-yl]-2- fluoro-phenyl}-N-[5-(l-trifluorometh l-cyclopropyl)-isoxazol-3-yl]-acetamide (P-244)
Step 1:
[0310] Step 1: To a mixture of 2-ethoxymethylenemalonic acid diethyl ester (10 g, 46.3 mmol) in EtOH (100 mL) was added N2H4HC1 (3.3 g, 48.2 mmol). The mixture was heated at 80 °C for 16 h before it was concentrated and diluted with H20 (150 mL). The mixture was extracted with DCM (3 χ 100 mL). The combined organic layers were washed with brine, dried over anhydrous a2S04, filtered and concentrated under reduced pressure to afford 3-ethoxy- lH-pyrazole-4-carboxylic acid ethyl ester as a brown oil (3.6 g 42%).
Step 2:
[0311] Step 2: A solution of 3-ethoxy-lH-pyrazole-4-carboxylic acid ethyl ester (3 6 g, 19.6 mmol) in 6M HC1 (50 mL) was heated to 100 °C for 16 h and concentrated under reduced pressure. The residue was adjusted to pH about 7 with saturated aq. NaHCC and extracted with EtOAc (3 x 100 mL). The combined organic layers were washed with brine, dried over anhydrous
Na2S(¾, filtered and concentrated under reduced pressure to afford 3-ethoxy-lH-pyrazole as brown oil (1.50 g, 65%).
[0312] Step 3: To a solution of 3-ethoxy-lH-pyrazole (1.4 g, 12.5 mmol) in concentrated H2SO4 (5 mL) at -10 °C was added KNO3 (1.33 g, 13.1 mmol) portionwise. The suspension was stirred at - 10 °C for 2 h before it was poured into ice-water and extracted with DCM (3 50 mL). The combined organic layers were dried over Na2SC>4, filtered and concentrated under reduced pressure to afford 3-ethoxy-4-nitro-lH-pyrazole as a yellow solid (1.2 g, 61%).
Step 4:
[0313] Step 4: To a solution of 3-ethoxy-4-nitro-lH-pyrazole (1.2 g, 7.6 mmol) in DMF (15 mL) were added iodomethane (5.40 g, 38 mmol) and K2CO3 (3.20 g, 22.8 mmol). The suspension was stirred at 20 °C for 16 h before it was diluted with H20 (20 mL) and extracted with EtOAc (3 x20 mL). The combined organic layers were washed with brine, dried over anhydrous Na2SC>4, filtered and concentrated under reduced pressure to afford 3-ethoxy-l- methyl-4-nitro-lH-pyrazole as a yellow solid (950 mg, 73%).
[0314] Step 5: To a solution of 3-ethoxy-l-methyl-4-nitro-lH-pyrazole (500 mg, 2.90 mmol) in EtOH (20 mL) was added 10% Pd/C (100 mg). The mixture was stirred at 20 °C for 16 h under H2. The mixture was filtered and concentrated under reduced pressure. The residue was purified by column chromatography on silica gel, eluting with DCM/MeOH (300: 1, v/v) to afford 3-ethoxy-l-methyl-lH-pyrazol-4-ylamine as a brown oil (0.40 g, 95%).
[0315] Step 6: To a solution of 3-ethoxy-l-methyl-lH-pyrazol-4-ylamine (370 mg, 2.60 mmol) in DMSO (8 mL) were added DIEA (670 mg, 5.20 mmol) and 5-bromo-2- chloropyrimidine (604 mg, 3.12 mmol). The suspension was heated at 120 °C for 4 h. The mixture was diluted with H20 (20 mL) and extracted with EtOAc (3 30 mL). The combined organic layers were washed with brine (20 mL), dried over anhydrous Na2S04, filtered and concentrated under reduced pressure. The residue was purified by column chromatography on silica gel, eluting with PE/EA (5 : 1, v/v) to afford (5-bromo-pyrimidin-2-yl)-(3-ethoxy-l-methyl- lH-pyrazol-4-yl)-amine as a yellow solid (270 mg, 34%).
Step 7:
[0316] Step 7: To a solution of 2-(2-fluoro-4-(4,4,5,5-tetramethyl-l,3,2-dioxaborolan-2- yl)phenyl)-N-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide (182 mg, 0.40 mmol) and (5-bromo-pyrimidin-2-yl)-(3-ethoxy-l-methyl-lH-pyrazol-4-yl)-amine (120 mg, 0.40 mmol) in CH3CN (10 mL) and H20 (2 mL) were added Na2C03 (127 mg, 1.20 mmol) and PdCl2(dppf) DCM (30 mg, 0.04 mmol). The mixture was heated at 75 °C for 6 h before it was cooled to rt and concentrated under reduced pressure. The residue was purified by preparative TLC eluting with DCM/MeOH (20: 1, v/v) to afford 2-{4-[2-(3-ethoxy-l-methyl-lH-pyrazol-4- ylamino)-pyrimidin-5-yl]-2-fluoro-phenyl}-N-[5-(l-trifluoromethyl-cyclopropyl)-isoxazol-3- yl]-acetamide as a yellow solid (90 mg, 41%). ¾ NMR (400 MHz, DMSO- ) 611.42 (s, IH), 8.71 (s, 2H), 8.58 (s, IH), 7.68 (s, IH), 7.57-7.55 (m, IH), 7.52-7.42 (m, 2H), 6.92 (s, IH), 4.13 (q, J= 6.8 Hz, 2H), 3.80 (s, 2H), 3.67 (s, 3H), 1.52-1.47 (m, 4H), 1.27 (t, J= 6.8 Hz, 3H). LC- MS (ESI) mlz 546.2 (M+H)+.
Example 8
Preparation of 2-(4-(4-chloro-2-((l,3-dimethyl-lH-pyrazol-4-yl)amino)pyrimidin-5-yl)-2- fluorophenyl)-N-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide (P-245)
Step 1:
[0317] Step 1: A mixture of l,3-dimethyl-lH-pyrazol-4-amine dihydrochloride (184 mg, 1.00 mmol), 5-bromo-2-chloro-4-methoxypyrimidine (223 mg, 1.00 mmol) and DIEA (1.5 mL) in DMSO (5 mL) was stirred at 120 °C for 2 h. The mixture was cooled to rt and purified by reverse phase flash chromatography (Welch Ultimate XB-C18, 40-70 μπι), eluting with a gradient of 15-95% acetonitrile in water to afford 5-bromo-N-(l,3-dimethyl-lH-pyrazol-4-yl)-4- methoxypyrimidin-2-amine as a light yellow solid (50 mg, 17 %).
Step 2:
[0318] Step 2: A mixture of 5-bromo-N-(l,3-dimethyl-lH-pyrazol-4-yl)-4- methoxypyrimidin-2-amine (72 mg, 0.24 mmol) in concentrated HCI (2 mL) was heated at 120 °C in a microwave reactor for 1 h. The mixture was cooled to rt and concentrated to afford 5- bromo-2-((l,3-dimethyl-lH-pyrazol-4-yl)amino)pyrimidin-4-ol hydrochloride (88 mg, 100%).
Step 3:
[0319] Step 3: A mixture of 5-bromo-2-((l ,3-dimethyl- lH-pyrazol-4-yl)amino)pyrimidin-4-ol hydrochloride (88 mg, ca. 0.24 mmol), 2-(2-fluoro-4-(4,4,5,5-tetramethyl-l,3,2-dioxaborolan-2- yl)phenyl)-N-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide (1 10 mg, 0.24 mmol), Na2C03 (100 mg, 0.94 mmol) and Pd(dppf)Cl2 CH2C12 (20 mg, 0.024 mmol) in
CH3CN H20 DMF (8 mL/3 mL/3 mL) was stirred under N2 at 75 °C overnight. The mixture was partitioned between EtOAc and water. The aqueous layer was further extracted with EtOAc. The combined organic layers were dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The residue was purified by preparative TLC, eluting with MeOH/DCM (15 : 1 , v/v) to afford 2-(4-(2-((l,3-dimethyl-lH-pyrazol-4-yl)amino)-4-hydroxypyrimidin-5-yl)- 2-fluorophenyl)-N-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide as a yellow solid (30 mg, 24%).
Step 4:
[0320] Step 4: To a mixture of 2-(4-(2-((l,3-dimethyl-lH-pyrazol-4-yl)amino)-4- hydroxypyrimidin-5-yl)-2-fluorophenyl)-N-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3- yl)acetamide (30 mg, 0.057 mmol) in THF (5 mL) was added POC (0.2 mL). The mixture was stirred at it for 2 d and then quenched with saturated aq NaHC03. The aqueous layer was extracted with EtOAc. The combined organic layers were dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The residue was purified by preparative TLC, eluting with EtO Ac/petroleum ether/DCM (1 : 1 : 1, v/v/v) to afford 2-(4-(4-chloro-2-((l ,3- dimethyl-lH-pyrazol-4-yl)amino)pyrimidin-5-yl)-2-fluorophenyl)-N-(5-(l- (trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide as a white solid (18 mg, 58%). LH NMR (400 MHz, OMSO-d6) δ 1 1.46 (br s, 1H), 9.41 (brs, 1H), 8.40 (s, 1H), 7.80 (s, 1H), 7.45 (t,
J=8.0 Hz, 1H), 7.34 (d, J=11.6 Hz, 1H), 7.28 (d, J=7.6 Hz, 1H), 6.93 (s, 1H), 3.83 (s, 2H), 3.75 (s, 3H), 2.11 (s, 3H), 1.53-1.51 (m, 2H), 1.49-1.47 (m, 2H). LCMS (ES+APCI) m/z 550, 552 (M+H)+.
Example 9
Preparation of 2-(4-(2-((3-ethoxy-l-methyl-lH-pyrazol-5-yl)amino)pyrimidin-5-yl)-2- fluorophenyl)-N-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide (P-246)
[0321] Step 1: To a solution of 3-nitro-lH-pyrazole (3.16 g, 28 mmol) in acetic acid (50 mL) at 0 °C was added dropwise fuming ΗΝΟ3 (2.6 mL, c.a. 58 mmol). Acetic anhydride (6.6 mL, 70 mmol) was added and the mixture was stirred at rt for 3h. The mixture was cooled to 0 °C and another portion of fuming ΗΝΟ3 (0.5 mL, c.a. 11 mmol) was added and the mixture was stirred at rt for 2h. The mixture was poured into water, stirred at rt overnight, and extracted with EtOAc. The combined organic layers were dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography eluting with 10% EtOAc in petroleum ether to afford 1,3-dinitro-lH-pyrazole as a white solid (3.56 g, 81%).
[0322] Step 2: A mixture of 1,3-dinitro-lH-pyrazole (3.56 g, 22.5 mmol) in benzonitrile (45 mL) was stirred at 180 °C for 3h. The mixture was cooled to rt and poured into a mixture of n- hexane and IN aq NaOH. The precipitate was collected by filtration to afford the first batch of 3,5-dinitro-lH-pyrazole as a pale-yellow solid (1.87 g, crude 53%). The aqueous layer of the
filtrate was separated, neutralized with aq HCl and concentrated under reduced pressure. The residue was purified by silica gel chromatography eluting with 30% EtOAc in petroleum ether to 10% MeOH in EtOAc to afford a second batch of 3,5-dinitro-lH-pyrazole as a pale-yellow solid (total crude yield 2.24 g, 63%).
[0323] Step 3: To a solution of 3,5-dinitro-lH-pyrazole (3.63 g, 23 mmol) in DMF (30 mL) were added K2CO3 (9.55 g, 69 mmol) and CH3I (1.5 mL, 24 mmol) and the mixture was stirred at rt overnight. The mixture was poured into water and extracted with EtOAc. The combined organic layers were dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography, eluting with 10% EtOAc in petroleum ether, to afford l-methyl-3,5-dinitro-lH-pyrazole as a pale-yellow solid
(2.25 g, 66%).
[0324] Step 4: Sodium (276 mg, 12 mmol) was added to EtOH (12 mL) and the mixture was stirred at rt for 0.5 h. l-Methyl-3,5-dinitro-lH-pyrazole (522 mg, 3 mmol) was added and the mixture was stirred at 65 °C for 0.5 h. The mixture was cooled to rt and concentrated under reduced pressure. The residue was purified by silica gel chromatography eluting with 20% EtOAc in petroleum ether to afford 3-ethoxy-l-methyl-5-nitro-lH-pyrazole as a pale-yellow solid (354 mg, 68 %).
Step 5:
[0325] Step 5: To a solution of 3-ethoxy-l-methyl-5-nitro-lH-pyrazole (257 mg, 1.5 mmol) in EtOH (10 mL) was added 10% Pd/C (wet, 95 mg). The mixture was stirred under a hydrogen balloon at rt overnight. The mixture was filtered through Celite and the filtrate was concentrated under reduced pressure to afford 3-ethoxy-l-methyl-lH-pyrazol-5-amine as a white solid (210 mg, 99%).
Step 6:
[0326] Step 6: A mixture of 3 -ethoxy-1 -methyl- lH-pyrazol-5 -amine (210 mg, 1.49 mmol), 5- bromo-2-fluoropyrimidine (270 mg, 1.53 mmol), and DIEA (1.5 mL) in DMSO (5 mL) was stirred at 80 °C for 3 h. The mixture was cooled to rt and purified by flash column
chromatography (Welch Ultimate XB-C18, 40-70 μιη) eluting with a gradient of 15-95% acetonitrile in water to afford 5-bromo-N-(3-ethoxy-l -methyl-lH-pyrazol-5-yl)pyrimidin-2- amine as a yellow solid (66 mg, 15 %).
Step 7:
[0327] Step 7: A mixture of 5-bromo-N-(3-ethoxy-l-methyl-lH-pyrazol-5-yl)pyrimidin-2- amine (66 mg, 0.22 mmol), 2-(2-fluoro-4-(4,4,5,5-tetramethyl-l,3,2-dioxaborolan-2-yl)phenyl)- N-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide (102 mg, 0.22 mmol), Na2C03 (85 mg, 0.80 mmol), and Pd(dppf)Cl2 CH2C12 (25 mg, 0.031 mmol) in CH3CN/H20 (8 mL/1.5 mL) was stirred under N2 at 75 °C overnight. The mixture was partitioned between EtOAc and water. The aqueous layer was re-extracted with EtOAc. The combined organic layers were dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The residue was purified by preparative TLC, eluting with EtOAc /MeOH DCM (50: 1 :50, v/v/v), and further purified by preparative HPLC (Xbridge CI 8 5 μηι, 19x150 mm, 45-85% B, A: H20 (0.1%
H4CO3), B : CH3CN, UV: 214 nm, flow rate: 12 mL/min) to afford 2-(4-(2-((3 -ethoxy-1 -
methyl-lH-pyrazol-5-yl)amino)pyrimidin-5-yl)-2-fluorophenyl)-N-(5-(l- (trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide as a white solid (16 mg, 13%). LH NMR (400 MHz, DMSO-£¾) δ 11.43 (br s, 1H), 9.84 (s, 1H), 8.81 (s, 2H), 7.58 (d, J= 11.6 Hz, 1H), 7.52 (d, J= 8.0 Hz, 1H), 7.45 (t, J= 7.8 Hz, 1H), 6.93 (s, 1H), 6.12 (s, 1H), 4.14 (q, J= 7.2 Hz, 2H), 3.82 (s, 2H), 3.48 (s, 3H), 1.55-1.52 (m, 2H), 1.49-1.46 (m, 2H), 1.37 (t, J= 7.2 Hz, 3H). LCMS (ES+APCI) m/z 546 (M+H)+.
Example 10
Preparation of 2-{2-Fluoro-4-[2-(3-isopropyl-l-methyl-lH-pyrazol-4-ylamino)-pyrimidin- 5-yl]-phenyl}-N-[5-(l-trifluoromethyl-cyclopropyl)-isoxazol-3-yl]-acetamide (P-247)
Step 1:
[0328] Step 1: A mixture of 3-methyl-but-l-yne (0.40 g, 5.88 mmol) in trimethylsilanyl- methanediazonium (3 mL) was heated at 135 °C for 1 h in a microwave reactor. The mixture was concentrated at low temperature to afford 3-isopropyl-lH-pyrazole as a yellow oil (380 mg 50%).
[0329] Step 2: To a solution of 3-isopropyl-lH-pyrazole (380 mg, 3.45 mmol) in DMF (8 mL) were added iodomethane (2.50 g, 17.3 mmol) and K2CO3 (1.40 g, 10.4 mmol). The suspension was stirred at 20 °C for 16 h before it was diluted with H20 (20 mL) and extracted with Et20 (3 χ20 mL). The combined organic layers were washed with brine, dried over anhydrous Na2S04 and filtered The filtrate was concentrated under reduced pressure to afford a mixture of 3-isopropyl-l-methyl-lH-pyrazole and 5-isopropyl-l -methyl- IH-pyrazole as a brown solid (350 mg, 82%).
Step 3:
[0330] Step 3: To a solution of 3 -isopropyl-1 -methyl- lH-pyrazole and 5-isopropyl-l-methyl- lH-pyrazole (350 mg, 2.80 mmol) from Step 2 of this example in concentrated H2S04 (2 mL) at -10 °C was added KNO3 (297 mg, 2.94 mmol) portion wise. The suspension was stirred at -10 °C for 2 h before it was poured into ice-water and extracted with DCM (3 ><50 mL). The combined organic layers were dried over Na2S04, filtered and concentrated under reduced pressure. The residue was purified by preparative TLC, eluting with petroleum ether/ethyl acetate (5 : 1, v/v) to afford a mixture of 3-isopropyl-l-methyl-4-nitro- lH-pyrazole and 5- isopropyl-1 -methyl -4-nitro-lH-pyrazole as a brown oil (130 mg, 27%).
[0331] Step 4: To a solution of 3-isopropyl-l-methyl-4-nitro-lH-pyrazole and 5-isopropyl-l- methyl-4-nitro-lH-pyrazole (150 mg, 0.88 mmol) in EtOH (10 mL) was added Pd/C (20 mg). The suspension was stirred at 20 °C for 3 h under a ¾ balloon. The mixture was filtered and concentrated under reduced pressure. The residue was purified by preparative TLC, eluting with DCM/MeOH (19: 1, v/v) to afford 3-isopropyl-l-methyl-lH-pyrazol-4-ylamine as brown oil (55 mg, 44%).
Step 5:
[0332] Step 5: To a solution of 3 -isopropyl-1 -methyl- lH-pyrazol-4-yl amine (55 mg, 0.39 mmol) in DMSO (3 mL) were added DIEA (101 mg, 0.78 mmol) and 5-bromo-2- chloropyrimidine (98 mg, 0.51 mmol). The suspension was heated at 120 °C for 2 h. The mixture was diluted with H20 (20 mL) and extracted with EtOAc (3 ><30 mL). The combined organic layers were washed with brine (20 mL), dried over anhydrous Na2S04, filtered and concentrated under reduced pressure. The residue was purified by preparative TLC, eluting with
DCM MeOH (20: 1, v/v) to afford (5-bromo-pyrimidin-2-yl)-(3-isopropyl-l-methyl-lH-pyrazol- 4-yl)-amine as a yellow solid (45 mg, 39%).
Step 6:
[0333] Step 6: To a solution of 2-(2-fluoro-4-(4,4,5,5-tetramethyl-l,3,2-dioxaborolan-2- yl)phenyl)-N-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide (69 mg, 0.15 mmol) and (5-bromo-pyrimidin-2-yl)-(3-isopropyl-l-methyl-lH-pyrazol-4-yl)-amine (45 mg, 0.15 mmol) in CH3CN (5 mL) and H20 (1 mL) were added Na2C03 (48 mg, 0.45mmol) and
PdCl2(dppf) DCM (11 mg, 0.02 mmol). The mixture was heated at 75 °C for 5 h before it was cooled to rt and concentrated under reduced pressure. The residue was purified by preparative TLC, eluting with DCM/MeOH (19: 1, v/v) to afford 2-{2-fluoro-4-[2-(3-isopropyl-l-methyl- lH-pyrazol-4-ylamino)-pyrimidin-5-yl]-phenyl}-N-[5-(l-trifluoromethyl-cyclopropyl)-isoxazol- 3-yl]-acetamide as a yellow solid (20 mg, 25%). ¾ NMR (400 MHz, DMSO-< ) δ 11.42 (s, 1H), 8.86 (s, 1H), 8.73 (s, 2H), 7.76 (s, 1H), 7.56-7.42 (m, 3H), 6.92 (s, 1H), 3.80 (s, 2H), 3.76 (s, 3H), 3.06-3.02 (m, 1H),1.52-1.47 (m, 4H), 1.15 (d, J = 8.8 Hz, 6H). LCMS (ESI) mlz 544.2 (M+H)+.
Example 11
Preparation of 2-(4-(2-((l,3-dimethyl-lH-pyrazol-4-yl)amino)-4-fluoropyrimidin-5-yl)-2- fluorophenyl)-Ar-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide (P-248)
[0334] Step 1: A mixture of 5-bromo-2-((l,3-dimethyl-lH-pyrazol-4-yl)amino)pyrimidin-4-ol hydrochloride from Step 1 of Example 8 (285 mg, c.a. 0.77 mmol) in POCl3 (5 mL) was stirred at 60 °C for 3h. The mixture was concentrated under reduced pressure and the residue was dissolved in EtOAc. The solution was washed with saturated aq. NaHC03, dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure to afford 5-bromo-4-chloro-N- (l,3-dimethyl-lH-pyrazol-4-yl)pyrimidin-2-amine as a pale yellow solid (224 mg, 96%).
Step 2:
[0335] Step 2: A mixture of 5-bromo-4-chloro-N-(l,3-dimethyl-lH-pyrazol-4-yl)pyrimidin-2- amine (152 mg, 0.50 mmol), KF (580 mg, 10 mmol), and 18-crown-6 (140 mg, 0.53 mmol) in DMF (5 mL) was stirred 120 °C for 2h. The mixture was partitioned between EtOAc and water, and the aqueous layer was further extracted with EtOAc. The combined organic layers were dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The residue was purified by preparative TLC, eluting with EtO Ac/petroleum ether (1 : 1, v/v) to afford 5-bromo-N-( 1,3 -dimethyl- lH-pyrazol-4-yl)-4-fluoropyrimidin-2-amine as a pale yellow solid (46.5 mg, 33%).
Step 3:
[0336] Step 3: A mixture of 5-bromo-N-(l,3-dimethyl-lH-pyrazol-4-yl)-4-fluoropyrimidin-2- amine (46.5 mg, 0.16 mmol), 2-(2-fluoro-4-(4,4,5,5-tetramethyl-l,3,2-dioxaborolan-2-
yl)phenyl)-N-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide (82 mg, 0.18 mmol), Na2C03 (58mg, 0.55 mmol), and Pd(dppf)Cl2 CH2C12 (16 mg, 0.020 mmol) in CH3CN/H20 (5 mL/0.8 mL) was stirred under N2 at 75 °C for 3h. The mixture was partitioned between EtOAc and water and the separated aqueous layer was further extracted with EtOAc. The combined organic layers were dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The residue was purified by preparative TLC, eluting with EtOAc/DCM (2: 1, v/v) to afford 2-(4-(2-((l,3-dimethyl- lH-pyrazol-4-yl)amino)-4-fluoropyrimidin-5-yl)-2- fluorophenyl)-N-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide a pink solid (63 mg, 72%). 'H NMR (400 MHz, OMSO-d6) δ 11.46 (br s, 1H), 9.45-9.39 (m, 1H), 8.67 (d, J=9.2 Ηζ, ΙΗ), 7.82 (s, 1H), 7.47-7.35 (m, 3H), 6.92 (s, 1H), 3.82 (s, 2H), 3.75 (s, 3H), 2.11 (s, 3H), 1.55-1.52 (m, 2H), 1.48-1.45 (m, 2H). LCMS (ES+APCI) m/z 534.0 (M+H)+.
Example 12
Preparation of 2-(4-(2-((3-ethyl-l-methyl-lH-pyrazol-4-yl)amino)pyrimidin-5-yl)-2- fluorophenyl)-/Y-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetaniide (P-249)
Step 1 :
[0337] Step 1 : To a suspension of methyltriphenylphosphonium bromide (714 mg, 2.00 mmol) in THF (10 mL) was added a solution of «-BuLi in w-hexane (2.5 M, 0.80 mL, 2.0 mmol) at 0 °C, and the mixture was stirred at 0 °C for 1 h. To the mixture was added a solution of 1- methyl-4-nitro-lH-pyrazole-3-carbaldehyde from Step 2 of example 6 (287 mg, 1.85 mmol) in THF (10 mL). The mixture was stirred at rt for 3 h and partitioned between EtOAc and brine. The separated aqueous layer was further extracted with EtOAc. The combined organic layers were dried over anhydrous Na2S04, filtered and concentrated under reduced pressure. The residue was purified by preparative TLC, eluting with EtO Ac/petroleum ether/DCM (1 :2: 1, v/v/v) to afford l-methyl-4-nitro-3-vinyl-lH-pyrazole as a white solid (75 mg, 24 %).
Step 2:
[0338] Step 2: To a solution of l-methyl-4-nitro-3-vinyl-lH-pyrazole (100 mg, 0.65 mmol) in EtOH (10 mL) was added 10% Pd/C (30 mg). The mixture was stirred under ¾ (50 psi) at 50 °C for 24 h. The mixture was filtered through Celite and the filtrate was concentrated under reduced pressure to afford 3-ethyl-l-methyl-lH-pyrazol-4-amine as a brown solid (75 mg crude, 92%).
Step 3:
[0339] Step 3: A mixture of 3-ethyl-l-methyl-lH-pyrazol-4-amine (75 mg, 0.60 mmol), 5- bromo-2-chloropyrimidine (124 mg, 0.64 mmol) and DIEA (0.8 mL) in DMSO (5 mL) was stirred at 120 °C for 2 h. The mixture was cooled to rt and purified by reverse phase flash chromatography (Welch Ultimate XB-C18, 40-70 μπι), eluting with a gradient of 15-95% acetonitrile in water, to afford 5-bromo-N-(3-ethyl-l-methyl-lH-pyrazol-4-yl)pyrimidin-2- amine as an off-white solid (97 mg, 57%).
Step 4:
[0340] Step 4: A mixture of 5-bromo-N-(3-ethyl-l-methyl-lH-pyrazol-4-yl)pyrimidin-2- amine (58 mg, 0.21 mmol), 2-(2-fluoro-4-(4,4,5,5-tetramethyl-l,3,2-dioxaborolan-2-yl)phenyl)- N-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide (101 mg, 0.22 mmol), Na2C03 (71 mg, 0.67 mmol) and PdCl2(dppf) DCM (23 mg, 0.028 mmol) in CH3CN/H20 (8 mL/1 mL) was stirred at 75 °C for 3 h under nitrogen. The mixture was cooled to rt and partitioned between
EtOAc and water. The organic layer was separated and the aqueous layer was extracted with EtOAc. The combined organic layers were dried over anhydrous a2SC>4, filtered and concentrated under reduced pressure. The residue was purified by preparative TLC, eluting with EtOAc/petroleum ether/MeOH/DCM (20/10/1/30, v/v/v/v) to afford 2-(4-(2-((3-ethyl-l-methyl- lH-pyrazol-4-yl)amino)pyrimidin-5-yl)-2-fluorophenyl)-N-(5-(l-
(trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide as a light yellow solid (80 mg, 73%). ¾ NMR (400 MHz, DMSO-J6) δ 11.42 (br s, 1H), 8.95 (s, 1H), 8.74 (s, 2H), 7.81 (s, 1H), 7.58- 7.52 (m, 1H), 7.50-7.46 (m, 1H), 7.46-7.40 (m, 1H), 6.92 (s, 1H), 3.80 (s, 2H), 3.75 (s, 3H), 2.54 (q, J= 7.6 Hz, 2H), 1.56-1.51 (m, 2H), 1.50-1.44 (m, 2H), 1.12 (t, J = 7.6 Hz, 3H). LCMS (ES+APCI) m/z 529.8 (M+H)+
Example 13
Preparation of Ar-(5-(l-(difluoromethyl)cyclopropyl)isoxazol-3-yl)-2-(4-(2-((l,3-dimethyl- lH-pyrazol-4-yl)amino)pyrimidin-5-yl)-2-fluorophenyl)acetamide (P-250)
[0341] Step 1: To a solution of dimethyl cyclopropane-l, l-dicarboxylate (6.32 g, 40 mmol) in anhydrous THF (120 mL) was added a solution of lithium tri-fert-butoxyaluminum hydride in THF (1M, 88 mL) and the mixture was stirred at 65 °C overnight. To the mixture were added H20 (4 mL) and 15% aq NaOH (4 mL). The mixture was dried over drying agent and filtered. The filtrate was concentrated under reduced pressure to afford methyl 1 - (hydroxymethyl)cyclopropane-l-carboxylate as a yellow oil (3.11 g, 60%).
Step 2:
[0342] Step 2: To a solution of methyl l-(hydroxymethyl)cyclopropane-l-carboxylate (3.11 g, 23.9 mmol) in DCM (80 mL) was added Dess-Martin periodinane (15.6 g, 36.8 mmol) and the mixture was stirred at rt overnight. The reaction was quenched with a solution of Na2S2(¾ (17.5 g) and saturated aqueous NaHC03 (80 mL). The organic layer was separated and the aqueous layer was further extracted with DCM. The combined organic layers were washed with saturated aq. NaHCC , dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure to afford methyl 1-formylcyclopropane-l-carboxylate as yellow oil (3.20 g, crude 100%).
Step 3:
[0343] Step 3: To a solution of methyl 1-formylcyclopropane-l-carboxylate (3.20 g, crude, 23.9 mmol) in DCM (70 mL) at 0 °C was added dropwise DAST (6 5 mL, 49.3 mmol) The mixture was stirred at rt overnight. The mixture was cooled to 0 °C and treated with saturated aq NaHC03. The organic layer was separated and the aqueous layer was further extracted with DCM. The combined organic layers were dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure to afford methyl l-(difluoromethyl)cyclopropane-l- carboxylate as a yellow oil (3.10 g, 87 %).
Step 4:
[0344] Step 4: To a stirred solution of methyl l-(difluoromethyl)cyclopropane-l-carboxylate (4.0 g, 26.7 mmol) and CH3CN (2 8 mL, 67 mmol) in anhydrous THF (120 mL) was added dropwise a solution of LDA in THF/heptane/PhCiHs (2 M, 35 mL) at -78 °C under nitrogen. The mixture was stirred at -78 °C for 2h before it was allowed to warm to rt and stir overnight. The mixture was partitioned between EtOAc and water. The organic layer was separated and the aqueous layer was further extracted with EtOAc. The combined organic layers were dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The residue was
purified by silica gel flash chromatography, eluting with 5-10% EtOAc in petroleum ether, to afford 3-(l-(difluoromethyl)cyclopropyl)-3-oxopropanenitrile as a yellow solid (2.236 g, 53%).
Step 5:
[0345] Step 5: A mixture of 3-(l-(difluoromethyl)cyclopropyl)-3-oxopropanenitrile (2.236 g, 14.1 mmol), hydroxylamine sulfate (2.82 g, 17.2 mmol), and NaHC03 (2.31 g, 27.5 mmol) in MeOH H20 (20 mL/100 mL) was stirred at 85 °C overnight. The mixture was acidified to pH lwith concentrated HC1 (2 mL) and heated in a microwave reactor at 140 °C for 25 min (8 batches). The mixture was basified with 2 N aq NaOH to pH 8 and extracted with EtOAc. The organic extract was washed with brine, dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The residue was purified by silica gel flash
chromatography eluting with 20% EtOAc in petroleum ether to afford 5-(l- (difluoromethyl)cyclopropyl)isoxazol-3-amine as a yellow solid (1.17 g, 47%).
Step 6:
[0346] Step 6: To a stirred mixture of 2-(2-fluoro-4-(4,4,5,5-tetramethyl-l,3,2-dioxaborolan- 2-yl)phenyl)acetic acid (1.54 g, 5.5 mmol), 5-(l-(difluoromethyl)cyclopropyl)isoxazol-3-amine (956 mg, 5.5 mmol) in anhydrous EtOAc (50 mL) were added T3P solution (50% in EtOAc, 10 mL, 16.8 mmol) and pyridine (1.3 mL , 16.5 mmol) and the mixture was stirred at 60 °C overnight. The mixture was washed with brine, dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The residue was purified by silica gel flash chromatography, eluting with 5% EtOAc in petroleum ether, to afford N-(5-(l- (difluoromethyl)cyclopropyl)isoxazol-3-yl)-2-(2-fluoro-4-(4,4,5,5-tetramethyl- 1,3,2- dioxaborolan-2-yl)phenyl)acetamide as a yellow solid (2.23 g, 93%).
[0347] Step 7: A mixture of l,3-dimethyl-lH-pyrazol-4-amine dihydrochloride (184 mg, 1 mmol), 5-bromo-2-chloropyrimidine (195 mg, 1 mmol), and DIEA (1 mL) in DMSO (5 mL) was stirred at 120 °C for 2 h. The mixture was cooled to rt and purified by flash column chromatography (Welch Ultimate XB-C18, 40-70 μιη) eluting with a gradient of 10-95% acetonitrile in water to afford 5-bromo-N-(l,3-dimethyl-lH-pyrazol-4-yl)pyrimidin-2-amine as a yellow solid (225 mg, 84 %).
Step 8:
[0348] Step 8: A mixture of 5-bromo-N-(l,3-dimethyl-lH-pyrazol-4-yl)pyrimidin-2-amine (53 mg, 0.198 mmol), N-(5-(l-(difluoromethyl)cyclopropyl)isoxazol-3-yl)-2-(2-fluoro-4- (4,4,5,5-tetramethyl-l,3,2-dioxaborolan-2-yl)phenyl)acetamide (87 mg, 0.20 mmol), Na2CC>3 (70 mg, 0.66 mmol), and Pd(dppf)Cl2 CH2C12 (16 mg, 0.020 mmol) in CH3CN H20 (8 mL/1.5 mL) was stirred under nitrogen at 75 °C for 4 h. The mixture was partitioned between EtOAc and water. The organic layer was separated and the aqueous layer was further extracted with EtOAc. The combined organic layers were dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The residue was purified by preparative TLC, eluting with EtO Ac/petroleum ether/ DCM (2: 1 : 1, v/v/v) to afford N-(5-(l- (difluoromethyl)cyclopropyl)isoxazol-3-yl)-2-(4-(2-((l,3-dimethyl-lH-pyrazol-4- yl)amino)pyrimidin-5-yl)-2-fluorophenyl)acetamide as a pale yellow solid (54 mg, 55%). XH MR (400 MHz, DMSO-<i6) δ 11.34 (br s, 1H), 9.00 (s, 1H), 8.75 (s, 2H), 7.83 (s, 1H), 7.55 (d, J= 10.4 Hz, 1H), 7.49 (d, J= 8.8 Hz, 1H), 7.43 (t, J= 7.6 Hz, 1H), 6.83 (s, 1H), 6.06 (t, J= 55.2 Hz, 1H), 3.80 (s, 2H), 3.74 (s, 3H), 2.11 (s, 3H), 1.31 (m, 4H). LCMS (ES+APCI) m/z 498.0 (M+H)+.
Example 14
Preparation of 2-(4-(2-((3-amino-l-methyl-lH-pyrazol-4-yl)amino)pyrimidin-5-yl)-2- fluorophenyl)-JV-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide (P-251)
[0349] Step 1: To a mixture of l-methyl-lH-pyrazol-3-ylamine (5.0 g, 51.5 mmol) and Et3N (15.6 g, 154 mmol) in toluene (50 mL) was added dropwise Ac20 (7.90 g, 77.4 mmol) at 20 °C and the mixture was stirred at 40 °C for 2 h. After cooling to rt and concentrated under reduced pressure. The residue was suspended in DCM (130 mL) and the solid was collected by filtration to afford N-(l-methyl-lH-pyrazol-3-yl)acetamide as a white solid (4.2 g, 59%).
Step 2:
[0350] Step 2: To a solution of N-(l -methyl- lH-pyrazol-3-yl)acetamide (2.0 g, 14 mmol) in concentrated H2SO4 (5 mL) at -10 °C was added ΚΝΟ3 (1.53 g, 15.1 mmol) portion wise. The suspension was stirred at -10 °C for 2 h, and then poured into ice-water and extracted with DCM (3 x50 mL). The combined organic layers were dried over anhydrous NazSOzt, filtered and concentrated under reduced pressure. The residue was purified by column chromatography on silica gel eluting with DCM MeOH (100: 1, v/v) to afford N-(l-methyl-4-nitro-lH-pyrazol-3- yl)acetamide as a white solid (1.3 g, 49%).
[0351] Step 3: To a solution of N-(l-methyl-4-nitro-lH-pyrazol-3-yl)acetamide (600 mg, 3.26 mmol) in EtOH (20 mL) was added Pd/C (60 mg). The suspension was stirred at 20 °C for 16 h under ¾, filtered and concentrated under reduced pressure. The residue was purified by column chromatography on silica gel eluting with DCM/MeOH (50: 1, v/v) to afford N-(4-amino- 1 - methyl-lH-pyrazol-3-yl)acetamide as a brown oil (500 mg, 100%)
Step 4:
[0352] Step 4: To a solution of N-(4-amino-l-methyl-lH-pyrazol-3-yl)acetamide (200 mg, 1.30 mmol) in DMSO (10 mL) were added DIEA (340 mg, 2.63 mmol) and 5-bromo-2- chloropyrimidine (315 mg, 1.63 mmol). The suspension was heated at 120 °C for 1.5 h. The mixture was diluted with water (20 mL) and extracted with EtOAc (3 30 mL). The combined organic layers were washed with water (2x20 mL), brine (20 mL), dried over anhydrous Na2S04, filtered and concentrated under reduced pressure. The residue was purified by column chromatography on silica gel eluting with petroleum ether/EtOAc (1 :2, v/v) to afford N-(4-((5- bromopyrimidin-2-yl)amino)-l-methyl-lH-pyrazol-3-yl)acetamide as a yellow solid (165 mg, 41%).
Step 5:
[0353] Step 5: To a solution of N-(4-((5-bromopyrimidin-2-yl)amino)-l-methyl-lH-pyrazol- 3-yl)acetamide (120 mg, 0.39 mmol) in dioxane (5 mL) was added 6 M HC1 (25 mL). The suspension was heated at 60 °C for 2.5 h and concentrated under reduced pressure. The residue was adjusted to pH about 7 with saturated aq. NaHC03 and extracted with EtOAc (3 x 10 mL). The combined organic layers were washed with brine, dried over anhydrous a2S04, filtered and concentrated under reduced pressure. The residue was purified by column chromatography
on silica gel eluting with DCM/MeOH (100: 1, v/v) to afford ^-(S-bromopyrimidin^-yl)-!- methyl-lH-pyrazole-3,4-diamine as a yellow solid (100 mg, 96%).
Step 6:
[0354] Step 6: To a solution of 2-(2-fluoro-4-(4,4,5,5-tetramethyl-l,3,2-dioxaborolan-2- yl)phenyl)-N-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide (136 mg, 0.30 mmol) and N4-(5-bromopyrimidin-2-yl)-l-methyl-lH-pyrazole-3,4-diamine (80 mg, 0.30 mmol) in C¾CN (10 mL) and H20 (2 mL) were added Na2C03 (95 mg, 0.90 mmol) and
PdCl2(dppf)-DCM (22 mg, 0.027 mmol). The mixture was heated at 75 °C for 5 h, cooled to rt and concentrated under reduced pressure. The residue was purified by column chromatography on silica gel eluting with DCM MeOH (50: 1, v/v) to afford 2-(4-(2-((3-amino-l-methyl-lH- pyrazol-4-yl)amino)pyrimidin-5-yl)-2-fluorophenyl)-N-(5-(l-
(trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide as a white solid (60 mg, 39%). LH NMR (400 MHz, DMSO-i¾) δ 11.43 (br s, 1H), 8.91 (s, 1H), 8.75 (s, 2H), 7.69 (s, 1H), 7.59-7.53 (m, 1H), 7.51-7.47 (m, 1H), 7.46-7.39 (m, 1H), 6.92 (s, 1H), 4.61 (s, 2H), 3.80 (s, 2H), 3.598 (s, 3H), 1.56-1.51 (m, 2H), 1.50-1.44 (m, 2H). LCMS (ESI) mlz 517.2 (M+H)+.
Example 15
Preparation of A/-(4-((5-(3-fluoro-4-(2-oxo-2-((5-(l-(trifluoromethyl)cyclopropyl)isoxazol- 3-yl)amino)ethyl)phenyl)pyrimidin-2-yl)amino)-l-methyl-lH-pyrazol-3-yl)acrylamide (P-
253)
[0355] Step 1: To a mixture of 2-(4-(2-((3 -amino- 1 -methyl- lH-pyrazol-4- yl)amino)pyrimidin-5-yl)-2-fluorophenyl)-N-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3- yl)acetamide from Example 14 (140 mg, 0.27 mmol) in THF (10 mL) were added Et3N (140 mg, 1.38 mmol) and acryloyl chloride (25 mg, 0.28 mmol) dropwise at -10 °C. The mixture was stirred at -10 °C for 0.5 h and concentrated under reduced pressure. The residue was purified by preparative TLC, eluting with DCM/MeOH (15: 1, v/v) to afford N-(4-((5-(3-fluoro-4-(2-oxo-2- ((5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3-yl)amino)ethyl)phenyl)pyrimidin-2-yl)amino)-l- methyl-lH-pyrazol-3-yl)acrylamide as a white solid (60 mg, 39%). LH NMR (400 MHz, DMSO- d6) δ 1 1.42 (br s, 1H), 10.76 (s, 1H), 9.20 (s, 1H), 8.79 (s, 2H), 8.14 (s, 1H), 7.62-7.54 (m, 1H), 7.53-7.40 (m, 2H), 6.92 (s, 1H), 6.54 (dd, J= 16.8, 10.0 Hz, 1H), 6.34 (d, J=16.8 Hz, 1H), 5.82 (d, J = 10.0 Hz, 1H), 3.81 (s, 2H), 3.80 (s, 3H), 1.56-1.50 (m, 2H), 1.50-1.44 (m, 2H). LCMS (ESI) mlz 571.2 (M+H).
Example 16
Preparation of 2-(4-(2-((3-chloro-l-methyl-lH-pyrazol-4-yl)amino)pyrimidin-5-yl)-2- fluorophenylJ-A'-iS-il-^rifluoromethy^cyclopropy^isoxazol-S-ylJacetamide
(P-254)
[0356] Step 1: To a mixture of N4-(5-bromopyrimidin-2-yl)-l-methyl-lH-pyrazole-3,4- diamine from Step 5 of Example 14 (160 mg, 0.59 mmol) in concentrated aqueous HCl (2 mL) at 0 °C was added NaN02 (58 mg, 0.84 mmol). The mixture was stirred at 0 °C for 1 h before CuCl (83 mg, 0.84 mmol) in CHCI3 was added dropwise. The mixture was heated at 55 °C for 2 h and stirred at 20 °C overnight. The mixture was concentrated under reduced pressure. The residue was adjusted to pH about 7 with saturated aq. NaHCC>3, extracted with DCM (3 >< 10 mL). The combined organic layers were washed with brine, dried over anhydrous
filtered and concentrated under reduced pressure. The residue was purified by preparative TLC, eluting with petroleum ether/EtOAc (1 : 1, v/v) to afford 5-bromo-N-(3-chloro-l-methyl-lH-pyrazol-4- yl)pyrimidin-2-amine as a white solid (70 mg, 41%).
Step 2:
[0357] Step 2: To a solution of 2-(2-fluoro-4-(4,4,5,5-tetramethyl-l,3,2-dioxaborolan-2- yl)phenyl)-N-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide (118 mg, 0.26 mmol) and 5-bromo-N-(3-chloro-l-methyl-lH-pyrazol-4-yl)pyrimidin-2-amine (75 mg, 0.26 mmol) in
CH3CN (10 mL) and H20 (2 mL) were added Na2C03 (82 mg, 0.77 mmol) and
PdCl2(dppf)-DCM (19.5 mg, 0.024 mmol). The mixture was heated at 75 °C for 5 h, cooled to rt and concentrated under reduced pressure. The residue was purified by TLC, eluting with petroleum ether/EtOAc (1 : 1, v/v) to afford 2-(4-(2-((3-chloro-l-methyl-lH-pyrazol-4- yl)amino)pyrimidin-5-yl)-2-fluorophenyl)-N-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3- yl)acetamide as a yellow solid (22 mg, 16%). 'HNMR (400 MHz, DMSO- ,) δ 1.43 (br s, 1H), 9.00 (s, 1H), 8.76 (s, 2H), 7.97 (s, 1H), 7.60-7.53 (m, 1H), 7.51-7.47 (m, 1H), 7.47-7.40 (m, 1H), 6.92 (s, 1H), 3.81 (s, 3H), 3.81 (s, 2H), 1.57-1.50 (m, 2H), 1.50-1.44 (m, 2H). LCMS (ESI) mlz 536.1 (M+H)+.
Example 17
Preparation of 2-{4-[2-(3-Cyano-l-methyl-lH-pyrazol-4-ylamino)-pyrimidin-5-yl]-2- fluoro-phenyl}-N-[5-(l-trifluoromethyl-cyclopropyl)-isoxazol-3-yl]-acetamide (P-185)
[0358] Step 1: To a solution of 4-nitro-lH-pyrazole-3-carboxylic acid (1.00 g, 6.37 mmol) in DMF (20 mL) were added K2C03 (1.93 g, 14.01 mmol) and iodomethane (1.99 g, 14.01 mmol), and the mixture was stirred at rt overnight under nitrogen. Water (50 mL) was added and the mixture was extracted with EtOAc (3 x 60 mL). The combined organic layers were washed with brine (25 mL), dried over anhydrous Na2S04 and concentrated. The residue was purified by silica gel chromatography eluting with petroleum ether/ EtOAc (8: lto 1 :2) to afford methyl 1- methyl-4-nitro-lH-pyrazole-3-carboxylate.
Step 2:
[0359] Step 2: To a solution of methyl l-methyl-4-nitro-lH-pyrazole-3-carboxylate (6.0 g, 32.4 mmol) in a mixture of THF (30 mL) and MeOH (20 mL) at 0 °C was added a solution of LiOH (2.6 g, 64,8 mmol) in water (12 mL), and the mixture was stirred at rt for 3 h. The mixture was concentrated and subsequently diluted with water. The aqueous layer was acidified with concentrated HQ to pH~2-3 and the solid was collected by filtration to afford l-methyl-4-nitro- lH-pyrazole-3-carboxylic acid.
Step 3:
[0360] Step 3: To a solution of l-methyl-4-nitro-lH-pyrazole-3-carboxylic acid (1.0 g, 5.85 mmol) in SOCL (10 mL) at 0°C was added catalytic amount of DMF (0.1 mL), and the mixture was heated at refiux for 2 h. The mixture was concentrated under reduced pressure and the residue was diluted with DMF and cooled to 0 °C. Ammonia (0.50g, 15mmol) was added dropwise and the mixture was kept at 0 °C for 30 min. The solid was collected by filtration to afford 1 -methyl -4-nitro- 1 H-py razol e-3 -carboxamide .
[0361] Step 4: To a stirred solution of l-methyl-4-nitro-lH-pyrazole-3-carboxamide (0.5 g, 2.91 mmol) in pyridine (4 mL) at -5 °C was added POCL (i mL) dropwise and the mixture was stirred at rt for lh. The mixture was poured into ice, acidified to pH~2-3 and extracted with EtOAc (3 x 60 mL). The combined organic layers were washed with brine (25 mL), dried over anhydrous NaiS04 and concentrated. The residue was purified by silica gel chromatography,
eluting with petroleum ether/ EtO Ac (8: 1 to 1 :2, v/v), to afford l-methyl-4-nitro-lH-pyrazole-3- carbonitrile.
[0362] Step 5: To a mixture of l-methyl-4-nitro-lH-pyrazole-3-carbonitrile (0.2 g, 1.32 mmol) and H4C1 (0.7 g, 6.58 mmol) in EtOH (25 mL) and H20 (10 mL) at 60 °C was added Fe (0.4 g, 6.58 mmol) and the mixture was stirred for lh at 60 °C. The crude product was purified by silica gel chromatography eluting with petroleum ether (8: 1 tol :2) to afford 4-amino-l- methy 1- 1 H-py razol e-3 -carb onitril e
Step 6:
[0363] Step 6: To a solution of 5-bromo-2-fluoro-pyrimidine (870 mg, 4.92 mmol) and 4- amino-l-methyl-lH-pyrazole-3-carbonitrile (600 mg, 4.92 mmol) in DMSO (20 mL) was added DIEA (1.3 g, 4.92 mmol), and the mixture was stirred at 120 °C for 2 h under N2 After cooling to rt, the mixture was treated with water (10 mL) and extracted with EtO Ac (3 x 60 mL). The combined organic layers were washed with brine (25 mL), dried over anhydrous Na2S04, filtered and concentrated. The residue was purified by reverse phase chromatography (Welch Ultimate XB-C18, 40-70 μιη) eluting with a gradient of 20-95% acetonitrile in water to afford 4-((543romopyrimidin-2-yl)amino)- 1 -methyl- 1 H-pyrazole-3 -carbonitrile .
Step 7:
[0364] Step 7: To a solution of 2-(2-fluoro-4-(4,4,5,5-tetramethyl-l,3,2-dioxaborolan-2- yl)phenyl)-N-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide (164 mg, 0.36 mmol) and 4-(5-bromo-pyrimidin-2-ylamino)-l-methyl-lH-pyrazole-3-carbonitrile (100 mg, 0.36 mmol) in CH3CN (15 mL) and H20 (3 mL) were added Na2C03 (76 mg, 0.72 mmol) and PdCi2(dppf) DCM (60 mg, 0.08 mmol), and the mixture was heated at 80 °C overnight under N2. The mixture was concentrated to dryness under reduced pressure. Water (20 mL) was added and the mixture was extracted with EtOAc (3 x 30 mL). The combined organic layers were washed with brine (15 mL), dried over anhydrous Na2SC)4, filtered and concentrated. The crude product was purified by reverse phase chromatography (Welch Ultimate XB-C18, 40-70 μιη) eluting with a gradient of 10-70% acetonitrile in water to afford 2-(4-(2-((3 -cyano-1 -methyl- 1 H- pyrazol-4-yl)amino)pyrimidin-5-yl)-2-fluorophenyl)-N-(5-(l-
(trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide. LH NMR (400 MHz, DMSO-i ) δ 11.43 (s, 1H), 9.79 (s, 1H), 8.84 (s, 2H), 8.16 (s, 1H), 7.61-7.46 (m, 3H), 6.92 (s, 1H), 3.94 (s, 3H), 3.82 (s, 2H), 1.53-1.48 (m, 4H). LCMS (ESI) mlz 526.8 (M+H)+.
Example 18
Preparation of 2-(2-fluoro-4-(2-((3-hydroxy-l-methyl-lH-pyrazol-4-yl)amino)pyrimidin-5- yl)phenyl)-N-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide (P-255)
[0365] Step 1: To a solution of 5-bromo-N-(3-methoxy-l-methyl-lH-pyrazol-4-yl)pyrimidin- 2-amine (460 mg, 1.63 mmol) in acetic acid (20 mL) was added HBr (5 mL). The mixture was stirred at 90 °C for 4h under N2, and then concentrated to dryness under reduced pressure. The residue was purified by reverse phase chromatography (Welch Ultimate XB-C18, 40-70 μηι) eluting with a gradient of 20-70% acetonitrile in water to afford 4-((5-bromopyrimidin-2- yl)amino)- 1 -methyl- lH-pyrazol-3 -ol .
Step 2:
[0366] Step 2: To a solution of 2-(2-fluoro-4-(4,4,5,5-tetramethyl-l,3,2-dioxaborolan-2- yl)phenyl)-N-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide (201 mg, 0.44 mmol) and 4-(5-bromo-pyrimidin-2-ylamino)-l-methyl-lH-pyrazol-3-ol (120 mg, 0.44 mmol) in C¾CN (15 mL) and H20 (3 mL) were added Na2C03 (140 mg, 1.32 mmol) and
PdCl2(dppf) DCM (72 mg, 0.09 mmol), and the mixture was heated at 80 °C overnight under N2. The mixture was concentrated to dryness under reduced pressure. Water (20 mL) was added and the mixture was extracted with EtOAc (3 x 30 mL). The combined organic layers were washed with brine (1 mL), dried over anhydrous a2S04_ filtered and concentrated The residue was purified by reverse phase chromatography (Welch Ultimate XB-C18, 40-70 μιη) eluting with a gradient of 10-70% acetonitrile in water to afford 2-{2-fluoro-4-[2-(3-hydroxy-l-methyl-lH- pyrazol-4-ylamino)-pyrimidin-5-yl]-phenyl}-N-[5-(l-trifluoromethyl-cyclopropyl)-isoxazol-3- yl]-acetamide. ^ MR (400 MHz, DMSO-< ) δ 11.40 (s, 1H), 9.88 (brs, 1H), 8.80 (s, 1H), 8.74 (s, 2H), 7.57-7.41 (m, 4H), 6.92 (s, 1H), 3.80 (s, 2H), 3.60 (s, 3H), 1.54-1.45 (m, 4H). LCMS (ESI) mlz 520 (M+H)+.
Example 19
Preparation of 2-(2-fluoro-4-(2-((l-methyl-3-(methylthio)-lH-pyrazol-4- yl)amino)pyrimidin-5-yl)phenyl)-N-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3- yl)acetamide (P-192)
[0367] Step 1 : NaN02 (700 mg, 10.1 mmol) in HC1/H20 (20 mL) was added dropwise to a suspension of l-methyl-4-nitro-lH-pyrazol-3 -amine (1.20 g, 8.45 mmol) in water at 0 °C. The mixture was stirred at -5 °C for lh before it was added dropwise to a mixture of potassium ethyl xanthate (2.40 g, 15.2 mmol) in H20 (5 mL) and 2M Na2C03 (10 mL). The mixture was stirred at 0 °C for lh and then extracted with EtOAc (3 x 50 mL). The combined organic layers were washed with brine (25 mL), dried over anhydrous Na2SC>4, filtered, and concentrated. The residue was purified by silica gel chromatography eluting with petroleum ether/ EtOAc (10: 1 to 1 :2) to afford O-ethyl S-(l -methyl-4-nitro-lH-pyrazol-3-yl) carbonodithioate.
[0368] Step 2: A solution of O-ethyl S-(l-methyl-4-nitro- lH-pyrazol-3-yl) carbonodithioate (430 mg, 1.87 mmol) and KOH (209 mg, 3.74 mmol) in EtOH (20 mL) and H20 (5 mL) was heated at 90 °C overnight under N2. The mixture was concentrated to dryness under reduced pressure, and then water (20 mL) was added and the mixture was extracted with EtOAc (3 x 30 mL). The combined organic layers were washed with brine (15 mL), dried over anhydrous Na2S04, filtered and concentrated. The residue was purified by silica gel chromatography eluting with petroleum ether/ EtOAc (5 : 1 to 1 : 1) to afford l-methyl-4-mtro- lH-pyrazole-3-thiol.
[0369] Step 3: To a solution of l-methyl-4-nitro-lH-pyrazole-3 -thiol (0.15 g, 0.94 mmol) in DMF (10 mL) were added K2C03 (0.16 g, 1.12 mmol) and iodomethane (0.15 g, 1.04 mmol), and the mixture was stirred at it overnight under N2. Water (20 mL) was added and the mixture was extracted with EtOAc (3 x 30 mL). The combined organic layers were washed with brine (15 mL), dried over anhydrous Na2S04, filtered, and concentrated. The residue was purified by
silica gel chromatography eluting with petroleum ether/ EtO Ac (10: 1 to 2: 1) to afford 1-methyl- 3-methylsulfanyl-4-nitro-lH-pyrazole.
[0370] Step 4: To a mixture of l-methyl-3-methylsulfanyl-4-nitro-lH-pyrazole (0.1 1 g, 0.66 mmol) and H4C1 (0.28 g, 5.28 mrao!) in EtOH (20 mL) and H20 (4 mL) at 60°C was added Fe (0.2 g, 3.29 mmol), and the resulting mixture was stirred for a further 1 h at 60 °C. The mixture was concentrated and the residue was purified by silica gel chromatography eluting with petroleum ether/ EtOAc (10: 1 to 1 : 1) to afford l-methyl-3-methylsulfanyl-lH-pyrazol-4- ylamine.
Step 5:
[0371] Step 5: To a solution of 5-bromo-2-chloro-pyrimidine (108 mg, 0.56 mmol) and 1- methyl-3-methylsulfanyl-lH-pyrazol-4-ylamine (80 mg, 0.56 mmol) in DMSO (8 mL) was added DIEA (144 mg, 1.12 mmol). The mixture was stirred at 100 °C for 6 h under N2 and then allowed to cool to rt. The mixture was purified by reverse phase chromatography (Welch Ultimate XB-C18, 40-70 μιη) eluting with a gradient of 20-95% acetonitrile in water to afford 5- bromo-N-(l-methyl-3-(methylthio)-lH-pyrazol-4-yl)pyrimidin-2-amine.
Step 6:
[0372] Step 6: To a solution of 2-(2-fluoro-4-(4,4,5,5-tetramethyl-l,3,2-dioxaborolan-2- yl)phenyl)-N-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide (50 mg, 0.11 mmol)
and 5-bromo-N-(l-methyl-3-(methylthio)-lH-pyrazol-4-yl)pyrimidin-2-amine (30 mg, 0.10 mmol) in CH3CN (10 mL) and H20 (3 mL) were added Na2C03 (21 mg, 0.20 mmol) and PdCl2(dppf) DCM (10 mg, 0.01 mmol), and the mixture was heated at 80 °C for 2h under N2. The mixture was concentrated to dryness under reduced pressure. Water (20 mL) was added and the mixture was extracted with EtOAc (3 x 30 mL). The combined organic layers were washed with brine (15 mL), dried over anhydrous a2S04_ filtered and concentrated. The residue was purified by reverse phase chromatography (Welch Ultimate XB-C18, 40-70 μηι) eluting with a gradient of 10-60% acetonitrile in water to afford 2-(2-fluoro-4-(2-((l-methyl-3-(methylthio)- lH-pyrazol-4-yl)amino)pyrimidin-5-yl)phenyl)-N-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol- 3-yl)acetamide. LH NMR (400 MHz,CDOD3) δ 8.72 (s, 2H), 8.10 (s, 1H), 7.50-7.30 (m, 3H), 6.90 (s, 1H), 3.89 (s, 3H), 3.83 (s, 2H), 2.38 (s, 3H), 1.53-1.43 (m, 4H). LCMS (ESI) mlz 548 (M+H)+.
Example 20
Preparation of 2-(2-fluoro-4-(2-((l-methyl-3-vinyl-lH-pyrazol-4-yl)amino)pyrimidin-5- yl)phenyl)-iV-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide (P-198)
[0373] Step 1: To a solution of 3-iodo-l-methyl-4-nitro-lH-pyrazole from step 1 of Example 22 (500 mg, 1.98 mmol) and potassium trifluoro(vinyl)borate (263 mg, 1.98 mmol) in CH3CN (15 mL) and H20 (3 mL) were added Na2C03 (420 mg, 3.96 mmol) and PdCl2(dppf) DCM (160 mg, 0.08 mmol), and the mixture was heated at 80 °C overnight under N2. The crude product was purified by silica gel chromatography eluting with petroleum ether in EtOAc (5 : 1 to 1 :2) to afford 1 -methyl -4-nitro-3 -vinyl - 1 H-pyrazol e.
Step 2:
[0374] Step 2: To a mixture of l-methyl-4-nitro-3-vinyl-lH-pyrazole (0.13 g, 0.85 mmol) and NH4C1 (0.36 g, 6.80 mmol) in EtOH (20 mL) and H20 (5 mL) at 60 °C was added Fe (0.23 g, 4.25 mmol), and the resulting mixture was stirred for Ih at 60 °C. The crude product was purified by silica gel chromatography eluting with petroleum ether/ EtOAc (5: 1-1 :2, v/v) to afford l-methyl-3-vinyl-lH-pyrazol-4-amine.
Step 3:
[0375] Step 3: To a solution of 5-bromo-2-chloro-pyrimidine (126 mg, 0.65 mmol) and 1- methyl-3-vinyl-lH-pyrazol-4-amine (80 mg, 0.65 mmol) in DMSO (8 mL) was added DIEA (168 mg, 1.30 mmol), and the mixture was stirred at 110 °C for 5 h under N2. After cooling to rt, the mixture was purified by reverse phase chromatography (W elch Ultimate XB-C 18, 40-70 μηι) eluting with a gradient of 20-95% acetonitrile in water to afford 5-bromo-N-(l-methyl-3- vinyl-lH-pyrazol-4-yl)pyrimidin-2-amine.
Step 4:
[0376] Step 4: To a solution of 2-(2-fluoro-4-(4,4,5,5-tetramethyl-l,3,2-dioxaborolan-2- yl)phenyl)-N-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide (97 mg, 0.22 mmol) and 5-bromo-N-(l-methyl-3-vinyl-lH-pyrazol-4-yl)pyrimidin-2-amine (60 mg, 0.22 mmol) in 1,4-dioxane (10 mL) and H20 (3 mL) were added Na2C03 (47 mg, 0.44 mmol) and
PdCl2(dppf) DCM (36 mg, 0.04 mmol), and the mixture was heated at 100 °C lh under N2. The mixture was concentrated to dryness under reduced pressure. Water (20 mL) was added and the
mixture was extracted with DCM (3 x 30 mL). The combined organic layers were washed with brine (15 mL), dried over anhydrous a2SC>4, filtered and concentrated. The residue was purified by column chromatography eluting with a gradient of DCM/CH3OH (50: 1-10: 1, v/v) to afford 2-(2-fluoro-4-(2-((l-methyl-3-vinyl-lH-pyrazol-4-yl)amino)pyrimidin-5-yl)phenyl)-N-(5- (l-(trifiuoromethyl)cyclopropyl)isoxazol-3-yl)acetamide. XH NMR (400 MHz, DMSO-<a¾ δ 11.43 (s, 1H), 9.21 (s, 1H), 8.77 (s, 2H), 7.95 (s, 1H), 7.58-7.42 (m, 3H), 6.92 (s, 1H), 6.84-6.77 (m, 1H), 5.72 (dd, J = 17.6, 2.4 Hz, 1H), 5.12 (dd, J= 6.4, 2.0 Hz, 1H), 3.39 (s, 3H), 3.22 (s, 2H), 1.55-1.46 (m, 4H). LCMS (ESI) mlz 528 (M+H
Example 21
Preparation of 2-(4-(2-((2,3-dihydropyrazolo [5,1-Z>] oxazol-7-yl)amino)pyr imidin-5-yl)-2- fluorophenyl)-Ar-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide (P-205)
Step 1:
[0377] Step 1: To a solution of diethyl 2-(ethoxymethylene)malonate (10.0 g, 46.2 mmol) and 2-hydrazinylethanol (3.52 g, 46.2 mmol) in DMF (100 mL) was added K2C03 (6.38 g, 46.2 mmol), and the mixture was heated at 80 °C for 2 h under N2. The mixture was filtered through celite washing with DMF (2 x 20 mL), and the combined filtrates were concentrated to dryness under reduced pressure. The residue was dissolved in DCM (200 mL), and PPI13 (12.1 g, 46.2 mmol), imidazole (3.14 g, 46.2 mmol) and I2 (23.4 g, 92.4 mmol) were added at 0 °C under N2. The mixture was stirred at rt overnight under N2. Saturated aqueous Na2S203 (200 mL) was added, and the mixture was extracted with DCM (3 x 200 mL). The combined organic layers were washed with brine (100 mL), dried over anhydrous Na2SC>4, filtered and concentrated to dryness under reduced pressure. The residue was purified by reverse phase chromatography (Welch Ultimate XB-C18, 40-70 μπι) eluting with a gradient of 10-60% acetonitnle in water to afford ethyl 2,3-dihydropyrazolo[5,l-b]oxazole-7-carboxylate.
Step 2:
[0378] Step 2: To a solution of ethyl 2,3-dihydropyrazolo[5, l-Z>]oxazole-7-carboxylate (500 mg, 2.75 mmol) in H20 (5 mL) was added KOH (308 mg, 5.50 mmol). The mixture was stirred at rt overnight under N2. The mixture was treated with 1M HCl to adjust the pH to 3 to about 4. The solid was collected by filtration, washed with H20 (2 x 5 mL) and dried under high vacuum to afford 2,3-dihydropyrazolo[5, l- ]oxazole-7-carboxylic acid.
Step 3:
[0379] Step 3: To a solution of 2,3-dihydropyrazolo[5, l-5]oxazole-7-carboxylic acid (180 mg, 1.17 mmol) in 1,4-dioxane (5 mL) were added DIEA (302 mg, 2.34 mmol), benzyl alcohol (632 mg, 5.85 mmol) and DPP A (386 mg, 1.40 mmol), and the mixture was heated at 90 °C overnight under N2. The mixture was concentrated to dryness under reduced pressure, and the residue was purified by reverse phase chromatography (Welch Ultimate XB-C18, 40-70 μηι) eluting with a gradient of 10-60% acetonitrile in water to afford benzyl (2,3- dihydropyrazolo[5, 1 -6]oxazol-7-yl)carbamate.
[0380] Step 4: To a solution of benzyl (2,3-dihydropyrazolo[5, l- ]oxazol-7-yl)carbamate (120 mg, 0.463 mmol) in EtOH (5 mL) was added 10% Pd/C (24 mg), and the suspension was stirred under H2 at rt for 2 h. The mixture was filtered washing with EtOH (2 x 5 mL), and the filtrate was concentrated to dryness under reduced pressure to afford 2,3-dihydropyrazolo[5, l- >]oxazol-7-amine.
Step 5:
[0381] Step 5: To a solution of 2,3-dihydropyrazolo[5,l-6]oxazol-7-amine (50 mg, 0.40 mmol) and 5-bromo-2-chloropyrimidine (77 mg, 0.40 mmol) in DMSO (3 mL) was added DIEA (103 mg, 0.80 mmol), and the mixture was heated at 120 °C for 1 h under N2. The mixture was purified by reverse phase chromatography (Welch Ultimate XB-C18, 40-70 μηι) eluting with a gradient of 10-50% acetonitrile in water to afford N-(5-bromopyrimidin-2-yl)-2,3- dihydropyrazolo[5, 1 -&]oxazol-7-amine.
Step 6:
[0382] Step 6: To a solution of 2-(2-fluoro-4-(4,4,5,5-tetramethyl-l,3,2-dioxaborolan-2- yl)phenyl)-N-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide (100 mg, 0.22 mmol) and N-(5-bromopyrimidin-2-yl)-2,3-dihydropyrazolo[5,l-¾]oxazol-7-amine (62 mg, 0.22 mmol) in 1,4-dioxane (5 mL) and H2O (1 mL) were added Na2CC>3 (47 mg, 0.44 mmol) and
PdCi2(dppf) DCM (18 mg, 0.022 mmol), and the mixture was heated at 75 °C overnight under N2. The mixture was purified by reverse phase chromatography (Welch Ultimate XB-C18, 40- 70 μπι) eluting with a gradient of 10-60% acetonitrile in water, then further purified by crystallization from Et20 (20 mL)/EtOH (4 mL) to afford 2-(4-(2-((2,3-dihydropyrazolo[5, l- b]oxazol-7-yl)amino)pyrimidin-5-yl)-2-fluorophenyl)-N-(5-(l-
(trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide. LH NMR (400 MHz, DMSO-i&) δ 11.40 (br s, 1H), 8.71 (br s, 1H), 8.69 (s, 2H), 7.52 (d, J= 11.6 Hz, 1H), 7.46 (d, J= 8.0 Hz, 1H), 7.42 (t, J = 8 0 Hz, 1H), 7.31 (s, 1H), 6 92 (s, 1H), 5.07 (t, J= 8.0 Hz, 2H), 4.28 (t, J= 8.0 Hz, 2H), 3.82 (s, 2H), 1.55-1.50 (m, 2H), 1.49-1.45 (m, 2H). LCMS (ESI) mlz 530 (M+H)+.
Example 22
Preparation of 22-{4-[2-(3-ethynyl-l-methyl-lH-pyrazol-4-ylamino)-pyrimidin-5-yl]-2- fluoro-phenyl}-N-[5-(l-trifluoromethyl-cyclopropyl)-isoxazol-3-yl]-acetamide (P-211)
[0383] Step 1: To a solution of l-methyl-4-nitro-lH-pyrazol-3-ylamine (2.0 g, 14.08 mmol) in HC1 (30 mL) at -10 °C was added NaN02 (1.2 g, 16.9 mmol). After stirring for 20 min at -10 °C, a solution of KI (3.03 g, 18.3 mmol) in water (5 mL) was added and the mixture was stirred at -5 °C for lh. Water (50 mL) was added and the mixture was extracted with EtOAc (3 x 60 mL). The combined organic layers were washed with brine (25 mL), dried over anhydrous Na2SC>4 and filtered. The crude product was purified by silica gel chromatography, eluting with petroleum ether/ethyl acetate (10: 1 to 2: 1), to afford 3-iodo-l-methyl-4-nitro-lH-pyrazole.
Step 2:
[0384] Step 2: A solution of 3-iodo-l -methyl-4-nitro-lH-pyrazole (1.0 g, 3.95 mmol), ethynyltriisopropylsilane (700 mg, 3.95 mmol), PdCl2(PPh3P)2 (300 mg, 0.40 mmol), Cul (130 mg, 0.59 mmol), and Et3N (2 mL) in DMF (20 mL) under N2 was heated at rt overnight. Water (30 mL) was added and the mixture was extracted with EtOAc (3 x 50 mL). The combined organic layers were washed with brine (30 mL), dried over anhydrous Na2S04j filtered and concentrated. The residue was purified by silica gel chromatography eluting with
petrol eum/ethyl acetate (10: 1 to 3 : 1) to afford l-methyl-4-nitro-3-((triisopropylsilyl)ethynyl)- lH-pyrazole.
Step 3:
[0385] Step 3: To a mixture of l-methyl-4-nitro-3-[(triisopropylsilanyl)-ethynyl]-lH-pyrazole (0.5 g, 1.63 mmoi) and NH4C1 (0.7 g, 13.2 mmol) in EtOH (30 roL) and H20 (5 mL) at 60 °C was added Fe (0.46 g, 8, 14 mmol) and the mixture was stirred for 1 h at 60 °C. The crude product was purified by column chromatography eluting with petroleum/ethyl acetate (8: 1 to 1 :2), to afford l-methyl-3-((triisopropylsilyl)ethynyl)-lH-pyrazol-4-amine.
Step 4:
[0386] Step 4: To a solution of 2,5-dibromo-pyrimidine (385 mg, 1.62 mmol) and 1-methyl- 3-((triisopropylsilyl)ethynyl)-lH-pyrazol-4-amine (300 mg, 1.08 mmol) in DMSO (20 mL) was added DIEA (279 mg, 2.16 mmol), and the mixture was stirred at 120 °C overnight under N2. After cooling to rt, the mixture was purified by reverse phase chromatography (Welch Ultimate XB-C18, 40-70 μηι) eluting with a gradient of 60-95% acetonitrile in water to afford 5-bromo- N-(l-methyl-3-((triisopropylsilyl)ethynyl)-lH-pyrazol-4-yl)pyrimidin-2-amine.
Step 5:
[0387] Step 5: To a solution of 2-(2-fluoro-4-(4,4,5,5-tetramethyl-l,3,2-dioxaborolan-2- yl)phenyl)-N-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide (208 mg, 0.46 mmol) and 5-bromo-N-(l-methyl-3-((triisopropylsilyl)ethynyl)-lH-pyrazol-4-yl)pyrimidin-2-amine (200 mg, 0.46 mmol) in 1,4-dioxane (20 mL) and H20 (4 mL) were added Na2C03 (98 mg, 0.92 mmol) and PdCl2(dppf) DCM (75 mg, 0.09 mmol), and the mixture was heated at 100 °C for 2h
under N2. The mixture was concentrated to dryness under reduced pressure. Water (20 mL) was added and the mixture was extracted with EtOAc (3 x 30 mL). The combined organic layers were washed with brine (15 mL), dried over anhydrous NaiSO^ filtered and concentrated. The crude product was purified by reverse phase chromatography (Welch Ultimate XB-C18, 40-70 μηι) eluting with a gradient of 60-95% acetonitrile in water to afford 2-(2-fluoro-4-(2-((l- methyl-3-((triisopropylsilyl)ethynyl)-lH-pyrazol-4-yl)amino)pyrimidin-5-yl)phenyl)-N-(5-(l- (trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide.
Step 6:
[0388] Step 6: To a solution of 2-[2-fluoro-4-(2-{ l-methyl-3-[(triisopropylsilanyl)-ethynyl]- lH-pyrazol-4-ylamino}-pyrimidin-5-yl)-phenyl]-iV-[5-(l-trifluoromethyl-cyclopropyl)-isoxazol- 3-yl]-acetamide (100 mg, 0.15 mmol) in THF (10 mL) was added excess TBAF and the mixture was stirred at rt for 1 h under N2. The mixture was concentrated under reduced pressure, and the residue was purified by reverse phase chromatography (Welch Ultimate XB-C18, 40-70 μιη) eluting with a gradient of 20-95% acetonitrile in water to afford 2-(4-(2-((3-ethynyl-l-methyl- lH-pyrazol-4-yl)amino)pyrimidin-5-yl)-2-fluorophenyl)-N-(5-(l-
(trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide. ¾ NMR (400 MHz, DMSO-i¾) δ 11.41 (s, 1H), 8.88 (s, 1H), 8.78 (s, 2H), 8.00 (s, 1H), 7.58-7.44 (m, 3H), 6.92 (s, 1H), 4.26 (s, 1H), 3.84 (s, 3H), 3.81 (s, 2H), 1.52-1.48 (m, 4H). LCMS (ESI) mlz 526 (M+H)+.
Example 23
Preparation of 2-(2-fluoro-4-(2-((l-methyl-3-(methylamino)-lH-pyrazol-4- yl)amino)pyrimidin-5-yl)phenyl)-Air-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3- yl)acetamide (P-212)
[0389] Step 1: To a mixture of l-methyl-lH-pyrazol-3-amine (500 mg, 5 mmol), Et3N (1 g, 10 mmol) and catalytic amount of 4-dimethylaminopyridine in DCM at 0 °C was added Βο¾0 (2.2 g, 10 mmol) and the mixture was stirred at rt for 3 h. The mixture was diluted with DCM (50 mL), washed with brine, dried over anhydrous Na2SC> , filtered and concentrated under reduced pressure to afford tert-b ty\ (l-methyl-lH-pyrazol-3-yl)carbamate.
Step 2:
Mel
N— . N—
BocHN N N
Boc
[0390] Step 2: A mixture of fe -butyl ( 1 -methyl- lH-pyrazol-3 -yl)carbamate (400 mg, 2 mmol) and NaH (120 mg, 3 mmol) in DMF (20 mL) was stirred at rt for 40 min before iodom ethane (850 mg, 6 mmol) was added. The mixture was stirred at rt overnight, then treated with water and extracted with EtOAc. The organic layer was washed with brine, dried over anhydrous NaiSOzt, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography eluting with DCM/MeOH (19: 1) to afford tert-butyl methyl(l- methyl-lH-pyrazol-3-yl)carbamate.
Step 3:
[0391] Step 3: To a solution of teri-b t l methyl(l-methyl-lH-pyrazol-3-yl)carbamate (240 mg, 1.14 mmol) in concentrated H2S04 (2 mL) at -10 °C was added KN03 (120 g, 1.19 mmol) portionwise. The suspension was stirred at -10 °C for 2 h before it was poured into ice-water and extracted with DCM (3 *50 mL). The residue was purified by preparative TLC, eluting with DCM MeOH (19: 1), to afford N,l-dimethyl-4-nitro-lH-pyrazol-3-amine.
[0392] Step 4: To a solution of N, l-dimethyl-4-nitro-lH-pyrazol-3 -amine (80 mg, 0.5 mmol) in EtOAc (10 mL) was added Pd/C (10 mg), and the mixture was stirred at 20 °C for 16 h under H2. The mixture was filtered and concentrated under reduced pressure to afford Λ^,Ι -dimethyl - lH-pyrazole-3,4-di amine.
Step 5:
[0393] Step 5: To a solution of A^,l-dimethyl-lH-pyrazole-3,4-diamine (60 mg, 0.5 mmol) in DMSO (5 mL) were added DIEA (195 mg, 0.65 mmol) and 5-bromo-2-chloropyrimidine (126 mg, 0.65 mmol), and the mixture was heated at 120 °C for 1.5 h. The mixture was diluted with H2O (20 mL) and extracted with EtOAc (3 x30 mL). The combined organic layers were washed with water (2><20 mL) and brine (20 mL), dried over anhydrous Na2SC>4, filtered and concentrated under reduced pressure. The residue was purified by preparative TLC eluting with DCM MeOH (15: 1) to afford -(5-bromopyrimidin-2-yl)-N3, 1 -dimethyl- lH-pyrazole-3, 4- diamine.
Step 6:
[0394] Step 6: To a solution of 2-(2-fluoro-4-(4,4,5,5-tetramethyl-l,3,2-dioxaborolan-2- yl)phenyl)-N-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide (80 mg, 0.18 mmol) and A^-(5-bromopyrimidin-2-yl)-N3, l-dimethyl-lH-pyrazole-3,4-diamine (50 mg, 0.18 mmol) in CH3CN (5 niL) and H20 (1 mL) were added Na2C03 (57 mg, 0.54 mmol) and PdCl2(dppf) DCM (14 mg, 0.02 mmol). The mixture was heated at 75 °C for 4 h before it was cooled to r.t. and concentrated under reduced pressure. The residue was purified by preparative TLC, eluting with DCM/MeOH (19: 1), to afford 2-(2-fluoro-4-(2-((l-methyl-3-(methylamino)-lH-pyrazol-4- yl)amino)pyrimidin-5-yl)phenyl)-N-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide. ¾ NMR (400 MHz, DMSO-d¾) δ 11.39 (s, 1H), 8.78 (s, 1H), 8.74(s, 2H), 7.68 (s, 1H), 7.55- 7.42 (m, 3H), 6.92 (s, 1H), 3.80 (s, 2H), 3.63 (s, 3H), 2.71 (s, 3H), 1.52-1.47 (m, 4H). LCMS (ESI) mlz 530 (M+H)+.
Example 24
Preparation of 2-(4-(2-((3-ethyl-lH-pyrazol-4-yl)amino)pyrimidin-5-yl)-2-fluorophenyl)-A'- (5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide (P-214)
Step 1:
[0395] Step 1: To a solution of 5-ethyl-4-nitro-lH-pyrazole (350 mg, 2.5 mmol) and 3,4- dihydro-2H-pyran (319 mg, 3.8 mmol) in DCM (20 mL) at 0 °C was added p-TsOH (43 mg, 0.25 mmol), and the mixture was stirred at 0 °C for lh and then at rt overnight. DCM (100 mL) was added, and the mixture was washed with water and brine, dried over Na2S04, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography, eluting with petroleum ether/EtO Ac (10: 1 to 1 :1) to afford a mixture of 3 -ethyl-4-nitro- 1 - (tetrahydro-2H-pyran-2-yl)-lH-pyrazole and 5-ethyl-4-nitro-l-(tetrahydro-2H-pyran-2-yl)-lH- pyrazole.
Step 2:
[0396] Step 2: To a solution of 3-ethyl-4-nitro-l-(tetrahydro-2H-pyran-2-yl)-lH-pyrazole and 5-ethyl-4-nitro-l-(tetrahydro-2H-pyran-2-yl)-lH-pyrazole (557 mg, 2.5 mmol) in MeOH (20 mL) at 0 °C was added 10 % Pd/C (50 mg), and the mixture was stirred under ¾ overnight at rt. DCM (20 mL) was added and the mixture was filtered through the Celite The filtrate was concentrated under reduced pressure to afford a mixture of 3-ethyl-l-(tetrahydro-2H-pyran-2- yl)-lH-pyrazol-4-amine and 5-ethyl-l-(tetrahydro-2H-pyran-2-yl)-lH-pyrazol-4-amine, which was used in the next step without further purification.
Step 3:
[0397] Step 3: To a solution of 3-ethyl-l-(tetrahydro-2H-pyran-2-yl)-lH-pyrazol-4-amine, 5- ethyl-l-(tetrahydro-2H-pyran-2-yl)-lH-pyrazol-4-amine (252 mg, 1.03 mmol) and 5-bromo-2- fluoro-pyrimidine (166 mg, 0.94 mmol) in DMSO (7 mL) was added DIEA (243 mg, 1.88 mmol), and the mixture was stirred at 100 °C for 1.5 h. DCM (100 mL) was added, and the
mixture was washed with brine, dried over a2S04, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography, eluting with petroleum ether/ EtOAc (10: 1 to 2: 1) to afford a mixture of 5-bromo-N-(3 -ethyl- l-(tetrahydro-2H-pyran-2-yl)- lH-pyrazol-4-yl)pyrimidin-2-amine and 5-bromo-N-(5-ethyl-l-(tetrahydro-2H-pyran-2-yl)- lH- pyrazol-4-yl)pyrimidin-2 -amine.
Step 4:
[0398] Step 4: To a solution of 5-bromo-N-(3-ethyl-l-(tetrahydro-2H-pyran-2-yl)-lH- pyrazol-4-yl)pyrimidin-2 -amine, 5-bromo-N-(5-ethyl-l-(tetrahydro-2H-pyran-2-yl)- lH-pyrazol- 4-yl)pyrimidin-2-amine (100 mg, 0.28 mmol), 2-(2-fluoro-4-(4,4,5,5-tetramethyl-l,3,2- dioxaborolan-2-yl)phenyl)-N-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide (127 mg, 0 28 mmol), and Na2C03 (89 mg, 0.84 mmol) in CH3CN (10 mL) and H20 (2 mL) was added Pd(dppf)Cl2 DCM (21 mg, 0.026 mmol). The mixture was stirred at 70 °C under N2 overnight and concentrated under reduced pressure. DCM (100 mL) was added and the organic layer was washed with brine, dried over Na2SC>4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography eluting with petroleum ether/EtOAc (10: 1 to 1 : 1) to afford a mixture of 2-(4-(2-((3 -ethyl- l-(tetrahy dro-2H-pyran-2-yl)- lH-pyrazol-4-yl)amino)pyrimidin-5-yl)-2-fluorophenyl)-N-(5-(l -
(trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide and 2-(4-(2-((5 -ethyl- l-(tetrahy dro-2H- pyran-2-yl)-lH-pyrazol-4-yl)amino)pyrimidin-5-yl)-2-iluorophenyl)-N-(5-(l-
(trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide.
Step 5:
[0399] Step 5: To a solution of 2-(4-(2-((3-ethyl-l-(tetrahydro-2H-pyran-2-yl)-lH-pyrazol-4- yl)amino)pyrimidin-5-yl)-2-fluorophenyl)-N-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol^ yl)acetamide and 2-(4-(2-((5-ethyl-l-(tetrahydro-2H-pyran-2-yl)-lH-pyrazol-4- yl)amino)pyrimidin-5-yl)-2-fluorophenyl)-N-(5-(l-(tri
yl)acetamide (136 mg, 0.23 mmol) in DCM (10 mL) was added TFA (3 mL), and the mixture was stirred at rt for 1 h and concentrated under reduced pressure. DCM (100 mL) was added and the mixture was washed with saturated NaHCC , water, and brine, dried over Na2SC¼, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography eluting with petroleum ether/EtOAc (10: 1 to 1 : 1), followed by preparative TLC, eluting with petroleum ether/EtOAc (1 : 1). The product was further purified by reverse-phase preparative HPLC (Xunion C18 5 μιη, 20x150 mm, 20-75% B, A: H20 (5 mmol H4HC03), B: acetonitrile, flow rate 20 mL/min, UV 214 nm) to afford 2-(4-(2-((3-ethyl-lH-pyrazol-4-yl)amino)pyrimidin- 5-yl)-2-fluorophenyl)-N-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide.1H NMR
(400 MHz, DMSO- ,) δ 12.27 (br s, 1H), 1 1.40 (s, 1H), 8.85 ( s, 1H), 8.72 (s, 2H), 7.66 (br s, 1H), 7.54 (d, J= 11.6 Hz, 1H), 7.50-7.40 (m, 2H), 6.92 (s, 1H), 3.80 (s, 2H), 2.58 (t, J= 7.2 Hz, 2H), 1.54-1.51 (m, 2H), 1.48-1.45 (m, 2H), 1.14 (t, J= 7.6 Hz, 3H). LCMS (ES+APCI) mlz 516 (M+H)+.
Example 25
Preparation of 2-(2-fluoro-4-(2-((2-(2-methoxyethoxy)thiazol-5-yl)amino)pyrimidin-5- yl)phenyl)-iV-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetaniide (P-155)
[0400] Step 1: To a solution of methyl 2-bromothiazole-5-carboxylate (6.66 g, 30 mmol) and 2-methoxyethan-l-ol (23.0 g, 302 mmol) in DMF (80 mL) was added K2C03 (20.7 g, 150 mmol), and the mixture was heated at 90 °C overnight and then filtered. The filtrate was concentrated under reduced pressure, and the residue was partitioned between water and EtOAc and the aqueous layer was re-extracted with EtOAc. The combined organic layers were dried over anhydrous a2S04, filtered and concentrated. The residue was purified by flash column chromatography, eluting with petroleum ether/EtOAc (6: 1, v/v), to afford 2-methoxyethyl 2-(2- methoxy ethoxy )thiazol e- -carb oxy late .
Step 2:
[0401] Step 2: To a solution of 2-methoxyethyl 2-(2-methoxyethoxy)thiazole-5-carboxylate (4.19 g, 16.1 mmol) in THF MeOH (60 mL/10 mL) was added 1 N aq NaOH (60 mL, 60 mmol), and the mixture was stirred at rt overnight. The mixture was concentrated under reduced pressure and the remaining aqueous solution was adjusted to pH~3-4 and extracted with DCM (3xl00mL). The combined organic layers were dried over anhydrous a2S04, filtered and concentrated to under reduced pressure to afford 2-(2-methoxyethoxy)thiazole-5-carboxylic acid.
Step 3: —
[0402] Step 3: A mixture of 2-(2-methoxyethoxy)thiazole-5-carboxylic acid (1.53 g, 7.5 mmol), DIEA (2.6 mL, 15.3 mmol), DPPA (2.0 mL, 9.3 mmol), and i-BuOH (3 mL, 3 1.6 mmol) in 1,4-dioxane (20 mL) was stirred at 100 °C overnight. The mixture was cooled to rt and purified by reverse phase column chromatography (Welch Ultimate XB-C18, 40-70 μπι), eluting with a gradient of 20-95% acetonitrile in water, to afford teri-butyl (2-(2- methoxyethoxy)thiazol-5-yl)carbamate.
Step 4:
[0403] Step 4: To a solution of 5-bromo-2-fluoropyrimidine (742 mg, 4.2 mmol) and tert- butyl (2-(2-methoxyethoxy)thiazol-5-yl)carbamate (765 mg, 2.8 mmol) in DMF (10 mL) was added K2C03 (800 mg, 5.8 mmol), and the mixture was stirred at 100 °C for 4 h. The mixture was cooled to rt and purified by reverse phase chromatography (Welch Ultimate XB-C18, 40-70 μιη), eluting with a gradient of 30-95% acetonitrile in water, to afford fer/-butyl (5- bromopyrimidin-2-yl)(2-(2-methoxyethoxy)thiazol-5-yl)carbamate.
Step 5:
[0404] Step 5: To a solution of 2-(2-fluoro-4-(4,4,5,5-tetramethyl-l,3,2-dioxaborolan-2- yl)phenyl)-N-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide (154 mg, 0.34 mmol) and fe/ -butyl (5-bromopyrimidin-2-yl)(2-(2-methoxyethoxy)thiazol-5-yl)carbamate (129 mg,
0.30 mmol) in CH3CN (8 niL) and ¾0 (1.5 mL) were added Na2C03 (112 mg, 1.05 mmol) and Pd(dppf)Cl2 CH2CI2 (30 mg, 0.037 mmol), and the mixture was stirred at 75 °C for 22 h under N2. The mixture was cooled to rt and purified by reverse phase column chromatography (Welch Ultimate XB-C18, 40-70 μιη), eluting with a gradient of 50-95% acetonitrile in water, to afford tert-butyl (5-(3-fluoro-4-(2-oxo-2-((5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3- yl)amino)ethyl)phenyl)pyrimidin-2-yl)(2-(2-methoxyethoxy)thiazol-5-yl)carbamate.
Step 6:
[0405] Step 6: To a solution of tert-butyl (5-(3-fluoro-4-(2-oxo-2-((5-(l- (trifluoromethyl)cyclopropyl)isoxazol-3-yl)amino)ethyl)phenyl)pyrimidin-2-yl)(2-(2- methoxyethoxy)thiazol-5-yl)carbamate (137 mg, 0.20 mmol) in CHCI3 (4 mL) was added TFA (4 mL), and the mixture was stirred at rt for 4 h. The mixture was concentrated under reduced pressure and the residue was partitioned between saturated aq NaHCC^ and DCM. The aqueous layer was further extracted with DCM ( 3 x 100 mL). The combined organic layers were dried over anhydrous a2S04, filtered and concentrated. The residue was purified by preparative TLC, eluting with MeOH/DCM (1 :50, v/v), and further purified by reverse phase preparative HPLC (Xbridge CI 8 5 μ m, 100 A 20x150 mm, 30-75% B, A: H20 (5 mmol N¾), B: acetonitrile, flowrate 20 mL/min, UV 214 nm) to afford 2-(2-fluoro-4-(2-((2-(2-methoxyethoxy)thiazol-5- yl)amino)pyrimidin-5-yl)phenyl)-N-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide. 'HNMR (400 MHz, DMS04) δ 11.41 (br s, 1H), 10.60 (s, 1H), 8.86 (s, 2H), 7.61 (dd, J = 11.6, 1.6 Hz, 1H), 7.54 (dd, J= 8.0, 1.6 Hz, 1H), 7.42 (t, J= 8.0 Hz, 1H), 6.92 (s, 1H), 6.86 (s, 1H), 4.43-4.41 (m, 2H), 3.81 (s, 2H), 3.67-3.65 (m, 2H), 3.30 (s, 3H), 1.55-1.51 (m, 2H), 1.48- 1.46 (m, 2H). LCMS (ES-APCI) mlz 579 (M+H)+.
Example 26
Preparation of 2-(2-fluoro-4-(2-((l-oxo-2,3-dihydro-lH-pyrrolizin-6-yl)amino)pyrimidin-5- yl)phenyl)-iV-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamid (P-085)
[04061 Step 1: A mixture of A1C13 (59.89 g, 0.45 mol), anhydrous KC1 (15.67 g, 0.21 mol), and NaCl (14.66 g, 0.25 mol) was heated to 130 °C under N2 until a brown oily solution was formed. Then 3-pyrrol-l-yl-propionitrile (16 g, 0.13 mol) was added rapidly and the mixture was vigorous stirred at 130 °C for 10 min. The hot solution was poured into ice water (250 mL) and the mixture was heated at 90 °C for 2h before it was cooled to rt. The mixture was extracted with EtOAc (3 χ 100 mL) and DCM (3 χ 100 mL). The combined organic layers were washed with brine (3 χ 100 mL), dried over anhydrous a2SC>4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography, eluting with petroleum ether/EtOAc (6: 1 to 1 : 1), to afford 2,3-dihydro-lH-pyrrolizin-l-one.
Step 2:
[0407] Step 2: A solution of 2,3-dihydro-lH-pyrrolizin-l-one (8.75 g, 72.28 mmol) in acetic anhydride (72.28 mL) was cooled to -78 °C under N2. Nitric acid (14.45 ml) was added dropwise and the mixture was allowed to warm slowly to rt and stir at rt for lh. The mixture was poured into ice water (200 mL) and extracted with EtOAc (3 χ 100 mL). The combined organic layers were washed with brine (3 100 mL), dried over anhydrous NaiSC^, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography,
eluting with petroleum ether/EtOAc (6: 1 to 3 : 1), to afford 6-nitro-2,3-dihydro-lH-pyrrolizin-l- one. 5-nitro-2,3-dihydro-lH-pyrrolizin-l-one was also recovered.
Step 3:
[0408] Step 3: To a solution of 6-nitro-2,3-dihydro-lH-pyrrolizin-l-one (2.32 g, 13.97 mmol) in MeOH/DMF (100 mL /15 mL) was added 10% Pd/C (500 mg), and the mixture was stirred under H2 at rt overnight. The mixture was filtered washing with MeOH (2 x 10 mL). The combined filtrates were concentrated under reduced pressure to afford 6-amino-2,3-dihydro-lH- pyrrolizin-l-one.
Step 4:
[0409] Step 4: To a solution of 5-bromo-2-chloro-pyrimidine (1.97 g, 10.21 mmol) in DMF (13 mL) were added DIEA (3.37 ml, 20.42 mmol) and 6-amino-2,3-dihydro-lH-pyrrolizin-l- one (1.39 g, 10.21 mmol), and the mixture was heated in a microwave reactor at 100 °C for 1.5 h. The mixture was cooled to rt, poured into water (50 mL) and extracted with EtOAc (3 χ 50 mL). The combined organic layers were washed with brine (3 χ 50 mL), dried over anhydrous Na2SC>4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromotagraphy, eluting with petroleum ether/EtOAc (6: 1 to 1 : 1), to afford 6-((5- bromopyrimidin-2-yl)amino)-2,3-dihydro-lH-pyrrolizin-l-one.
Step 5:
[0410] Step 5: To a solution of 2-[2-fluoro-4-(4,4,5,5-tetramethyl-[l,3,2]dioxaborolan-2-yl)- phenyl]-N-[5-(l-trifluoromethyl-cyclopropyl)-isoxazol-3-yl]-acetamide (150 mg, 0.33 mmol) and 6-((5-bromopyrimidin-2-yl)amino)-2,3-dihydro-lH-pyrrolizin-l-one (96.8 mg, 0.33 mmol)
in CH3CN (30 niL) and H20 (5 mL) was added Pd(dppf )C12DCM (26.7 mg, 0.033 mmol). The mixture was heated at 80 °C overnight under 2 before it was cooled to rt and concentrated under reduced pressure. The residue was poured into water (10 mL) and extracted with EtOAc (3 x 10 mL). The combined organic layers were washed with brine (5 mL), dried over anhydrous Na2SC>4, filtered and concentrated under reduced pressure. The residue was purified by preparative TLC, eluting with EtO Ac/petroleum ether (1 :2, v/v), then further purified by re- crystallization from EtOAc (20 ml) to afford 2-(2-fluoro-4-(2-((l-oxo-2,3-dihydro-lH- pyrrolizin-6-yl)amino)pyrimidin-5-yl)phenyl)-N-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3- yl)acetamide. LH NMR (400 MHz, DMSO-^) δ 11.41 (s, 1H), 9.85 (s, 1H), 8.82 (s, 2H), 7.70 (d, J= 1.0 Hz, 1H), 7 58 (dd, J = 11.3, 1 6 Hz, 1H), 7.51 (dd, J= 8.0, 1.7 Hz, 1H), 7.44 (t, J = 7.9 Hz, 1H), 6.92 (s, 1H), 6.67 (d, J= 1.2 Hz, 1H), 4.31 (t, J= 5.9 Hz, 2H), 3.81 (s, 2H), 2.97 - 2.92 (m, 2H), 1.56 - 1.51 (m, 2H), 1.50 - 1.45 (m, 2H). LCMS (ESI) m!z 541 (M+H)+.
Example 27
Preparation of 2-(4-(2-((6,7-dihydro-5H-pyrrolo[l,2-a]imidazol-2-yl)amino)pyrimidin-5- yl)-2-fluorophenyl)-iV-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide (P-079)
[0411] Step 1: To a solution of propynoic acid ethyl ester (15 g, 0.15 mmol) in CH3CN (150 mL) was added pyrrolidine (10.8 g, 0.15 mmol), and the mixture was stirred at rt overnight under N2. The mixture was concentrated under reduced pressure, and the crude product was used for next step without purification.
Step 2:
[0412] Step 2: A mixture of 3-pyrrolidin- 1 -yl-acrylic acid ethyl ester (18.0 g, 0.11 mmol) and 4-nitrobenzenediazonium tetrafluoroborate (25 g, 0.11 mmol) in C¾CN (300 mL) was stirred at rt under 2 for 2 h before Et3N (2 ! .5 g, 0.22 mmol) was added, and the resulting mixture was heated at reflux overnight. The mixture was purified by reverse phase column chromatography (Welch Ultimate XB-C18, 40-70 μηι) eluting with a gradient of 5-60% acetonitrile in water to afford ethyl 6,7-dihydro-5H-pyrrolo[l,2-o]imidazole-2-carboxylate.
[0413] Step 3: To a solution of ethyl 6,7-dihydro-5H-pyrrolo[l,2-a]imidazole-2-carboxylate (3.0 g, 16.7 mmol) in ΕίΟΗ (30 mL) at 0 °C was added a solution of NaOH (1. 3 g, 33.3 mmol) in water (6 mL), and the mixture was stirred at rt for 5 h. The mixture was concentrated and subsequently diluted with water and acidified with aq HC1 to pH~2-3. The solid was collected by filtration to afford 6,7-dihydro-5H-pyrrolo[l,2-a]imidazole-2-carboxylic acid.
[0414] Step 4: To a solution of 6,7-dihydro-5H-pyrrolo[l,2-o]imidazole-2-carboxylic acid (2.0 g, 13.2 mmol) in benzyl alcohol (2 mL) were added DIEA (2.7 g, 21.1 mmol) and DPPA (5.43 g, 19.1 mmol), and the mixture was heated at 90 °C overnight under N2. The mixture was concentrated to dryness under reduced pressure, and the residue was purified by reverse phase column chromatography (Welch Ultimate XB-C 18, 40-70 μιη) eluting with a gradient of 10- 80% acetonitrile in water to afford benzyl (6,7-dihydro-5H-pyrrolo[l,2-a]imidazol-2- yl)carbamate.
Step 5:
[0415] Step 5: To a solution of benzyl (6,7-dihydro-5H-pyrrolo[l,2- ]imidazol-2- yl)carbamate (1.30 g, 5.06 mmol) in acetic acid (10 mL) was added HBr in acetic acid (10 mL). The mixture was stirred at rt overnight, and then concentrated to dryness under reduced pressure to afford 6,7-dihydro-5H-pyrrolo[l,2-a]imidazol-2-amine which was used for next step without purification.
[0416] Step 6: To a solution of 5-bromo-2-fluoro-pyrimidine (1.0 g, 4.93 mmol) and 6,7- dihydro-5H-pyrrolo[l,2-a]imidazol-2-amine (0.87 g, 4.93 mmol) in DMSO (20 mL) was added DIEA (1.27 g, 9.86 mmol), and the mixture was stirred at 100 °C for 2 h under 2 before it was allowed to cool to rt. The mixture was purified by reverse phase column chromatography (Welch Ultimate XB-C18, 40-70 μιη) eluting with a gradient of 20-95% acetonitrile in water to afford N-(5-bromopyrimidin-2-yl)-6,7-dihydro-5H-pyrrolo[l,2- ]imidazol-2-amine.
Step 7:
[0417] Step 7: To a solution of 2-(2-fluoro-4-(4,4,5,5-tetramethyl-l,3,2-dioxaborolan-2- yl)phenyl)-N-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide (350 mg, 0.77 mmol) and N-(5-bromopyrimidin-2-yl)-6,7-dihydro-5H-pyrrolo[l,2-a]imidazol-2-amine (200 mg, 0.72 mmol) in 1,4-dioxane (30 mL) and Η2Ο (5 mL) were added Na2C03 (200 mg, 1.89 mmol) and PdCl2(dppf) DCM (80 mg, 0.09 mmol), and the mixture was heated at 100 °C for 1 h under N2. The mixture was concentrated to dryness under reduced pressure and purified by reverse phase chromatography (Welch Ultimate XB-C18, 40-70 μπι) eluting with a gradient of 20-95%
acetonitrile in water to afford 2-(4-(2-((6,7-dihydro-5H-pyrrolo[l,2-a]imidazol-2- yl)amino)pyrimidin-5-yl)-2-fluorophenyl)-N-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3 yl)acetamide. LH NMR (400 MHz, DMSO-< ) δ 11.42 (s, 1H), 8.95 (s, 2H), 7.66-7.45 (m, 3H), 6.92 (s, 1H), 4.63 (s, 2H), 3.83 (s, 2H), 3.51 (t, J= 6.8 Hz, 2H), 2.86 (t, J= 8.0 Hz, 2H), 2.07- 1.99 (m, 2H), 1.55-1.45 (m, 4H). LCMS (ESI) mlz 528 (M+H)+
Example 28
Preparation of 2-(2-fluoro-4-{2-[3-(2-hydroxy-ethyl)-l-methyl-lH-pyrazol-4-ylamino]- pyrimidin-5-yl}-phenyl)-N-[5-(l-trifluoromethyl-cyclopropyl)-isoxazol-3-yl]-acetamide (P-
069)
[0418] Step 1: To a solution of (methoxymethyl)triphenylphosphonium chloride (2.3 g, 6.71 mmol) in THF (50 niL) at 0 °C was added i-BuOK (0.75 g, 6.71 mmol). After 30 min, a solution of l-methyl-4-nitro-lH-pyrazole-3-carbaldehyde (0 8 g, 5.16 mmol) in THF (20 mL) was added The mixture was allowed to warm to rt and stirring was continued for 3h under N2. The mixture was extracted with EtOAc (3 x 60 mL), and the combined organic layers were washed with brine (30 mL), dried over anhydrous Na2S04, filtered, and concentrated The residue was purified by silica gel chromatography, eluting with petroleum ether/ethyl acetate (2: 1 to 1 :2), to afford (i¾-3-(2-methoxy vinyl)- 1 -methyl -4-nitro- lH-pyrazole.
Step 2:
[0419] Step 2: To (£)-3-(2-methoxyvinyl)-l-methyl-4-nitro-lH-pyrazole (0.6 g, 3.28 mmol) in acetone (10 mL) was added 12 N HC1 (6 mL), and the mixture was heated at reflux overnight. The mixture was extracted with EtOAc (3 x 60 mL) and the combined organic layers were washed with brine (30 mL), dried over anhydrous Na2S04, filtered, and concentrated. The residue was purified by silica gel chromatography , eluting with petroleum ether/ethyl acetate (2: 1 to 1 :2), to afford 2-(l-methyl-4-nitro-lH-pyrazol-3-yl)acetaldehyde.
Step 3:
[0420] Step 3: To a solution of 2-(l-methyl-4-nitro-lH-pyrazol-3-yl)acetaldehyde (0.2 g, 1.18 mmol) in MeOH (10 mL) at 0 °C was added NaBH4 (45 mg, 1 .18 mmol), and the mixture was stirred at rt for 1 h. The mixture was extracted with EtOAc (3 x 30 mL) and the combined organic layers were washed with brine (10 mL), dried over anhydrous Na2SC>4, filtered and concentrated. The residue was purified by silica gel chromatography, eluting with petroleum ether/EtOAc (2: 1 to 1 :3), to afford 2-(l-methyl-4-nitro-lH-pyrazol-3-yl)ethanol.
Step 4:
[0421] Step 4: To a solution of 2-(l-methyl-4-nitro-lH-pyrazol-3-yl)ethanol (130 mg, 0.76 mmol) in EtOAc (10 mL) was added 10% Pd/C (26 mg), and the mixture was stirred under ¾ at rt for 1 h. The mixture was filtered washing with EtOAc (2 x 10 mL) and the combined filtrates were concentrated to dryness under reduced pressure to afford 2-(4-amino-l -methyl- lH-pyrazol- 3-yl)ethanol.
Step 5:
[0422] Step 5: To a solution of 5-bromo-2-fluoro-pyrimidine (1 12 mg, 0.64 mmol) and 2-(4- amino-l-methyl-lH-pyrazol-3-yl)-ethanol (90 mg, 0.64 mmol) in DMSO (lOmL) was added DIEA (165 mg, 1.28 mmol), and the mixture was stirred at 100 °C for 2 h under N2. The mixture was allowed to cool to rt and was purified by reverse phase column chromatography (Welch Ultimate XB-C18, 40-70 μτη) eluting with a gradient of 20-95% acetonitnle in water to afford 2-[4-(5-bromo-pyrimidin-2-ylamino)-l-methyl-lH-pyrazol-3-yl]-ethanol.
Step 6:
[0423] Step 6: To a solution of 2-(2-fluoro-4-(4,4,5,5-tetramethyl-l,3,2-dioxaborolan-2- yl)phenyl)-N-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3-yl)acetamide (109 mg, 0.24 mmol) and 2-[4-(5-bromo-pyrimidin-2-ylamino)-l-methyl-lH-pyrazol-3-yl]-ethanol (60 mg, 0.20 mmol) in CH3CN (10 mL) and H20 (3 mL) were added Na2C03 (42 mg, 0.40 mmol) and PdCl2(dppf)-DCM (16 mg, 0.02 mmol), and the mixture was heated at 100 °C for 1 h under N2. The mixture was concentrated to dryness under reduced pressure and the residue was purified by reverse phase chromatography (Welch Ultimate XB-C18, 40-70 μηι) eluting with a gradient of 20-95% acetonitrile in water to afford 2-(2-fluoro-4-(2-((3-(2-hydroxy ethyl)- 1 -methyl- 1H- pyrazol-4-yl)amino)pyrimidin-5-yl)phenyl)-N-(5-(l-(trifluoromethyl)cyclopropyl)isoxazol-3- yl)acetamide. ¾ NMR (400 MHz, DMSO-< ) δ 11.40 (s, IH), 9.07 (s, IH), 8.75 (s, 2H), 7.89 (s, IH), 7.57-7.42 (s, 3H), 6.92 (s, IH), 4.83 (brs, IH), 3.81 (s, 2H), 3.76 (s, 3H), 3.64 (t, J = 6.4 Hz, 2H), 2.73 (t, J= 5.1 Hz, 2H), 1.55-1.46 (m, 4H). LCMS (ESI) mlz 546 (M+H)+.
[0424] The following compounds were prepared in a manner analogous to the syntheses depicted herein. Boronic acids or esters that were not commercially available were prepared in a manner analogous to the syntheses depicted herein. Additional protecting groups readily available to one skilled in the art were used as needed.
[0425] Compounds P-001 - P-225 in TABLE 1A and P-226-237 in TABLE IB below can be made according to the methods described herein, and by making the necessary substitutions to the reactants and/or starting materials, that the skilled artisan would readily be able to do, to anive at these compounds.
TABLE 1A
012
dioxothiolan-
3- yl)-3-ethyl- pyrazol-4- yl]amino]pyr
imidin-5-yl]- 2-fluoro- 3 633.62 634 phenyl]-N- [5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol- 3- yllacetamide
P- 2-[2-fluoro-
013 4-[2-[(l-
Δ · rVy- methyltriazol
-4- yl)amino]pyr
imidin-5- yl]phenyl]- 1 502.42 503
N-[5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol-
3- yl]acetamide
P- 2-[2-fluoro- 014 4-[2-[[l-(2- hydroxy ethyl
)pyrazol-4- yl]amino]pyr
imidin-5- yl]phenyl]- 1 531.46 532
N-[5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol-
3- yl]acetamide
P- 2-[2-fluoro-
015 4-[2-[[l-(2- methoxyethy
l)pyrazol-4- yl]amino]pyr
imidin-5- yl]phenyl]- 1 545.49 546
N-[5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol-
3- yl]acetamide
P- 2-[2-fluoro-
016 4-[2-[(l- r T V methylimida
zol-4- yl)amino]pyr
Tr imidin-5- yl]phenyl]- 1 501.44 502
N-[5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol- yl]acetamide
P- 2-[4-[2-[[l-
017 [2-
(dimethylami
no)-2-oxo- ethyl]pyrazol
-4- yl]amino]pyr
imidin-5-yl]-
3 572.51 573
2-fluoro- phenyl]-N-
[5-[l-
(trifluoromet
hyl)cyclopro
P- 2-[2-fluoro-
024 4-[2-[[l-(2- hydroxyprop
yl)pyrazol-4- yl]amino]pyr
imidin-5- yl]phenyl]- 3 545.49 546
N-[5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol-
3- yl]acetamide
P- 2-[4-[2-[[l-
025 (2- aminopropyl)
pyrazol-4- yl]amino]pyr
imidin-5-yl]-
2-fluoro-
544.5 545 phenyl]-N- [5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol- yl]acetamide
P- 2-[2-fluoro-
026 4- [2-[(6- methoxy-3- pyridyl)amin
o]pyrimidin-
5- yl]phenyl]-
1 528.46 529 N-[5-[l- (trifluoromet
hyl)cyclopro
pyl]isoxazol- 3- yl]acetamide
P- 2-[2-fluoro-
027 4-[2-[(l- methylpyraz
ol-4- yl)amino]-4-
F (trifluoromet
hyl)pyrimidi
n-5- 1 569.43 570 yljphenyl]-
N-[5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol-
3- yllacetamide
P- 2-[2-fluoro-
028 4-[4-methyl-
2-[(l- methylpyraz
ol-4-
F yl)amino]pyr
imidin-5-
1 515.46 516 yljphenyl]-
N-[5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol-
3- yl]acetamide
P- 2-[2-fluoro-
029 4-[2-[(l,3,5- trimethylpyra
zol-4- yl)amino]pyr
F imidin-5- yl]phenyl]- 1 529.49 530
N-[5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol-
3- yl]acetamide
P- 2-[4-[2-[(l,5-
030 dimethylpyra
zol-4- yl)amino]pyr
imidin-5-yl]-
2-fluoro- phenyl]-N- 1 515.46 516
[5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol- 3- yl]acetamide
P- 2-[2-fluoro-
031 4-[2-(4- fluoroanilino
)pyrimidin-5- yl]phenyl]-
N-[5-[l- 1 515.43 516
(trifluoromet
hyl)cyclopro
pyl]isoxazol-
3- yl]acetamide
P- 2-[2-fluoro-
032 4-[2-
(isoxazol-3- ylamino)pyri
midin-5- yl]phenyl]-
2 488.39 489
N-[5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol-
3- yl]acetamide
P- 2-[4-[2-[3-
033 [(dimethylam
ino)methyl]a
nilino]pyrimi
din-5-yl]-2- fluoro- phenyl]-N- 1 554.54 555
[5-[l-
(trifluoromet
hyl)cyclopro
y acetam e
P- 2-[2-fluoro-
048 4-[2-[[l-(3- morpholinop
ropyl)pyrazol
-4- yl]amino]pyr
imidin-5-
3 614.59 615 yljphenyl]-
N-[5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol-
3- yl]acetamide
P- N-[4-[(4-
049 ethylpiperazi
n-1- yl)methyl]-3-
(trifluoromet
hyl)phenyl]-
2-[2-fluoro-
1 596.62 597
4-[2-[(l- methylpyraz
ol-4- yl)amino]pyr
imidin-5- yl]phenyl]ac
etamide
P- 2-[2-fluoro-
050 4-[2-[[l-[2- (2- methoxyetho
xy)ethyl]pyra
zol-4- yl]amino]pyr
imidin-5- 3 589.54 590 yl]phenyl]-
N-[5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol-
3- yllacetamide
P- 2-[4-[2-[[l -
051 [(i - aminocyclop
ropyl)methyl
1 ]pyrazol-4- yl]amino]pyr
imidin-5-yl]-
2-fluoro- 3 556.51 557 phenyl]-N-
[5-[ l -
(trifluoromet
hyl)cyclopro
pyl]isoxazol- 3- yllacetamide
P- 2-[2-fluoro-
052 4-[2-(4- methyl sulfon
o i f Y o % ylanilino)pyr
imidin-5- yl]phenyl]-
1 575.53 576
N-[5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol-
T J..
yl]acetamide
P- 2-[2-fluoro- 053 4-[2-
(isoindolin- 5- ylamino)pyri
midin-5- yl]phenyl]- 1 538.5 539
N-[5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol-
3- yl]acetamide
yljacetamide
P- 2-[2-fluoro-
060 4- [2-[(2- methoxy-4- pyridyl)amin
o]pyrimidin-
F 5- yl]phenyl]-
1 528.46 529 N-[5-[l- (trifluoromet
hyl)cyclopro
pyl]isoxazol- 3- yl]acetamide
P- F. / H 2-[2-fluoro-
061 4-[2-[(l-
-Y F f i T r methylimida
zol-4- yl)amino]pyr
H 1 imidin-5-
F yl]phenyl]- 1 503.45 504
N-[5-(2,2,2- trifluoro-1, 1- dimethyl- ethyl)isoxazo
1 'i
yl]acetamide
P- 2-[4-[2-[[l-
062 (2-amino-2- methyl- propyl)pyraz
01- 4-
F yl]amino]pyr
imidin-5-yl]-
2- fluoro- 1 558.53 559 phenyl]-N- [5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol- 3- yl]acetamide
P- 2-[4-[2-[(l-
067 Fv-F cyclopropylp
yrazol-4- II yl)amino]pyr
imidin-5-yl]-
2-fluoro- phenyl]-N- 1 527.47 528
[5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol- 3- yl]acetamide
P- 2-[4-[2-[(l-
068 ethylimidazo
1 A
yl)amino]pyr
J, II imidin-5-yl]-
2-fluoro- phenyl]-N- 3 515.46 516
[5-[ l -
(trifluoromet
hyl)cyclopro
pyl]isoxazol- 3- yl]acetamide
P- 2-[2-fluoro-
069 4-[2-[[3-(2-
1 1 N— " hydroxy ethyl
)-l -methyl- pyrazol-4- yl]amino]pyr
imidin-5-
28 545.49 546 yl]phenyl]-
N-[5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol-
3- yl]acetamide
P- 2-[2-fluoro-
070 4-[2-[[l-(2- methoxyethy
l)-5-methyl- pyrazol-4- yl]amino]pyr
imidin-5-
3 559.52 560 yljphenyl]-
N-[5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol-
3- yl]acetamide
P- 2-[2-fluoro-
071 4-[2-[[l-(2- methoxyethy
l)-3-methyl- pyrazol-4- yl]amino]pyr
imidin-5- ■χ
j 559.52 560 yl]phenyl]-
N-[5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol- yl]acetamide
P- 2-[2-fluoro- 072 4_[2-[4-(l- methylazetidi
n-3- yl)anilino]py
rimidin-5- yl]phenyl]- 1 566.55 567
N-[5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol-
3- yl]acetamide
P- methyl 2-[4-
073 [[5-[3-fluoro- 4-[2-oxo-2- [[5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol-
3 559.47 560 3- yl] amino] eth
yl]phenyl]py
rimidin-2- yl]amino]pyr
azol-1- yl]acetate
P- 2-[2-fluoro-
074 4-[2-[[l-[(3- methyl oxetan
-3- yl)methyl]py
razol-4- yl]amino]pyr
imidin-5- 3 571.53 572 yljphenyl]-
N-[5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol-
3- yl]acetamide
P- 2-[4-[2-[(l,5-
075 fV - dimethylimid
azol-4- yl)amino]pyr
imidin-5-yl]-
2-fluoro- phenyl]-N- 1 515.46 516
[5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol- 3- yl]acetamide
079 dihydro-5H- pyrrolo[l,2- a]imidazol-2- ylamino)pyri
midin-5-yl]-
2-fluoro-
27 527.47 528 phenyl]-N- [5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol- yl]acetamide
P- 2-[4-[2-[(2,5-
080 dimethylpyra
zol-3- yl)amino]pyr
imidin-5-yl]-
2-fluoro- phenyl]-N- 1 515.46 516
[5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol- 3- yl]acetamide
P- 2- [4-[2-[[l- 081 0, 1- dioxothiolan-
3- yl)pyrazol- 4_
yl]amino]pyr
imidin-5-yl]-
2-fluoro- 3 605.56 606 phenyl]-N-
[5-[l-
(trifluoromet
hyl)cyclopro
085 4-[2-[(7-oxo-
5,6- dihydropyrro
1 lizin-2- yl)amino]pyr
imidin-5-
26 540.47 541 yljphenyl]-
N-[5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol-
3- yl]acetamide
P- 2-[2-fluoro-
086 4-[2-
(pyrazin-2- ylamino)pyri
midin-5- yl]phenyl]-
4 499.42 500
N-[5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol-
3- yl]acetamide
P- 2-[2-fluoro-
087 4- [2-[(2- fluoro-4- pyridyl)amin
o]pyrimidin-
5- yl]phenyl]-
4 516.42 517 N-[5-[l- (trifluoromet
hyl)cyclopro
pyl]isoxazol- 3- yllacetamide
P- 2-[2-fluoro-
088 4-[2-[[l-
[(3S,4R)-4- fluoro- 1 - methyl - pyrrolidin-3- yl]pyrazol-4- yl]amino]pyr
3 588.53 589 imidin-5- yl]phenyl]-
N-[5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol-
3- yl]acetamide
P- 2-[2-fluoro-
089 4-[2-[[l-(2- hydroxy-1, 1- dimethyl- ethyl)imidaz
ol-4- yl]amino]pyr
imidin-5- 3 559.52 560 yl]phenyl]-
N-[5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol-
3- yl]acetamide
P- 2-[2-fluoro-
090 4-[2-[(l- _
isopropylimi
dazol-4- o 1 1 yl)amino]pyr
imidin-5- yl]phenyl]- 3 529.49 530
N-[5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol-
094 4-[2-[(3- methyltriazol
-4- yl)amino]pyr
imidin-5- yl]phenyl]- 1 502.42 503
N-[5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol-
3- yl]acetamide
P- 2-[2-fluoro-
095 4-[2-[[3-
(methoxymet
hyl)-l- methyl - pyrazol-4- yl]amino]pyr
imidin-5- 1 545.49 546 yl]phenyl]-
N-[5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol- yl]acetamide
P- 2-[2-fluoro-
096 4-[2-[[3- methoxy-1- (2- methoxyethy
l)pyrazol-4- yl]amino]pyr
imidin-5- 3 575.51 576 yl]phenyl]-
N-[5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol-
104 (difluoromet
hyl)-3- methoxy- pyrazol-4- yl]amino]pyr
imidin-5-yl]-
2-fluoro- 3 567.44 568 phenyl]-N-
[5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol- 3- yllacetamide
P- 2-[2-fluoro-
105 4- [2-[(3- methoxy-4- pyridyl)amin
o]pyrimidin-
5- yl]phenyl]-
1 528.46 529 N-[5-[l- (trifluoromet
hyl)cyclopro
pyl]isoxazol- 3- yl]acetamide
P- 2-[2-fluoro- 106 4-[2-[[l-(3- methyl -1, 1 - dioxo- thietan-3- yl)pyrazol-4- yl]amino]pyr
imidin-5- 3 605.56 606 yl]phenyl]-
N-[5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol-
3- yl]acetamide
P- 2-[2-fluoro-
107 4-[2-
XXV (pyrimidin-5- ylamino)pyri
midin-5- yl]phenyl]-
4 499.42 500
N-[5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol-
3- yl]acetamide
P- 2-[2-fluoro-
108 4-[2-[[5- methyl- 1 -
(oxetan-3- J, II yl)pyrazol-4- yl]amino]pyr
imidin-5-
3 557.5 558 yl]phenyl]-
N-[5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol-
3- yl]acetamide
P- 2-[4-[2-[[3-
109 rVy- (difluoromet
hyl)-l- methyl - pyrazol-4- yl]amino]pyr
imidin-5-yl]-
2-fluoro- 6 551.44 552 phenyl]-N-
[5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol- 3- yl]acetamide
y acetam e
116 dimethylpyra
zol-4- yl)amino]-4- methyl-
H
F pyrimidin-5- yl]-2-fluoro-
1 529.49 530 phenyl]-N-
[5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol- 3- yl]acetamide
P- F 2-[4-[2-[(l,3-
117 iYYV dimethylpyra
zol-4- yl)amino]-4- methoxy-
H
F pyrimidin-5- yl]-2-fluoro-
1 545.49 546 phenyl]-N-
[5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol-
3- yl]acetamide
P- F 2-[4-[2-[(3- 118 ethyl-1- methyl- pyrazol-4- yl)amino]pyr
H
F imidin-5-yl]-
2-fluoro-
12 529.49 530 phenyl]-N- [5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol- yl]acetamide
P- F. / H 2-[2-fluoro-
119 4-[4-methyl-
2-[(l- methylimida
zol-4- yl)amino]pyr
F
imidin-5-
1 515.46 516 yljphenyl]-
N-[5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol-
3- yl]acetamide
P- 2-[2-fluoro-
120 4-[2-[[l-
(trideuteriom
ethyl)imidaz
ol-4- yl]amino]pyr
imidin-5-
J 504.45 505 yl]phenyl]-
N-[5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol- yl]acetamide
P- 2-[2-fluoro- 121 4-[2-[(2- methyl- 1 -
0X0- isoindolin-4- yl)amino]pyr
F imidin-5-
1 566.51 567 yl]phenyl]-
N-[5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol- yl]acetamide
134 4-[2-[[l-(2- hydroxy ethyl
)-3-methyl- pyrazol-4- yl]amino]pyr
imidin-5-
3 545.49 546 yljphenyl]-
N-[5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol-
3- yl]acetamide
P- 2-[2-fluoro-
135 4-[2-[[l-(2- hydroxy ethyl
)-3-methoxy- pyrazol-4- yl]amino]pyr
imidin-5-
J ■χ 561.49 562 yl]phenyl]-
N-[5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol-
T j, - yl]acetamide
P- 2- [4-[2-[(l- 136 Λ cyclopropyl-
3- methoxy- pyrazol-4- yl)amino]-4- methoxy- pyrimidin-5- yl] ^-fluoro3 587.53 588 phenyl]^- [5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol- 3- yllacetamide
152 4-[2-[[5- methyl- 1 -
(trideuteriom
0 i JJ X y> ethyl)pyrazol
-4- yl]amino]pyr
imidin-5- 3 518.48 519 yljphenyl]-
N-[5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol-
3- yllacetamide
P- 2-[4-[2-[(3-
153 ethoxy- 1 - methyl - c ^ pyrazol-4- o II yl)amino]pyr
imidin-5-yl]-
F
2-fluoro-
7 545.49 546 phenyl]-N-
[5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol- 3- yl]acetamide
P- 2-[4-[2-[(l-
154 cyclopropyli
midazol-4- yl)amino]pyr
imidin-5-yl]-
2-fluoro- phenyl]-N- 5 527.47 528
[5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol- 3- yl]acetamide
y acetam e
P- 2-[4-[2-[(5-
158 ethoxy-2- methyl- pyrazol-3- yl)amino]pyr
imidin-5-yl]-
2-fluoro-
9 545.49 546 phenyl]-N-
[5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol- 3- yl]acetamide
P- [1, 1,2,2-
159 tetradeuterio-
2-[4-[[5-[3- fluoro-4-[2- oxo-2-[[5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol-
3- 3 607.55 608 yl] amino] eth
yl]phenyl]py
rimidin-2- yl] amino] -3- methoxy- pyrazol-1- yl]ethyl]
acetate
P- 2-[2-fluoro-
160 4-[2-[[3- methoxy-1-
(1, 1,2,2- tetradeuterio-
2-hydroxy- ethyl)pyrazol
4
yl]amino]pyr 3 565.51 566 imidin-5- yl]phenyl]-
N-[5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol- yl]acetamide
P- 2-[4-[[5-[3-
161 fluoro-4-[2- oxo-2-[[5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol- yl] amino] eth 3 603.52 604 yl]phenyl]py
rimidin-2- yl] amino] -3- methoxy- pyrazol-1- yl] ethyl
acetate
P- 2-[2-fluoro-
162 4-[2-[[l-(2- hydroxy-1, 1- dimethyl- ethyl)-3- methoxy- pyrazol-4- yl]amino]pyr
3 589.54 590 imidin-5- yl]phenyl]-
N-[5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol-
3- yl]acetamide
P- 2-[2-fluoro-
163 4-[2-[[l-(2- hydroxy-1, 1- dimethyl- ethyl)-3- methyl- pyrazol-4- yl]amino]pyr
3 573.54 574 imidin-5- yl]phenyl]-
N-[5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol-
3- yl]acetamide
acetate
etamide
etamide
P- F H 2-[4-[2-[(3-
185 cyano-1 - methyl- pyrazol-4- yl)amino]pyr
F imidin-5-yl]-
2-fluoro-
17 526.45 527 phenyl]-N- [5-[ l -
(trifluoromet
hyl)cyclopro
pyl]isoxazol- yl]acetamide
P- 2-[4-[2-[(5-
186 cyano-1 - methyl- pyrazol-4- yl)amino]pyr
imidin-5-yl]-
2-fluoro-
17 526.45 527 phenyl]-N- [5-[ l -
(trifluoromet
hyl)cyclopro
pyl]isoxazol- yl]acetamide
P- 2-(4-(2-((3- 187 ethyl- l -(2- hydroxy ethyl
)-lH- pyrazol-4-
F yl)amino)pyr
imidin-5-yl)-
2- 3 559.2 560 fluorophenyl
)-N-(5-(l-
(trifluoromet
hyl)cyclopro
pyl)isoxazol-
3- yl)acetamide
P- 2-[2-fluoro-
188 4-[2-[(3- methoxy-lH- pyrazol-4- yl)amino]pyr
imidin-5-
F
yl]phenyl]- 3 517.44 518
N-[5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol-
3- yl]acetamide
P- 2-[3-methyl-
189 4-[[5-[4-[2- oxo-2-[[5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol-
3-
3 569.54 570 yl] amino] eth
yl]phenyl]py
rimidin-2- yl]amino]pyr
azol-1- yl] ethyl
acetate
P- 2-[4-[2-[[5- 190 ethyl-l-(2- hydroxyethyl
)pyrazol-4- yl]amino]pyr
imidin-5-yl]-
2-fluoro-
3 559.52 560
T O
(trifluoromet
hyl)cyclopro
197 (2- hydroxy ethyl
)-3-methyl- pyrazol-4- yl]amino]pyr
imidin-5-
3 527.5 528 yljphenyl]-
N-[5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol-
3- yl]acetamide
P- 2-[2-fluoro-
198 jf T 4-[2-[(l- methyl -3- vinyl- pyrazol-4- yl)amino]pyr
imidin-5-
20 527.47 528 yl]phenyl]-
N-[5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol-
3- yl]acetamide
P- 2-[4-[2-[[3- 199 (difluoromet
hoxy)-l - methyl-
A, pyrazol-4- yl]amino]pyr
imidin-5-yl]-
2-fluoro- 3 567.44 568 phenyl]-N-
[5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol- 3- yllacetamide
P- 2-[4-[2-[[3-
200 ethyl-l-(2- methoxyethy
l)pyrazol-4- yl]amino]pyr
imidin-5-yl]-
2-fluoro- 1
j 573.54 574 phenyl]-N- [5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol- yl]acetamide
P- 2-[4-[2-[[5-
201 ethyl-l-(2- methoxyethy
l)pyrazol-4- yl]amino]pyr
imidin-5-yl]-
2-fluoro- ά 573.54 574 phenyl]-N- [5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol-
J - yl]acetamide
P- 2-[4-[2-(5,6-
202 dihydro-4H- pyrrolo[l,2- b]pyrazol-3- ylamino)pyri
midin-5-yl]-
2-fluoro- c 527.47 528 phenyl]-N- [5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol- yl]acetamide
209 cyclopropyl-
1- (2- hydroxy ethyl
)pyrazol-4- yl]amino]pyr
imidin-5-yl]-
2- fluoro- 3 571.53 572 phenyl]-N- [5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol- 3- yllacetamide
P- 2-[4-[2-[[5-
210 cyclopropyl-
1- (2- hydroxy ethyl
)pyrazol-4- yl]amino]pyr
imidin-5-yl]-
2- fluoro- 3 571.53 572 phenyl]-N- [5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol- 3- yl]acetamide
P- 2-[4-[2-[(3-
211 ethynyl-1- methyl- pyrazol-4-
H yl)amino]pyr
imidin-5-yl]-
2-fluoro-
17 525.46 526 phenyl]-N-
[5-[l-
(trifluoromet
hyl)cyclopro
215 4-[2-[(3- methyl-lH- pyrazol-4- yl)amino]pyr
imidin-5-
F
yl]phenyl]- 24 501.44 502
N-[5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol-
3- yl]acetamide
P- 2-[2-fluoro-
216 4-[2-(thiazol-
5- ylamino)pyri
midin-5- yl]phenyl]-
F 4 504.46 505
N-[5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol-
3- yl]acetamide
P- 2-[2-fluoro-
217 4- [2-[(l- methyl -6- oxo-3- pyridyl)amin
o]pyrimidin-
F
5- yl]phenyl]- 1 528.46 529 N-[5-[l- (trifluoromet
hyl)cyclopro
pyl]isoxazol- 3- yllacetamide
P- F / H 2-[2-fluoro- 218 4-[2-[(3- methyl-lH- pyrazol-5- yl)amino]pyr
imidin-5- F
yl]phenyl]- 1 501.44 502
N-[5-[l-
(trifluoromet
hyl)cyclopro
pyl]isoxazol-
]acetamide
P- 2-[2-fluoro-
225 4-[2-(4,5,6,7- tetrahydropyr
azolo[l,5- a]pyridin-3- ylamino)pyri
midin-5-
543.52 544 yljphenyl]-
N-[5-(2,2,2- trifluoro-1, 1- dimethyl- ethyl)isoxazo
1-3- yljacetamide
TABLE IB
soxazol-3- yl)acetamide
2-(4-(2-((l- methyl-lH- pyrazol-4- yl)amino)pyri
midin-5-
P- yl)phenyl)-N- 483.45 484 233
(5-(l -
(tnfluoromethy
l)cyclopropyl)i
soxazol-3- yl)acetamide
H N-(5-(tert- butyl)isoxazol-
3-yl)-2-(2- fluoro-4-(2-
P- (pyrazolo[l,5-
485.51
234 a]pyridin-3-
F ylamino)pyrim
idin-5- yl)phenyl)aceta
mide
2-(2-fluoro-4- (2-
(imidazo[l,2- a]pyrazin-3- ylamino)pyrim
P- idin-5-
483.45
235 yl)phenyl)-N- (5-(l -
(trifluoromethy
l)cyclopropyl)i
soxazol-3- yl)acetamide
2-(2-fluoro-4- (2-(isoxazol-3- ylamino)pyrim
idin-5-
P- yl)phenyl)-N-
488.39 489
236 (5-(l -
F (trifluoromethy
l)cyclopropyl)i
midin-5- r- yl)phenyl)-N- 501.44 502
237
(5-(l-
(trifluoromethy
l)cyclopropyl)i
soxazol-3- yl)acetamide
Biological Examples
Example 17
Binding Assays
[0426] Binding assays can be performed in a variety of ways, including a variety of ways known in the art. For example, as indicated above, binding assays can be performed using fluorescence resonance energy transfer (FRET) format, or using an AlphaScreen.
[0427] Alternatively, any method which can measure binding of a ligand to the ATP-binding site can be used. For example, a fluorescent ligand can be used. When bound Flt3, the emitted fluorescence is polarized. Once displaced by inhibitor binding, the polarization decreases.
[0428] Determination of IC50 for compounds by competitive binding assays. (Note that ¾ is the dissociation constant for inhibitor binding; KD is the dissociation constant for substrate binding.) For this system, the IC50, inhibitor binding constant and substrate binding constant can be interrelated according to the following Formula:
KT = IC50
1+ [L*]/KD
[0429] When using radiolabeled substrate, the IC50 ~ ¾ when there is a small amount of labeled substrate.
Example 18
Competition binding assay to determine binding constants (Kd) for the compounds against selected kinases and selectivity scores against a panel of kinases
[0430] Competition binding assays used herein were developed, validated and performed as described in Fabian et al., Nature Biotechnology 2005, 23,329-336 Kinases were produced as fusions to T7 phage (See, Fabian et al. or WO04/015142) or alternatively, the kinases were
expressed in HEK-293 cells and subsequently tagged with DNA for PCR detection {See, WO08/005310). For the binding assays, streptavidin-coated magnetic beads were treated with biotinylated affinity ligands for 30 min at room temperature to generate affinity resins. The liganded beads were blocked with excess biotin and washed with blocking buffer (SeaBlock (Pierce), 1 % BSA, 0.05 % Tween 20, 1 mM DTT) to remove unbound ligand and to reduce non-specific binding. Binding reactions were assembled by combining kinase, liganded affinity beads, and test compounds in 1 x binding buffer (20 % SeaBlock, 0.17x PBS, 0.05 % Tween 20, 6 mM DTT). Test compounds were prepared as 100 x stocks in DMSO and diluted into the aqueous environment. Kds were determined using an eleven point threefold serial dilutions. DMSO or control compounds were was added to control assays lacking a test
compound. Primary screen assays for determination of selectivity scores were performed in polypropylene 384-well plates in a final volume of 20-40 iL, while Kd determinations were performed in polystyrene 96-well plates in a final volume of 135 μL. The assay plates were incubated at room temperature with shaking for 1 hour to allow the binding reactions to reach equilibrium, and the affinity beads were washed extensively with wash buffer (lx PBS, 0.05 % Tween 20) to remove unbound protein. The beads were then resuspended in elution buffer (lx PBS, 0.05 % Tween 20, 0.5 μΜ non-biotinylated affinity ligand) and incubated at room temperature with shaking for 30 min. The kinase concentration in the eluates was measured by quantitative PCR.
[0431] A selectivity score (S35) is a quantitative measure of selectivity of a compound against a panel of kinases. An S35 was calculated for a compound by dividing the number of kinases found to have a percent of control (DMSO) less than 35 by the total number of distinct kinases tested (excluding mutant variants). Percent of control (POC) is calculated by subtracting the signal of the control compound (POC = 0) from the signal of the test compound and dividing the outcome by the signal of DMSO (POC = 100) minus the signal of the control compound. For the compounds disclosed herein, S35 scores were obtained by testing the compounds at 100 nM concentration in a kinase panel containing 395 distinct kinases. The Kd values for
representative compounds of Formula I are provided in TABLE 2 below.
Example 19
FLT3-expressing Ba/F3 cell-based assays
[0432] Gene constructs containing the human FLT3 sequences FLT3-ITD, FLT3-ITD-F691L, FLT3-ITD-D835V and FLT3-D835V were synthesized by reverse translation of the human protein sequences, with codons optimized for mammalian expression. Sequence of the internal tandem duplication (ITD) was based on the MV4-11 ITD sequence. Synthetic DNA constructs
were cloned into the pMSCV puro retroviral vector (Clontech) and transfected into the
EcoPack2-293 packaging cell line (Clontech) to generate retroviruses that contain the different FLT3 constructs. Viruses were transduced into the IL-3 -dependent, murine macrophage cell line, Ba F3, and selected for puromycin resistance and IL-3 independence. All cell lines were cloned by limiting dilution and clones were used for all subsequent cell assays. Overexpression of the FLT3 mutants in the Ba/F3 cells results in constitutive phosphorylation of the exogenous FLT3 protein, which is required for IL-3 independence.
[0433] pFLT3 MSD Assays: The effects of the compounds of Formula I provided herein, on the tyrosine kinase activity of the FLT3 mutants were determined by pFLT3 MSD (Meso Scale Discovery) electrochemiluminescence assay. Briefly, cell lines were serum starved overnight in media containing 0.5% FBS. Cells were plated at 200,000 cells/well in 96-well round bottom plates in low serum, and 3-fold serial dilutions of test compounds were added for 2 hours at 37 °C. Cells were washed with PBS, lysed with 30 uL/well of cell lysis buffer (Cell Signaling Technology), and 25 uL/well were applied to FLT3 MSD capture plates that were pre-coated with anti-FLT3 monoclonal antibody (R&D Systems Catalog # MAB8121). After an overnight incubation at 4 °C shaking at 450 rpm, plates were washed with MSD wash buffer, and captured FLT3 was detected with biotinylated-anti-phosphotyrosine antibody 4G10 (Millipore) and SulfoTAG-streptavidin (MSD) for 1 hour at room temperature, and read on an MSD SECTOR Imager 6000. Percent remaining phospho-FLT3 in compound-treated cells was normalized to DMSO-treated cells, and IC50S were determined using Igor Pro software. All compounds are assayed in duplicate cell and MSD plates.
[0434] In vivo model system testing: For in vivo testing, a suitable animal model system can be selected for use. For example, human AML cell lines like MV4;1 1 which harbor the activated FLT3-ITD oncogene can be grown as xenograft tumors in immune compromised mice and the efficacy of the compounds can be evaluated by tumor size measurements upon oral dosing of the compounds.
[0435] CTB Viability Assays: Cell lines were serum starved overnight in media containing 0.5% FBS, plated at 15,000 cells/well in 96-well white-walled tissue culture plates, and 3-fold serial dilutions of test compounds of Formula I were added for 72 hours at 37 °C. CellTiter Blue (CTB, Promega) was added and incubated for an additional 3 hours at 37 °C. Fluorescence was read at 560 nm excitation, 590 nm emission. Wells with CTB + media only were used for background subtraction, and the fluorescence of compound-treated cells was normalized to the fluorescence of DMSO-treated cells. IC50s were determined using Igor Pro software. All compounds are assayed in duplicate cell plates.
[0436] A number of compounds from P-001-P-237 have been tested and determined to be active in inhibiting CSFIR, c-kit, or both CSFIR and c-kit as measured the CSFIR and c-kit assays described in WO2011/022473.
[0437] IC50s for the compounds having the Formula I are provided in TABLE 2. Specifically, the following TABLE 2 provides data indicating FLT3 ITD, D835Y and F69L biochemical inhibitory activity for exemplary compounds as described in TABLE 1 A. In the table below, activity is provided as follows: +++ = O.OOOlnM < IC50 <10 nM; ++ = 10 nM < IC50 < 50 nM , + = 50 nM < IC < ΙΟΟ ηΜ.
TABLE 2
P-021 +++ +++ +++
P-022 +++ +++ +++
P-023 +++ +++ +++
P-024 +++ +++ +++
P-025 +++ +++ +++
P-026 +++ +++ +++
P-027 +++ +
++
P-028 +++ +++ +++
P-029 ++ ++ ++
P-030 +++ +++ +++
P-031 +++ +++ +++
P-032 +++ +++ +++
P-033 +++ +++ +++
P-034 +++ +++ +++
P-035 +++ +++ +++
P-036 +++ +++ +++
P-037 +++ +++ +++
P-038 +++ +++ +++
P-039 +++ +++ +++
P-040 +++ +++ +++
P-041 +++ +++ +++
P-042 +++ +++ +++
P-043 +++ +++ +++
P-044 +++ +++ +++
P-045 +++ +++ +++
P-046 +++ +++ +++
P-047 +++ +++ +++
P-048 +++ +++ +++
P-049 +++ +++ +++
P-050 +++ +++ +++
P-051 +++ +++ +++
P-052 +++ +++ +++
P-053 +++ +++ +++
P-054 +++ +++ +++
P-055 +++ +++ +++
P-056 +++ +++ +++
P-057 +++ +++ +++
P-058 +++ +++ +++
P-059 +++ +++ +++
P-060 +++ +++ +++
P-061 +++ +++ +++
P-062 +++ +++ +++
P-063 +++ +++ +++
P-064 +++ +++ +++
P-065 +++ +++ +++
P-066 +++ +++ +++
P-067 +++ +++ +++
P-068 +++ +++ ++
P-069 +++ +++ +++
P-070 +++ +++ +++
P-071 +++ +++ +++
P-072 +++ +++ +++
P-073 +++ +++ +++
P-074 +++ +++ +++
P-075 +++ ++ ++
P-076 +++ +++ +++
P-077 +++ +++ ++
P-078 ++ ++ +
P-089 +++ +++ +++
P-080 +++ +++ +++
P-081 +++ +++ +++
P-082 +++ +++ +++
P-083 +++ +++ +++
P-084 +++ +++ +++
P-085 +++ +++ +++
P-086 +++ ++ ++
P-087 +++ +++ +++
P-088 +++ +++
P-089 +++ +++
P-090 +++ +++
P-091 +++ ++
P-092 +++ +++
P-093 +++ +++
P-094 +++ +++
P-095 +++ +++
P-096 +++ +++
P-097 +++ +++
P-098 +++ +++
P-099 +++ +++
P-100 +++ +++
P-101 +++ +++
P-102 +++ +++
P-103 +++ ++
P-104 +++ +++
P-105 +++ ++ +
P-106 +++ +++ +++
P-107 +++ +++ +++
P-108 +++ +++
P-109 +++ +++
P-110 +++ +++
P-l l l +++ +++
P-112 +++ ++
P-113 +++ ++
P-114 +++ ++
P-115 +++ +++
P-116 +++ +++ ++
P-117 +++ ++ +++
P-118 +++ +++ +++
P-119 +++ ++ +
P-120 +++ +++ +++
P-121 +++ +++ +++
P-122 +++ +++ +++
P-123 +++ +++ ++
P-124 +++ +++ ++
P-125 +++ ++ +
P-126 +++ ++ ++
P-127 +++ +++ +++
P-128 +++ +++ +++
P-129 +++ ++ ++
P-130 +++ ++ ++
P-131 +++ +++ +++
P-132 +++ ++ ++
P-133 +++ +++ +++
P-134 +++ +++ +++
P-135 +++ +++ +++
P-136 +++ +++ ++
P-137 +++ +++ +++
P-138 +++ +++ +++
P-139 +++ +++ +++
P-140 +++ +++ +++
P-141 +++ +++ +++
P-142 +++ +++ +++
P-143 +++ +++ +++
P-144 +++ ++ +
P-145 +++ +++ +++
P-146 +++ +++ +++
P-147 +++ ++ +
P-148 +++ +++ ++
P-149 +++ ++ ++
P-150 +++ +++ +++
P-151 +++ +++ +++
P-152 +++ +++ +++
P-153 +++ +++ +++
P-154 +++ +++ +++
P-155 +++ +++ +++
P-156 +++ ++ ++
P-157 +++ +++ ++
P-158 +++ +++ +++
P-159 +++ +++ +++
P-160 +++ +++ +++
P-161 +++ +++ +++
P-162 +++ +++ +++
P-163 +++ +++ +++
P-164 +++ +++ ++
P-165 +++ +++ +++
P-166 +++ +++ +++
P-167 +++ +++ +++
P-168 +++ ++ ++
P-169 +++ +++ +++
P-170 +++ +++ +++
P-171 +++ +++ +++
P-172 +++ +++ +++
P-173 +++ +++ +++
P-174 +++ +++ +++
P-175 +++ +++ +++
P-176 +++ +++ +++
P-177 +++ +++ +++
P-178 +++ +++ +++
P-179 +++ +++ +++
P-180 +++ +++ +++
P-181 +++ +++ +++
P-182 +++ +++ +++
P-183 +++ +++ +++
P-184 +++ +++ ++
P-185 +++ +++ +++
P-186 +++ +++ +++
P-187 +++ +++ +++
P-188 +++ +++ +++
P-189 +++ +++ +++
P-190 +++ +++ +++
P-191 +++ +++ +++
P-192 +++ +++ +++
P-193 +++ +++ +++
P-194 +++ +++ +++
P-195 +++ +++ +++
P-196 +++ +++ +++
P-197 +++ +++ +++
P-198 +++ +++ +++
P-199 +++ +++ +++
P-200 +++ +++ +++
P-201 +++ +++ +++
P-202 +++ +++ +++
P-203 +++ +++ +++
P-204 +++ ++ ++
P-205 +++ +++ +++
P-206 +++ +++ +++
P-207 +++ +++ +++
P-208 +++ +++ +++
P-209 +++ +++ +++
P-210 +++ ++ ++
P-211 +++ +++ +++
P-212 +++ +++
P-213 +++ +++
P-214 +++ ++
P-215 +++ +++
P-216 +++ +++
P-217 +++ +++
P-218 +++ +++
P-219 +++ +++
P-220 +++ +++
P-221 +++ +++
P-222 +++ +++
P-223 +++ +++
P-224 +++ +++
P-225 +++ +++
[0438] The compounds in TABLE IB (P-226 - P-237) were also found to be active as determined by at least one of the BaF3 assays used to generate the data in TABLE 2. These assays are identical and differ only in minor details in regards to vector design, not biological function. Both introduce the FLT3 gene with MV4-11 based ITD duplications and resistance mutations from an exogenous promoter (MSCV and CMV respectively) in the exact same cell line.
[0439] Compounds P-238- P-255 disclosed herein were tested to be active as determined by at least one of the BaF3 assays described herein used to generate the data in TABLE 2.
[0440] As a result of the expressed FLT3 protein, the IL3 factor dependent BaF3 cell clones become IL3-factor independent.
[0441] The compounds in disclosed in TABLE IB were tested in an identical fashion by incubating such clones in with increasing concentrations. Inhibition of the FLT3 activity by an inhibitor results in factor dependency, which in the absence of IL3 results in cell death in the three day growth
[0442] As shown below, the novel compounds of this disclosure exhibit superior and unexpectedly better potency against the mutated forms of the FLT3 tyrosine kinase enzymes, particularly the F691L mutation and/or D835Y mutation when compared to the the compounds
in WO 2011/022473. Table 3 below lists two compounds in this disclosure and their FLT3 inhibitory activity, and Table 4 lists five compounds in WO 2011/022473 and their FLT3 inhibitory activity.
TABLE 3
TABLE 4
[0443] All patents and other references cited herein are indicative of the level of skill of those skilled in the art to which the disclosure pertains, and are incorporated by reference in their entireties, including any tables and figures, to the same extent as if each reference had been incorporated by reference in its entirety individually.
[0444] One skilled in the art would readily appreciate that the present disclosure is well adapted to obtain the ends and advantages mentioned, as well as those inherent therein. The methods, variances, and compositions described herein as presently representative of the embodiments described herein are exemplary and are not intended as limitations on the scope of the disclosure. Changes therein and other uses will occur to those skilled in the art, which are encompassed within the spirit of the disclosure, are defined by the scope of the claims.
[0445] It will be readily apparent to one skilled in the art that varying substitutions and modifications may be made to the present disclosure described herein without departing from the scope and spirit of the disclosure. For example, variations can be made to provide additional compounds of Formula I and all sub-embodiments thereof, and/or various methods of administration can be used Thus, such additional embodiments are within the scope of the present disclosure and the following claims.
[0446] The present disclosure illustratively described herein suitably may be practiced in the absence of any element or elements, limitation or limitations which is not specifically described herein. The terms and expressions which have been employed are used as terms of description and not of limitation, and there is no intention that in the use of such terms and expressions of excluding any equivalents of the features shown and described or portions thereof, but it is recognized that various modifications are possible within the scope of the disclosure claimed. Thus, it should be understood that although the present disclosure has been specifically described by the embodiments and optional features, modification and variation of the concepts herein described may be resorted to by those skilled in the art, and that such modifications and variations are considered to be within the scope of this disclosure as defined by the appended claims.
[0447] In addition, where features or aspects of the disclosure are described in terms grouping of alternatives, those skilled in the art will recognize that the disclosure is also thereby described in terms of any individual member or subgroup of members of the groups described herein.
[0448] Also, unless indicated to the contrary, where various numerical values are provided for embodiments, additional embodiments are described by taking any 2 different values as the endpoints of a range. Such ranges are also within the scope of the present disclosure.
[0449] Thus, additional embodiments are within the scope of the disclosure and within the following claims.
SEQUENCE LISTING
SEQ ID NO: 1 Sequence NP 004110.2
MPALARDGGQLPLLVWSAMIFGTITNQDLPVIKCVLINHKNND
SSVGKSSSYPMVSESPEDLGCALRPQSSGTVYEAAAVEVDVSASITLQVLVDAPGNIS
CLWVFKHS SLNCQPHFDLQNRGVVSMVILKMTETQ AGEYLLFIQ SEATNYTILFT VSI
RNTLLYTLRRP YFRKMENQD AL VCI SES VPEPIVEW VLCDS QGE S CKEE SP A VVKKEE
KVLHELFGTDIRCCARNELGRECTRLFTIDLNQTPQTTLPQLFLKVGEPLWIRCKAVH
VNHGFGLTWELENKALEEGNYFEMSTYSTNRTMIRILFAFVSSVARNDTGYYTCSSSK
HPSQSALVTIVEKGFLNATNSSEDYEIDQYEEFCFSVRFKAYPQIRCTWTFSRKSFPC
EQKGLDNGYSISKFCNHKHQPGEYIFHAENDDAQFTKMFTLNIRRKPQVLAEASASQA
SCF SDGYPLP S WTWKKC SDKSPNCTEEITEGVWNRKANRKVFGQWVS S STLNMSEAIK
GFLVKCCAYNSLGTSCETILLNSPGPFPFIQDNISFYATIGVCLLFIVVLTLLICHKY
KKQFRYESQLQMVQVTGSSDNEYFYVDFREYEYDLKWEFPRENLEFGKVLGSGAFGK V
MNATAYGISKTGVSIQVAVKMLKEKADSSEREALMSELKMMTQLGSHENIVNLLGACT
LSGPIYLIFEYCCYGDLLNYLRSKREKFHRTWTEIFKEHNFSF YPTFQ SHPNS SMPGS
REVQIHPDSDQISGLHGNSFHSEDEIEYENQKRLEEEEDLNVLTFEDLLCFAYQVAKG
MEFLEFKSCVHRDLAARNVLVTHGKVVKICDFGLARDIMSDSNYVVRGNARLPVKWM A
PESLFEGIYTIKSDVWSYGILLWEIFSLGVNPYPGIPVDANFYKLIQNGFKMDQPFYA
TEEIYIIMQSCWAFDSRKRPSFPNLTSFLGCQLADAEEAMYQNVDGRVSECPHTYQNR
RPFSREMDLGLLSPQAQVEDS
SEQ ID NO : 2 Sequence NM 441 19
1 acctgcagcg cgaggcgcgc cgctccaggc ggcatcgcag ggctgggccg gcgcggcctg 61 gggaccccgg gctccggagg ccatgccggc gttggcgcgc gacggcggcc agctgccgct 121 gctcgttgtt ttttctgcaa tgatatttgg gactattaca aatcaagatc tgcctgtgat 181 caagtgtgtt ttaatcaatc ataagaacaa tgattcatca gtggggaagt catcatcata 241 tcccatggta tcagaatccc cggaagacct cgggtgtgcg ttgagacccc agagctcagg 301 gacagtgtac gaagctgccg ctgtggaagt ggatgtatct gcttccatca cactgcaagt 361 gctggtcgac gccccaggga acatttcctg tctctgggtc tttaagcaca gctccctgaa 421 ttgccagcca cattttgatt tacaaaacag aggagttgtt tccatggtca ttttgaaaat 481 gacagaaacc caagctggag aatacctact ttttattcag agtgaagcta ccaattacac 541 aatattgttt acagtgagta taagaaatac cctgctttac acattaagaa gaccttactt 601 tagaaaaatg gaaaaccagg acgccctggt ctgcatatct gagagcgttc cagagccgat 661 cgtggaatgg gtgctttgcg attcacaggg ggaaagctgt aaagaagaaa gtccagctgt 721 tgttaaaaag gaggaaaaag tgcttcatga attatttggg acggacataa ggtgctgtgc 781 cagaaatgaa ctgggcaggg aatgcaccag gctgttcaca atagatctaa atcaaactcc 841 tcagaccaca ttgccacaat tatttcttaa agtaggggaa cccttatgga taaggtgcaa 901 agctgttcat gtgaaccatg gattcgggct cacctgggaa ttagaaaaca aagcactcga 961 ggagggcaac tactttgaga tgagtaccta ttcaacaaac agaactatga tacggattct 1021 gtttgctttt gtatcatcag tggcaagaaa cgacaccgga tactacactt gttcctcttc 1081 aaagcatccc agtcaatcag ctttggttac catcgtagaa aagggattta taaatgctac 1 141 caattcaagt gaagattatg aaattgacca atatgaagag ttttgttttt ctgtcaggtt 1201 taaagcctac ccacaaatca gatgtacgtg gaccttctct cgaaaatcat ttccttgtga 1261 gcaaaagggt cttgataacg gatacagcat atccaagttt tgcaatcata agcaccagcc 1321 aggagaatat atattccatg cagaaaatga tgatgcccaa tttaccaaaa tgttcacgct 1381 gaatataaga aggaaacctc aagtgctcgc agaagcatcg gcaagtcagg cgtcctgttt 1441 ctcggatgga tacccattac catcttggac ctggaagaag tgttcagaca agtctcccaa
1501 ctgcacagaa gagatcacag aaggagtctg gaatagaaag gctaacagaa aagtgtttgg 1561 acagtgggtg tcgagcagta ctctaaacat gagtgaagcc ataaaagggt tcctggtcaa 1621 gtgctgtgca tacaattccc ttggcacatc ttgtgagacg atccttttaa actctccagg 1681 ccccttccct ttcatccaag acaacatctc attctatgca acaattggtg tttgtctcct 1741 cttcattgtc gttttaaccc tgctaatttg tcacaagtac aaaaagcaat ttaggtatga 1801 aagccagcta cagatggtac aggtgaccgg ctcctcagat aatgagtact tctacgttga 1861 tttcagagaa tatgaatatg atctcaaatg ggagtttcca agagaaaatt tagagtttgg 1921 gaaggtacta ggatcaggtg cttttggaaa agtgatgaac gcaacagctt atggaattag 1981 caaaacagga gtctcaatcc aggttgccgt caaaatgctg aaagaaaaag cagacagctc 2041 tgaaagagag gcactcatgt cagaactcaa gatgatgacc cagctgggaa gccacgagaa 2101 tattgtgaac ctgctggggg cgtgcacact gtcaggacca atttacttga tttttgaata 2161 ctgttgctat ggtgatcttc tcaactatct aagaagtaaa agagaaaaat ttcacaggac 2221 ttggacagag attttcaagg aacacaattt cagtttttac cccactttcc aatcacatcc 2281 aaattccagc atgcctggtt caagagaagt tcagatacac ccggactcgg atcaaatctc 2341 agggcttcat gggaattcat ttcactctga agatgaaatt gaatatgaaa accaaaaaag 2401 gctggaagaa gaggaggact tgaatgtgct tacatttgaa gatcttcttt gctttgcata 2461 tcaagttgcc aaaggaatgg aatttctgga atttaagtcg tgtgttcaca gagacctggc 2521 cgccaggaac gtgcttgtca cccacgggaa agtggtgaag atatgtgact ttggattggc 2581 tcgagatatc atgagtgatt ccaactatgt tgtcaggggc aatgcccgtc tgcctgtaaa 2641 atggatggcc cccgaaagcc tgtttgaagg catctacacc attaagagtg atgtctggtc 2701 atatggaata ttactgtggg aaatcttctc acttggtgtg aatccttacc ctggcattcc 2761 ggttgatgct aacttctaca aactgattca aaatggattt aaaatggatc agccatttta 2821 tgctacagaa gaaatataca ttataatgca atcctgctgg gcttttgact caaggaaacg 2881 gccatccttc cctaatttga cttcgttttt aggatgtcag ctggcagatg cagaagaagc 2941 gatgtatcag aatgtggatg gccgtgtttc ggaatgtcct cacacctacc aaaacaggcg 3001 acctttcagc agagagatgg atttggggct actctctccg caggctcagg tcgaagattc 3061 gtagaggaac aatttagttt taaggacttc atccctccac ctatccctaa caggctgtag
3121 attaccaaaa caagattaat ttcatcacta aaagaaaatc tattatcaac tgctgcttca 3181 ccagactttt ctctagaagc tgtctgcgtt tactcttgtt ttcaaaggga cttttgtaaa 3241 atcaaatcat cctgtcacaa ggcaggagga gctgataatg aactttattg gagcattgat 3301 ctgcatccaa ggccttctca ggctggcttg agtgaattgt gtacctgaag tacagtatat 3361 tcttgtaaat acataaaaca aaagcatttt gctaaggaga agctaatatg attttttaag 3421 tctatgtttt aaaataatat gtaaattttt cagctattta gtgatatatt ttatgggtgg 3481 gaataaaatt tctactacag aattgcccat tattgaatta tttacatggt ataattaggg 3541 caagtcttaa ctggagttca cgaaccccct gaaattgtgc acccatagcc acctacacat 3601 tccttccaga gcacgtgtgc ttttacccca agatacaagg aatgtgtagg cagctatggt 3661 tgtcacagcc taagatttct gcaacaacag gggttgtatt gggggaagtt tataatgaat 3721 aggtgttcta ccataaagag taatacatca cctagacact ttggcggcct tcccagactc 3781 agggccagtc agaagtaaca tggaggatta gtattttcaa taaagttact cttgtcccca 3841 caaaaaaa
Claims
What is claimed is:
1. A compound having Formula I:
I
or a pharmaceutically acceptable salt, a solvate, a tautomer, an isomer or a deuterated analog thereof, wherein:
Ring A is a 5 or 6 membered aryl or heteroaryl ring;
J is O or S;
X is S, 0, -N=C(H , -C(H)=N-, or -C(R9) =C(R9)-;
R1 is hydrogen or alkyl;
B is a fused 5- or 6-membered saturated or unsaturated ring having 0-3 heteroatoms selected from O, N, or S;
each Q is independently hydrogen, alkyl, halo, cyano, deuteroalkyl, haloalkyl, cycloalkyl, cycloalkylalkyl, heterocycloalkyl, heterocyclylalkyl,
oxo, -RuORx, -RuORvORx', -RuOC(0)Rx', -RuC(0)ORx', -RuC(0)N(Ry)(Rz),
-RuS(0)tRx", -RuN(Ry)(Rz), -R¾(Ry)C(0)Rx, or RvC(0)N(Ry)(Rz), wherein the alkyl, cycloalkyl, cycloalkylalkyl, heterocycloalkyl or heterocyclylalkyl is each independently optionally substituted with 1 to 3 groups each independently halo, oxo, -NH2, alkyl, haloalkyl or -RuORx , provided that when Q is attached to nitrogen, Q is not halo or cyano;
Q1 is hydrogen, alkyl, deuteroalkyl, haloalkyl, cycloalkyl, cycloalkylalkyl, heterocycloalkyl,
heterocyclylalkyl, -R\)RX', -RuORvORx, -RttC(0)Rx', -RuN(Ry)(Rz), -RuOC(0)Rx',
-RuC(0)ORx', -RuC(0)N(Ry)(Rz), or -RuS(0)tRx", wherein the alkyl, cycloalkyl, cycloalkylalkyl, heterocycloalkyl or heterocyclylalkyl is each independently optionally substituted with 1 to 3 groups each independently halo, oxo, amino, alkyl, haloalkyl or -RuORx ;
Q2 is hydrogen, methoxyethoxy, ethoxymethoxy, cyclopropyl, or Ci-C2 alkyl optionally subsiuted with 1-3 substituents each independently halo, hydroxyl or methoxy;
each Q3 is independently hydrogen, cyano, -OH, -S(Ci-C2alkyl), halo, C2-C3alkenyl, C2- C3alkynyl, Ci-C3alkoxy, cyclopropyl, -NH2, -N(H)(Ci-C3alkyl), -N(H)C(0)C(H)=CH2, or Q- C3alkyl, wherein each Q3 is optionally substituted with 1-3 substituents each independently halo, hydroxyl or methoxy,
Q4 is hydrogen, cyclopropyl, or Ci-C2alkyl optionally subsiuted with 1-3 substituents each independently halo, hydroxyl or methoxy;
R3 is hydrogen, alkyl or haloalkyl;
R4 and R5 are each independently hydrogen, deuterium, halo, alkyl, haloalkyl, hydroxy, alkoxy or amino;
each R6 is independently deuterium, halo or alkyl;
each R7 is independently deuterium, halo, alkyl, haloalkyl, cycloalkyl, cycloalkylalkyl, aryl, aralkyl, heterocycloalkyl, heterocyclylalkyl, heteroaryl, heteroarylalkyl, or -RuORx, wherein the alkyl, cycloalkyl, heterocycloalkyl, and heterocyclylalkyl moieties are each independently optionally substituted with 1 to 5 groups each independently halo, alkyl, or haloalkyl;
each R9 is independently hydrogen, halo, -NH2, alkyl, haloalkyl, alkoxy, or cyano;
each t is independently 0, 1 or 2;
each Ru is independently alkylene, alkenylene, alkynylene or a direct bond;
each Rx is independently hydrogen, alkyl, haloalkyl, alkenyl, alkynyl or cycloalkyl; each Rx is independently alkyl, haloalkyl, alkenyl, alkynyl or cycloalkyl;
each Rv is independently alkylene, alkenylene or alkynylene wherein the alkylene, alkenylene or alkynylene are each optionally substituted with one or more deuterium atoms;
Ry and Rz are each independently hydrogen or alkyl,
a is 0 , 1, 2, or 3;
m is 1 or 2, and
n is 0, 1 or 2.
2 The compound of claim 1 having Formula 11(a) or 11(b)
or a pharmaceutically acceptable salt, a solvate, a tautomer, an isomer or a deuterated analog thereof, wherein:
ring A is phenyl or isoxazolyl;
Y is N or CR9;
R1 is hydrogen;
R3 is hydrogen or alkyl;
R4 and R5 are each independently hydrogen or deuterium;
each R6 is independently deuterium, halo or alkyl;
each R7 is independently alkyl, haloalkyl, cycloalkyl, heterocycloalkyl,
cycloalkylalkyl,or heterocyclylalkyl, wherein the alkyl, haloalkyl, cycloalkyl, heterocycloalkyl, cycloalkylalkyl, or heterocyclylalkyl are each independently optionally substituted with 1 to 3 groups each independently halo, alkyl or haloalkyl;
R10 is hydrogen, halo, -N¾, alkyl, haloalkyl or alkoxy;
m is 1 or 2; and
n is 0, 1 or 2.
3. The compound of claim 2 having formula 11(a), wherein:
R1 is hydrogen;
R3 is hydrogen;
R4 and R5 are each hydrogen or deuterium;
R6 is deuterium, halo or alkyl;
R7 is alkyl, haloalkyl, cycloalkyl, heterocycloalkyl, where the alkyl, cycloalkyl and heterocycloalkyl are each independently optionally substituted with 1 to 3 groups each independently halo, alkyl or haloalkyl;
R10 is hydrogen;
m is 1, and
n is 0 or 1.
4. The compound of any of claims 1-3, wherein R6 is fluoro; and
n is 1.
5. The compound of claim 1, wherein:
Ring A is phenyl or isoxazolyl; and J is O.
6.
or a pharmaceutically acceptable salt, a solvate, a tautomer, an isomer or a deuterated analog thereof, wherein:
Y is N or CH, and
R7 is alkyl, haloalkyl or cyclopropyl, where the alkyl, haloalkyl or cyclopropyl are each independently optionally substituted with 1 to 3 groups each independently halo, alkyl or haloalkyl.
8. The compound of claim 7 having Formula IV or V:
10. The compound of any of clai R7 is
12. The compound according to any of claims 1-10, wherein R is:
13. The compound according to any of claims 1-12, wherein
each Q is independently hydrogen, C1-C3 alkyl, C1-C3 haloalkyl, C1-C3 deuteroalkyl, C3- Ce cycloalkyl, or a 4-6 membered heterocycloalkyl, wherein the C1-C3 alkyl, C1-C3 haloalkyl, Q-C3 deuteroalkyl, C3-C6 cycloalkyl, or a 4-6 membered heterocycloalkyl are each
independently optionally substituted with 1 to 3 groups each independently halo or -OH;
Q1 is hydrogen, C1-C3 alkyl, C1-C3 haloalkyl, C1-C3 deuteroalkyl, C3-C6 cycloalkyl, or a 4-6 membered heterocycloalkyl, wherein the C1-C3 alkyl, C1-C3 haloalkyl, C1-C3 deuteroalkyl, C3-C6 cycloalkyl, or a 4-6 membered heterocycloalkyl areeach independently optionally substituted with 1 to 3 groups each independently halo or -OH;
each Q3 is independently hydrogen, - H2, -NHCH3, -S-CH3, -CH=CH2, ethynyl, cyano, - OH, halo, C2-C3alkenyl, C2-C3alkynyl, Ci-C2alkoxy, or Ci-C2alkyl, wherein each C2-C3alkenyl, C2-C3alkynyl, Ci-C2alkoxy, or Ci-C2 alkyl, is optionally substituted with 1-3 substituents each independently halo, hydroxyl or methoxy; and
Q4 is hydrogen or C1-C2 alkyl optionally substituted with 1-3 substituents each independently halo, hydroxyl or methoxy.
15. The compound of claim 1 selected from Compound P-001-P-255.
16. A pharmaceutical composition comprising a compound of any of claims 1-15 and a pharmaceutically acceptable carrier.
17. The pharmaceutical composition of claim 16 further comprising a second pharmaceutical agent selected from the group consisting of an anti -proliferative agent, an anti-inflammatory agent, an immunomodulatory agent and an immunosuppressive agent.
18. The pharmaceutical composition of claim 16, further comprising a second
pharmaceutical agent, wherein the second pharmaceutical agent is
is i) an alkylating agent selected from adozelesin, altretamine, bizelesin, busulfan, carboplatin, carboquone, carmustine, chlorambucil, cisplatin, cyclophosphamide, dacarbazine, estramustine, fotemustine, hepsulfam, ifosfamide, improsulfan, irofulven, lomustine, mechlorethamine, melphalan, oxaliplatin, piposulfan, semustine, streptozocin, temozolomide, thiotepa, and treosulfan; ii) an antibiotic selected from bleomycin, dactinomycin, daunorubicin, doxorubicin, epirubicin, idarubicin, menogaril, mitomycin, mitoxantrone, neocarzinostatin, pentostatin, and plicamycin; iii) an antimetabolite selected from the group consisting of azacitidine, capecitabine, cladribine, clofarabine, cytarabine, decitabine, floxuridine, fludarabine, 5-fluorouracil, ftorafur, gemcitabine, hydroxyurea, mercaptopurine, methotrexate, nelarabine, pemetrexed, raltitrexed, thioguanine, and trimetrexate; iv) an antibody therapy agent selected from alemtuzumab, bevacizumab, cetuximab, galiximab, gemtuzumab, nivolumab, panitumumab, pembrolizumab, pertuzumab, rituximab, tositumomab, trastuzumab, and 90 Y ibritumomab tiuxetan; v) a hormone or hormone antagonist selected from the group consisting of anastrozole, androgens, buserelin, diethylstilbestrol, exemestane, flutamide, fulvestrant, goserelin, idoxifene, letrozole, leuprolide, magestrol, raloxifene, tamoxifen, and toremifene, vi) a taxane selected from DJ-927, docetaxel, TPI 287, paclitaxel and DHA-paclitaxel; vii) a retinoid selected from alitretinoin, bexarotene, fenretinide, isotretinoin, and tretinoin; viii) an alkaloid selected from etoposide, homoharringtonine, teniposide, vinblastine, vincristine, vindesine, and vinorelbine; ix) an
antiangiogenic agent selected from AE-941 (GW786034, Neovastat), ABT-510, 2- methoxyestradiol, lenalidomide, and thalidomide; x) a topoisomerase inhibitor selected from amsacrine, edotecarin, exatecan, irinotecan, SN-38 (7-ethyl-lO-hydroxy-camptothecin), rubitecan, topotecan, and 9-aminocamptothecin; xi) a kinase inhibitor selected from erlotinib, gefitmib, flavopiridol, imatinib mesylate, lapatmib, sorafenib, sunitinib malate, AEE-788, AG- 013736, AMG 706, AMN107, BMS-354825, BMS-599626, UCN-01 (7-hydroxystaurosporine), vemurafenib, dabrafenib, trametinib, cobimetinib selumetinib and vatalanib; xii) a targeted signal transduction inhibitor selected from bortezomib, geldanamycin, and rapamycin; xiii) a biological response modifier selected from imiquimod, interferon-a and interleukin-2, xiv) an IDO inhibitor; and xv) a chemotherapeutic agent selected from 3-AP (3-amino-2- carboxyaldehyde thiosemicarbazone), altrasentan, aminoglutethimide, anagrelide, asparaginase, bryostatin-1, cilengitide, elesclomol, eribulin mesylate (E7389), ixabepilone, lonidamine, masoprocol, mitoguanazone, oblimersen, sulindac, testolactone, tiazofurin, a mTOR inhibitor, a PI3K inhibitor, a Cdk4 inhibitor, an Akt inhibitor, a Hsp90 inhibitor, a farnesyltransferase inhibitor or an aromatase inhibitor (anastrozole letrozole exemestane); xvi) a Mek inhibitor; xvii) a tyrosine kinase inhibitor; or xviii) an EGFR inhibitor.
19. A method for treatment of a disease or condition modulated by a FLT3, CSF1R, or c-kit, wherein the disease is an inflammatory disease, an inflammatory condition, an autoimmune disease or cancer, said method comprising administering to a subject suffering from the disease a therapeutically effective amount of a compound as in one of claims 1-15, or a pharmaceutical composition as in one of claims 16-18.
20. A method for treating a subject with a disease or condition mediated by FLT3, CSF1R or c-kit, said method comprising administering to the subject an effective amount of a compound as in one of claims 1-15, or a pharmaceutically acceptable salt, deuterated analog, a tautomer or an isomer thereof, or a pharmaceutical composition as in one of claims 16-18, wherein the disease or condition is acute myeloid leukemia, stem cell ablation and myelopreparation for stem cell transplant, primary progressive multiple sclerosis, traumatic brain injury, epilepsy, tauopathies, Erdheim-Chester Disease, Langerhans cell histocytosis, hairy cell leukemia, HIV, glioblastoma, scleroderma, anterior or posterior eye disease, lysosomal storage diseases, complex regional pain syndrome, reflex sympathetic dystrophy, muscular dystrophy, duchenne muscular dystrophy, causalgia, neuro-inflammation, neuroinflammatory disorders, benign forgetfulness, HIV, binswager type dementia, dementia with lewy bodie, prosencephaly, microencepahy, cerebral palsy, congenital hydrocephalus, abdominal dropsy, progressive supranuclear palsy,
glaucoma, addiction disorders, dependencies, alcoholism, tremors, Wilson's disease, vascular dementias, multi infarct dementia, fronto temporal dementia, pseudo-dementia, bladder cancer, basal cell carcinoma, cholangiocarcinoma, colon cancer, endometrial cancer, esophageal cancer, Ewing's sarcoma, gastric cancer, glioma, hepatocellular carcinoma, Hodgkin lymphoma, laryngeal carcinoma, leukemia, liver cancer, lung cancer, melanoma, mesothelioma, pancreatic cancer, rectal cancer, renal cancer, squamous cell carcinoma, T cell lymphoma, thyroid cancer, monocytic leukemia, pheochromocytoma, malignant peripheral nerve cell tumors, malignant peripheral nerve sheath tumors (MPNST), cutaneous and plexiform neurofibromas,
leiomyoadenomatoid tumor, fibroids, uterine fibroids, leiomyosarcoma, papillary thyroid cancer, anaplastic thyroid cancer, medullary thyroid cancer, follicular thyroid cancer, hurthle cell carcinoma, thyroid cancer, ascites, malignant ascites, mesothelioma, salivary gland tumors, mucoepidermoid carcinoma of the salivary gland, acinic cell carcinoma of the salivary gland, gastrointestinal stromal tumors (GIST), tumors that cause effusions in potential spaces of the body, pleural effusions, pericardial effusions, peritoneal effusions aka ascites, giant cell tumors (GCT), GCT of bone other sarcomas, tumor angiogenesis, paracrine tumor growth or tumors that express aberrantly or otherwise a FLT3 ligand, or activating mutations or translocations of any of the foregoing.
21. A method for treating a subject with a disease or condition mediated by a FLT3, CSF1R or c-kit, said method comprising administering to the subject an effective amount of a compound as in one of claims 1-15, or a pharmaceutically acceptable salt, deuterated analog, a tautomer or an isomer thereof, or a pharmaceutical composition according to as in one of claims 16-18, wherein the disease or condition is a lysosomal storage disease selected from the group consisting of mucolipodosis, alpha-mannosidosis; aspartylglucosaminuria; Batten disease; beta- mannosidosis; cystinosis; Danon disease; Fabry disease; Farber disease; fucosidosis;
galactosialidosis; Gaucher disease; gangliosidosis; Krabbe disease; metachromatic
leukodystrophy; mucopolysaccharidoses disorders; aspartylglucosaminuria; Batten disease; beta-mannosidosis; cystinosis; Danon disease, Fabry disease; Farber disease; fucosidosis;
galactosialidosis; Gaucher disease; gangliosidosis; Krabbe disease; metachromatic
leukodystrophy; mucopolysaccharidoses disorders; mucolipidosis type I (Sialidosis);
Mucolipidosis type II (I-Cell disease); Mucolipidosis type III (Pseudo-Hurl er polydystrophy); Mucolipidosis type IV; multiple sulfatase deficiency; Niemann-Pick types A, B, C; Pompe disease (glycogen storage disease); pycnodysostosis; Sandhoff disease; Schindler disease; Salla disease/sialic acid storage disease; Tay-Sachs; and Wolman disease.
22. The method according to any of claims 20-21, wherein FLT3 kinase is a mutated form comprising a FLT3 internal tandem duplication (ITD) mutation.
23. The method according to claim 22, wherein mutated FLT3 kinase futher comprises a D835Y mutation, a F691L mutation, or both D835Y and F691L mutations.
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201562198092P | 2015-07-28 | 2015-07-28 | |
| US62/198,092 | 2015-07-28 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2017019804A2 true WO2017019804A2 (en) | 2017-02-02 |
| WO2017019804A3 WO2017019804A3 (en) | 2017-03-09 |
Family
ID=56567730
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2016/044330 Ceased WO2017019804A2 (en) | 2015-07-28 | 2016-07-27 | Compounds and methods for kinase modulation, and indications therefor |
Country Status (2)
| Country | Link |
|---|---|
| US (1) | US10829484B2 (en) |
| WO (1) | WO2017019804A2 (en) |
Cited By (12)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2017161045A1 (en) * | 2016-03-16 | 2017-09-21 | Plexxikon Inc. | Compounds and methods for kinase modulation and indications therefore |
| WO2019126383A1 (en) | 2017-12-20 | 2019-06-27 | Denali Therapeutics Inc. | Process for the preparation of pyrimidinyl-4-aminopyrazole compounds |
| CN110041259A (en) * | 2019-05-17 | 2019-07-23 | 南开大学 | Fluorine substituted pyrazolecarboxylic amine derivant and its preparation method and application |
| CN111380971A (en) * | 2018-12-29 | 2020-07-07 | 江苏先声药业有限公司 | A kind of HPLC analysis method of bortezomib related substances |
| WO2020161209A1 (en) | 2019-02-06 | 2020-08-13 | Syngenta Crop Protection Ag | Herbicidal fused pyridazine compounds |
| WO2020161208A1 (en) | 2019-02-06 | 2020-08-13 | Syngenta Crop Protection Ag | Herbicidal fused pyridazine compounds |
| US10829484B2 (en) | 2015-07-28 | 2020-11-10 | Plexxikon Inc. | Compounds and methods for kinase modulation, and indications therefor |
| US11040027B2 (en) | 2017-01-17 | 2021-06-22 | Heparegenix Gmbh | Protein kinase inhibitors for promoting liver regeneration or reducing or preventing hepatocyte death |
| JP2022070999A (en) * | 2016-12-16 | 2022-05-13 | 株式会社半導体エネルギー研究所 | Compound |
| WO2023282110A1 (en) | 2021-07-08 | 2023-01-12 | 石原産業株式会社 | Nematocidal composition |
| US11667651B2 (en) | 2017-12-22 | 2023-06-06 | Hibercell, Inc. | Aminopyridine derivatives as phosphatidylinositol phosphate kinase inhibitors |
| US12006332B2 (en) | 2019-06-17 | 2024-06-11 | Hibercell, Inc. | Aminopyrimidine derivatives as phosphatidylinositol phosphate kinase inhibitors |
Families Citing this family (35)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2009012283A1 (en) | 2007-07-17 | 2009-01-22 | Plexxikon Inc. | Compounds and methods for kinase modulation, and indications therefor |
| US9624213B2 (en) | 2011-02-07 | 2017-04-18 | Plexxikon Inc. | Compounds and methods for kinase modulation, and indications therefor |
| US9358235B2 (en) | 2012-03-19 | 2016-06-07 | Plexxikon Inc. | Kinase modulation, and indications therefor |
| EP2892534B8 (en) | 2012-09-06 | 2021-09-15 | Plexxikon Inc. | Compounds and methods for kinase modulation, and indications therefor |
| MX365640B (en) | 2012-12-21 | 2019-06-10 | Plexxikon Inc | Compounds and methods for kinase modulation, and indications therefor. |
| DK2970265T3 (en) | 2013-03-15 | 2018-10-01 | Plexxikon Inc | HETEROCYCLIC COMPOUNDS AND APPLICATIONS THEREOF |
| US20140303121A1 (en) | 2013-03-15 | 2014-10-09 | Plexxikon Inc. | Heterocyclic compounds and uses thereof |
| CN105228983A (en) | 2013-05-30 | 2016-01-06 | 普莱希科公司 | The compound regulated for kinases and indication thereof |
| LT3292123T (en) | 2015-05-06 | 2020-12-28 | Plexxikon Inc. | Solid forms of a compound modulating kinases |
| JP6530826B2 (en) | 2015-05-06 | 2019-06-12 | プレキシコン インコーポレーテッドPlexxikon Inc. | Synthesis of 1H-pyrrolo [2,3-B] pyridine derivatives that modify kinases |
| US9814714B2 (en) | 2015-05-22 | 2017-11-14 | Plexxikon Inc. | Kinase modulation, and indications therefor |
| WO2016191295A1 (en) | 2015-05-22 | 2016-12-01 | Plexxikon Inc. | Solid forms of a compound for modulating kinases |
| ES2913048T3 (en) | 2015-09-21 | 2022-05-31 | Opna Immuno Oncology Sa | Heterocyclic Compounds and Uses of These |
| MX2018006856A (en) | 2015-12-07 | 2018-08-01 | Plexxikon Inc | Compounds and methods for kinase modulation, and indications therefor. |
| TW201815766A (en) | 2016-09-22 | 2018-05-01 | 美商普雷辛肯公司 | Compounds and methods for IDO and TDO modulation and indications thereof |
| CN106588884B (en) * | 2016-11-10 | 2019-04-09 | 浙江大学 | 2-polysubstituted aromatic ring-pyrimidine derivatives and their preparation and medicinal use |
| EP3558991A2 (en) | 2016-12-23 | 2019-10-30 | Plexxikon Inc. | Compounds and methods for cdk8 modulation and indications therefor |
| US11426406B2 (en) | 2017-02-09 | 2022-08-30 | Georgetown University | Compositions and methods for treating lysosomal storage disorders |
| JP2020511467A (en) | 2017-03-20 | 2020-04-16 | プレキシコン インコーポレーテッドPlexxikon Inc. | 4- (1- (1,1-di (pyridin-2-yl) ethyl) -6- (3,5-dimethylisoxazol-4-yl) -1H-pyrrolo [3,2- that inhibits the bromodomain b] Pyridin-3-yl) benzoic acid crystalline form |
| WO2018226846A1 (en) | 2017-06-07 | 2018-12-13 | Plexxikon Inc. | Compounds and methods for kinase modulation |
| AU2018307910B2 (en) | 2017-07-25 | 2024-07-25 | Daiichi Sankyo Company, Limited | Formulations of a compound modulating kinases |
| US10717735B2 (en) | 2017-10-13 | 2020-07-21 | Plexxikon Inc. | Solid forms of a compound for modulating kinases |
| AU2018354423B2 (en) | 2017-10-27 | 2024-11-07 | Plexxikon Inc. | Formulations of a compound modulating kinases |
| EP3768666A1 (en) | 2018-03-20 | 2021-01-27 | Plexxikon Inc. | Compounds and methods for ido and tdo modulation, and indications therefor |
| KR101954370B1 (en) | 2018-07-25 | 2019-03-05 | 한미약품 주식회사 | Pyrimidine compounds and pharmaceutical composition for preventing or treating cancers comprising the same |
| BR112021016522A2 (en) | 2019-02-22 | 2021-10-26 | Hanmi Pharm. Co., Ltd. | PHARMACEUTICAL COMPOSITION FOR THE TREATMENT OF ACUTE MYELOID LEUKEMIA |
| SG11202110714VA (en) | 2019-04-09 | 2021-10-28 | Plexxikon Inc | Condensed azines for ep300 or cbp modulation and indications therefor |
| EA202290154A1 (en) | 2019-06-27 | 2022-03-29 | Ханми Фарм. Ко., Лтд. | PHARMACEUTICAL COMPOSITION FOR TREATMENT OF ACUTE MYELOID LEUKEMIA CONTAINING FLT3 INHIBITOR AND CHEMOTHERAPEUTIC AGENTS |
| US12509444B2 (en) | 2019-12-06 | 2025-12-30 | Plexxikon Inc. | Compounds and methods for CD73 modulation and indications therefor |
| US11807626B2 (en) | 2020-04-23 | 2023-11-07 | Opna Bio SA | Compounds and methods for CD73 modulation and indications therefor |
| WO2021222442A1 (en) | 2020-04-29 | 2021-11-04 | Plexxikon Inc. | Synthesis of heterocyclic compounds |
| TW202227068A (en) | 2020-08-21 | 2022-07-16 | 美商普雷辛肯公司 | Combinational drug therapies |
| US20250288549A1 (en) * | 2022-04-29 | 2025-09-18 | University Health Network | Synthetic process for production of lipoxin b4 and analogues thereof |
| AU2023372170A1 (en) * | 2022-11-04 | 2025-04-24 | Hanmi Pharm. Co., Ltd. | Novel crystalline form of a pyrimidine compound and pharmaceutical compositions comprising the same and methods of use thereof |
| CN116178281B (en) * | 2023-04-27 | 2023-07-21 | 中国药科大学 | A kind of bifunctional immunosuppressant and its preparation method and application |
Citations (53)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4150949A (en) | 1976-04-15 | 1979-04-24 | Technicon Instruments Corporation | Immunoassay for gentamicin |
| EP0154734A1 (en) | 1984-03-15 | 1985-09-18 | Immunex Corporation | Immediate ligand detection assay, a test kit and its formation |
| US4568649A (en) | 1983-02-22 | 1986-02-04 | Immunex Corporation | Immediate ligand detection assay |
| US4626513A (en) | 1983-11-10 | 1986-12-02 | Massachusetts General Hospital | Method and apparatus for ligand detection |
| US5143854A (en) | 1989-06-07 | 1992-09-01 | Affymax Technologies N.V. | Large scale photolithographic solid phase synthesis of polypeptides and receptor binding screening thereof |
| US5426039A (en) | 1993-09-08 | 1995-06-20 | Bio-Rad Laboratories, Inc. | Direct molecular cloning of primer extended DNA containing an alkane diol |
| US5434049A (en) | 1992-02-28 | 1995-07-18 | Hitachi, Ltd. | Separation of polynucleotides using supports having a plurality of electrode-containing cells |
| US5449614A (en) | 1988-09-01 | 1995-09-12 | Whitehead Institue For Biomedical Research | Recombinant retroviruses with amphotropic and ecotropic host ranges |
| US5474935A (en) | 1990-05-23 | 1995-12-12 | The United States Of America As Represented By The Department Of Health And Human Services | Adeno-associated virus (AAV)-based eucaryotic vectors |
| WO1996017958A1 (en) | 1994-12-09 | 1996-06-13 | The Regents Of The University Of California | Comparative fluorescence hybridization to nucleic acid arrays |
| US5556752A (en) | 1994-10-24 | 1996-09-17 | Affymetrix, Inc. | Surface-bound, unimolecular, double-stranded DNA |
| US5580859A (en) | 1989-03-21 | 1996-12-03 | Vical Incorporated | Delivery of exogenous DNA sequences in a mammal |
| US5631236A (en) | 1993-08-26 | 1997-05-20 | Baylor College Of Medicine | Gene therapy for solid tumors, using a DNA sequence encoding HSV-Tk or VZV-Tk |
| US5632957A (en) | 1993-11-01 | 1997-05-27 | Nanogen | Molecular biological diagnostic systems including electrodes |
| US5658775A (en) | 1988-05-17 | 1997-08-19 | Sloan-Kettering Institute For Cancer Research | Double copy retroviral vector |
| WO1997046313A1 (en) | 1996-06-07 | 1997-12-11 | Eos Biotechnology, Inc. | Immobilised linear oligonucleotide arrays |
| US5700637A (en) | 1988-05-03 | 1997-12-23 | Isis Innovation Limited | Apparatus and method for analyzing polynucleotide sequences and method of generating oligonucleotide arrays |
| US5721118A (en) | 1995-10-31 | 1998-02-24 | The Regents Of The University Of California, San Diego | Mammalian artificial chromosomes and methods of using same |
| US5744305A (en) | 1989-06-07 | 1998-04-28 | Affymetrix, Inc. | Arrays of materials attached to a substrate |
| US5770456A (en) | 1989-06-07 | 1998-06-23 | Affymetrix, Inc. | Cyclic nucleic acid and polypeptide arrays |
| US5800992A (en) | 1989-06-07 | 1998-09-01 | Fodor; Stephen P.A. | Method of detecting nucleic acids |
| US5807522A (en) | 1994-06-17 | 1998-09-15 | The Board Of Trustees Of The Leland Stanford Junior University | Methods for fabricating microarrays of biological samples |
| US5856174A (en) | 1995-06-29 | 1999-01-05 | Affymetrix, Inc. | Integrated nucleic acid diagnostic device |
| WO1999009217A1 (en) | 1997-08-15 | 1999-02-25 | Hyseq, Inc. | Methods and compositions for detection or quantification of nucleic acid species |
| US5959098A (en) | 1996-04-17 | 1999-09-28 | Affymetrix, Inc. | Substrate preparation process |
| US5965452A (en) | 1996-07-09 | 1999-10-12 | Nanogen, Inc. | Multiplexed active biologic array |
| WO1999051773A1 (en) | 1998-04-03 | 1999-10-14 | Phylos, Inc. | Addressable protein arrays |
| US6013440A (en) | 1996-03-11 | 2000-01-11 | Affymetrix, Inc. | Nucleic acid affinity columns |
| US6022963A (en) | 1995-12-15 | 2000-02-08 | Affymetrix, Inc. | Synthesis of oligonucleotide arrays using photocleavable protecting groups |
| US6025155A (en) | 1996-04-10 | 2000-02-15 | Chromos Molecular Systems, Inc. | Artificial chromosomes, uses thereof and methods for preparing artificial chromosomes |
| US6045996A (en) | 1993-10-26 | 2000-04-04 | Affymetrix, Inc. | Hybridization assays on oligonucleotide arrays |
| US6048695A (en) | 1998-05-04 | 2000-04-11 | Baylor College Of Medicine | Chemically modified nucleic acids and methods for coupling nucleic acids to solid support |
| US6054270A (en) | 1988-05-03 | 2000-04-25 | Oxford Gene Technology Limited | Analying polynucleotide sequences |
| US6096718A (en) | 1997-06-05 | 2000-08-01 | Gene Targeting Corp. | Tissue specific adenovirus vectors for breast cancer treatment |
| US6107478A (en) | 1995-09-08 | 2000-08-22 | Pedersen; Finn Skou | Retroviral vector, a replication system for said vector and avian or mammalian cells transfected with said vector |
| US6110456A (en) | 1995-06-07 | 2000-08-29 | Yale University | Oral delivery or adeno-associated viral vectors |
| US6110458A (en) | 1991-07-26 | 2000-08-29 | University Of Rochester | Cancer therapy utilizing ex vivo gene transduction |
| US6113913A (en) | 1998-06-26 | 2000-09-05 | Genvec, Inc. | Recombinant adenovirus |
| US6117681A (en) | 1995-03-29 | 2000-09-12 | Bavarian Nordic Research Inst. A/S | Pseudotyped retroviral particles |
| US20010008765A1 (en) | 1999-12-06 | 2001-07-19 | Fuji Photo Film Co., Ltd. | DNA chip and reactive solid carrier |
| US20010012537A1 (en) | 1999-07-30 | 2001-08-09 | Anderson Norman G. | Dry deposition of materials for microarrays using matrix displacement |
| US20010014448A1 (en) | 1997-09-30 | 2001-08-16 | Surmodics, Inc. | Target molecule attachment to surfaces |
| US20010014449A1 (en) | 1993-11-01 | 2001-08-16 | Michael I. Nerenberg | Methods for determination of single nucleic acid polymorphisms using bioelectronic microchip |
| US6277489B1 (en) | 1998-12-04 | 2001-08-21 | The Regents Of The University Of California | Support for high performance affinity chromatography and other uses |
| US6277628B1 (en) | 1998-10-02 | 2001-08-21 | Incyte Genomics, Inc. | Linear microarrays |
| US20010016322A1 (en) | 1999-04-27 | 2001-08-23 | Caren Michael P. | Method of performing array-based hybridization assays using thermal inkjet deposition of sample fluids |
| US20010018642A1 (en) | 1997-07-25 | 2001-08-30 | David Balaban | Method and system for providing a probe array chip design database |
| US20010019827A1 (en) | 1997-09-11 | 2001-09-06 | Dawson Elliott P. | Method of making high density arrays |
| WO2004015142A1 (en) | 2002-08-07 | 2004-02-19 | Ambit Biosciences Corporation | Uncoupling of dna propagation and expression of protein for phage display |
| US20040077595A1 (en) | 2002-09-06 | 2004-04-22 | Insert Therapeutics, Inc. | Cyclodextrin-based polymers for therapeutics delivery |
| US6846630B2 (en) | 1996-10-18 | 2005-01-25 | Takara Shuzo Co., Ltd. | Nucleic acid encoding receptor type protein kinase |
| WO2008005310A2 (en) | 2006-06-30 | 2008-01-10 | Ambit Biosciences Corp. | Detectable nucleic acid tag |
| WO2011022473A1 (en) | 2009-08-19 | 2011-02-24 | Ambit Biosciences Corporation | Biaryl compounds and methods of use thereof |
Family Cites Families (72)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20040171062A1 (en) | 2002-02-28 | 2004-09-02 | Plexxikon, Inc. | Methods for the design of molecular scaffolds and ligands |
| AU2003272548A1 (en) | 2002-09-16 | 2004-04-30 | Plexxikon, Inc. | Crystal structure of pim-1 kinase |
| US20050048573A1 (en) | 2003-02-03 | 2005-03-03 | Plexxikon, Inc. | PDE5A crystal structure and uses |
| JP2007524374A (en) | 2003-02-28 | 2007-08-30 | プレキシコン,インコーポレーテッド | PYK2 crystal structure and use |
| US20050079548A1 (en) | 2003-07-07 | 2005-04-14 | Plexxikon, Inc. | Ligand development using PDE4B crystal structures |
| CA2532403A1 (en) | 2003-07-17 | 2005-02-03 | James Arnold | Ppar active compounds |
| US7348338B2 (en) | 2003-07-17 | 2008-03-25 | Plexxikon, Inc. | PPAR active compounds |
| WO2005028624A2 (en) | 2003-09-15 | 2005-03-31 | Plexxikon, Inc. | Molecular scaffolds for kinase ligand development |
| US7517970B2 (en) | 2003-12-19 | 2009-04-14 | Plexxikon, Inc. | Nucleic acids encoding kinase and phosphatase enzymes, expression vectors and cells containing same |
| US20070066641A1 (en) | 2003-12-19 | 2007-03-22 | Prabha Ibrahim | Compounds and methods for development of RET modulators |
| CN1925855B (en) | 2003-12-19 | 2010-06-16 | 普莱希科公司 | Compounds and methods for developing Ret modulators |
| EP1742627A4 (en) | 2004-05-06 | 2009-08-26 | Plexxikon Inc | Pde4b inhibitors and uses therefor |
| US7498342B2 (en) | 2004-06-17 | 2009-03-03 | Plexxikon, Inc. | Compounds modulating c-kit activity |
| JP2008503473A (en) | 2004-06-17 | 2008-02-07 | プレキシコン,インコーポレーテッド | Compounds that modulate C-KIT activity |
| WO2006026754A2 (en) | 2004-09-03 | 2006-03-09 | Plexxikon, Inc. | Bicyclic heteroaryl pde4b inhibitors |
| JP2008521829A (en) | 2004-11-30 | 2008-06-26 | プレキシコン,インコーポレーテッド | PPAR active compounds |
| JP2008521831A (en) | 2004-11-30 | 2008-06-26 | プレキシコン,インコーポレーテッド | PPAR active compounds |
| US20060160135A1 (en) | 2004-12-08 | 2006-07-20 | Weiru Wang | SF-1 and LRH-1 modulator development |
| DOP2006000051A (en) | 2005-02-24 | 2006-08-31 | Lilly Co Eli | VEGF-R2 INHIBITORS AND METHODS |
| US7846941B2 (en) | 2005-05-17 | 2010-12-07 | Plexxikon, Inc. | Compounds modulating c-kit and c-fms activity and uses therefor |
| UA95244C2 (en) | 2005-06-22 | 2011-07-25 | Плексикон, Инк. | Compounds and methods for kinase modulation, and indications therefor |
| JP2009509932A (en) | 2005-09-07 | 2009-03-12 | プレキシコン,インコーポレーテッド | PPAR active compounds |
| BRPI0615948A2 (en) | 2005-09-07 | 2011-05-31 | Plexxikon Inc | ppar active compound, its composition, its kit and its use |
| WO2007030559A2 (en) | 2005-09-07 | 2007-03-15 | Plexxikon, Inc. | 1, 3-disubstituted indole derivatives for use as ppar modulators |
| WO2008063888A2 (en) | 2006-11-22 | 2008-05-29 | Plexxikon, Inc. | Compounds modulating c-fms and/or c-kit activity and uses therefor |
| PE20121126A1 (en) | 2006-12-21 | 2012-08-24 | Plexxikon Inc | PIRROLO [2,3-B] PYRIDINES COMPOUNDS AS KINASE MODULATORS |
| JP2010514695A (en) | 2006-12-21 | 2010-05-06 | プレキシコン,インコーポレーテッド | Compounds and methods for kinase regulation and indications therefor |
| WO2008079909A1 (en) | 2006-12-21 | 2008-07-03 | Plexxikon, Inc. | Pyrrolo [2,3-b] pyridines as kinase modulators |
| PE20090159A1 (en) | 2007-03-08 | 2009-02-21 | Plexxikon Inc | INDOL-PROPIONIC ACID DERIVED COMPOUNDS AS PPARs MODULATORS |
| EP2121591A2 (en) | 2007-03-08 | 2009-11-25 | Plexxikon, Inc. | Ppar active compounds |
| WO2009012283A1 (en) | 2007-07-17 | 2009-01-22 | Plexxikon Inc. | Compounds and methods for kinase modulation, and indications therefor |
| WO2009143018A2 (en) | 2008-05-19 | 2009-11-26 | Plexxikon, Inc. | Compounds and methods for kinase modulation, and indications therefor |
| PE20091846A1 (en) | 2008-05-19 | 2009-12-16 | Plexxikon Inc | PIRROLO [2,3-d] -PYRIMIDINE DERIVATIVES AS KINE MODULATORS |
| US8110576B2 (en) | 2008-06-10 | 2012-02-07 | Plexxikon Inc. | Substituted pyrrolo[2,3b]pyrazines and methods for treatment of raf protein kinase-mediated indications |
| JP5767965B2 (en) | 2008-06-10 | 2015-08-26 | プレキシコン インコーポレーテッドPlexxikon Inc. | 5H-pyrrolo [2,3-B] pyrazine derivatives that regulate kinases and indications thereof |
| WO2010104945A1 (en) | 2009-03-11 | 2010-09-16 | Plexxikon, Inc. | Pyrrolo [2, 3-b] pyridine derivatives for the inhibition of raf kinases |
| AU2010224184A1 (en) | 2009-03-11 | 2011-09-29 | Plexxikon, Inc. | Pyrrolo [2, 3-b] pyridine derivatives for the inhibition of Raf kinases |
| WO2010111527A1 (en) | 2009-03-26 | 2010-09-30 | Plexxikon, Inc. | Pyrazolo [ 3, 4 -b] pyridines as kinase inhibitors and their medical use |
| MY172424A (en) | 2009-04-03 | 2019-11-25 | Hoffmann La Roche | Propane- i-sulfonic acid {3- (4-chloro-phenyl)-1h-pyrrolo [2, 3-b] pyridine-3-carconyl] -2, 4-difluoro-phenyl} -amide compositions and uses thereof |
| CA2761009A1 (en) | 2009-05-04 | 2010-11-11 | Plexxikon, Inc. | Compounds and methods for inhibition of renin, and indications therefor |
| TW201041888A (en) | 2009-05-06 | 2010-12-01 | Plexxikon Inc | Compounds and methods for kinase modulation, and indications therefor |
| CN106220623A (en) | 2009-11-06 | 2016-12-14 | 普莱希科公司 | Compounds and methods for and indication thereof for kinases regulation |
| ES2627911T3 (en) | 2009-11-18 | 2017-08-01 | Plexxikon, Inc. | N- [2-Fluoro-3- (4-amino-7H-pyrrolo [2,3-d] pyrimidin-5-carbonyl) -phenyl] -4-benzenesulfonamide derivatives as modulators of the Raf protein kinase for the treatment of Cancer |
| BR112012015745A2 (en) | 2009-12-23 | 2016-05-17 | Plexxikon Inc | compounds and methods for kinase modulation, and indications thereof |
| TWI510487B (en) | 2010-04-21 | 2015-12-01 | Plexxikon Inc | Compounds and methods for kinase regulation and their indications |
| US8642606B2 (en) | 2010-09-29 | 2014-02-04 | Plexxikon Inc. | ZAP-70 active compounds |
| JP6097998B2 (en) | 2010-12-16 | 2017-03-22 | ベーリンガー インゲルハイム インターナショナル ゲゼルシャフト ミット ベシュレンクテル ハフツング | Biarylamide inhibitors of leukotriene formation |
| US9624213B2 (en) | 2011-02-07 | 2017-04-18 | Plexxikon Inc. | Compounds and methods for kinase modulation, and indications therefor |
| AR085279A1 (en) | 2011-02-21 | 2013-09-18 | Plexxikon Inc | SOLID FORMS OF {3- [5- (4-CHLORINE-PHENYL) -1H-PIRROLO [2,3-B] PIRIDINA-3-CARBONIL] -2,4-DIFLUOR-PHENIL} -AMIDE OF PROPANE ACID-1- SULFONIC |
| JP6113151B2 (en) | 2011-05-17 | 2017-04-12 | プレキシコン インコーポレーテッドPlexxikon Inc. | Kinase regulation and its indications |
| US9321760B2 (en) | 2011-09-12 | 2016-04-26 | Merck Patent Gmbh | Aminopyrimidine derivatives for use as modulators of kinase activity |
| US9358235B2 (en) | 2012-03-19 | 2016-06-07 | Plexxikon Inc. | Kinase modulation, and indications therefor |
| US9150570B2 (en) | 2012-05-31 | 2015-10-06 | Plexxikon Inc. | Synthesis of heterocyclic compounds |
| EP2892534B8 (en) | 2012-09-06 | 2021-09-15 | Plexxikon Inc. | Compounds and methods for kinase modulation, and indications therefor |
| MX365640B (en) | 2012-12-21 | 2019-06-10 | Plexxikon Inc | Compounds and methods for kinase modulation, and indications therefor. |
| DK2970265T3 (en) | 2013-03-15 | 2018-10-01 | Plexxikon Inc | HETEROCYCLIC COMPOUNDS AND APPLICATIONS THEREOF |
| US20140303121A1 (en) | 2013-03-15 | 2014-10-09 | Plexxikon Inc. | Heterocyclic compounds and uses thereof |
| SMT201700152T1 (en) | 2013-03-15 | 2017-05-08 | Glaxosmithkline Ip Dev Ltd | Pyridine derivatives as rearranged during transfection (ret) kinase inhibitors |
| CN105228983A (en) | 2013-05-30 | 2016-01-06 | 普莱希科公司 | The compound regulated for kinases and indication thereof |
| KR20160055170A (en) * | 2013-08-30 | 2016-05-17 | 암비트 바이오사이언시즈 코포레이션 | Biaryl acetamide compounds and methods of use thereof |
| US9771369B2 (en) | 2014-03-04 | 2017-09-26 | Plexxikon Inc. | Compounds and methods for kinase modulation, and indications therefor |
| ES2774177T3 (en) | 2014-09-15 | 2020-07-17 | Plexxikon Inc | Heterocyclic compounds and uses of these |
| WO2016164641A1 (en) | 2015-04-08 | 2016-10-13 | Plexxikon Inc. | Compounds and methods for kinase modulation, and indications therefor |
| JP6530826B2 (en) | 2015-05-06 | 2019-06-12 | プレキシコン インコーポレーテッドPlexxikon Inc. | Synthesis of 1H-pyrrolo [2,3-B] pyridine derivatives that modify kinases |
| LT3292123T (en) | 2015-05-06 | 2020-12-28 | Plexxikon Inc. | Solid forms of a compound modulating kinases |
| WO2016191295A1 (en) | 2015-05-22 | 2016-12-01 | Plexxikon Inc. | Solid forms of a compound for modulating kinases |
| US9814714B2 (en) | 2015-05-22 | 2017-11-14 | Plexxikon Inc. | Kinase modulation, and indications therefor |
| US10829484B2 (en) | 2015-07-28 | 2020-11-10 | Plexxikon Inc. | Compounds and methods for kinase modulation, and indications therefor |
| ES2913048T3 (en) | 2015-09-21 | 2022-05-31 | Opna Immuno Oncology Sa | Heterocyclic Compounds and Uses of These |
| MX2018006856A (en) | 2015-12-07 | 2018-08-01 | Plexxikon Inc | Compounds and methods for kinase modulation, and indications therefor. |
| JP2020511467A (en) | 2017-03-20 | 2020-04-16 | プレキシコン インコーポレーテッドPlexxikon Inc. | 4- (1- (1,1-di (pyridin-2-yl) ethyl) -6- (3,5-dimethylisoxazol-4-yl) -1H-pyrrolo [3,2- that inhibits the bromodomain b] Pyridin-3-yl) benzoic acid crystalline form |
| AU2018307910B2 (en) | 2017-07-25 | 2024-07-25 | Daiichi Sankyo Company, Limited | Formulations of a compound modulating kinases |
-
2016
- 2016-07-27 US US15/221,474 patent/US10829484B2/en active Active
- 2016-07-27 WO PCT/US2016/044330 patent/WO2017019804A2/en not_active Ceased
Patent Citations (56)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4150949A (en) | 1976-04-15 | 1979-04-24 | Technicon Instruments Corporation | Immunoassay for gentamicin |
| US4568649A (en) | 1983-02-22 | 1986-02-04 | Immunex Corporation | Immediate ligand detection assay |
| US4626513A (en) | 1983-11-10 | 1986-12-02 | Massachusetts General Hospital | Method and apparatus for ligand detection |
| EP0154734A1 (en) | 1984-03-15 | 1985-09-18 | Immunex Corporation | Immediate ligand detection assay, a test kit and its formation |
| US6054270A (en) | 1988-05-03 | 2000-04-25 | Oxford Gene Technology Limited | Analying polynucleotide sequences |
| US5700637A (en) | 1988-05-03 | 1997-12-23 | Isis Innovation Limited | Apparatus and method for analyzing polynucleotide sequences and method of generating oligonucleotide arrays |
| US5658775A (en) | 1988-05-17 | 1997-08-19 | Sloan-Kettering Institute For Cancer Research | Double copy retroviral vector |
| US5449614A (en) | 1988-09-01 | 1995-09-12 | Whitehead Institue For Biomedical Research | Recombinant retroviruses with amphotropic and ecotropic host ranges |
| US5580859A (en) | 1989-03-21 | 1996-12-03 | Vical Incorporated | Delivery of exogenous DNA sequences in a mammal |
| US6261776B1 (en) | 1989-06-07 | 2001-07-17 | Affymetrix, Inc. | Nucleic acid arrays |
| US5800992A (en) | 1989-06-07 | 1998-09-01 | Fodor; Stephen P.A. | Method of detecting nucleic acids |
| US5143854A (en) | 1989-06-07 | 1992-09-01 | Affymax Technologies N.V. | Large scale photolithographic solid phase synthesis of polypeptides and receptor binding screening thereof |
| US5744305A (en) | 1989-06-07 | 1998-04-28 | Affymetrix, Inc. | Arrays of materials attached to a substrate |
| US5770456A (en) | 1989-06-07 | 1998-06-23 | Affymetrix, Inc. | Cyclic nucleic acid and polypeptide arrays |
| US5474935A (en) | 1990-05-23 | 1995-12-12 | The United States Of America As Represented By The Department Of Health And Human Services | Adeno-associated virus (AAV)-based eucaryotic vectors |
| US6110458A (en) | 1991-07-26 | 2000-08-29 | University Of Rochester | Cancer therapy utilizing ex vivo gene transduction |
| US5434049A (en) | 1992-02-28 | 1995-07-18 | Hitachi, Ltd. | Separation of polynucleotides using supports having a plurality of electrode-containing cells |
| US5631236A (en) | 1993-08-26 | 1997-05-20 | Baylor College Of Medicine | Gene therapy for solid tumors, using a DNA sequence encoding HSV-Tk or VZV-Tk |
| US5426039A (en) | 1993-09-08 | 1995-06-20 | Bio-Rad Laboratories, Inc. | Direct molecular cloning of primer extended DNA containing an alkane diol |
| US6045996A (en) | 1993-10-26 | 2000-04-04 | Affymetrix, Inc. | Hybridization assays on oligonucleotide arrays |
| US20010014449A1 (en) | 1993-11-01 | 2001-08-16 | Michael I. Nerenberg | Methods for determination of single nucleic acid polymorphisms using bioelectronic microchip |
| US5632957A (en) | 1993-11-01 | 1997-05-27 | Nanogen | Molecular biological diagnostic systems including electrodes |
| US5807522A (en) | 1994-06-17 | 1998-09-15 | The Board Of Trustees Of The Leland Stanford Junior University | Methods for fabricating microarrays of biological samples |
| US5556752A (en) | 1994-10-24 | 1996-09-17 | Affymetrix, Inc. | Surface-bound, unimolecular, double-stranded DNA |
| US5830645A (en) | 1994-12-09 | 1998-11-03 | The Regents Of The University Of California | Comparative fluorescence hybridization to nucleic acid arrays |
| WO1996017958A1 (en) | 1994-12-09 | 1996-06-13 | The Regents Of The University Of California | Comparative fluorescence hybridization to nucleic acid arrays |
| US6117681A (en) | 1995-03-29 | 2000-09-12 | Bavarian Nordic Research Inst. A/S | Pseudotyped retroviral particles |
| US6110456A (en) | 1995-06-07 | 2000-08-29 | Yale University | Oral delivery or adeno-associated viral vectors |
| US5856174A (en) | 1995-06-29 | 1999-01-05 | Affymetrix, Inc. | Integrated nucleic acid diagnostic device |
| US6107478A (en) | 1995-09-08 | 2000-08-22 | Pedersen; Finn Skou | Retroviral vector, a replication system for said vector and avian or mammalian cells transfected with said vector |
| US5721118A (en) | 1995-10-31 | 1998-02-24 | The Regents Of The University Of California, San Diego | Mammalian artificial chromosomes and methods of using same |
| US6022963A (en) | 1995-12-15 | 2000-02-08 | Affymetrix, Inc. | Synthesis of oligonucleotide arrays using photocleavable protecting groups |
| US6013440A (en) | 1996-03-11 | 2000-01-11 | Affymetrix, Inc. | Nucleic acid affinity columns |
| US6025155A (en) | 1996-04-10 | 2000-02-15 | Chromos Molecular Systems, Inc. | Artificial chromosomes, uses thereof and methods for preparing artificial chromosomes |
| US5959098A (en) | 1996-04-17 | 1999-09-28 | Affymetrix, Inc. | Substrate preparation process |
| WO1997046313A1 (en) | 1996-06-07 | 1997-12-11 | Eos Biotechnology, Inc. | Immobilised linear oligonucleotide arrays |
| US5965452A (en) | 1996-07-09 | 1999-10-12 | Nanogen, Inc. | Multiplexed active biologic array |
| US6258606B1 (en) | 1996-07-09 | 2001-07-10 | Nanogen, Inc. | Multiplexed active biologic array |
| US6846630B2 (en) | 1996-10-18 | 2005-01-25 | Takara Shuzo Co., Ltd. | Nucleic acid encoding receptor type protein kinase |
| US6096718A (en) | 1997-06-05 | 2000-08-01 | Gene Targeting Corp. | Tissue specific adenovirus vectors for breast cancer treatment |
| US20010018642A1 (en) | 1997-07-25 | 2001-08-30 | David Balaban | Method and system for providing a probe array chip design database |
| WO1999009217A1 (en) | 1997-08-15 | 1999-02-25 | Hyseq, Inc. | Methods and compositions for detection or quantification of nucleic acid species |
| US20010019827A1 (en) | 1997-09-11 | 2001-09-06 | Dawson Elliott P. | Method of making high density arrays |
| US20010014448A1 (en) | 1997-09-30 | 2001-08-16 | Surmodics, Inc. | Target molecule attachment to surfaces |
| WO1999051773A1 (en) | 1998-04-03 | 1999-10-14 | Phylos, Inc. | Addressable protein arrays |
| US6048695A (en) | 1998-05-04 | 2000-04-11 | Baylor College Of Medicine | Chemically modified nucleic acids and methods for coupling nucleic acids to solid support |
| US6113913A (en) | 1998-06-26 | 2000-09-05 | Genvec, Inc. | Recombinant adenovirus |
| US6277628B1 (en) | 1998-10-02 | 2001-08-21 | Incyte Genomics, Inc. | Linear microarrays |
| US6277489B1 (en) | 1998-12-04 | 2001-08-21 | The Regents Of The University Of California | Support for high performance affinity chromatography and other uses |
| US20010016322A1 (en) | 1999-04-27 | 2001-08-23 | Caren Michael P. | Method of performing array-based hybridization assays using thermal inkjet deposition of sample fluids |
| US20010012537A1 (en) | 1999-07-30 | 2001-08-09 | Anderson Norman G. | Dry deposition of materials for microarrays using matrix displacement |
| US20010008765A1 (en) | 1999-12-06 | 2001-07-19 | Fuji Photo Film Co., Ltd. | DNA chip and reactive solid carrier |
| WO2004015142A1 (en) | 2002-08-07 | 2004-02-19 | Ambit Biosciences Corporation | Uncoupling of dna propagation and expression of protein for phage display |
| US20040077595A1 (en) | 2002-09-06 | 2004-04-22 | Insert Therapeutics, Inc. | Cyclodextrin-based polymers for therapeutics delivery |
| WO2008005310A2 (en) | 2006-06-30 | 2008-01-10 | Ambit Biosciences Corp. | Detectable nucleic acid tag |
| WO2011022473A1 (en) | 2009-08-19 | 2011-02-24 | Ambit Biosciences Corporation | Biaryl compounds and methods of use thereof |
Non-Patent Citations (106)
| Title |
|---|
| "Bioreversible Carriers in Drug Design", 1987, AMERICAN PHARMACEUTICAL ASSOCIATION AND PERGAMON PRESS |
| "Current Protocols in Molecular Biology", 1997, JOHN WILEY & SONS, INC. |
| "CURRENT PROTOCOLS IN NUCLEIC ACID CHEMISTRY", vol. 1, 2000, JOHN WILEY AND SONS |
| "Design of Prodrugs", 1985, ELSEVIER |
| "Molecular Cloning: a Laboratory Manual", vol. 1-3, 1989, COLD SPRING HARBOR LABORATORY |
| "Part I. Theory and Nucleic Acid Preparation", 1993, ELSEVIER, article "Laboratory Techniques in Biochemistry and Molecular Biology: Hybridization With Nucleic Acid Probes" |
| "Remington's Pharmaceutical Sciences", vol. 2, 1995, MACK PUBLISHING CO., pages: 1457 |
| "The Practice of Medicinal Chemistry", 2001, ACADEMIC PRESS |
| "The Science and Practice of Pharmacy", 2005, LIPPINCOTT, WILLIAMS AND WILKINS |
| ALFTHAN: "Surface plasmon resonance biosensors as a tool in antibody engineering", BIOSENSORS & BIOELECTRONICS, vol. 13, 1998, pages 653 - 663 |
| ARMSTRONG ET AL., CANCER CELL, vol. 3, 2003, pages 173 - 183 |
| BAGSHAWE, DRUG DEV. RES., vol. 34, 1995, pages 220 - 230 |
| BASHFORD ET AL.: "Spectrophotometry and Spectrofluorometry: A Practical Approach", 1987, IRL PRESS LTD., pages: 91 - 114 |
| BEAUCAGE; IYER, TETRAHEDRON, vol. 48, 1992, pages 2223 - 2311 |
| BELL: "Spectroscopy In Biochemistry", vol. I, 1981, CRC PRESS, pages: 155 - 194 |
| BERGE, S. M. ET AL.: "Pharmaceutical Salts", J. PHARMACEUTICAL SCIENCE, vol. 66, 1977, pages 1 - 19 |
| BERTOLINI ET AL., J. MED CHEM., vol. 40, 1997, pages 2011 - 2016 |
| BOWTELL, NATURE GENETICS SUPP., vol. 21, 1999, pages 25 - 32 |
| BUCHSCHER, J. VIROL., vol. 66, 1992, pages 2731 - 2739 |
| CAPON, NATURE, vol. 377, 1989, pages 525 - 531 |
| CHECOVICH, W. J. ET AL., NATURE, vol. 375, 1995, pages 254 - 256 |
| COLLIUOD, BIOCONJUGATE CHEM., vol. 4, 1993, pages 528 - 536 |
| CURRENT PHARMACEUTICAL DESIGN, vol. 11, 2005, pages 3449 - 3457 |
| DANDLIKER, W. B. ET AL., METHODS IN ENZYMOLOGY, vol. 74, 1981, pages 3 - 28 |
| DOBELI, PROTEIN EXPR. PURIF., vol. 12, 1998, pages 404 - 414 |
| EICHER; HAUPTMANN: "The Chemistry of Heterocycles", 2003 |
| FABIAN ET AL., NATURE BIOTECHNOLOGY, vol. 23, 2005, pages 329 - 336 |
| FENG, NATURE BIOTECHNOLOGY, vol. 15, 1997, pages 866 - 870 |
| FIVASH ET AL.: "BIAcore for macromolecular interaction", CURRENT OPINION IN BIOTECHNOLOGY, vol. 9, 1998, pages 97 - 101 |
| GILLIAND ET AL., CURR. OPIN. HEMATOL., vol. 9, 2002, pages 274 - 281 |
| GILLILAND ET AL., BLOOD, vol. 100, 2002, pages 1532 - 1542 |
| GORDON, A. J.; FORD, R. A.: "The Chemist's Companion: A Handbook Of Practical Data, Techniques, And References", 1972, JOHN WILEY AND SONS, pages: 437 |
| GREEN, T.W.; P.G.M. WUTZ: "Protective Groups in Organic Synthesis", 1991, WILEY-INTERSCIENCE |
| HAFNER ET AL., BIOTECHNIQUES, vol. 30, no. 4, April 2001 (2001-04-01), pages 852 - 6,858,860 |
| HANSELMAN ET AL., J. LIPID RES., vol. 38, 1997, pages 2365 - 2373 |
| HARRISON; HARRISON ET AL.: "COMPENDIUM OF SYNTHETIC ORGANIC METHODS", vol. 1-8, JOHN WILEY AND SONS, pages: 1971 - 1996 |
| HAYAKAWA ET AL., ONCOGENE, vol. 19, 2000, pages 624 |
| HEIM ET AL., CURR. BIOL., vol. 6, 1996, pages 178 - 182 |
| IWANE, BIOPHYS. BIOCHEM. RES. COMM., vol. 230, 1997, pages 76 - 80 |
| J. MARCH: "ADVANCED ORGANIC CHEMISTRY", 2007, JOHN WILEY AND SONS |
| JERRY MARCH: "Advanced Organic Chemistry: Reactions, Mechanisms and Structures", 1992, JOHN WILEY & SONS, pages: 69 - 74 |
| JOHANN, J. VIROL., vol. 66, 1992, pages 1635 - 1640 |
| JOHNSTON, CURR. BIOL., vol. 8, 1998, pages R171 - R174 |
| KAHL ET AL., ANAL. BIOCHEM., vol. 243, 1996, pages 282 - 283 |
| KERN, BIOTECHNIQUES, vol. 23, 1997, pages 120 - 124 |
| KROLL, DNA CELL. BIOL., vol. 12, 1993, pages 441 - 453 |
| LIPAROTO ET AL.: "Biosensor analysis of the interleukin-2 receptor complex", JOURNAL OF MOLECULAR RECOGNITION, vol. 12, 1999, pages 316 - 321 |
| LIPSCHULTZ ET AL.: "Experimental design for analysis of complex kinetics using surface plasmon resonance", METHODS, vol. 20, no. 3, 2000, pages 310 - 318 |
| LOPESDE MENEZES ET AL., CLIN. CANCER RES., vol. 11, no. 14, 2005, pages 5281 - 5291 |
| LOWENBERG ET AL., N. ENG. J. MED., vol. 341, 1999, pages 1051 - 1062 |
| LU, ANAL. CHEM., vol. 67, 1995, pages 83 - 87 |
| LYMAN ET AL.: "FLT3 Ligand in THE CYTOKINE HANDBOOK", vol. 989, 2003 |
| MALMBORG ET AL.: "BIAcore as a tool in antibody engineering", JOURNAL OF IMMUNOLOGICAL METHODS, vol. 183, 1995, pages 7 - 13 |
| MALMQVIST ET AL.: "Biomolecular interaction analysis: affinity biosensor technologies for functional analysis of proteins", CURRENT OPINION IN CHEMICAL BIOLOGY, vol. 1, 1997, pages 378 - 383 |
| MALMQVIST: "BIACORE: an affinity biosensor system for characterization of biomolecular interactions", BIOCHEMICAL SOCIETY TRANSACTIONS, vol. 27, 1999, pages 335 - 340 |
| MARCH: "Advanced Organic Chemistry: Reactions, Mechanisms, and Structure", 1992, WILEY INTERSCIENCE |
| MCKENNA ET AL., BLOOD, vol. 95, 2000, pages 3489 - 2497 |
| MENDEL ET AL., CLIN. CANCER RES, vol. 9, 2003, pages 327 - 337 |
| MITRA ET AL., GENE, vol. 173, 1996, pages 13 - 17 |
| MIZUKI ET AL., BLOOD, vol. 96, 2000, pages 3907 |
| NG, LANGMUIR, vol. 11, 1995, pages 4048 - 4055 |
| NICHOLS ET AL., ANAL. BIOCHEM., vol. 257, 1998, pages 112 - 119 |
| O'FARRELL ET AL., BLOOD, vol. 101, 2003, pages 3597 - 3605 |
| OKADA, GENE THER., vol. 3, 1996, pages 957 - 964 |
| ONO ET AL., J. OF CLINICAL INVESTIGATION, vol. 115, 2005, pages 919 - 929 |
| O'SHANNESSY ET AL.: "Interpretation of deviations from pseudo-first-order kinetic behavior in the characterization of ligand binding by biosensor technology", ANALYTICAL BIOCHEMISTRY, vol. 236, 1996, pages 275 - 283 |
| O'SHANNESSY: "Determination of kinetic rate and equilibrium binding constants for macromolecular interactions: a critique of the surface plasmon resonance literature", CURRENT OPINIONS IN BIOTECHNOLOGY, vol. 5, 1994, pages 65 - 71 |
| OWICKIET: "Application of Fluorescence Polarization Assays in High-Throughput Screening", GENETIC ENGINEERING NEWS, vol. 17, 1997, pages 27 |
| PARKER ET AL.: "Development of high throughput screening assays using fluorescence polarization: nuclear receptor-ligand-binding and kinase/phosphatase assays", J BIOMOL SCREEN, vol. 5, 2000, pages 77 - 88 |
| PRICE ET AL.: "Summary report on the ISOBM TD-4 Workshop: analysis of 56 monoclonal antibodies against the MUC1 mucin", TUMOUR BIOLOGY, vol. 19, no. 1, 1998, pages 1 - 20 |
| RASKO ET AL., LEUKEMIA, vol. 9, 1995, pages 2058 - 2066 |
| ROBERTS, NATURE, vol. 328, 1987, pages 731 |
| ROBINSON, BLOOD, vol. 33, 1969, pages 396 - 399 |
| ROSENFELD, NAT. GENET, vol. 15, 1997, pages 333 - 335 |
| ROSNET ET AL., ACTA HAEMATOL, vol. 95, 1996, pages 218 |
| ROSNET ET AL., BLOOD, vol. 82, 1993, pages 1110 - 1119 |
| ROSNET ET AL., LEUKEMIA, vol. 10, 1996, pages 238 - 248 |
| SAIKI ET AL.: "PCR Protocols", 1990, ACADEMIC PRESS, article "Amplification of Genomic DNA", pages: 13 - 20 |
| SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual", 1989, COLD SPRING HARBOR LABORATORY PRESS, pages: 16.30 - 16.37 |
| SCHNEIDER, PROTEIN EXPR. PURIF., vol. 6435, 1995, pages 10 |
| SCHUHMANN, ADV. MATER., vol. 3, 1991, pages 388 - 391 |
| SCHUMMER, BIOTECHNIQUES, vol. 23, 1997, pages 1087 - 1092 |
| SELVIN ET AL., METH. ENZYMOL., vol. 246, 1995, pages 300 - 345 |
| SHAN ET AL., J PHARM SCI, vol. 86, no. 7, 1997, pages 756 - 757 |
| SIGAL, ANAL. CHEM., vol. 68, 1996, pages 490 - 497 |
| SMALL ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 91, 1994, pages 459 - 463 |
| SMITH ET AL., BLOOD, vol. 121, 2013, pages 3165 - 3171 |
| SMITH ET AL., NATURE, vol. 485, 2012, pages 260 - 263 |
| SOLINAS-TOLDO, GENES, CHROMOSOMES & CANCER, vol. 20, 1997, pages 399 - 407 |
| SPIEKERMANN ET AL., BLOOD, vol. 101, 2003, pages 1494 - 1504 |
| STILL ET AL., J. ORG. CHEM., vol. 43, 1978, pages 2923 |
| SUN ET AL., J. MED. CHEM., vol. 46, 2003, pages 1116 - 1119 |
| T. HIGUCHI; V. STELLA: "A.C.S. Symposium Series", vol. 14, article "Pro-drugs as Novel Delivery Systems" |
| T.W. GREENE; P.G. WUTS: "PROTECTIVE GROUPS IN ORGANIC CHEMISTRY", 2006, WILEY |
| TALLMAN ET AL., BLOOD, vol. 122, 2013, pages 494 |
| TCGA, N ENGL J MED., vol. 368, 2013, pages 2059 - 2074 |
| UNDENFRIEND ET AL., ANAL. BIOCHEM., vol. 161, 1987, pages 494 - 500 |
| VAN REGENMORTEL: "Use of biosensors to characterize recombinant proteins", DEVELOPMENTS IN BIOLOGICAL STANDARDIZATION, vol. 83, 1994, pages 143 - 151 |
| VELY F. ET AL.: "BIAcore8' analysis to test phosphopeptide-SH2 domain interactions", METHODS IN MOLECULAR BIOLOGY, vol. 121, 2000, pages 313 - 321 |
| WHARAM ET AL., NUCLEIC ACIDS RES., vol. 29, no. 11, 1 June 2001 (2001-06-01), pages E54 - E54 |
| WILLIAMS, BIOCHEMISTRY, vol. 34, 1995, pages 1787 - 1797 |
| WOON, GENOMICS, vol. 50, 1998, pages 306 - 316 |
| YAO ET AL., CLINICAL CANCER RESEARCH, vol. 9, 2003, pages 4483 - 4493 |
| YOKOTA ET AL., LEUKEMIA, vol. 11, 1997, pages 1605 - 1609 |
| ZHONG ET AL., BIOTECHNIQUES, vol. 30, no. 4, April 2001 (2001-04-01), pages 852 - 856,858,860 |
| ZIMMERMAN ET AL., BLOOD, vol. 122, 2013, pages 3607 - 3615 |
Cited By (24)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10829484B2 (en) | 2015-07-28 | 2020-11-10 | Plexxikon Inc. | Compounds and methods for kinase modulation, and indications therefor |
| AU2017232610B2 (en) * | 2016-03-16 | 2021-07-22 | Plexxikon Inc. | Compounds and methods for kinase modulation and indications therefore |
| US10160747B2 (en) | 2016-03-16 | 2018-12-25 | Plexxikon Inc. | Compounds and methods for kinase modulation, and indications therefor |
| WO2017161045A1 (en) * | 2016-03-16 | 2017-09-21 | Plexxikon Inc. | Compounds and methods for kinase modulation and indications therefore |
| JP2019512505A (en) * | 2016-03-16 | 2019-05-16 | プレキシコン インコーポレーテッドPlexxikon Inc. | Compounds and methods for kinase modulation and its indication |
| JP7247388B2 (en) | 2016-12-16 | 2023-03-28 | 株式会社半導体エネルギー研究所 | Compound |
| JP2022070999A (en) * | 2016-12-16 | 2022-05-13 | 株式会社半導体エネルギー研究所 | Compound |
| US11040027B2 (en) | 2017-01-17 | 2021-06-22 | Heparegenix Gmbh | Protein kinase inhibitors for promoting liver regeneration or reducing or preventing hepatocyte death |
| US11834438B2 (en) | 2017-12-20 | 2023-12-05 | Denali Therapeutics Inc. | Process for the preparation of pyrimidinyl-4-aminopyrazole compounds |
| CN112088003A (en) * | 2017-12-20 | 2020-12-15 | 戴纳立制药公司 | Process for preparing pyrimidinyl-4-aminopyrazole compounds |
| JP2021506892A (en) * | 2017-12-20 | 2021-02-22 | デナリ セラピューティクス インコーポレイテッドDenali Therapeutics Inc. | Method for preparing pyrimidinyl-4-aminopyrazole compound |
| CN112088003B (en) * | 2017-12-20 | 2023-10-13 | 戴纳立制药公司 | Process for preparing pyrimidinyl-4-aminopyrazole compounds |
| IL275480B1 (en) * | 2017-12-20 | 2023-06-01 | Denali Therapeutics Inc | Process for the preparation of pyrimidinyl-4-aminopyrazole compounds |
| EP3727377A4 (en) * | 2017-12-20 | 2021-08-18 | Denali Therapeutics Inc. | PROCESS FOR THE PREPARATION OF PYRIMIDINYL-4-AMINOPYRAZOLE COMPOUNDS |
| IL275480B2 (en) * | 2017-12-20 | 2023-10-01 | Denali Therapeutics Inc | Process for the preparation of pyrimidinyl-4-aminopyrazole compounds |
| US12497387B2 (en) | 2017-12-20 | 2025-12-16 | Denali Therapeutics Inc. | Process for the preparation of pyrimidinyl-4-aminopyrazole compounds |
| WO2019126383A1 (en) | 2017-12-20 | 2019-06-27 | Denali Therapeutics Inc. | Process for the preparation of pyrimidinyl-4-aminopyrazole compounds |
| US11667651B2 (en) | 2017-12-22 | 2023-06-06 | Hibercell, Inc. | Aminopyridine derivatives as phosphatidylinositol phosphate kinase inhibitors |
| CN111380971A (en) * | 2018-12-29 | 2020-07-07 | 江苏先声药业有限公司 | A kind of HPLC analysis method of bortezomib related substances |
| WO2020161208A1 (en) | 2019-02-06 | 2020-08-13 | Syngenta Crop Protection Ag | Herbicidal fused pyridazine compounds |
| WO2020161209A1 (en) | 2019-02-06 | 2020-08-13 | Syngenta Crop Protection Ag | Herbicidal fused pyridazine compounds |
| CN110041259A (en) * | 2019-05-17 | 2019-07-23 | 南开大学 | Fluorine substituted pyrazolecarboxylic amine derivant and its preparation method and application |
| US12006332B2 (en) | 2019-06-17 | 2024-06-11 | Hibercell, Inc. | Aminopyrimidine derivatives as phosphatidylinositol phosphate kinase inhibitors |
| WO2023282110A1 (en) | 2021-07-08 | 2023-01-12 | 石原産業株式会社 | Nematocidal composition |
Also Published As
| Publication number | Publication date |
|---|---|
| US20170029413A1 (en) | 2017-02-02 |
| US10829484B2 (en) | 2020-11-10 |
| WO2017019804A3 (en) | 2017-03-09 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US10829484B2 (en) | Compounds and methods for kinase modulation, and indications therefor | |
| US10160755B2 (en) | Compounds and methods for kinase modulation, and indications therefor | |
| EP3386980B1 (en) | Compounds and methods for kinase modulation, and indications therefor | |
| EP3430005B1 (en) | Compounds and methods for kinase modulation and indications therefore | |
| US10301280B2 (en) | Compounds and methods for kinase modulation, and indications therefor | |
| EP2892534B1 (en) | Compounds and methods for kinase modulation, and indications therefor | |
| US10428067B2 (en) | Compounds and methods for kinase modulation | |
| EP3558991A2 (en) | Compounds and methods for cdk8 modulation and indications therefor | |
| AU2017331345A1 (en) | Compounds and methods for IDO and TDO modulation, and indications therefor | |
| CA3047580C (en) | Compounds and methods for cdk8 modulation and indications therefor | |
| HK1213877B (en) | Compounds and methods for kinase modulation, and indications therefor |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 16747712 Country of ref document: EP Kind code of ref document: A2 |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 16747712 Country of ref document: EP Kind code of ref document: A2 |


















































































































































































































































