WO2017017624A1 - Combination of pd-1 antagonist with an egfr inhibitor - Google Patents
Combination of pd-1 antagonist with an egfr inhibitor Download PDFInfo
- Publication number
- WO2017017624A1 WO2017017624A1 PCT/IB2016/054488 IB2016054488W WO2017017624A1 WO 2017017624 A1 WO2017017624 A1 WO 2017017624A1 IB 2016054488 W IB2016054488 W IB 2016054488W WO 2017017624 A1 WO2017017624 A1 WO 2017017624A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- amino acid
- acid sequence
- pharmaceutical combination
- antibody molecule
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/39558—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/21—Esters, e.g. nitroglycerine, selenocyanates
- A61K31/255—Esters, e.g. nitroglycerine, selenocyanates of sulfoxy acids or sulfur analogues thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/55—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having seven-membered rings, e.g. azelastine, pentylenetetrazole
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2818—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2300/00—Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
Definitions
- the present invention relates to a pharmaceutical composition comprising a PD-1 antagonist and an EGFR inhibitor.
- the present combination is administered independently or separately, in a quantity which is jointly therapeutically effective for lung cancer, e.g. squamous lung cancer and NSCLC, colorectal cancer and breast cancer, e.g., triple-negative breast cancer (TNBC).
- the invention further relates to a use of such a combination for the manufacture of a medicament; the use of such combination as a medicine; a kit of parts comprising such a combination; a dosing regimen using the combination disclosed herein, and a method of treatment of lung cancer, e.g. squamous lung cancer and NSCLC, colorectal cancer and breast cancer, e.g., triple-negative breast cancer (TNBC), involving the combination.
- TNBC triple-negative breast cancer
- Lung cancer is the most common cancer worldwide, with NSCLC accounting for approximately 85% of lung cancer cases.
- NSCLC non-small cell lung cancer
- EGFR epidermal growth factor receptor
- Asian countries have reported rates as high as 30-40%.
- the predominant oncogenic EGFR mutations (L858R and exl9del) account for about 90% of EGFR NSCLC.
- EGFR Exon 20 insertion mutations were described to account for 4-10% of all EGFR mutations in patients, the third largest EGFR mutant patient population behind the classic (L858R and exl9del) EGFR mutations.
- EGFR-mutant patients are given an EFGR inhibitor as first line therapy. However, most patients develop acquired resistance, generally within 10 to 14 months.
- TKIs first generation reversible EGFR Tyrosine Kinase Inhibitors
- Second-generation EGFR TKIs (such as afatinib and dacomitinib) have been developed to try to overcome this mechanism of resistance. These are irreversible agents that covalently bind to cysteine 797 at the EGFR ATP site and are potent on both activating [L858R, exl9del] and acquired T790M mutations in pre-clinical models. Their clinical efficacy has however proven to be limited, possibly due to severe adverse effects caused by concomitant wild-type (WT) EGFR inhibition.
- WT concomitant wild-type
- Third generation EFGR TKIs such as AZD9291 (mereletinib) and CO- 1686 (rociletinib) are thus beginning to enter clinical development and to show significant initial promise (e.g., see "AZD9291 in EGFR Inhibitor-Resistant Non-Small-Cell Lung Cancer", Hanne et al, N Engl J Med, 2015; 372; 1689-99 and "Rociletinib in EGFR-Mutated Non-Small-Cell Lung Cancer", Sequist et al, J Med, 2015; 372; 1700-9).
- ASP8273 a novel mutant-selective irreversible EGFR inhibitor, inhibits growth of non-small cell lung cancer (NSCLC) cells with EGFR activating and T790M resistance mutations "Sakagami et al, AACR; Cancer Res 2014;74; 1728.
- TNBC triple -negative breast cancer
- CRC Colorectal cancer
- lung cancer such as squamous lung cancer and NSCLC, colorectal cancer and breast cancer, and in particular, triple-negative breast cancer (TNBC).
- TNBC triple-negative breast cancer
- cancers such as lung cancer, such as squamous lung cancer and NSCLC, colorectal cancer and breast cancer, and in particular, triple-negative breast cancer (TNBC), which prove to be resistant or refractory to immunotherapy such as anti-PD-1 or anti-PD-Ll therapy.
- TNBC triple-negative breast cancer
- TEC-family protein tyrosine kinases ITK, RLK and TEC have been identified as key components of T-cell-receptor signaling that contributes to the regulation and polarization of T-cell activation. Functional studies have implicated TEC kinases as important mediators of pathways that control CD4+ T helper cell differentiation and promote effector functions. ITK is specific for T cells and is critically required for Th2 differentiation. TEC kinases have now emerged as important modulators of T-cell function that have exciting therapeutic potential for the regulation of polarized T-cell responses.
- Compound A i.e. (i?,£)-N-(7-chloro-l-(l-(4-(dimethylamino)but-2-enoyl)azepan-3-yl)- lHbenzo[d]imidazol-2-yl)-2-methylisonicotinamide, has been found to have immunomodulatory function due to its cross-reactivity on the TEC family of kinases, in particular ITK. ITK is expressed and regulates Th2 cell differentiation. Inhibition of TEC kinases and particularly ITK could shift the balance from Th2 to Thl cells. Skewing the microenvironment from a Th2 to Thl with Compound A may improve the antitumor immune response in some patients, particularly in combination with other immune modulators such as the antibody molecules disclosed herein.
- the present invention therefore provides a novel combination of an EGFR inhibitor and a Programmed Death 1 (PD-1) antagonist that can provide an advantageous effect for treatment of specific cancers.
- the present invention therefore provides therapies which provide safe, effective treatment for patients suffering from cancer. It is also important that the patients continue to respond positively to such treatment for as long as possible.
- the combination of an EGFR inhibitor and a Programmed Death 1 (PD-1) antagonist may be particularly useful in the treatment of lung cancer, such as squamous lung cancer and NSCLC, colorectal cancer and breast cancer, and in particular, triple-negative breast cancer (TNBC).
- the invention provides a pharmaceutical combination including an isolated antibody molecule capable of binding to a human Programmed Death- 1 (PD-1) antagonist comprising (a) a heavy chain variable region (VH) comprising a HCDR1, a HCDR2 and a HCDR3 amino acid sequence of BAP049-Clone-B or BAP049-Clone-E as described in Table 1 and a light chain variable region (VL) comprising a LCDR1, a LCDR2 and a LCDR3 amino acid sequence of BAP049-Clone-B or BAP049-Clone-E as described in Table 1; and ii) (R,E)- N-(7-chloro- 1 -( 1 -(4-(dimethylamino)but-2-enoyl)azepan-3-yl)- lHbenzo[d]imidazol-2-yl)-2- methylisonicotinamide (Compound A), or a pharmaceutically acceptable salt thereof.
- Compound A may also be in the free form (i.e. not a salt).
- the invention also provides the pharmaceutical combination described above for use in the treatment of a cancer, such as lung cancer (e.g. squamous lung cancer and NSCLC), colorectal cancer and breast cancer (in particular, triple-negative breast cancer (TNBC)), which prove to be resistant, relapsing, or refractory to immunotherapy such as anti-PD-1 or anti-PD-Ll therapy.
- a cancer such as lung cancer (e.g. squamous lung cancer and NSCLC), colorectal cancer and breast cancer (in particular, triple-negative breast cancer (TNBC)
- TNBC triple-negative breast cancer
- these therapies include therapy with pembrolizumab, nivolumab, atezolizumab and MEDI4736.
- the pharmaceutical combination described herein includes a quantity which is therapeutically effective for the treatment of a cancer such as lung cancer, such as squamous lung cancer and NSCLC, colorectal cancer and breast cancer, and in particular, triple-negative breast cancer (TNBC), which prove to be resistant or refractory to immunotherapy such as anti-PD-1 or anti-PD-Ll therapy.
- a cancer such as lung cancer, such as squamous lung cancer and NSCLC, colorectal cancer and breast cancer, and in particular, triple-negative breast cancer (TNBC), which prove to be resistant or refractory to immunotherapy such as anti-PD-1 or anti-PD-Ll therapy.
- these therapies include therapy with pembrolizumab, nivolumab, atezolizumab and MEDI4736.
- the invention includes the use of the pharmaceutical combination described herein for the manufacture of a medicament for the treatment of a cancer such as lung cancer, such as squamous lung cancer and NSCLC; colorectal cancer and breast cancer, (and in particular, triple-negative breast cancer (TNBC)), which prove to be resistant or refractory to immunotherapy such as anti-PD-1 or anti-PD-Ll therapy.
- a cancer such as lung cancer, such as squamous lung cancer and NSCLC; colorectal cancer and breast cancer, (and in particular, triple-negative breast cancer (TNBC)
- TNBC triple-negative breast cancer
- these therapies include therapy with pembrolizumab, nivolumab, atezolizumab and MEDI4736.
- novel dosage regimens involving the pharmaceutical combinations described herein are also provided.
- the anti-PD-1 antibody molecule e.g. BAP049-Clone-B or BAP049-Clone-E, is preferably administered or used at a flat or fixed dose.
- the invention features a method of treating the cancers described herein wherein the method includes administering to the subject a pharmaceutical combination described herein wherein the anti-PD-1 antibody molecule, e.g. BAP049-Clone- B or BAP049-Clone-E, is administered at a dose of about 300 mg to 400 mg once every three weeks or once every four weeks.
- the anti-PD-1 antibody molecule e.g. BAP049-Clone-B or BAP049-Clone-E
- the anti-PD-1 antibody molecule, e.g. BAP049- Clone-B or BAP049-Clone-E is preferably administered at a dose of about 400 mg once every four weeks.
- Figure 1 depicts the predicted Ctrough (Cmin) concentrations across the different weights for patients while receiving the same dose of an exemplary anti-PD-1 antibody molecule.
- Cmin Ctrough
- Figure 2 depicts observed versus model predicted (population or individual based) Cmin concentrations.
- Figure 3 depicts the accumulation, time course and within subject variability of the model used to analyze pharmacokinetics.
- the shaded areas represent 90% prediction interval; solid lines are the median of prediction at each time point; black dots represent observed pharmacokinetic data.
- Figure 4 depicts the percent survival of mice bearing A20 lymphoma allografts after treatment with Compound A (also known as EGF816), ibrutinib, anti-PD-Ll antibody, a combination of Compound A (EGF816) and anti-PD-Ll antibody, or a combination of ibrutinib and anti-PD-Ll antibody.
- Compound A also known as EGF816
- ibrutinib also known as EGF816
- anti-PD-Ll antibody a combination of Compound A (EGF816) and anti-PD-Ll antibody
- a combination of ibrutinib and anti-PD-Ll antibody or a combination of ibrutinib and anti-PD-Ll antibody.
- Figure 5 depicts the mean tumor volume in mice bearing A20 lymphoma allografts after treatment with Compound A (also known as EGF816), ibrutinib, anti-PD-Ll antibody, a combination of EGF816 and anti-PD-Ll antibody, or a combination of ibrutinib and anti-PD- Ll antibody. Bar indicates treatment period for EGF816 and ibrutinib. Arrows indicate when anti-PD-Ll antibody was administered.
- Compound A also known as EGF816
- ibrutinib anti-PD-Ll antibody
- Anti-PD-Ll antibody a combination of EGF816 and anti-PD-Ll antibody
- Bar indicates treatment period for EGF816 and ibrutinib.
- Arrows indicate when anti-PD-Ll antibody was administered.
- the present invention is directed to a combination of Compound A and an anti- PD-1 antibody as shown in Table 1 that can be used to treat cancers. While not wishing to be bound by theory the use of the novel combination disclosed herein to treat a particular cancer is believed to be advantageous as it affects the immune response rescuing T cell antitumor response and expanding the endogenous antitumor response of T cells. After activation, T cells increase the expression of PD-1 on their surface, allowing them to receive a negative signal thereby inhibiting T cell responses. Tumor cells have taken advantage of this system by expressing binding partners of PD-1, such as PD-L1, that prematurely shut down T cell responses against the tumor.
- PD-L1 binding partners of PD-1
- the anti-PDl antibody molecule recognizes and binds PD-1 on T cells thereby preventing the tumor cells from binding PD-1 and reducing T cell activity.
- the anti-PD-1 antibody molecule binds the T cell but does not interfere with T cell function thus ensuring that T cells retain their tumor killing affect.
- Compound A is a targeted covalent irreversible EGFR inhibitor that selectively inhibits activating and acquired resistance mutants (L858R, exl9del and T790M), while sparing WT EGFR. (see Jia et al, Cancer Res October 1, 2014 74; 1734). Compound A has shown significant efficacy in EGFR mutant (L858R, exl9del and T790M) cancer models (in vitro and in vivo) with no indication of WT EGFR inhibition at clinically relevant efficacious concentrations.
- Compound A demonstrated strong tumor regressions in several EGFR activating and resistant tumor models in vivo. These include HCC827 (exl9del), H3255 (L858R) and H1975
- Compound A inhibited tumor growth in a dose-dependent manner and achieved regressions of established tumors at well tolerated doses.
- Compound A is predicted to have improved antitumor activity in humans with known EGFR-driven cancers.
- Compound A was also found to have immune-modulatory potential.
- Compound A is thus expected to stimulate a more effective anti -tumor immune response. Enhancing the antitumor immune response is thus expected to be beneficial across the diseases described herein.
- a combined small molecule targeted-immunotherapy approach may provide clinical benefit, such as improved and sustained therapy for patients suffering from cancer e.g, lung cancer, such as squamous lung cancer and NSCLC, colorectal cancer and breast cancer, and in particular, triple-negative breast cancer (TNBC); and also in lung cancer, such as squamous lung cancer and NSCLC, colorectal cancer and breast cancer, and in particular, triple- negative breast cancer (TNBC), which prove to be resistant or refractory to immunotherapy such as anti-PD-1 or anti-PD-Ll therapy.
- these therapies include therapy with pembrolizumab, nivolumab, atezolizumab and MEDI4736.
- the present invention relates to the use of (i?,£)-N-(7-chloro-l-(l-(4-(dimethylamino)but-2- enoyl)azepan-3-yl)-lHbenzo[d]imidazol-2-yl)-2-methylisonicotinamide (Compound A), or a pharmaceutically acceptable salt thereof.
- Compound A is also known as and herein referred by the code "EGF816".
- a particularly useful salt of Compound A is the mesylate salt thereof.
- WO2013/184757 the contents of which are hereby incorporated by reference, describes Compound A, its method of preparation and pharmaceutical compositions comprising Compound A.
- Compound A has the following structure:
- Compound A may be in the free form (i.e. not a salt). Alternatively, Compound A may be present as a salt. Compound A may be present as the hydrocholoride salt or the mesylate (methylsulphonate) salt, more preferably as the mono-mesylate salt. Said mesylate salts may be in an amorphous or crystalline state. A particularly useful salt form of Compound A is the mono-mesylate trihydrate salt thereof. Free forms, salt forms and pharmaceutical compositions of Compound A are described in PCT application PCT/IB2014/066475, which published as WO/2015/083059.
- Compound A also inhibits one or more kinases in the TEC family of kinases.
- the Tec family kinases include, e.g., ITK, BMX, TEC, RLK, and BTK, and are central in the propogation of T-cell receptor and chemokine receptor signaling (Schwartzberg et al. (2005) Nat. Rev.
- ITK is a critical enzyme for the survival of Th2 cells and its inhibition results in a shift in the balance between Th2 and Thl cells.
- Combined treatment, in vivo, with the ITK inhibitor ibrutinib or Compound A, and anti-PD-Ll antibody results in superior efficacy compared with either single agent in several models.
- the combination of ITK inhibition (with ibrutinib) and checkpoint inhibition is more effective than either single agent in numerous syngeneic mouse models, e.g., those which express ITK but not BTK.
- Compound A and ibrutinib were dosed for only ten days, and a total of 5 doses of anti-PD-Ll antibody were given. Compound A and ibrutinib were only dosed transiently and the effects of Compound A plus anti-PD-Ll antibody and ibrutinib plus anti-PD-Ll antibody on survival extended beyond 60 days. Combination of anti-PD-Ll antibody and Compound A resulted in tumor regression in mice bearing A20 lymphoma allografts.
- the EGFR inhibitor (R,E)-N-(7-chloro-l-(l-(4-(dimethylamino)but-2-enoyl)azepan-3-yl)- lH-benzo[d]imidazol-2-yl)-2-methylisonicotinamide (Compound A), or a pharmaceutically acceptable salt thereof, enhances, or is used to enhance an antitumor effect of an inhibitor of PD-1 (e.g., an anti-PD-1 antibody molecule).
- Compound A e.g., an anti-PD-1 antibody molecule
- the EGFR inhibitor is chosen from one of more of erlotinib, gefitinib, cetuximab, panitumumab, necitumumab, PF-00299804, nimotuzumab, or RO5083945.
- PD-1 Antagonists are chosen from one of more of erlotinib, gefitinib, cetuximab, panitumumab, necitumumab, PF-00299804, nimotuzumab, or RO5083945.
- PD-1 molecules useful in the present invention are shown in Table 1 and are described in PCT application PCT/US2015/012754, which was published on 30 th July 2015, as WO/2015/112900, and which is incorporated herein in its entirety by reference.
- the anti-PD-1 antibody molecule is a humanized anti-PD-1 antibody and includes a heavy chain variable domain and a constant region, a light chain variable domain and a constant region, or both, comprising the amino acid sequence of BAP049-Clone-B or BAP049-Clone-E as described in Table 1, or encoded by the nucleotide sequence in Table 1.
- the anti-PD-1 antibody molecule optionally, comprises a leader sequence from a heavy chain, a light chain, or both, as shown in Table 2; or a sequence substantially identical thereto.
- the anti-PD-1 antibody molecule includes at least one, two, or three complementarity determining regions (CDRs) from a heavy chain variable region of an antibody described herein, e.g., an antibody chosen from any of BAP049-Clone- B or BAP049-Clone-E as described in Table 1, or encoded by the nucleotide sequence in Table 1
- CDRs complementarity determining regions
- the antibody molecule is a monospecific antibody molecule, a bispecific antibody molecule, or is an antibody molecule that comprises an antigen binding fragment of an antibody, e.g., a half antibody or antigen binding fragment of a half antibody.
- a CDR e.g., Chothia CDR or Kabat CDR
- the antibody molecule is a monospecific antibody molecule, a bispecific antibody molecule, or is an antibody molecule that comprises an antigen binding fragment of an antibody, e.g., a half antibody or antigen binding fragment of a half antibody.
- SEQ ID NO: 8 DNA VH ACCGTGTCTAGC
- SEQ ID NO: 38 DNA VL GGCACTAAGGTCGAGATTAAG
- KSCDKTHTCP PCPAPEAAGG PSVFLFPPKP KDTLMISRTP EVTCVWDVS 116) HEDPEVKFNW YVDGVEVHNA KTKPREEQYN STYRVVSVLT VLHQDWLNGK EYKCKVSNKA LPAPIEKTIS KAKGQPREPQ VYTLPPSREE MTKNQVSLTC LVKGFYPSDI AVEWESNGQP ENNYKTTPPV LDSDGSFFLY SKLTVDKSRW QQGNVFSCSV MHEALHNHYT QKSLSLSPGK
- VLFWl DVVMTQSPLSLPVTLGQPASISC (SEQ ID NO: 81)
- VLFW3 GVPSRFSGSGSGTEFTLTISSLQPDDFATYYC SEQ ID NO: 100
- the anti-PD-1 antibody molecule can include any of the following: a VH comprises a HCDR1 amino acid sequence of SEQ ID NO: 1, a HCDR2 amino acid sequence of SEQ ID NO: 2, and a HCDR3 amino acid sequence of SEQ ID NO: 3; and a VL comprising a LCDRl amino acid sequence of SEQ ID NO: 11, a LCDR2 amino acid sequence of SEQ ID NO: 12, and a LCDR3 amino acid sequence of SEQ ID NO: 13; a VH comprising a HCDR1 amino acid sequence chosen from SEQ ID NO: 4; a HCDR2 amino acid sequence of SEQ ID NO: 5; and a HCDR3 amino acid sequence of SEQ ID NO: 6; and a VL comprising a LCDRl amino acid sequence of SEQ ID NO: 14, a LCDR2 amino acid sequence of SEQ ID NO: 15, and a LCDR3 amino acid sequence of SEQ ID NO: 16;
- VH comprising a HCDR1 amino acid sequence of SEQ ID NO: 21, a HCDR2 amino acid sequence of SEQ ID NO: 22, and a HCDR3 amino acid sequence of SEQ ID NO: 23; and a VL comprising a LCDRl amino acid sequence of SEQ ID NO: 31, a LCDR2 amino acid sequence of SEQ ID NO: 32, and a LCDR3 amino acid sequence of SEQ ID NO: 33; or
- VH comprising a HCDR1 amino acid sequence of SEQ ID NO: 24; a HCDR2 amino acid sequence of SEQ ID NO: 25; and a HCDR3 amino acid sequence of SEQ ID NO: 26; and a VL comprising a LCDRl amino acid sequence of SEQ ID NO: 34, a LCDR2 amino, acid sequence of SEQ ID NO: 35, and a LCDR3 amino acid sequence of SEQ ID NO: 36.
- the aforesaid antibodies comprise a heavy chain variable domain comprising an amino acid sequence at least 85% identical to any of SEQ ID NOs: 7 or 27.
- the aforesaid antibody molecules comprise a light chain variable domain comprising an amino acid sequence at least 85% identical to any of SEQ ID NOs: 17 or 37. In other embodiments, the aforesaid antibody molecules comprise a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 7.
- the aforesaid antibody molecules comprise a heavy chain comprising the amino acid sequence of SEQ ID NO: 9.
- the aforesaid antibody molecules comprise a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 17.
- the aforesaid antibody molecules comprise a light chain comprising the amino acid sequence of SEQ ID NO: 19.
- the aforesaid antibody molecules comprise a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 27.
- the aforesaid antibody molecules comprise a heavy chain comprising the amino acid sequence of SEQ ID NO: 29.
- the aforesaid antibody molecules comprise a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 37.
- the aforesaid antibody molecules comprise a light chain comprising the amino acid sequence of SEQ ID NO: 39.
- the aforesaid antibody molecules comprise a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 7 and a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 17.
- the aforesaid antibody molecules comprise a heavy chain comprising the amino acid sequence of SEQ ID NO: 9 and a light chain comprising the amino acid sequence of SEQ ID NO: 19.
- the aforesaid antibody molecules comprise a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 27 and a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 37.
- the aforesaid antibody molecules comprise a heavy chain comprising the amino acid sequence of SEQ ID NO: 29 and a light chain comprising the amino acid sequence of SEQ ID NO: 39.
- the aforesaid antibody molecules are chosen from a Fab, F(ab')2, Fv, or a single chain Fv fragment (scFv).
- the aforesaid antibody molecules comprise a heavy chain constant region selected from IgGl, IgG2, IgG3, and IgG4.
- the aforesaid antibody molecules comprise a light chain constant region chosen from the light chain constant regions of kappa or lambda.
- the aforesaid antibody molecules comprise a human IgG4 heavy chain constant region with a mutation at position 228 and a kappa light chain constant region.
- the aforesaid antibody molecules comprise a human IgG4 heavy chain constant region with a Serine to Proline mutation at position 228 or 214 and a kappa light chain constant region.
- the aforesaid antibody molecules comprise a human IgGl heavy chain constant region with an Asparagine to Alanine mutation at position 297 and a kappa light chain constant region.
- the aforesaid antibody molecules comprise a human IgGl heavy chain constant region with an Aspartate to Alanine mutation, and Proline to Alanine mutation of SEQ ID NO: 217 and a kappa light chain constant region.
- the aforesaid antibody molecules comprise a human IgGl heavy chain constant region with a Leucine to Alanine mutation at position 234 and Leucine to Alanine mutation at position 235 and a kappa light chain constant region.
- the aforesaid antibody molecules are capable of binding to human PD-1 with a dissociation constant (K D ) of less than about 0.2 nM.
- the aforesaid antibody molecules bind to human PD-1 with a K D of less than about 0.2 nM, 0.15 nM, 0.1 nM, 0.05 nM, or 0.02 nM, e.g., about 0.13 nM to 0.03 nM, e.g., about 0.077 nM to 0.088 nM, e.g., about 0.083 nM, e.g., as measured by a Biacore method.
- the aforesaid antibody molecules bind to cynomolgus PD-1 with a K D of less than about 0.2 nM, 0.15 nM, 0.1 nM, 0.05 nM, or 0.02 nM, e.g., about 0.11 nM to 0.08 nM, e.g., about 0.093 nM, e.g., as measured by a Biacore method.
- the aforesaid antibody molecules bind to both human PD-1 and cynomolgus PD-1 with similar K D , e.g., in the nM range, e.g., as measured by a Biacore method.
- the aforesaid antibody molecules bind to a human PD-l-Ig fusion protein with a K D of less than about 0.1 nM, 0.075 nM, 0.05 nM, 0.025 nM, or 0.01 nM, e.g., about 0.04 nM, e.g., as measured by ELISA.
- the aforesaid antibody molecules bind to Jurkat cells that express human PD-1 (e.g., human PD-1 -transfected Jurkat cells) with a K D of less than about 0.1 nM, 0.075 nM, 0.05 nM, 0.025 nM, or 0.01 nM, e.g., about 0.06 nM, e.g., as measured by FACS analysis.
- human PD-1 e.g., human PD-1 -transfected Jurkat cells
- the aforesaid antibody molecules bind to cynomolgus T cells with a K D of less than about InM, 0.75 nM, 0.5 nM, 0.25 nM, or 0.1 nM, e.g., about 0.4 nM, e.g., as measured by FACS analysis.
- the aforesaid antibody molecules bind to cells that express cynomolgus PD-1 (e.g., cells transfected with cynomolgus PD-1) with a KD of less than about InM, 0.75 nM, 0.5 nM, 0.25 nM, or 0.01 nM, e.g., about 0.6 nM, e.g., as measured by FACS analysis.
- cynomolgus PD-1 e.g., cells transfected with cynomolgus PD-1
- KD a KD of less than about InM, 0.75 nM, 0.5 nM, 0.25 nM, or 0.01 nM, e.g., about 0.6 nM, e.g., as measured by FACS analysis.
- the aforesaid antibody molecules are not cross-reactive with mouse or rat PD-1.
- the aforesaid antibodies are cross-reactive with rhesus PD- 1.
- the cross-reactivity can be measured by a Biacore method or a binding assay using cells that expresses PD-1 (e.g., human PD-1 -expressing 300.19 cells).
- the aforesaid antibody molecules bind an extracellular Ig-like domain of PD-1.
- the aforesaid antibody molecules are capable of reducing binding of PD-1 to PD-L1, PD-L2, or both, or a cell that expresses PD-L1, PD-L2, or both.
- the aforesaid antibody molecules reduce (e.g., block) PD-L1 binding to a cell that expresses PD-1 (e.g., human PD-1 -expressing 300.19 cells) with an IC50 of less than about 1.5 nM, 1 nM, 0.8 nM, 0.6 nM, 0.4 nM, 0.2 nM, or 0.1 nM, e.g., between about 0.79 nM and about 1.09 nM, e.g., about 0.94 nM, or about 0.78 nM or less, e.g., about 0.3 nM.
- the aforesaid antibodies reduce (e.g., block) PD-L2 binding to a cell that expresses PD-1 (e.g., human PD-1 -expressing 300.19 cells) with an IC50 of less than about 2 nM, 1.5 nM, 1 nM, 0.5 nM, or 0.2 nM, e.g., between about 1.05 nM and about 1.55 nM, or about 1.3 nM or less, e.g., about 0.9 nM.
- PD-1 e.g., human PD-1 -expressing 300.19 cells
- an IC50 of less than about 2 nM, 1.5 nM, 1 nM, 0.5 nM, or 0.2 nM, e.g., between about 1.05 nM and about 1.55 nM, or about 1.3 nM or less, e.g., about 0.9 nM.
- the aforesaid antibody molecules are capable of enhancing an antigen-specific T cell response.
- the aforesaid antibody molecules increase the expression of
- IL-2 from cells activated by Staphylococcal enterotoxin B (SEB) (e.g., at 25 ⁇ g/mL) by at least about 2, 3, 4, 5-fold, e.g., about 2 to 3-fold, e.g., about 2 to 2.6-fold, e.g., about 2.3-fold, compared to the expression of IL-2 when an isotype control (e.g., IgG4) is used, e.g., as measured in a SEB T cell activation assay or a human whole blood ex vivo assay.
- SEB Staphylococcal enterotoxin B
- the aforesaid antibody molecules increase the expression of IFN- ⁇ from T cells stimulated by anti-CD3 (e.g., at 0.1 ⁇ g/mL) by at least about 2, 3, 4, 5- fold, e.g., about 1.2 to 3.4-fold, e.g., about 2.3-fold, compared to the expression of IFN- ⁇ when an isotype control (e.g., IgG4) is used, e.g., as measured in an IFN- ⁇ activity assay.
- an isotype control e.g., IgG4
- the aforesaid antibody molecules increase the expression of IFN- ⁇ from T cells activated by SEB (e.g., at 3 pg/mL) by at least about 2, 3, 4, 5-fold, e.g., about 0.5 to 4.5-fold, e.g., about 2.5-fold, compared to the expression of IFN- ⁇ when an isotype control (e.g., IgG4) is used, e.g., as measured in an IFN- ⁇ activity assay.
- an isotype control e.g., IgG4
- the aforesaid antibody molecules increase the expression of IFN- ⁇ from T cells activated with an CMV peptide by at least about 2, 3, 4, 5-fold, e.g., about 2 to 3.6-fold, e.g., about 2.8-fold, compared to the expression of IFN- ⁇ when an isotype control (e.g., IgG4) is used, e.g., as measured in an IFN- ⁇ activity assay.
- an isotype control e.g., IgG4
- the aforesaid antibody molecules increase the proliferation of
- an isotype control e.g., IgG4
- the aforesaid antibody molecules has a Cmax between about
- the aforesaid antibody molecules has a T1 2 between about 250 hours and about 650 hours, between about 300 hours and about 600 hours, between about 350 hours and about 550 hours, or between about 400 hours and about 500 hours, e.g., about 465.5 hours, e.g., as measured in monkey.
- the aforesaid antibody molecules bind to PD-1 with a Kd slower than 5 X 10 "4 , 1 X 10 "4 , 5 X 10 "5 , or 1 X 10 "5 s “1 , e.g., about 2.13 X 10 "4 s "1 , e.g., as measured by a Biacore method.
- the aforesaid antibody molecules bind to PD-1 with a Ka faster than 1 X 10 4 , 5 X 10 4 , 1 X 10 5 , or 5 X 10 5 M ' V 1 , e.g., about 2.78 X 10 5 M ' V 1 , e.g., as measured by a Biacore method.
- a preferred antibody molecule of the present invention is BAP049-Clone E. Dosages and dosing regimens
- an immune checkpoint molecule e.g., an inhibitor of PD-1 (e.g., an anti-PD-1 antibody molecule)
- the present invention provides the following dosing regimens.
- Compound A may be administered at a dose between 5 mg and 100 mg, e.g., between 10 mg and 75 mg, between 15 mg and 50 mg, between 20 mg and 30 mg, between 10 mg and 40 mg, between 10 mg and 25 mg, or between 25 mg and 40 mg, e.g., at a dose of 5 mg, 10 mg, 15 mg, 20 mg, 25 mg, 30 mg, 35 mg, 40 mg, 45 mg, 50 mg, 60 mg, 70 mg, 80 mg, 90 mg, or 100 mg, e.g., twice a day, once a day, once every two days, once every three days, or once a week.
- the anti-PD-1 antibody molecule may be administered by injection (e.g., subcutaneously or intravenously) at a dose (e.g., a flat dose) of about 200 mg to 500 mg, e.g., about 250 mg to 450 mg, about 300 mg to 400 mg, about 250 mg to 350 mg, about 350 mg to 450 mg, or about 300 mg or about 400 mg.
- the dosing schedule (e.g., flat dosing schedule) can vary from e.g., once a week to once every 2, 3, 4, 5, or 6 weeks.
- the anti-PD-1 antibody molecule is administered at a dose from about 300 mg to 400 mg once every three weeks or once every four weeks.
- the anti-PD-1 antibody molecule is administered at a dose from about 300 mg once every four weeks.
- the anti-PD-1 antibody molecule is administered at a dose from about 400 mg once every three weeks.
- the anti-PD-1 antibody molecule is administered at a dose from about 300 mg once every three weeks. In one preferred embodiment, the anti-PD-1 antibody molecule is administered at a dose from about 400 mg once every four weeks.
- the EGFR inhibitor, (R,E)-N-(7-chloro- l-(l-(4-(dimethylamino)but-2- enoyl)azepan-3-yl)-lH-benzo[d]imidazol-2-yl)-2-methylisonicotinamide is administered at a dose between 10 mg and 50 mg (e.g., 25 mg), e.g., once a day.
- the EGFR inhibitor (R,E)-N-(7-chloro-l-(l-(4-(dimethylamino)but-2- enoyl)azepan-3-yl)-lH-benzo[d]imidazol-2-yl)-2-methylisonicotinamide (Compound A), is administered orally.
- the EGFR inhibitor (R,E)-N-(7-chloro-l-(l-(4- (dimethylamino)but-2-enoyl)azepan-3-yl)-lH-benzo[d]imidazol-2-yl)-2- methylisonicotinamide (Compound A)
- Compound A is administered at a dose between 10 mg and 50 mg (e.g., 25 mg), e.g., once a day, e.g., orally, and the PD-1 inhibitor (e.g., the anti-PD-1 antibody molecule, e.g.
- BAP049-Clone E is administered at a dose between 300 mg and 500 mg (e.g., at a dose of 400 mg), e.g., once every 4 weeks, e.g., by intravenous infusion.
- the combination is administered in one or more dosing cycles, e.g., one or more 28-day dosing cycles, e.g., one to six 28-day dosing cycles.
- Compound A may not be administered on certain days of a given cycle.
- the EGFR inhibitor, (R,E)-N-(7-chloro-l-(l-(4- (dimethylamino)but-2-enoyl)azepan-3-yl)-lH-benzo[d]imidazol-2-yl)-2- methylisonicotinamide is administered on day 1 to day 5, or on day 1 to day 6, or on day 1 to day 7, or on day 1 to day 8, or on day 1 to day 9, preferably on day 1 to day 10 of any 28-day dosing cycle, e.g. the first 28-day dosing cycle.
- the EGFR inhibitor (R,E)-N-(7-chloro- 1 -( 1 -(4-(dimethylamino)but-2-enoyl)azepan-3-yl)- 1H- benzo[d]imidazol-2-yl)-2-methylisonicotinamide (Compound A)
- Compound A is administered at a dose of 25 mg, on day 1 to day 10 of any dosing cycle, e.g. the first dosing cycle.
- the EGFR inhibitor (R,E)-N-(7-chloro-l-(l-(4-(dimethylamino)but-2-enoyl)azepan-3-yl)-lH- benzo[d]imidazol-2-yl)-2 -methylisonicotinamide (Compound A)
- Compound A is administered at a dose of 50 mg, on day 1 to day 10 of any dosing cycle, e.g. the first dosing cycle.
- the EGFR inhibitor (R,E)-N-(7-chloro-l-(l-(4-(dimethylamino)but- 2-enoyl)azepan-3-yl)-lH-benzo[d]imidazol-2-yl)-2-methylisonicotinamide (Compound A)
- Compound A is not administered on day 11 to day 28 of a first dosing cycle, or in any subsequent dosing cycle(s).
- a drug holiday or a treatment interruption period which is a period where neither Compound A nor the PD-1 inhibitor (e.g., the anti-PD-1 antibody molecule, e.g. BAP049-Clone E) is administered after a given dosing cycle.
- a drug holiday period is the period of days after the sequential administration of one of Compound A and the PD-1 inhibitor (e.g., the anti-PD-1 antibody molecule, e.g.
- the drug holiday may, for example, be a period of days selected from: 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 11 days, 12 days, 13 days and 14 days.
- the present invention therefore also provides a dosing regimen, wherein the treatment with the pharmaceutical combination is interrupted for a period or a drug holiday period, until evidence of disease progression emerges, wherein the pharmaceutical combination is administered upon evidence of disease progression.
- Disease progression may be measured e.g. by determining tumor response according to RECIST v 1.1. or irRC.
- Compound A, or Antibody B, or the combination therapy may be interrupted after 6 months and the patient followed for progression of disease.
- patients may continue safety and efficacy assessments until clinical or radiological evidence of disease progression emerges, at which time they may resume treatment.
- Suitable diseases to be treated with the pharmaceutical combination of the present invention, and the dosing regimens described herein are colorectal cancer (CRC), a lung cancer (e.g., a non-small cell lung cancer (NSCLC)), or a breast cancer (e.g., a triple negative breast cancer (TNBC)).
- CRC colorectal cancer
- NSCLC non-small cell lung cancer
- TNBC triple negative breast cancer
- the EGFR inhibitor, (R,E)-N-(7-chloro-l-(l-(4- (dimethylamino)but-2-enoyl)azepan-3-yl)-lH-benzo[d]imidazol-2-yl)-2- methylisonicotinamide is administered in combination with an inhibitor of PD-1 (e.g., an anti-PD-1 antibody molecule) to treat a colorectal cancer (CRC), a lung cancer (e.g., a non-small cell lung cancer (NSCLC)), or a breast cancer (e.g., a triple negative breast cancer (TNBC)).
- PD-1 e.g., an anti-PD-1 antibody molecule
- the present invention also relates to a pharmaceutical product or a commercial package comprising a combination product according to the invention described herein, in particular together with instructions for simultaneous, separate or sequential use (especially for being jointly active) thereof in the treatment of an EGFR tyrosine kinase activity mediated disease, especially a cancer.
- the present invention embodiments also include pharmaceutically acceptable salts of the compounds useful according to the invention described herein.
- pharmaceutically acceptable salts of the compounds useful according to the invention described herein are also include pharmaceutically acceptable salts of the compounds useful according to the invention described herein.
- pharmaceutically acceptable salts refers to derivatives of the disclosed compounds wherein the parent compound is modified by converting an existing acid or base moiety to its salt form.
- examples of pharmaceutically acceptable salts include, but are not limited to, mineral or organic acid salts of basic residues such as amines; alkali or organic salts of acidic residues such as carboxylic acids; and the like.
- the pharmaceutically acceptable salts of the present invention include the conventional non-toxic salts of the parent compound formed, for example, from non-toxic inorganic or organic acids.
- the pharmaceutically acceptable salts of the present invention can be synthesized from the parent compound which contains a basic or acidic moiety by conventional chemical methods. Generally, such salts can be prepared by reacting the free acid or base forms of these compounds with a stoichiometric amount of the appropriate base or acid in water or in an organic solvent, or in a mixture of the two;
- nonaqueous media like ether, ethyl acetate, ethanol, isopropanol, or acetonitrile are preferred.
- Lists of suitable salts are found in Remington's Pharmaceutical Sciences, 17th ed., Mack Publishing Company, Easton, Pa., 1985, p. 1418 and Journal of Pharmaceutical Science, 66, 2 (1977), each of which is incorporated herein by reference in its entirety.
- a preferred salt of Compound A is the mesylate salt.
- phrases "pharmaceutically acceptable” is employed herein to refer to those compounds, materials, compositions, and/or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio.
- the present invention relates to a pharmaceutical combination, especially a pharmaceutical combination product, comprising the mentioned combination partners and at least one pharmaceutically acceptable carrier.
- “Combination” refers to formulations of the separate partners with or without instructions for combined use or to combination products.
- the combination partners may thus be entirely separate pharmaceutical dosage forms or pharmaceutical compositions that are also sold independently of each other and where just instructions for their combined use are provided in the package equipment, e.g. leaflet or the like, or in other information e.g.
- physicians and medical staff e.g. oral communications, communications in writing or the like
- simultaneous or sequential use for being jointly active, especially as defined below.
- co-administration or “combined administration” or the like as utilized herein are meant to encompass
- combination product means a pharmaceutical product that results from the mixing or combining of more than one active ingredient and includes both fixed and non-fixed combinations of the active ingredients (which may also be combined).
- non-fixed combination means that the active ingredients are both administered to a patient as separate entities either simultaneously, concurrently or sequentially with no specific time limits, wherein such administration provides
- non-fixed combination thus defines especially a "kit of parts” in the sense that the combination partners (i) an anti-PD-1 antibody and (ii) Compound A, or a pharmaceutically acceptable salt thereof (and if present further one or more co-agents) as defined herein can be dosed independently of each other or by use of different fixed combinations with
- the combination partners may also be used as entirely separate pharmaceutical dosage forms or pharmaceutical formulations that are also sold independently of each other and just instructions of the possibility of their combined use is or are provided in the package equipment, e.g. leaflet or the like, or in other information e.g. provided to physicians and medical staff.
- the independent formulations or the parts of the kit of parts can then, e.g. be administered simultaneously or chronologically staggered, that is at different time points and with equal or different time intervals for any part of the kit of parts.
- the time intervals are chosen such that the effect on the treated disease in the combined use of the parts is larger than the effect which would be obtained by use of only any one of the combination partners (i) and (ii), thus being jointly active.
- the ratio of the total amounts of the combination partner (i) to the combination partner (ii) to be administered in the combined preparation can be varied, e.g. in order to cope with the needs of a patient sub-population to be treated or the needs of the single patient which different needs can be due to age, sex, body weight, etc. of the patients.
- the combination partners (i) and (ii) in any embodiment are preferably formulated or used to be jointly (prophylactically or especially therapeutically) active.
- beneficial effect e.g. a mutual enhancing of the effect of the combination partners (i) and (ii), in particular a synergism, e.g. a more than additive effect, additional advantageous effects (e.g. a further therapeutic effect not found for any of the single compounds), less side effects, a combined therapeutic effect in a non-effective dosage of one or both of the combination partners (i) and (ii), and very preferably a clear synergism of the combination partners (i) and (ii).
- beneficial effect e.g. a mutual enhancing of the effect of the combination partners (i) and (ii)
- a synergism e.g. a more than additive effect
- additional advantageous effects e.g. a further therapeutic effect not found for any of the single compounds
- less side effects e.g. a further therapeutic effect not found for any of the single compounds
- a combined therapeutic effect in a non-effective dosage of one or both of the combination partners (i) and (ii) and very
- (therapeutically) active may mean that the compounds may be given separately or sequentially (in a chronically staggered manner, especially a sequence-specific manner) in such time intervals that they preferably, in the warm-blooded animal, especially human, to be treated, and still show a (preferably synergistic) interaction (joint therapeutic effect).
- a joint therapeutic effect can, inter alia, be determined by following the blood levels, showing that both compounds are present in the blood of the human to be treated at least during certain time intervals, but this is not to exclude the case where the compounds are jointly active although they are not present in blood simultaneously.
- the present invention thus pertains to a combination product for simultaneous, separate or sequential use, such as a combined preparation or a pharmaceutical fixed combination, or a combination of such preparation and combination.
- the combination partners may be brought together into a combination therapy: (i) prior to release of the combination product to physicians (e.g. in the case of a kit comprising the compound of the invention and the other therapeutic agent); (ii) by the physician themselves (or under the guidance of a physician) shortly before administration; (iii) in the patient themselves, e.g. during sequential administration of the compound of the invention and the other therapeutic agent.
- any of the above methods involve further administering one or more other (e.g. third) co-agents, especially a chemotherapeutic agent.
- one or more other (e.g. third) co-agents especially a chemotherapeutic agent.
- the combination partners forming a corresponding product according to the invention may be mixed to form a fixed pharmaceutical composition or they may be administered separately or pairwise (i.e. before, simultaneously with or after the other drug substance(s)).
- a combination product according to the invention can besides or in addition be administered especially for cancer therapy in combination with chemotherapy, radiotherapy, immunotherapy, surgical intervention, or a combination of these.
- Long-term therapy is equally possible as is adjuvant therapy in the context of other treatment strategies, as described above.
- Other possible treatments are therapy to maintain the patient's status after tumor regression, or even chemopreventive therapy, for example in patients at risk.
- compositions e.g., pharmaceutically acceptable compositions, which include an antibody molecule described herein, formulated together with a pharmaceutically acceptable carrier.
- pharmaceutically acceptable carrier includes any and all solvents, dispersion media, isotonic and absorption delaying agents, and the like that are physiologically compatible.
- the carrier can be suitable for intravenous, intramuscular, subcutaneous, parenteral, rectal, spinal or epidermal administration (e.g. by injection or infusion).
- the compositions of this invention may be in a variety of forms.
- liquid, semi-solid and solid dosage forms such as liquid solutions (e.g., injectable and infusible solutions), dispersions or suspensions, liposomes and suppositories.
- liquid solutions e.g., injectable and infusible solutions
- dispersions or suspensions e.g., dispersions or suspensions
- liposomes e.g., liposomes
- suppositories e.g., suppositories.
- the preferred form depends on the intended mode of administration and therapeutic application. Typical preferred compositions are in the form of injectable or infusible solutions.
- the preferred mode of administration is parenteral (e.g., intravenous, subcutaneous,
- the combination disclosed herein is administered by intravenous infusion or injection. In another preferred embodiment, the combination disclosed herein is administered by intramuscular or subcutaneous injection.
- parenteral administration and “administered parenterally” as used herein means modes of administration other than enteral and topical administration, usually by injection, and includes, without limitation, intravenous, intramuscular, intraarterial, intrathecal, intracapsular, intraorbital, intracardiac, intradermal, intraperitoneal, transtracheal, subcutaneous, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal, epidural and intrasternal injection and infusion.
- compositions typically should be sterile and stable under the conditions of manufacture and storage.
- the composition can be formulated as a solution,
- Sterile injectable solutions can be prepared by incorporating the active compound (i.e., antibody or antibody portion) in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by filtered sterilization.
- dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above.
- the preferred methods of preparation are vacuum drying and freeze-drying that yields a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
- the proper fluidity of a solution can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants.
- Prolonged absorption of injectable compositions can be brought about by including in the composition an agent that delays absorption, for example, monostearate salts and gelatin.
- the combination disclosed herein can be administered by a variety of methods known in the art, although for many therapeutic applications, the preferred route/mode of administration is intravenous injection or infusion for the antibody and oral for Compound A
- the antibody molecule can be administered by intravenous infusion at a rate of more than 20 mg/min, e.g. , 20-40 mg/min, and typically greater than or equal to 40 mg/min to reach a dose of about 35 to 440 mg/m 2 , typically about 70 to 310 mg/m 2 , and more typically, about 110 to 130 mg/m 2 .
- the antibody molecules can be administered by intravenous infusion at a rate of less than lOmg/min; preferably less than or equal to 5 mg/min to reach a dose of about 1 to 100 mg/m 2 , preferably about 5 to 50 mg/m 2 , about 7 to 25 mg/m 2 and more preferably, about 10 mg/m 2 .
- the route and/or mode of administration will vary depending upon the desired results.
- the active compound may be prepared with a carrier that will protect the compound against rapid release, such as a controlled release formulation, including implants, transdermal patches, and microencapsulated delivery systems.
- Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid. Many methods for the preparation of such formulations are patented or generally known to those skilled in the art. See, e.g., Sustained and Controlled Release Drug Delivery Systems, J. R. Robinson, ed., Marcel Dekker, Inc., New York, 1978.
- Dosage regimens are adjusted to provide the optimum desired response (e.g. , a therapeutic response). For example, a single bolus may be administered, several divided doses may be administered over time or the dose may be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation. It is especially advantageous to formulate parenteral compositions in dosage unit form for ease of administration and uniformity of dosage.
- Dosage unit form as used herein refers to physically discrete units suited as unitary dosages for the subjects to be treated; each unit contains a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier.
- the specification for the dosage unit forms of the invention are dictated by and directly dependent on (a) the unique characteristics of the active compound and the particular therapeutic effect to be achieved, and (b) the limitations inherent in the art of compounding such an active compound for the treatment of sensitivity in individuals.
- An exemplary, non-limiting range for a therapeutically or prophylactically effective amount of an antibody molecule is 0.1-30 mg/kg, more preferably 1-25 mg/kg. They can be delivered separately or simultaneously.
- the anti-PD-1 antibody molecule is administered by injection (e.g., subcutaneously or intravenously) at a dose of about 1 to 40 mg/kg, e.g., 1 to 30 mg/kg, e.g., about 5 to 25 mg/kg, about 10 to 20 mg/kg, about 1 to 5 mg/kg, 1 to 10 mg/kg, 3 to 10 mg/kg, 5 to 15 mg/kg, 10 to 20 mg/kg, 15 to 25 mg/kg, or about 3 mg/kg and Compound A, or a pharmaceutically acceptable salt thereof, is administered by injection (e.g., subcutaneously or intravenously) at a dose of about 1 to 40 mg/kg, e.g. 30 mg/kg.
- the dosing schedule can vary from e.g., once a week to once every 2, 3, or 4 weeks.
- the antibody molecules can be administered by intravenous infusion at a rate of more than 20 mg/min, e.g. , 20-40 mg/min, and typically greater than or equal to 40 mg/min to reach a dose of about 35 to 440 mg/m 2 , typically about 70 to 310 mg/m 2 , and more typically, about 110 to 130 mg/m 2 .
- the infusion rate of about 110 to 130 mg/m 2 achieves a level of about 3 mg/kg.
- the antibody molecules can be administered by intravenous infusion at a rate of less than 10 mg/min, e.g., less than or equal to 5 mg/min to reach a dose of about 1 to 100 mg/m 2 , e.g., about 5 to 50 mg/m 2 , about 7 to 25 mg/m 2 , or, about 10 mg/m 2 .
- the antibody is infused over a period of about 30 min.
- compositions of the invention may include a "therapeutically effective amount” or a “prophylactically effective amount” of an antibody or antibody portion of the invention.
- a “therapeutically effective amount” refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired therapeutic result.
- a therapeutically effective amount of the modified antibody or antibody fragment may vary according to factors such as the disease state, age, sex, and weight of the individual, and the ability of the antibody or antibody portion to elicit a desired response in the individual.
- a therapeutically effective amount is also one in which any toxic or detrimental effects of the modified antibody or antibody fragment is outweighed by the therapeutically beneficial effects.
- a "therapeutically effective dosage" of the disclosed combination preferably inhibits a measurable parameter, e.g., tumor growth rate by at least about 20%, more preferably by at least about 40%, even more preferably by at least about 60%, and still more preferably by at least about 80% relative to untreated subjects.
- a measurable parameter e.g., tumor growth rate
- the ability of the combination disclosed herein to inhibit a measurable parameter, e.g., cancer can be evaluated in a clinical trial and evaluated by a skilled practitioner.
- prophylactically effective amount refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired prophylactic result. Typically, since a prophylactic dose is used in subjects prior to or at an earlier stage of disease, the prophylactically effective amount will be less than the therapeutically effective amount.
- kits comprising an antibody molecule described herein.
- the kit can include one or more other elements including: instructions for use; other reagents, e.g., a label, a therapeutic agent, or an agent useful for chelating, or otherwise coupling, an antibody to a label or therapeutic agent, or a radioprotective composition; devices or other materials for preparing the antibody for administration;
- the invention relates to treatment of a subject in vivo using combination including an anti-PD-1 antibody molecule shown in Table 1 and Compound A, or a pharmaceutically acceptable salt thereof, such that growth of cancerous tumors as described herein are inhibited or reduced.
- the anti-PD-1 antibody and the Compound A, or a pharmaceutically acceptable salt thereof, combination can be used alone to inhibit the growth of cancerous tumors or can be used in combination with one or more of: a standard of care treatment (e.g., for cancers or infectious disorders), another antibody or antigen-binding fragment thereof, an immunomodulator (e.g., an activator of a costimulatory molecule or an inhibitor of an inhibitory molecule); a vaccine, e.g., a therapeutic cancer vaccinE other forms of cellular immunotherapy, as described below.
- a standard of care treatment e.g., for cancers or infectious disorders
- an immunomodulator e.g., an activator of a costimulatory molecule or an inhibitor of an inhibitory molecule
- a vaccine e.g., a therapeutic cancer vaccinE other forms of cellular immunotherapy, as described below.
- the combination described herein may be used for the treatment of lung cancer such as non-small cell lung cancer (NSCLC) or squamous lung cancer.
- the cancer may be locally advanced or metastatic NSCLC.
- the cancer may be resistant to treatment with erlotinib, gefitinib and/or icotinib.
- the cancer may be resistant to treatment with mereletinib and/or rociletinib.
- Cancer subjects receiving the combination can be patients with lung cancer who have been previously treated with standard of care (e.g., erlotinib, gefitinib and icotinib) or patients who have not yet received any treatment.
- the combination described herein is used to treat patients having lung cancer who have been treated with standard of care but show disease progression.
- the cancer to be treated may be cancer, e.g. NSCLC, with an EGFR mutation selected from the group consisting of L858R, exl9del and T790M, and combinations thereof.
- the predominant oncogenic EGFR mutations (L858R and exl9del) account for about 90% of EGFR NSCLC.
- a secondary "gatekeeper" T790M mutation may also develops in certain patients.
- the combination described herein can be used for the treatment of a cancer which is resistant or refractory to immunotherapy such as anti-PD-1 or anti-PD-Ll therapy.
- immunotherapy such as anti-PD-1 or anti-PD-Ll therapy.
- these therapies include therapy with pembrolizumab, nivolumab, atezolizumab and MEDI4736.
- the combination of the invention can be administered alone or in combination with one or more other agents, and the combination can be administered in either order or simultaneously.
- the combination therapy disclosed herein can include a composition of the present invention co-formulated with, and/or co-administered with, one or more additional therapeutic agents, e.g., one or more anti-cancer agents, cytotoxic or cytostatic agents, hormone treatment, vaccines, and/or other immunotherapies.
- the combination described herein can be administered in combination with other therapeutic treatment modalities, including surgery, radiation, cryosurgery, and/or thermotherapy.
- Such combination therapies may advantageously utilize lower dosages of the administered therapeutic agents, thus avoiding possible toxicities or complications associated with the various monotherapies.
- the anti- PD-1 antibody and Compound A, or a pharmaceutically acceptable salt thereof can be administered concurrently with, prior to, or subsequent to, one or more other additional therapies or therapeutic agents.
- each agent will be administered at a dose and/or on a time schedule determined for that agent.
- the additional therapeutic agent utilized may be administered together in a single composition or administered separately in different compositions.
- additional therapeutic agents utilized in combination be utilized at levels that do not exceed the levels at which they are utilized individually.
- the combination of the invention is administered in combination with one or more other inhibitors of PD-1, PD-L1 and/or PD-L2 known in the art.
- the antagonist may be an antibody, an antigen binding fragment thereof, an
- the other anti-PD-1 antibody is chosen from MDX-1106, Merck 3475 or CT-011.
- the PD- 1 inhibitor is an immunoadhesin (e.g., an immunoadhesin comprising an extracellular or PD- 1 binding portion of PD-L1 or PD-L2 fused to a constant region (e.g., an Fc region of an immunoglobulin sequence).
- the PD-1 inhibitor is AMP-224.
- the PD-L1 inhibitor is anti-PD-Ll antibody.
- the anti-PD- LI binding antagonist is chosen from YW243.55.S70, MPDL3280A, MEDI-4736, MSB- 0010718C, or MDX-1105.
- MDX-1105 also known as BMS-936559, is an anti-PD-Ll antibody described in WO2007/005874.
- Antibody YW243.55.S70 (heavy and light chain variable region sequences shown in SEQ ID Nos. 20 and 21, respectively) is an anti-PD-Ll described in WO 2010/077634.
- MDX-1106 also known as MDX-1106-04, ONO-4538 or BMS-936558, is an anti-
- Merck 3745 also known as MK-3475 or SCH- 900475, is an anti-PD-1 antibody described in WO2009/114335.
- Pidilizumab CT-011; Cure Tech
- CT-011 Cure Tech
- Pidilizumab and other humanized anti-PD-1 monoclonal antibodies are disclosed in WO2009/101611.
- the anti-PD-1 antibody is pembrolizumab.
- Pembrolizumab (Trade name
- AMP-224 (B7-DCIg; Amplimmune; e.g., disclosed in WO2010/027827 and WO2011/066342), is a PD-L2 Fc fusion soluble receptor that blocks the interaction between PD-1 and B7-H1.
- Other anti-PD-1 antibodies include AMP 514 (Amplimmune), among others, e.g., anti-PD-1 antibodies disclosed in US 8,609,089, US 2010028330, and/or US 20120114649.
- Exemplary other agents that can be combined with the combination of the invention can include standard of care chemotherapeutic agent including, but not limited to, anastrozole (Arimidex®), bicalutamide (Casodex®), bleomycin sulfate (Blenoxane®), busulfan
- chemotherapeutic agent including, but not limited to, anastrozole (Arimidex®), bicalutamide (Casodex®), bleomycin sulfate (Blenoxane®), busulfan
- DTPA pentostatin
- polifeprosan 20 with carmustine implant Gliadel®
- tamoxifen citrate Nolvadex®
- teniposide Vumon®
- 6-thioguanine thiotepa
- tirapazamine Terazone®
- topotecan hydrochloride for injection Hycamptin®
- vinblastine Velban®
- alkylating agents include, without limitation, nitrogen mustards, ethylenimine derivatives, alkyl sulfonates, nitrosoureas and triazenes): uracil mustard (Aminouracil Mustard®, Chlorethaminacil®, Demethyldopan®, Desmethyldopan®, Haemanthamine®, Nordopan®, Uracil nitrogen mustard®, Uracillost®, Uracilmostaza®, Uramustin®, Uramustine®), chlormethine (Mustargen®), cyclophosphamide (Cytoxan®, Neosar®, Clafen®, Endoxan®, Procytox®, RevimmuneTM), ifosfamide (Mitoxana®), melphalan (Alkeran®), Chlorambucil (Leukeran®), pipobroman (Amedel®, Vercyte®), triethylenemelamine (Hemel®, Hexalen®
- Oxaliplatin (Eloxatin®); Temozolomide (Temodar® and Temodal®); Dactinomycin (also known as actinomycin-D, Cosmegen®); Melphalan (also known as L-PAM, L-sarcolysin, and phenylalanine mustard, Alkeran®); Altretamine (also known as hexamethylmelamine (HMM), Hexalen®); Carmustine (BiCNU®); Bendamustine (Treanda®); Busulfan (Busulfex® and Myleran®); Carboplatin (Paraplatin®); Lomustine (also known as CCNU, CeeNU®); Cisplatin (also known as CDDP, Platinol® and Platinol®-AQ); Chlorambucil (Leukeran®); Cyclophosphamide (Cytoxan® and Neosar®); dacarbazine (also known as DTIC, DIC and imidazole carbox
- Procarbazine (Matulane®); Mechlorethamine (also known as nitrogen mustard, mustine and mechloroethamine hydrochloride, Mustargen®); Streptozocin (Zanosar®); Thiotepa (also known as thiophosphoamide, TESPA and TSPA, Thioplex®); Cyclophosphamide
- anthracyclines include, e.g. , doxorubicin (Adriamycin® and Rubex®); bleomycin (lenoxane®); daunorubicin (dauorubicin hydrochloride, daunomycin, and rubidomycin hydrochloride, Cerubidine®); daunorubicin liposomal (daunorubicin citrate liposome, DaunoXome®); mitoxantrone (DHAD, Novantrone®); epirubicin (EllenceTM); idarubicin (Idamycin®, Idamycin PFS®); mitomycin C (Mutamycin®); geldanamycin; herbimycin; ravidomycin; and desacetylravidomycin.
- doxorubicin Adriamycin® and Rubex®
- bleomycin lenoxane®
- daunorubicin daunorubicin hydrochloride, daunomycin,
- Exemplary vinca alkaloids that can be used in combination with the anti-PD-1 antibody molecules, alone or in combination with another immunomodulator include, but ate not limited to, vinorelbine tartrate (Navelbine®), Vincristine (Oncovin®), and Vindesine (Eldisine®)); vinblastine (also known as vinblastine sulfate, vincaleukoblastine and VLB, Alkaban-AQ® and Velban®); and vinorelbine (Navelbine®).
- Exemplary doses for the three (or more) agent regimens are as follows.
- the PD-1 antibody molecule can be administered, e.g., at a dose of about 1 to 40 mg/kg, e.g., 1 to 30 mg/kg, e.g., about 5 to 25 mg/kg, about 10 to 20 mg/kg, about 1 to 5 mg/kg, or about 3 mg/kg.
- the invention further includes selecting patients that may benefit most from treatment with the combination of the invention. Selection of patients can be achieved by determining for the presence of PD-1 or the presence of TAMS. While not wishing to be bound by theory, in some embodiments, a patient is more likely to respond to treatment with the combination of the invention if the patient has a cancer that highly expresses PD-L1, and/or the cancer is infiltrated by anti-tumor immune cells, e.g., TILs and/or has a high TAMS level, e.g., determined by looking for CD 163 or CD 163/CD8 as described below.
- TILs anti-tumor immune cells
- determining for the presence of PD- 1 can be to determine the anti- tumor immune cells by assaying for cells positive for CD8, PD-L1, and/or IFN- ⁇ ; thus levels of CD8, PD-L1, and/or IFN- ⁇ can serve as a readout for levels of TILs in the
- the cancer microenvironment is referred to as triple-positive for PD-Ll/CD8/IFN-y.
- this application provides methods of determining whether a tumor sample is positive for one or more of PD-L1, CD8, and IFN- ⁇ , and if the tumor sample is positive for one or more, e.g., two, or all three, of the markers, then administering to the patient a therapeutically effective amount of an anti-PD-1 antibody molecule, optionally in combination with one or more other immunomodulators or anticancer agents.
- L1/CD8/IFN-Y TN breast cancer. Regardless of whether a large or small fraction of patients is triple-positive for these markers, screening the patients for these markers allows one to identify a fraction of patients that has an especially high likelihood of responding favorably to therapy with a PD-1 antibody (e.g., a blocking PD-1 antibody) in combination with a PD-1 antibody (e.g., a blocking PD-1 antibody) in combination with a PD-1 antibody (e.g., a blocking PD-1 antibody) in combination with a PD-1 antibody (e.g., a blocking PD-1 antibody) in combination with a PD-1 antibody (e.g., a blocking PD-1 antibody) in combination with
- the cancer sample is classified as triple -positive for PD- L1/CD8/IFN-Y. This measurement can roughly be broken down into two thresholds: whether an individual cell is classified as positive, and whether the sample as a whole is classified as positive. First, one can measure, within an individual cell, the level of PD-L1, CD8, and/or IFN- ⁇ .
- a cell that is positive for one or more of these markers is a cell that has a higher level of the marker compared to a control cell or a reference value.
- a high level of PD-L1 in a given cell is a level higher than the level of PD-L1 in a corresponding non-cancerous tissue in the patient.
- a high level of CD8 or IFN- ⁇ in a given cell is a level of that protein typically seen in a TIL.
- a triple positive sample is one that has a high percentage of cells, e.g., higher than a reference value or higher than a control sample, that are positive for these markers.
- a high level of CD8 or IFN- ⁇ in the sample can be the level of that protein typically seen in a tumor infiltrated with TIL.
- a high level of PD-L1 can be the level of that protein typically seen in a tumor sample, e.g., a tumor microenvironment.
- IM-TN breast cancer is described in, e.g., Brian D. Lehmann et al, "Identification of human triple -negative breast cancer subtypes and preclinical models for selection of targeted therapies", J Clin Invest. Jul 1, 2011; 121(7): 2750-2767.
- Triple-negative breast cancers are those that do not express estrogen receptor (ER), progesterone receptor (PR) and Her2/neu. These cancers are difficult to treat because they are typically not responsive to agents that target ER, PR, and Her2/neu. Triple -negative breast cancers can be further subdivided into different classes, one of which is
- IM-TN breast cancer is enriched for factors involved in immune cell processes, for example, one or more of immune cell signaling (e.g., TH1/TH2 pathway, NK cell pathway, B cell receptor signaling pathway, DC pathway, and T cell receptor signaling), cytokine signaling (e.g., cytokine pathway, IL-12 pathway, and IL-7 pathway), antigen processing and presentation, signaling through core immune signal transduction pathways (e.g., NFKB, TNF, and JAK/STAT signaling), genes involved in T-cell function, immune transcription, interferon (IFN) response and antigen processing.
- immune cell signaling e.g., TH1/TH2 pathway, NK cell pathway, B cell receptor signaling pathway, DC pathway, and T cell receptor signaling
- cytokine signaling e.g., cytokine pathway, IL-12 pathway, and IL-7 pathway
- antigen processing and presentation e.g., signaling through core immune signal transduction pathways (e.g., NFKB
- the cancer treated is a cancer that is, or is determined to be, positive for one or more marker of IM-TN breast cancer, e.g. , a factor that promotes one or more of immune cell signaling (e.g., TH1/TH2 pathway, NK cell pathway, B cell receptor signaling pathway, DC pathway, and T cell receptor signaling), cytokine signaling (e.g., cytokine pathway, IL-12 pathway, and IL-7 pathway), antigen processing and presentation, signaling through core immune signal transduction pathways (e.g., NFKB, TNF, and JAK/STAT signaling), genes involved in T-cell function, immune transcription, interferon (IFN) response and antigen processing.
- a factor that promotes one or more of immune cell signaling e.g., TH1/TH2 pathway, NK cell pathway, B cell receptor signaling pathway, DC pathway, and T cell receptor signaling
- cytokine signaling e.g., cytokine pathway, IL-12 pathway, and IL
- Patients with tumors harboring EGFR activating mutation e.g., L858R and/or exl9del
- an acquired EGFR T790M mutation may particularly benefit from the combination of the present invention.
- EGFR mutation status may be determined by tests available in the art, e.g. QIAGEN therascreen® EGFR test and the cobas® EGFR Mutation Test v2.
- the therascreen EGFR RGQ PCR Kit is an FDA-approved, qualitative real-time PCR assay for the detection of specific mutations in the EGFR oncogene.
- Evidence of EGFR mutation can be obtained from existing local data and testing of tumor samples.
- EGFR mutation status may be determined from any available tumor tissue.
- PD- 1 include isoforms, mammalian, e.g., human PD-1, species homologs of human PD-1, and analogs comprising at least one common epitope with PD-1.
- the amino acid sequence of PD- 1, e.g., human PD- 1 is known in the art, e.g., Shinohara T et al. ( 1994) Genomics 23(3):704-6; Finger LR, et al. Gene (1997) 197(1- 2): 177-87.
- the articles “a” and “an” refer to one or to more than one (e.g., to at least one) of the grammatical object of the article.
- compositions and methods of the present invention encompass polypeptides and nucleic acids having the sequences specified, or sequences substantially identical or similar thereto, e.g., sequences at least 85%, 90%, 95% identical or higher to the sequence specified.
- substantially identical is used herein to refer to a first amino acid that contains a sufficient or minimum number of amino acid residues that are i) identical to, or ii) conservative substitutions of aligned amino acid residues in a second amino acid sequence such that the first and second amino acid sequences can have a common structural domain and/or common functional activity.
- amino acid sequences that contain a common structural domain having at least about 85%, 90%.
- nucleotide sequence 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity to a reference sequence, e.g., a sequence provided herein.
- a reference sequence e.g., a sequence provided herein.
- substantially identical is used herein to refer to a first nucleic acid sequence that contains a sufficient or minimum number of nucleotides that are identical to aligned nucleotides in a second nucleic acid sequence such that the first and second nucleotide sequences encode a polypeptide having common functional activity, or encode a common structural polypeptide domain or a common functional polypeptide activity.
- nucleotide sequences having at least about 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity to a reference sequence, e.g., a sequence provided herein.
- the term "functional variant” refers to polypeptides that have a substantially identical amino acid sequence to the naturally-occurring sequence, or are encoded by a substantially identical nucleotide sequence, and are capable of having one or more activities of the naturally-occurring sequence.
- amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions are then compared.
- a position in the first sequence is occupied by the same amino acid residue or nucleotide as the corresponding position in the second sequence, then the molecules are identical at that position (as used herein amino acid or nucleic acid “identity” is equivalent to amino acid or nucleic acid “homology”).
- the percent identity between the two sequences is a function of the number of identical positions shared by the sequences, taking into account the number of gaps, and the length of each gap, which need to be introduced for optimal alignment of the two sequences.
- isolated refers to material that is removed from its original or native environment (e.g., the natural environment if it is naturally occurring).
- a naturally-occurring polynucleotide or polypeptide present in a living animal is not isolated, but the same polynucleotide or polypeptide, separated by human intervention from some or all of the co-existing materials in the natural system, is isolated.
- Such polynucleotides could be part of a vector and/or such polynucleotides or polypeptides could be part of a
- composition and still be isolated in that such vector or composition is not part of the environment in which it is found in nature.
- antibody molecule refers to a protein, e.g., an
- an antibody molecule includes, for example, a monoclonal antibody (including a full length antibody which has an immunoglobulin Fc region). In an embodiment, an antibody molecule comprises a full length antibody, or a full length immunoglobulin chain. In an embodiment, an antibody molecule comprises an antigen binding or functional fragment of a full length antibody, or a full length immunoglobulin chain. .
- an antibody molecule in another example, includes two heavy (H) chain variable domain sequences and two light (L) chain variable domain sequence, thereby forming two antigen binding sites, such as Fab, Fab', F(ab')2, Fc, Fd, Fd', Fv, single chain antibodies (scFv for example), single variable domain antibodies, diabodies (Dab) (bivalent and bispecific), and chimeric (e.g. , humanized) antibodies, which may be produced by the modification of whole antibodies or those synthesized de novo using recombinant DNA technologies. These functional antibody fragments retain the ability to selectively bind with their respective antigen or receptor.
- Antibodies and antibody fragments can be from any class of antibodies including, but not limited to, IgG, IgA, IgM, IgD, and IgE, and from any subclass (e.g. , IgGl, IgG2, IgG3, and IgG4) of antibodies.
- the preparation of antibody molecules can be monoclonal or polyclonal.
- An antibody molecule can also be a human, humanized, CDR-grafted, or in vitro generated antibody.
- the antibody can have a heavy chain constant region chosen from, e.g., IgGl, IgG2, IgG3, or IgG4.
- the antibody can also have a light chain chosen from, e.g., kappa or lambda.
- immunoglobulin (Ig) is used interchangeably with the term "antibody” herein.
- antigen-binding fragments of an antibody molecule include: (i) a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CHI domains; (ii) a F(ab')2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the VH and CHI domains; (iv) a Fv fragment consisting of the VL and VH domains of a single arm of an antibody, (v) a diabody (dAb) fragment, which consists of a VH domain; (vi) a camelid or camelized variable domain; (vii) a single chain Fv (scFv); (viii) a single domain antibody.
- dAb diabody fragment
- Constant regions of the antibodies can be altered, e.g. , mutated, to modify the properties of the antibody (e.g., to increase or decrease one or more of: Fc receptor binding, antibody glycosylation, the number of cysteine residues, effector cell function, or complement function).
- an antibody molecule is a monospecific antibody molecule and binds a single epitope.
- a monospecific antibody molecule having a plurality of immunoglobulin variable domain sequences, each of which binds the same epitope.
- an antibody molecule is a multispecific antibody molecule, e.g. , it comprises a plurality of immunoglobulin variable domains sequences, wherein a first immunoglobulin variable domain sequence of the plurality has binding specificity for a first epitope and a second immunoglobulin variable domain sequence of the plurality has binding specificity for a second epitope.
- the first and second epitopes are on the same antigen, e.g. , the same protein (or subunit of a multimeric protein).
- the first and second epitopes overlap.
- the first and second epitopes do not overlap.
- the first and second epitopes are on different antigens, e.g.
- a multispecific antibody molecule comprises a third, fourth or fifth immunoglobulin variable domain.
- a multispecific antibody molecule is a bispecific antibody molecule, a trispecific antibody molecule, or tetraspecific antibody molecule,
- a multispecific antibody molecule is a bispecific antibody molecule.
- a bispecific antibody has specificity for no more than two antigens.
- a bispecific antibody molecule is characterized by a first immunoglobulin variable domain sequence which has binding specificity for a first epitope and a second immunoglobulin variable domain sequence that has binding specificity for a second epitope.
- the first and second epitopes are on the same antigen, e.g. , the same protein (or subunit of a multimeric protein).
- the first and second epitopes overlap.
- the first and second epitopes do not overlap.
- the first and second epitopes are on different antigens, e.g.
- a bispecific antibody molecule comprises a heavy chain variable domain sequence and a light chain variable domain sequence which have binding specificity for a first epitope and a heavy chain variable domain sequence and a light chain variable domain sequence which have binding specificity for a second epitope.
- a bispecific antibody molecule comprises a half antibody having binding specificity for a first epitope and a half antibody having binding specificity for a second epitope.
- a bispecific antibody molecule comprises a half antibody, or fragment thereof, having binding specificity for a first epitope and a half antibody, or fragment thereof, having binding specificity for a second epitope.
- a bispecific antibody molecule comprises a scFv, or fragment thereof, have binding specificity for a first epitope and a scFv, or fragment thereof, have binding specificity for a second epitope.
- the first epitope is located on PD-1 and the second epitope is located on a TIM-3, LAG-3, CEACAM (e.g., CEACAM-1 and/or CEACAM-5), PD-L1, or PD-L2.
- VH and VL regions can be subdivided into regions of hypervariability, termed “complementarity determining regions” (CDR), interspersed with regions that are more conserved, termed “framework regions” (FR or FW).
- CDR complementarity determining regions
- FR framework regions
- CDR complementarity determining region
- HCDR1, HCDR2, HCDR3 three CDRs in each heavy chain variable region
- LCDR1, LCDR2, LCDR3 three CDRs in each light chain variable region
- VH heavy chain variable domain
- HCDRl heavy chain variable domain
- HCDR2 50-65
- HCDR3 95- 102
- VL light chain variable domain
- LCDRl LCDRl
- 50-56 LCDR2
- LCDR3 LCDR3
- HCDRl CDR amino acids in the VH
- 52-56 HCDR2
- 95-102 HCDR3
- amino acid residues in VL are numbered 26-32 (LCDRl), 50-52 (LCDR2), and 91-96 (LCDR3).
- the CDRs consist of amino acid residues 26-35 (HCDRl), 50-65 (HCDR2), and 95-102 (HCDR3) in human VH and amino acid residues 24-34 (LCDRl), 50-56 (LCDR2), and 89-97 (LCDR3) in human VL.
- the anti-PD-1 antibody molecules can include any combination of one or more Kabat CDRs and/or Chothia hypervariable loops, e.g., described in Table 1.
- the following definitions are used for the anti-PD- 1 antibody molecules described in Table 1 : HCDRl according to the combined CDR definitions of both Kabat and Chothia, and HCCDRs 2-3 and LCCDRs 1-3 according the CDR definition of Kabat.
- each VH and VL typically includes three CDRs and four FRs, arranged from amino-terminus to carboxy -terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
- antigen-binding site refers to the part of an antibody molecule that comprises determinants that form an interface that binds to the PD-1 polypeptide, or an epitope thereof.
- the antigen-binding site typically includes one or more loops (of at least four amino acids or amino acid mimics) that form an interface that binds to the PD- 1 polypeptide.
- the antigen-binding site of an antibody molecule includes at least one or two CDRs and/or hypervariable loops, or more typically at least three, four, five or six CDRs and/or hypervariable loops.
- monoclonal antibody or “monoclonal antibody composition” as used herein refer to a preparation of antibody molecules of single molecular composition.
- a monoclonal antibody composition displays a single binding specificity and affinity for a particular epitope.
- a monoclonal antibody can be made by hybridoma technology or by methods that do not use hybridoma technology (e.g., recombinant methods).
- An "effectively human” protein is a protein that does not evoke a neutralizing antibody response, e.g. , the human anti-murine antibody (HAMA) response.
- HAMA human anti-murine antibody
- HAMA can be problematic in a number of circumstances, e.g., if the antibody molecule is administered repeatedly, e.g., in treatment of a chronic or recurrent disease condition.
- a HAMA response can make repeated antibody administration potentially ineffective because of an increased antibody clearance from the serum (see, e.g., Saleh et al ⁇ Cancer Immunol. Immunother., 32: 180-190 (1990)) and also because of potential allergic reactions (see, e.g., LoBuglio et al, Hybridoma, 5:5117-5123 (1986)).
- a humanized or CDR-grafted antibody will have at least one or two but generally all three recipient CDRs (of heavy and or light immuoglobulin chains) replaced with a donor CDR.
- the antibody may be replaced with at least a portion of a non-human CDR or only some of the CDRs may be replaced with non-human CDRs. It is only necessary to replace the number of CDRs required for binding of the humanized antibody to PD-1.
- the donor will be a rodent antibody, e.g., a rat or mouse antibody
- the recipient will be a human framework or a human consensus framework.
- the immunoglobulin providing the CDRs is called the "donor” and the immunoglobulin providing the framework is called the “acceptor.”
- the donor immunoglobulin is a non-human (e.g., rodent).
- the acceptor framework is a naturally-occurring (e.g., a human) framework or a consensus framework, or a sequence about 85% or higher, preferably 90%, 95%, 99% or higher identical thereto.
- Consensus sequence refers to the sequence formed from the most frequently occurring amino acids (or nucleotides) in a family of related sequences (See e.g., Winnaker, From Genes to Clones (Verlagsgesellschaft, Weinheim, Germany 1987). In a family of proteins, each position in the consensus sequence is occupied by the amino acid occurring most frequently at that position in the family. If two amino acids occur equally frequently, either can be included in the consensus sequence.
- a “consensus framework” refers to the framework region in the consensus immunoglobulin sequence.
- Effectiveness of the combination therapy disclosed herein, and emergence of disease progression may be measured using RECIST criteria for tumor responses (Therasse P, Arbuck S, Eisenhauer E, et al (2000) New Guidelines to Evaluate the Response to Treatment in Solid Tumors, Journal of National Cancer Institute, Vol. 92; 205-16) and the revised RECIST 1.1 guidelines (Eisenhauer E, et al (2009). New response evaluation criteria in solid tumors: revised RECIST guideline (version 1.1). European Journal of Cancer; Vol.45 : 228-47.).
- ORR Overall response rate
- DCR Disease control rate
- EPR Early progression rate
- Tumor response assessment may also be determined locally according to immune-related Response Criteria (irRC) (Wolchok JD, Hoos A, O'Day S et al (2009) Guidelines for the Evaluation of Immune Therapy Activity in Solid Tumors: Immune-Related Response Criteria, Clin Cancer Res; 15:7412-20 and Nishino M, Giobbie-Hurder A, Gargano M, et al (2013) Developing a Common Language for Tumor Response to Immunotherapy: Immune-Related Response Criteria Using Unidimensional Measurements , Clin Cancer Res; 19:3936-3943.
- irRC immune-related Response Criteria
- Murine anti-PD-1 monoclonal antibody BAP049 was humanized. The sequences and test samples of sixteen humanized BAP049 clones with unique variable region sequences were obtained. These clones were further analyzed for their biological functions (e.g., antigen binding and ligand blocking), structural features, and transcient expression in CHO cells.
- FWs human germline variable region frameworks
- the technology entails transferring the murine CDRs in frame to a library of human variable regions (VRs) that had been constructed by randomly combining human germ line FW1, FW2 and FW3 sequences. Only one FW4 sequence was used, which is WGQGTTVTVSS (SEQ ID NO: 67) for the heavy chain (HC) (Kabat human HC subgroup I) and FGQGTKVEIK (SEQ ID NO: 106) for the light chain (LC) (Kabat human ⁇ subgroup I).
- the library of VR sequences was fused to human constant region (CR) sequences, human IgG4(S228P) of HC and human ⁇ CR of LC, and the resulting library of whole IgG was expressed in CHO cells for screening. Screening was performed with tissue culture supernatants measuring binding avidity on antigen-expressing cells in a whole cell ELISA format or on FACS.
- CR constant region
- the humanization process was performed in a stepwise manner starting with the construction and expression of the appropriate chimeric mAb (murine VR, IgG4(S228P), human ⁇ ), which can serve as a comparator for the screening of the humanized clones.
- the constant region amino acid sequences for human IgG4(S228P) heavy chain and human kappa light chain are shown in Table 3.
- Humanization of the VR of LC and HC were performed in two independent steps.
- the library of humanized LC was paired with the chimeric HC (murine VR, IgG4(S228P)) and the resulting "half-humanized" mAbs were screened for binding activity by ELISA.
- the huLC of clones with adequate binding activity > binding of chimeric mAb
- the library of humanized HC was paired with the chimeric LC (murine VR, human ⁇ ) and screened for binding activity by ELISA.
- the huHC of clones with appropriate binding activity were selected.
- variable regions of the selected huLC and huHC were then sequenced to identify the huLC and huHC with unique sequences (some clones from the initial selection process may share the same LC or HC).
- the unique huLC and huHC were then randomly combined to form a small library of humanized mAbs (humAbs), which was expressed in CHO cells and screened on antigen- expressing cells in an ELISA and FACS format. Clones with binding activities that were equal or better than the binding of the chimeric comparator mAb are the final product of the humanization process.
- the three chimeric antibodies i.e., BAP049- chi (Cys), BAP049-chi (Tyr), and BAP049-chi (Ser) (also known as BAP049-chi, BAP049- chi-Y, and BAP049-chi-S, respectively), were expressed in CHO cells and tested for their ability to compete with labeled murine antibody for binding to PD-1 expressing Jurkat cells. The three variants were indistinguishable in the competition experiment.
- the process of humanization yielded sixteen clones with binding affinities comparable to that of the chimeric antibody.
- the VR sequences were provided along with a sample of the mAb.
- the samples had been prepared by transient transfections of CHO cells and were concentrated tissue culture supernatants.
- the antibody concentrations in the solutions had been determined by an IgG4- specific ELISA.
- the sixteen unique clones are combinations of four unique HC sequences and nine unique LC sequences.
- the HC sequences are combinations of one of two different VHFW1, one of three different VHFW2, and one of two different VHFW3 sequences.
- the LC sequences are combinations of one of five different VLFW1, one of three different VLFW2, and one of four different VLFW3 sequences.
- the amino acid and nucleotide sequences of the heavy and light chain variable domains for the humanized BAP049 clones B and E are shown in Table 1.
- the amino acid and nucleotide sequences of the heavy and light chain CDRs of the humanized BAP049 clones are also shown in Table 1.
- the binding activity and specificity was measured in a competition binding assay using a constant concentration of Alexa 488-labeled murine mAb, serial dilutions of the test mAbs, and PD-1 -expressing 300.19 cells. Incubations with the mAb mixtures having different concentration ratios of test mAb to labeled mAb was at 4 °C for 30 min. Bound labeled murine mAb was then quantified using a FACS machine. The experiment was performed twice. Within the accuracy of the experiment, all humanized clones show similar activity for competing with binding of labeled murine mAb. The activity is also comparable to the activity of the parent murine mAb and chimeric mAb. MAbs were ranked relative to each other.
- Selected clones including clones B and E were further tested for their ability to block the binding of PD-L1 and PD-L2 to PD-1 and for enhancing T cell activity in vitro assays with human PBMC.
- Murine anti-PD-1 mAb blocks the binding of the natural ligands PD-L1 and PD-L2 to PD-1 expressed on cells at low concentrations. Whether the humanized clones had preserved the blocking capacity of the parent murine mAb was tested in comparative experiments with murine and chimeric antibodies.
- the blocking capacity of the mAbs was evaluated in a competition binding assay using a constant concentration of PD-Ll-huIgGl Fc fusion protein or PD-L2-huIgGl Fc fusion protein, serial dilutions of the mAbs to be tested, and PD-1 -expressing 300.19 cells. Incubation was at 4 °C for 30 min. Bound ligand fusion proteins were detected with PE- conjugated F(ab')2 fragment of goat anti-human IgG which doesn't recognize IgG4 mAbs (Southern Biotech 2043-09), and flow cytometry. Within the accuracy of the experiments, the humanized clones, chimeric antibody and murine parent mAb demonstrated comparable blocking activity for both the PD-L1 and PD-L2 ligands.
- Single gene vectors were constructed using Lonza's GS Xceed vectors (IgG4proAk for heavy chain and Kappa for light chain). The SGVs were amplified and transiently co-transfected into CHOK1SV GS-KO cells for expression at a volume of 2.8 L.
- Light chain variable domain encoding regions were synthesised by GeneArt AG.
- Light chain variable domain encoding regions were sub-cloned into pXC-Kappa and heavy chain variable domain encoding regions into pXC-IgG4pro ⁇ vectors respectively using the N-terminal restriction site Hind III and the C-terminal restriction sites BsiWI (light chain) and Apal (heavy chain).
- Positive clones were screened by PCR amplification (primers 1053: GCTGACAGACTAACAGACTGTTCC (SEQ ID NO: 226) and 1072: CAAATGTGGTATGGCTGA (SEQ ID NO: 227)) and verified by restriction digest (using a double digest of EcoRI-HF and Hindlll-HF) and nucleotide sequencing of the gene of interest.
- a single bacterial colony was picked into 15 ml Luria Bertani (LB) medium (LB Broth, Sigma-Aldrich, L7275) containing 50 ⁇ g/ml ampicillin and incubated at 37 °C overnight with shaking at 220 rpm.
- the resulting starter culture was used to inoculate 1 L Luria Bertani (LB) medium containing 50 ⁇ g/ml ampicillin and incubated at 37 °C overnight with shaking at 220 rpm.
- Vector DNA was isolated using the QIAGEN Plasmid Plus Gigaprep system (QIAGEN, 12991).
- DNA concentration was measured using a Nanodrop 1000 spectrophotometer (Thermo-Scientific) and adjusted to 1 mg/ml with EB buffer (10 mM Tris-Cl, pH 8.5). DNA quality for the single gene vectors was assessed by measuring the absorbance ratio A260/A280. This was found to be between 1.88 and 1.90.
- CHOK1SV GS-KO cells were cultured in CD-CHO media (Invitrogen, 10743-029) supplemented with 6 mM glutamine (Invitrogen, 25030-123). Cells were incubated in a shaking incubator at 36.5 °C, 5% CO 2 , 85% humidity, 140 rpm. Cells were routinely sub- cultured every 3-4 days, seeding at 2 x 10 5 cells/ml and were propagated in order to have sufficient cells available for transfection. Cells were discarded by passage 20. Transient Transfections of CHOK1SV GS-KO Cells
- Transient transfections were performed using CHOK1SV GS-KO cells which had been in culture a minimum two weeks. Cells were sub-cultured 24 h prior to transfection and cell viability was >99% at the time of transfection.
- Cell culture supernatant was harvested and clarified by centrifugation at 2000 rpm for 10 min, then filtered through a 0.22 ⁇ PES membrane filter. Clarified supernatant was purified using a pre-packed 5 ml HiTrap MabSelect SuRE column (GE Healthcare, 11-0034- 94) on an AKTA purifier (10 ml/min). The column was equilibrated with 50 mM sodium phosphate, 125 mM sodium chloride, pH 7.0 (equilibration buffer) for 5 column volumes (CVs).
- the column was washed with 2 CVs of equilibration buffer followed by 3 CVs of 50 mM sodium phosphate, 1 M sodium chloride pH 7.0 and a repeat wash of 2 CVs of equilibration buffer.
- the Product was then eluted with 10 mM sodium formate, pH 3.5 over 5 CVs. Protein containing, eluted fractions were immediately pH adjusted to pH 7.2 and filtered through a 0.2 ⁇ filter.
- Samples of Protein A purified antibodies were analyzed in duplicate by SE-HPLC on an Agilent 1200 series HPLC system, using a Zorbax GF-250 4 ⁇ 9.4 mm ID x 250 mm column (Agilent). Aliquots of sample at a concentration of 1 mg/ml were filtered through a 0.2 ⁇ filter prior to injection. 80 ⁇ aliquots were injected respectively and run at 1 ml/min for 15 minutes. Soluble aggregate levels were analysed using Chemstation (Agilent) software.
- Reduced samples were prepared for analysis by mixing with NuPage 4x LDS sample buffer (Invitrogen, NP0007) and NuPage lOx sample reducing agent (Invitrogen, NP0009), and incubated at 70 °C, 10 min. For non-reduced samples, the reducing agent and heat incubation were omitted. Samples were electrophoresed on 1.5 mm NuPage 4-12% Bis-Tris Novex pre-cast gels (Invitrogen, NP0335PK2) with NuPage MES SDS running buffer under denaturing conditions.
- Non-reduced samples of Protein A purified antibody were electrophoresed as described below.
- the tested clones show charge isoforms between pH 7.4 and 8.0 markers.
- the detected charge isoforms are slightly more basic than the theorectically calculated pis for these antibodies which were predicted to be between 6.99 and 7.56.
- the general shift to more basic charge isoforms suggests the presence of post-translational modifications such as glycosylation on the molecules.
- Clone C and Clone E show comparable charge isoforms, which is also consistent with the theorectically calculated pi being the same for both (6.99).
- the control IgG4 antibody behaved as expected.
- the binding of the same humanized anti-PD-1 antibody on human PD-1 -expressing 300.19 cells was measured using FACS analysis. The result shows that the anti-PD-1 antibody (human IgG4) binds with high affinity to human PD-1 compared to a human IgG4 isotype control.
- the exemplary humanized anti-PD-1 antibody was found to exhibit high affinity to cynomolgus PD-1 protein and cynomolgus PD-1 -expressing 300.19 cells.
- the anti-PD-1 antibody binds to cynomolgus PD-1 with a KD of 0.093 ⁇ 0.015 nM.
- the binding affinity to cynomolgus PD-1 is comparable to its binding affinity to human PD-1. Additional binding analyses show that the exemplary humanized anti-PD-1 antibody is not cross-reactive with mouse PD-1 or cross-reactive with parental cell line.
- the ability of the exemplary humanized anti-PD-1 antibody to block the interactions between PD-1 and both of its known ligands, PD-Ll and PD-L2 was examined.
- the results show that the anti-PD-1 antibody blocked the binding of PD-Ll and PD-L2 on human PD-1- expressing 300.19 cells compared to human IgG4 isotype control and no antibody control.
- the anti-PD-1 antibody blocked PD-Ll binding on the 300.19 cells with an IC50 of 0.94 ⁇ 0.15 nM.
- the same antibody blocked PD-L2 binding on the 300.19 cells with an IC50 of 1.3 ⁇ 0.25 nM.
- EGF816 is a potent inhibitor of the TEC family of kinases.
- the Tec family kinases include ITK, BMX,TEC, RLK and BTK and are central in the propogation of T-cell receptor and chemokine receptor signaling.
- Compound A a potent inhibitor of mutant EGFR, displays potent inhibition of Tec family kinases in vitro. As shown in Table 7, in the biochemical based assay, Compound A showed single digit nM potency on the three T-cell Tec family members: ITK, TEC and TXK.
- the biochemical assays for ITK, TEC and TXK were carried out using Caliper Life Sciences' proprietary LabChipTM technology. This technology uses a microfluidic chip to measure the conversion of a fluorescent peptide substrate to a phosphorylated product. The product conversions were determined in the presence of various compound concentrations, and IC50 values were calculated.
- the cellular IL-2 Production assay was carried out using Jurkat cells. Upon CD3/CD28 stimulation overnight in the presence of various concentrations of compound, the IL-2 content in the conditioned media was measured by ELISA, and compound IC50 was determined.
- CD4+ T cells were purified from mouse spleens, and plated in the tissue culture plates coated with anti-CD3. Cells were incubated for 48h at 37°C in the presence of various concentrations of compound. 3 H-Thymidine was then added and cells were incubated for an additional 18h at 37°C. Cells were then harvested and read on a beta counter.
- B cells are purified from mouse splenocytes and plated in the tissue culture plates with supplement of anti-IgM and m-IL4. Cells were incubated at 37°C in the presence of various concentrations of compound. After 3 days, cell viability was measured using Cell Titer Glo.
- TMD-8 cells were incubated at 37°C in the presence of various concentrations of compound. After 3 days, cell viability was measured using Cell Titer Glo. Table 7: Compound A biochemical and cellular IC50 on Tec family kinases
- *IL2-production assay encompasses the TEC-family kinases (ITK, TEC, and TXK)
- T-cells play critical roles in immune regulation.
- T-cell Tec family kinases are important players in T-cell function, which in turn can modulate immune function.
- Compound A showed potent inhibition of T-cell Tec family kinases, we further investigated its potential immune-modulatory effect in vivo.
- Compound A was tested in a T-cell dependent antibody response (TDAR) assay, a frequently used functional assessment of the immune system.
- TDAR T-cell dependent antibody response
- Compound A was administered orally to rats for 5 weeks at a dose of 30 mg/kg/day.
- animals received 300 ⁇ g of KLH (Keyhole Limpet Hemocyanin) antigen.
- KLH Keyhole Limpet Hemocyanin
- Table 8 Decreased anti-KLH IgM and IgG indicated by mean percent differences compared to vehicle controls following administration of Compound A at 30 mg/kg/day
- Mean % difference (mean dose group value - mean control value)/ mean control value)xl00%
- Compound A was combined in vivo with an exemplary anti-PD-Ll antibody molecule in an A20 lymphoma model. As shown in Figure 4, the combination of anti-PD-Ll antibody and Compound A, or anti-PD-Ll antibody and ibrutinib, were more effective than any single agent. Compound A and ibrutinib were dosed for only ten days, and a total of 5 doses of anti-PD-Ll -antibody were given. Even though Compound A and ibrutinib were only dosed transiently, the effects of Compound A plus anti-PD-Ll antibody and ibrutinib plus anti-PD- Ll antibody on survival extended beyond 60 days.
- COMPOUND A with anti-PD-Ll antibody was also well tolerated, and positive body weight change observed in animals treated at all doses during the course of treatment.
- the expected mean steady state Cmin concentrations for the exemplary anti-PD-1 antibody molecule observed with either doses/regimens (300 mg q3w or 400 mg q4w) will be at least 77 fold higher than the EC50 (0.42ug/mL) and about 8.6 fold higher than the EC90.
- the ex vivo potentcy is based on IL-2 change in SEB ex-vivo assay.
- FIG. 1 Predicted Ctrough (Cmin) concetrations across the different weights for patients while receiving the same dose of the exemplary anti-PD-1 antibody molecule are shown in Figure 1.
- Body weight based dosing is compared to fixed dose (3.75 mg/kg Q3W vs. 300 mg Q3W and 5 mg/kg Q4W vs. 400 mg Q4W).
- Figure 1 supports flat dosing of the exemplary anti- PD-1 antibody molecule.
- the PK model further is validated. As shown in Figure 2, the observed versus model predicted concentrations lie on the line of unity. Figure 3 shows that the model captures accumulation, time course, and within subject variability. A recommended dose for the antibody molecule may therefore be selected as 400 mg Q4W. An alternative dosing regimen of 300 mg Q3W is expected to achieve similar exposure to 400 mg Q4W, and may be utilized in combination regimens where a Q3W schedule in a given dosing cycle is more convenient.
- Example 6 A phase lb. open-label, multi-center study of Compound A combined with an exemplary antibody molecule (Antibody B) in adult patients with colorectal cancer (CRC). non-small-cell lung cancer (NSCLC) or triple-negative breast cancer (TNBC).
- CRC colorectal cancer
- NSCLC non-small-cell lung cancer
- TNBC triple-negative breast cancer
- the investigational drugs are Compound A and Antibody Molecule B, an anti- PD-1 receptor recombinant humanized monoclonal antibody.
- the exemplary antibody molecule, Antibody B, (BAP049-Clone-E) tested in this study is a humanized anti-programmed death-1 (PD-1) IgG4 monoclonal antibody (mAb) that blocks binding of programmed cell death ligand-1 (PD-L1) and programmed cell death ligand-2 (PD-L2) to PD-1. It binds to PD-1 with high affinity and inhibits its biological activity.
- PD-1 humanized anti-programmed death-1
- mAb programmed cell death ligand-1
- PD-L2 programmed cell death ligand-2
- the amino acid sequences of this antibody molecule are described in Table 1 herein.
- the study is comprised of a dose escalation part followed by a dose expansion part.
- the study treatment is administered in 28-day dosing cycles.
- the screening period begins once the patient has signed the study informed consent. Patients are evaluated to ensure that they meet all the inclusion and none of the exclusion criteria. Treatment period 1
- study treatment is administered for up to six cycles unless the patient experiences unacceptable toxicity, has clinical evidence of disease progression and/or treatment is discontinued at the discretion of the investigator or the patient. Patients who have radiological evidence of disease progression but have evidence of clinical benefit may continue study treatment to complete six cycles.
- Treatment period 2 is given as in treatment period 1 (in cycle 1 only). All patients have a tumor assessment, e.g. using RECIST vl .1 or irRC criteria, prior to resuming study treatment.
- This tumor assessment is used as treatment period 2 baseline scan.
- EOT End of treatment
- Antibody B as a lyophilisate in vial (LYVI) for i.v. infusion, is given at dose of 400 mg as a fixed dose, once every four weeks. Antibody B is given as a 30 minute i.v. infusion, or up to two hours if clinically indicated. Antibody B dose may be delayed by up to seven days.
- LYVI lyophilisate in vial
- Compound A can be administered before or after the Antibody B infusion.
- Compound A is initially given at or below a low dose with evidence of pharmacologic activity established previously by other clinical studies.
- the starting dose of Compound A may be 25 mg given daily, from Day 1 to Day 10 only in the first cycle, and then stopped. If the dose combination is determined to be safe, the dose of Compound A is tested in additional patients to confirm the safety and tolerability at that dose level, or escalated.
- the starting dose of Compound A may be escalated to 50 mg given daily, from Day 1 to Day 10 in the first cycle, and then stopped.
- the dose escalation is guided by a Bayesian Logistic Regression Model (BLRM) based on any Dose Limiting Toxicities (DLTs) observed in the first two cycles of therapy.
- BLRM Bayesian Logistic Regression Model
- the BLRM is a well- established method to estimate the maximum tolerated dose (MTD)/recommended dose for expansion (RDE) in cancer patients.
- the adaptive BLRM is guided by the Escalation With Overdose Control (EWOC) principle to control the risk of DLT in future patients on the study.
- EWOC Escalation With Overdose Control
- Bayesian response adaptive models for small datasets has been accepted by EMA (Guideline on clinical trials in small populations February 1 2007) and endorsed by numerous publications and its development and appropriate use is one aspect of the FDA's Critical Path Initiative.
- the MTD is defined as the highest combination of drug doses not expected to cause DLT in 33% or more of the treated patients in 56 days following the first treatment of the combination.
- the expansion part of the study is initiated to further assess the safety, tolerability and preliminary efficacy of the combination.
- the dose of Compound A is expected to be identified without testing a large number of dose levels or schedules.
- all patients undergo a tumor biopsy at baseline and again after approximately two cycles of therapy.
- the extent of the change in tumor infiltration by immune cells including lymphocytes and myeloid cells may contribute to a decision on any potential benefit for a given combination.
- Patient must have a site of disease amenable to biopsy, and be a candidate for tumor biopsy according to the treating institution's guidelines. Patient must be willing to undergo a new tumor biopsy at baseline, and again during therapy on this study.
- CNS central nervous system
- Total bilirubin > 1.5 x ULN except for patients with Gilbert's syndrome who are excluded if total bilirubin > 3.0 x ULN or direct bilirubin > 1.5 x ULN
- ALT Alanine aminotransferase
- AST Aspartate aminotransferase
- HIV Human Immunodeficiency Virus
- Escalation part Active Hepatitis B (HBV) virus or Hepatitis C (HCV) virus infection at screening.
- HBV Active Hepatitis B virus
- HCV Hepatitis C
- Expansion part Patients with active HBV or HCV are excluded, excepting those patients undergoing treatment for HBV or HCV. 8. Malignant disease, other than that being treated in this study. Exceptions to this exclusion include the following: malignancies that were treated curatively and have not recurred within 2 years prior to study treatment; completely resected basal cell and squamous cell skin cancers; any malignancy considered to be indolent and that has never required therapy; and completely resected carcinoma in situ of any type.
- a limited field such as for the treatment of bone pain or a focally painful tumor mass.
- patients must have remaining measurable disease that has not been irradiated.
- hematopoietic colony-stimulating growth factors e.g. G-CSF, GMCSF, M-CSF
- An erythroid stimulating agent is allowed as long as it was initiated at least 2 weeks prior to the first dose of study treatment. 19. Any medical condition that would, in the investigator's judgment, prevent the patient's participation in the clinical study due to safety concerns, compliance with clinical study procedures or interpretation of study results.
- Pregnant or lactating women where pregnancy is defined as the state of a female after conception and until the termination of gestation, confirmed by a positive hCG laboratory test.
- hCG levels may be above normal limits but with no pregnancy in the patient.
- these patients may enter the study.
- Women of child-bearing potential defined as all women physiologically capable of becoming pregnant, unless they are using highly effective methods of contraception during study treatment and for 90 days after the last any dose of study treatment.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- Immunology (AREA)
- General Health & Medical Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Organic Chemistry (AREA)
- Veterinary Medicine (AREA)
- Engineering & Computer Science (AREA)
- Epidemiology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Microbiology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Biomedical Technology (AREA)
- Mycology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Oncology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Emergency Medicine (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Peptides Or Proteins (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
Abstract
Description
Claims
Priority Applications (13)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP16750496.8A EP3328407A1 (en) | 2015-07-29 | 2016-07-27 | Combination of pd-1 antagonist with an egfr inhibitor |
| RU2018105846A RU2018105846A (en) | 2015-07-29 | 2016-07-27 | COMBINATION OF PD-1 ANTAGONIST WITH EGFR INHIBITOR |
| CN201680057132.5A CN108235685A (en) | 2015-07-29 | 2016-07-27 | The combination of PD-1 antagonists and EGFR inhibitor |
| KR1020187005362A KR20180030911A (en) | 2015-07-29 | 2016-07-27 | Combination of PD-1 antagonist and EGFR inhibitor |
| CA2993908A CA2993908A1 (en) | 2015-07-29 | 2016-07-27 | Combination of pd-1 antagonist with an egfr inhibitor |
| BR112018001640A BR112018001640A2 (en) | 2015-07-29 | 2016-07-27 | combination of pd-1 antagonist with an egfr inhibitor |
| US15/877,436 US20180177872A1 (en) | 2015-07-29 | 2016-07-27 | Combination of PD-1 antagonist with an EGFR inhibitor |
| HK18107449.2A HK1247850A1 (en) | 2015-07-29 | 2016-07-27 | Combination of pd-1 antagonist with an egfr inhibitor |
| JP2018504285A JP2018523652A (en) | 2015-07-29 | 2016-07-27 | Combination of PD-1 antagonist and EGFR inhibitor |
| MX2018001268A MX2018001268A (en) | 2015-07-29 | 2016-07-27 | Combination of pd-1 antagonist with an egfr inhibitor. |
| AU2016298823A AU2016298823A1 (en) | 2015-07-29 | 2016-07-27 | Combination of PD-1 antagonist with an EGFR inhibitor |
| IL256775A IL256775A (en) | 2015-07-29 | 2018-01-07 | Combination of pd-1 antagonist with an egfr inhibitor |
| PH12018500097A PH12018500097A1 (en) | 2015-07-29 | 2018-01-11 | Combination of pd-1 antagonist with an egfr inhibitor |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201562198390P | 2015-07-29 | 2015-07-29 | |
| US62/198,390 | 2015-07-29 | ||
| US201662331371P | 2016-05-03 | 2016-05-03 | |
| US62/331,371 | 2016-05-03 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2017017624A1 true WO2017017624A1 (en) | 2017-02-02 |
Family
ID=56682137
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/IB2016/054488 Ceased WO2017017624A1 (en) | 2015-07-29 | 2016-07-27 | Combination of pd-1 antagonist with an egfr inhibitor |
Country Status (15)
| Country | Link |
|---|---|
| US (1) | US20180177872A1 (en) |
| EP (1) | EP3328407A1 (en) |
| JP (1) | JP2018523652A (en) |
| KR (1) | KR20180030911A (en) |
| CN (1) | CN108235685A (en) |
| AU (1) | AU2016298823A1 (en) |
| BR (1) | BR112018001640A2 (en) |
| CA (1) | CA2993908A1 (en) |
| CL (1) | CL2018000223A1 (en) |
| HK (1) | HK1247850A1 (en) |
| IL (1) | IL256775A (en) |
| MX (1) | MX2018001268A (en) |
| PH (1) | PH12018500097A1 (en) |
| RU (1) | RU2018105846A (en) |
| WO (1) | WO2017017624A1 (en) |
Cited By (46)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2019165374A1 (en) | 2018-02-26 | 2019-08-29 | Gilead Sciences, Inc. | Substituted pyrrolizine compounds as hbv replication inhibitors |
| WO2019193543A1 (en) | 2018-04-06 | 2019-10-10 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 3'3'-cyclic dinucleotides |
| WO2019195181A1 (en) | 2018-04-05 | 2019-10-10 | Gilead Sciences, Inc. | Antibodies and fragments thereof that bind hepatitis b virus protein x |
| WO2019193533A1 (en) | 2018-04-06 | 2019-10-10 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 2'2'-cyclic dinucleotides |
| WO2019193542A1 (en) | 2018-04-06 | 2019-10-10 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 2'3'-cyclic dinucleotides |
| WO2019200247A1 (en) | 2018-04-12 | 2019-10-17 | Precision Biosciences, Inc. | Optimized engineered meganucleases having specificity for a recognition sequence in the hepatitis b virus genome |
| WO2019211799A1 (en) | 2018-05-03 | 2019-11-07 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 2'3'-cyclic dinucleotide analogue comprising a cyclopentanyl modified nucleotide |
| US10513558B2 (en) | 2015-07-13 | 2019-12-24 | Cytomx Therapeutics, Inc. | Anti-PD1 antibodies, activatable anti-PD1 antibodies, and methods of use thereof |
| WO2020028097A1 (en) | 2018-08-01 | 2020-02-06 | Gilead Sciences, Inc. | Solid forms of (r)-11-(methoxymethyl)-12-(3-methoxypropoxy)-3,3-dimethyl-8-0x0-2,3,8,13b-tetrahydro-1h-pyrido[2,1-a]pyrrolo[1,2-c] phthalazine-7-c arboxylic acid |
| WO2020081786A1 (en) * | 2018-10-17 | 2020-04-23 | Immunome, Inc. | Exosome-targeting bispecific antibodies |
| WO2020092621A1 (en) | 2018-10-31 | 2020-05-07 | Gilead Sciences, Inc. | Substituted 6-azabenzimidazole compounds as hpk1 inhibitors |
| WO2020092528A1 (en) | 2018-10-31 | 2020-05-07 | Gilead Sciences, Inc. | Substituted 6-azabenzimidazole compounds having hpk1 inhibitory activity |
| US10662416B2 (en) | 2016-10-14 | 2020-05-26 | Precision Biosciences, Inc. | Engineered meganucleases specific for recognition sequences in the hepatitis B virus genome |
| WO2020178768A1 (en) | 2019-03-07 | 2020-09-10 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 3'3'-cyclic dinucleotide analogue comprising a cyclopentanyl modified nucleotide as sting modulator |
| WO2020178769A1 (en) | 2019-03-07 | 2020-09-10 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 2'3'-cyclic dinucleotides and prodrugs thereof |
| WO2020178770A1 (en) | 2019-03-07 | 2020-09-10 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 3'3'-cyclic dinucleotides and prodrugs thereof |
| WO2020214652A1 (en) | 2019-04-17 | 2020-10-22 | Gilead Sciences, Inc. | Solid forms of a toll-like receptor modulator |
| WO2020214663A1 (en) | 2019-04-17 | 2020-10-22 | Gilead Sciences, Inc. | Solid forms of a toll-like receptor modulator |
| WO2020237025A1 (en) | 2019-05-23 | 2020-11-26 | Gilead Sciences, Inc. | Substituted exo-methylene-oxindoles which are hpk1/map4k1 inhibitors |
| WO2021034804A1 (en) | 2019-08-19 | 2021-02-25 | Gilead Sciences, Inc. | Pharmaceutical formulations of tenofovir alafenamide |
| US10966999B2 (en) | 2017-12-20 | 2021-04-06 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 3′3′ cyclic dinucleotides with phosphonate bond activating the sting adaptor protein |
| WO2021067181A1 (en) | 2019-09-30 | 2021-04-08 | Gilead Sciences, Inc. | Hbv vaccines and methods treating hbv |
| US10981990B2 (en) | 2014-01-31 | 2021-04-20 | Novartis Ag | Antibody molecules to TIM-3 and uses thereof |
| WO2021113765A1 (en) | 2019-12-06 | 2021-06-10 | Precision Biosciences, Inc. | Optimized engineered meganucleases having specificity for a recognition sequence in the hepatitis b virus genome |
| WO2021188959A1 (en) | 2020-03-20 | 2021-09-23 | Gilead Sciences, Inc. | Prodrugs of 4'-c-substituted-2-halo-2'-deoxyadenosine nucleosides and methods of making and using the same |
| JP2021527111A (en) * | 2018-06-15 | 2021-10-11 | ボード オブ レジェンツ, ザ ユニバーシティ オブ テキサス システムBoard Of Regents, The University Of Texas System | Breast cancer treatment and prevention methods using S-equol |
| US11155619B2 (en) | 2015-11-18 | 2021-10-26 | Merck Sharp & Dohme Corp. | PD1 and/or LAG3 binders |
| US20210363243A1 (en) * | 2018-02-01 | 2021-11-25 | Merck Sharp & Dohme Corp. | Methods for treating cancer or infection using a combination of an anti-pd-1 antibody, an anti-lag3 antibody, and an anti-tigit antibody |
| US11203610B2 (en) | 2017-12-20 | 2021-12-21 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 2′3′ cyclic dinucleotides with phosphonate bond activating the sting adaptor protein |
| US11344620B2 (en) | 2014-09-13 | 2022-05-31 | Novartis Ag | Combination therapies |
| WO2022241134A1 (en) | 2021-05-13 | 2022-11-17 | Gilead Sciences, Inc. | COMBINATION OF A TLR8 MODULATING COMPOUND AND ANTI-HBV siRNA THERAPEUTICS |
| WO2022261301A1 (en) | 2021-06-11 | 2022-12-15 | Gilead Sciences, Inc. | Combination mcl-1 inhibitors with anti-cancer agents |
| WO2022261310A1 (en) | 2021-06-11 | 2022-12-15 | Gilead Sciences, Inc. | Combination mcl-1 inhibitors with anti-body drug conjugates |
| WO2022271659A1 (en) | 2021-06-23 | 2022-12-29 | Gilead Sciences, Inc. | Diacylglyercol kinase modulating compounds |
| WO2022271677A1 (en) | 2021-06-23 | 2022-12-29 | Gilead Sciences, Inc. | Diacylglyercol kinase modulating compounds |
| WO2022271684A1 (en) | 2021-06-23 | 2022-12-29 | Gilead Sciences, Inc. | Diacylglyercol kinase modulating compounds |
| WO2022271650A1 (en) | 2021-06-23 | 2022-12-29 | Gilead Sciences, Inc. | Diacylglyercol kinase modulating compounds |
| US11708412B2 (en) | 2013-09-26 | 2023-07-25 | Novartis Ag | Methods for treating hematologic cancers |
| US11827704B2 (en) | 2014-01-24 | 2023-11-28 | Novartis Ag | Antibody molecules to PD-1 and uses thereof |
| US12064413B2 (en) | 2018-06-15 | 2024-08-20 | The Board Of Regents Of The University Of Texas System | Methods of treating melanoma with S-equol |
| US12252535B2 (en) | 2014-03-14 | 2025-03-18 | Novartis Ag | Antibody molecules to LAG-3 and uses thereof |
| US12398209B2 (en) | 2018-01-22 | 2025-08-26 | Janssen Biotech, Inc. | Methods of treating cancers with antagonistic anti-PD-1 antibodies |
| WO2025240246A1 (en) | 2024-05-13 | 2025-11-20 | Gilead Sciences, Inc. | Combination therapies with ribavirin |
| WO2025240242A1 (en) | 2024-05-13 | 2025-11-20 | Gilead Sciences, Inc. | Combination therapies with ribavirin |
| WO2025240243A1 (en) | 2024-05-13 | 2025-11-20 | Gilead Sciences, Inc. | Combination therapies with bulevirtide and an inhibitory nucleic acid targeting hepatitis b virus |
| WO2025240244A1 (en) | 2024-05-13 | 2025-11-20 | Gilead Sciences, Inc. | Combination therapies comprising bulevirtide and lonafarnib for use in the treatment of hepatitis d virus infection |
Citations (11)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2006121168A1 (en) | 2005-05-09 | 2006-11-16 | Ono Pharmaceutical Co., Ltd. | Human monoclonal antibodies to programmed death 1(pd-1) and methods for treating cancer using anti-pd-1 antibodies alone or in combination with other immunotherapeutics |
| WO2007005874A2 (en) | 2005-07-01 | 2007-01-11 | Medarex, Inc. | Human monoclonal antibodies to programmed death ligand 1 (pd-l1) |
| WO2009101611A1 (en) | 2008-02-11 | 2009-08-20 | Curetech Ltd. | Monoclonal antibodies for tumor treatment |
| WO2009114335A2 (en) | 2008-03-12 | 2009-09-17 | Merck & Co., Inc. | Pd-1 binding proteins |
| US20100028330A1 (en) | 2002-12-23 | 2010-02-04 | Medimmune Limited | Methods of upmodulating adaptive immune response using anti-pd1 antibodies |
| WO2010027827A2 (en) | 2008-08-25 | 2010-03-11 | Amplimmune, Inc. | Targeted costimulatory polypeptides and methods of use to treat cancer |
| WO2010077634A1 (en) | 2008-12-09 | 2010-07-08 | Genentech, Inc. | Anti-pd-l1 antibodies and their use to enhance t-cell function |
| WO2011066342A2 (en) | 2009-11-24 | 2011-06-03 | Amplimmune, Inc. | Simultaneous inhibition of pd-l1/pd-l2 |
| US20120114649A1 (en) | 2008-08-25 | 2012-05-10 | Amplimmune, Inc. Delaware | Compositions of pd-1 antagonists and methods of use |
| WO2015083059A1 (en) | 2013-12-02 | 2015-06-11 | Novartis Ag | Forms of the egfr inhibitor |
| WO2015112900A1 (en) * | 2014-01-24 | 2015-07-30 | Dana-Farber Cancer Institue, Inc. | Antibody molecules to pd-1 and uses thereof |
Family Cites Families (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US1511900A (en) * | 1923-12-10 | 1924-10-14 | John A Mandis | Snap fastener |
| JO3300B1 (en) * | 2012-06-06 | 2018-09-16 | Novartis Ag | Compounds and compositions for modulating egfr activity |
| ES2986067T3 (en) * | 2015-12-17 | 2024-11-08 | Novartis Ag | Antibody molecules against PD-1 and their uses |
-
2016
- 2016-07-27 EP EP16750496.8A patent/EP3328407A1/en not_active Withdrawn
- 2016-07-27 KR KR1020187005362A patent/KR20180030911A/en not_active Withdrawn
- 2016-07-27 CN CN201680057132.5A patent/CN108235685A/en active Pending
- 2016-07-27 JP JP2018504285A patent/JP2018523652A/en active Pending
- 2016-07-27 US US15/877,436 patent/US20180177872A1/en not_active Abandoned
- 2016-07-27 BR BR112018001640A patent/BR112018001640A2/en not_active Application Discontinuation
- 2016-07-27 MX MX2018001268A patent/MX2018001268A/en unknown
- 2016-07-27 AU AU2016298823A patent/AU2016298823A1/en not_active Abandoned
- 2016-07-27 WO PCT/IB2016/054488 patent/WO2017017624A1/en not_active Ceased
- 2016-07-27 RU RU2018105846A patent/RU2018105846A/en not_active Application Discontinuation
- 2016-07-27 CA CA2993908A patent/CA2993908A1/en not_active Abandoned
- 2016-07-27 HK HK18107449.2A patent/HK1247850A1/en unknown
-
2018
- 2018-01-07 IL IL256775A patent/IL256775A/en unknown
- 2018-01-11 PH PH12018500097A patent/PH12018500097A1/en unknown
- 2018-01-26 CL CL2018000223A patent/CL2018000223A1/en unknown
Patent Citations (12)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20100028330A1 (en) | 2002-12-23 | 2010-02-04 | Medimmune Limited | Methods of upmodulating adaptive immune response using anti-pd1 antibodies |
| WO2006121168A1 (en) | 2005-05-09 | 2006-11-16 | Ono Pharmaceutical Co., Ltd. | Human monoclonal antibodies to programmed death 1(pd-1) and methods for treating cancer using anti-pd-1 antibodies alone or in combination with other immunotherapeutics |
| WO2007005874A2 (en) | 2005-07-01 | 2007-01-11 | Medarex, Inc. | Human monoclonal antibodies to programmed death ligand 1 (pd-l1) |
| WO2009101611A1 (en) | 2008-02-11 | 2009-08-20 | Curetech Ltd. | Monoclonal antibodies for tumor treatment |
| WO2009114335A2 (en) | 2008-03-12 | 2009-09-17 | Merck & Co., Inc. | Pd-1 binding proteins |
| WO2010027827A2 (en) | 2008-08-25 | 2010-03-11 | Amplimmune, Inc. | Targeted costimulatory polypeptides and methods of use to treat cancer |
| US20120114649A1 (en) | 2008-08-25 | 2012-05-10 | Amplimmune, Inc. Delaware | Compositions of pd-1 antagonists and methods of use |
| US8609089B2 (en) | 2008-08-25 | 2013-12-17 | Amplimmune, Inc. | Compositions of PD-1 antagonists and methods of use |
| WO2010077634A1 (en) | 2008-12-09 | 2010-07-08 | Genentech, Inc. | Anti-pd-l1 antibodies and their use to enhance t-cell function |
| WO2011066342A2 (en) | 2009-11-24 | 2011-06-03 | Amplimmune, Inc. | Simultaneous inhibition of pd-l1/pd-l2 |
| WO2015083059A1 (en) | 2013-12-02 | 2015-06-11 | Novartis Ag | Forms of the egfr inhibitor |
| WO2015112900A1 (en) * | 2014-01-24 | 2015-07-30 | Dana-Farber Cancer Institue, Inc. | Antibody molecules to pd-1 and uses thereof |
Non-Patent Citations (25)
| Title |
|---|
| "Remington's Pharmaceutical Sciences", 1985, MACK PUBLISHING COMPANY, pages: 1418 |
| "Sustained and Controlled Release Drug Delivery Systems", 1978, MARCEL DEKKER, INC. |
| AL-LAZIKANI ET AL., JMB, vol. 273, 1997, pages 927 - 948 |
| BRIAN D. LEHMANN ET AL.: "Identification of human triple-negative breast cancer subtypes and preclinical models for selection of targeted therapies", J CLIN INVEST., vol. 121, no. 7, 1 July 2011 (2011-07-01), pages 2750 - 2767 |
| CHOTHIA, C. ET AL., J. MOL. BIOL., vol. 196, 1987, pages 901 - 917 |
| EISENHAUER E ET AL.: "New response evaluation criteria in solid tumors: revised RECIST guideline (version 1.1", EUROPEAN JOURNAL OF CANCER, vol. 45, 2009, pages 228 - 247 |
| FINGER LR ET AL., GENE, vol. 197, no. 1-2, 1997, pages 177 - 187 |
| GETTINGER S ET AL: "Safety and Response With Nivolumab (Anti-PD-1; BMS-936558, ONO-4538) Plus Erlotinib in Patients (Pts) With Epidermal Growth Factor Receptor Mutant (EGFR MT) Advanced Non-Small Cell Lung Cancer (NSCLC) Metastatic Non-Small Cell Lung Cancer", INTERNATIONAL JOURNAL OF RADIATION: ONCOLOGY BIOLOGY PHYSICS, vol. 90, no. 5, 15 November 2014 (2014-11-15), XP029091333, ISSN: 0360-3016, DOI: 10.1016/J.IJROBP.2014.08.210 * |
| HAMID, O ET AL., NEW ENGLAND JOURNAL OF MEDICINE, vol. 369, no. 2, 2013, pages 134 - 144 |
| HANNE ET AL.: "AZD9291 in EGFR Inhibitor-Resistant Non-Small-Cell Lung Cancer", N ENGL J MED, vol. 372, 2015, pages 1689 - 1699 |
| JIA ET AL., CANCER RES, vol. 74, 1 October 2014 (2014-10-01), pages 1734 |
| JOURNAL OF PHARMACEUTICAL SCIENCE, vol. 66, 1977, pages 2 |
| KABAT ET AL.: "Sequences of Proteins of Immunological Interest", 1991, NATIONAL INSTITUTES OF HEALTH |
| KABAT, E. A. ET AL.: "Sequences of Proteins of Immunological Interest", 1991, NIH PUBLICATION NO. 91-3242 |
| LOBUGLIO ET AL., HYBRIDOMA, vol. 5, 1986, pages 5117 - 5123 |
| NISHINO M; GIOBBIE-HURDER A; GARGANO M ET AL.: "Developing a Common Language for Tumor Response to Immunotherapy: Immune-Related Response Criteria Using UnidimensionalMeasurements", CLIN CANCER RES, vol. 19, 2013, pages 3936 - 3943 |
| SAGIV-BARFI ET AL., BLOOD, 2015, pages 2079 - 2086 |
| SAKAGAMI ET AL.: "ASP8273, a novel mutant-selective irreversible EGFR inhibitor, inhibits growth of non-small cell lung cancer (NSCLC) cells with EGFR activating and T790M resistance mutations", AACR; CANCER RES, vol. 74, 2014, pages 1728 |
| SALEH ET AL., CANCER IMMUNOL. IMMUNOTHER., vol. 32, 1990, pages 180 - 190 |
| SCHWARTZBERG ET AL., NAT. REV. LMMUNOL, 2005, pages 284 - 295 |
| SEQUIST ET AL.: "Rociletinib in EGFR-Mutated Non-Small-Cell Lung Cancer", J MED, vol. 372, 2015, pages 1700 - 1709 |
| SHINOHARA T ET AL., GENOMICS, vol. 23, no. 3, 1994, pages 704 - 706 |
| THERASSE P; ARBUCK S; EISENHAUER E ET AL.: "New Guidelines to Evaluate the Response to Treatment in Solid Tumors", JOURNAL OF NATIONAL CANCER INSTITUTE, vol. 92, 2000, pages 205 - 216 |
| WINNAKER: "From Genes to Clones", 1987, VERLAGSGESELLSCHAFT |
| WOLCHOK JD; HOOS A; O'DAY S ET AL.: "Guidelines ,for the Evaluation of Immune Therapy Activity in Solid Tumors: Immune-Related Response Criteria", CLIN CANCER RES, vol. 15, 2009, pages 7412 - 7420 |
Cited By (67)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11708412B2 (en) | 2013-09-26 | 2023-07-25 | Novartis Ag | Methods for treating hematologic cancers |
| US11827704B2 (en) | 2014-01-24 | 2023-11-28 | Novartis Ag | Antibody molecules to PD-1 and uses thereof |
| US11155620B2 (en) | 2014-01-31 | 2021-10-26 | Novartis Ag | Method of detecting TIM-3 using antibody molecules to TIM-3 |
| US10981990B2 (en) | 2014-01-31 | 2021-04-20 | Novartis Ag | Antibody molecules to TIM-3 and uses thereof |
| US12252535B2 (en) | 2014-03-14 | 2025-03-18 | Novartis Ag | Antibody molecules to LAG-3 and uses thereof |
| US11344620B2 (en) | 2014-09-13 | 2022-05-31 | Novartis Ag | Combination therapies |
| US10513558B2 (en) | 2015-07-13 | 2019-12-24 | Cytomx Therapeutics, Inc. | Anti-PD1 antibodies, activatable anti-PD1 antibodies, and methods of use thereof |
| US11168135B2 (en) | 2015-11-18 | 2021-11-09 | Merck Sharp & Dohme Corp. | PD1 and/or LAG3 binders |
| US11155619B2 (en) | 2015-11-18 | 2021-10-26 | Merck Sharp & Dohme Corp. | PD1 and/or LAG3 binders |
| US11168136B2 (en) | 2015-11-18 | 2021-11-09 | Merck Sharp & Dohme Corp. | PD1 and/or LAG3 binders |
| US12351630B2 (en) | 2015-11-18 | 2025-07-08 | Merck Sharp & Dohme Llc | PD1 and/or LAG3 binders |
| US11274285B2 (en) | 2016-10-14 | 2022-03-15 | Precision Biosciences, Inc. | Engineered meganucleases specific for recognition sequences in the Hepatitis B virus genome |
| US10662416B2 (en) | 2016-10-14 | 2020-05-26 | Precision Biosciences, Inc. | Engineered meganucleases specific for recognition sequences in the hepatitis B virus genome |
| US11203610B2 (en) | 2017-12-20 | 2021-12-21 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 2′3′ cyclic dinucleotides with phosphonate bond activating the sting adaptor protein |
| US10966999B2 (en) | 2017-12-20 | 2021-04-06 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 3′3′ cyclic dinucleotides with phosphonate bond activating the sting adaptor protein |
| US12398209B2 (en) | 2018-01-22 | 2025-08-26 | Janssen Biotech, Inc. | Methods of treating cancers with antagonistic anti-PD-1 antibodies |
| US20210363243A1 (en) * | 2018-02-01 | 2021-11-25 | Merck Sharp & Dohme Corp. | Methods for treating cancer or infection using a combination of an anti-pd-1 antibody, an anti-lag3 antibody, and an anti-tigit antibody |
| WO2019165374A1 (en) | 2018-02-26 | 2019-08-29 | Gilead Sciences, Inc. | Substituted pyrrolizine compounds as hbv replication inhibitors |
| WO2019195181A1 (en) | 2018-04-05 | 2019-10-10 | Gilead Sciences, Inc. | Antibodies and fragments thereof that bind hepatitis b virus protein x |
| US11292812B2 (en) | 2018-04-06 | 2022-04-05 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 3′3′-cyclic dinucleotides |
| WO2019193533A1 (en) | 2018-04-06 | 2019-10-10 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 2'2'-cyclic dinucleotides |
| WO2019193542A1 (en) | 2018-04-06 | 2019-10-10 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 2'3'-cyclic dinucleotides |
| US11149052B2 (en) | 2018-04-06 | 2021-10-19 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 2′3′-cyclic dinucleotides |
| WO2019193543A1 (en) | 2018-04-06 | 2019-10-10 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 3'3'-cyclic dinucleotides |
| US11788077B2 (en) | 2018-04-12 | 2023-10-17 | Precision Biosciences, Inc. | Polynucleotides encoding optimized engineered meganucleases having specificity for a recognition sequence in the Hepatitis B virus genome |
| WO2019200247A1 (en) | 2018-04-12 | 2019-10-17 | Precision Biosciences, Inc. | Optimized engineered meganucleases having specificity for a recognition sequence in the hepatitis b virus genome |
| US11142750B2 (en) | 2018-04-12 | 2021-10-12 | Precision Biosciences, Inc. | Optimized engineered meganucleases having specificity for a recognition sequence in the Hepatitis B virus genome |
| WO2019211799A1 (en) | 2018-05-03 | 2019-11-07 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 2'3'-cyclic dinucleotide analogue comprising a cyclopentanyl modified nucleotide |
| US12070443B2 (en) | 2018-06-15 | 2024-08-27 | The Board Of Regents Of The University Of Texas System | Methods of treating and preventing breast cancer with S-equol |
| US12064413B2 (en) | 2018-06-15 | 2024-08-20 | The Board Of Regents Of The University Of Texas System | Methods of treating melanoma with S-equol |
| JP2021527111A (en) * | 2018-06-15 | 2021-10-11 | ボード オブ レジェンツ, ザ ユニバーシティ オブ テキサス システムBoard Of Regents, The University Of Texas System | Breast cancer treatment and prevention methods using S-equol |
| JP7329860B2 (en) | 2018-06-15 | 2023-08-21 | ボード オブ レジェンツ,ザ ユニバーシティ オブ テキサス システム | Method for treating and preventing breast cancer using S-equol |
| WO2020028097A1 (en) | 2018-08-01 | 2020-02-06 | Gilead Sciences, Inc. | Solid forms of (r)-11-(methoxymethyl)-12-(3-methoxypropoxy)-3,3-dimethyl-8-0x0-2,3,8,13b-tetrahydro-1h-pyrido[2,1-a]pyrrolo[1,2-c] phthalazine-7-c arboxylic acid |
| WO2020081786A1 (en) * | 2018-10-17 | 2020-04-23 | Immunome, Inc. | Exosome-targeting bispecific antibodies |
| EP4671244A1 (en) | 2018-10-31 | 2025-12-31 | Gilead Sciences, Inc. | SUBSTITUTED 6-AZABENZIMIDAZOLE COMPOUNDS AS HPK1 HIBITORS |
| WO2020092528A1 (en) | 2018-10-31 | 2020-05-07 | Gilead Sciences, Inc. | Substituted 6-azabenzimidazole compounds having hpk1 inhibitory activity |
| EP4371987A1 (en) | 2018-10-31 | 2024-05-22 | Gilead Sciences, Inc. | Substituted 6-azabenzimidazole compounds as hpk1 inhibitors |
| WO2020092621A1 (en) | 2018-10-31 | 2020-05-07 | Gilead Sciences, Inc. | Substituted 6-azabenzimidazole compounds as hpk1 inhibitors |
| WO2020178769A1 (en) | 2019-03-07 | 2020-09-10 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 2'3'-cyclic dinucleotides and prodrugs thereof |
| US11766447B2 (en) | 2019-03-07 | 2023-09-26 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 3′3′-cyclic dinucleotide analogue comprising a cyclopentanyl modified nucleotide as sting modulator |
| US12318403B2 (en) | 2019-03-07 | 2025-06-03 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 2′3′-cyclic dinucleotides and prodrugs thereof |
| WO2020178770A1 (en) | 2019-03-07 | 2020-09-10 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 3'3'-cyclic dinucleotides and prodrugs thereof |
| WO2020178768A1 (en) | 2019-03-07 | 2020-09-10 | Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. | 3'3'-cyclic dinucleotide analogue comprising a cyclopentanyl modified nucleotide as sting modulator |
| EP4458416A2 (en) | 2019-04-17 | 2024-11-06 | Gilead Sciences, Inc. | Solid forms of a toll-like receptor modulator |
| WO2020214663A1 (en) | 2019-04-17 | 2020-10-22 | Gilead Sciences, Inc. | Solid forms of a toll-like receptor modulator |
| WO2020214652A1 (en) | 2019-04-17 | 2020-10-22 | Gilead Sciences, Inc. | Solid forms of a toll-like receptor modulator |
| WO2020237025A1 (en) | 2019-05-23 | 2020-11-26 | Gilead Sciences, Inc. | Substituted exo-methylene-oxindoles which are hpk1/map4k1 inhibitors |
| WO2021034804A1 (en) | 2019-08-19 | 2021-02-25 | Gilead Sciences, Inc. | Pharmaceutical formulations of tenofovir alafenamide |
| WO2021067181A1 (en) | 2019-09-30 | 2021-04-08 | Gilead Sciences, Inc. | Hbv vaccines and methods treating hbv |
| EP4458975A2 (en) | 2019-09-30 | 2024-11-06 | Gilead Sciences, Inc. | Hbv vaccines and methods treating hbv |
| US12410418B2 (en) | 2019-12-06 | 2025-09-09 | Precision Biosciences, Inc. | Optimized engineered meganucleases having specificity for a recognition sequence in the Hepatitis B virus genome |
| WO2021113765A1 (en) | 2019-12-06 | 2021-06-10 | Precision Biosciences, Inc. | Optimized engineered meganucleases having specificity for a recognition sequence in the hepatitis b virus genome |
| EP4567109A2 (en) | 2019-12-06 | 2025-06-11 | Precision Biosciences, Inc. | Optimized engineered meganucleases having specificity for a recognition sequence in the hepatitis b virus genome |
| WO2021188959A1 (en) | 2020-03-20 | 2021-09-23 | Gilead Sciences, Inc. | Prodrugs of 4'-c-substituted-2-halo-2'-deoxyadenosine nucleosides and methods of making and using the same |
| WO2022241134A1 (en) | 2021-05-13 | 2022-11-17 | Gilead Sciences, Inc. | COMBINATION OF A TLR8 MODULATING COMPOUND AND ANTI-HBV siRNA THERAPEUTICS |
| WO2022261301A1 (en) | 2021-06-11 | 2022-12-15 | Gilead Sciences, Inc. | Combination mcl-1 inhibitors with anti-cancer agents |
| US11931424B2 (en) | 2021-06-11 | 2024-03-19 | Gilead Sciences, Inc. | Combination MCL-1 inhibitors with anti-body drug conjugates |
| US11957693B2 (en) | 2021-06-11 | 2024-04-16 | Gilead Sciences, Inc. | Combination MCL-1 inhibitors with anti-cancer agents |
| WO2022261310A1 (en) | 2021-06-11 | 2022-12-15 | Gilead Sciences, Inc. | Combination mcl-1 inhibitors with anti-body drug conjugates |
| WO2022271659A1 (en) | 2021-06-23 | 2022-12-29 | Gilead Sciences, Inc. | Diacylglyercol kinase modulating compounds |
| WO2022271677A1 (en) | 2021-06-23 | 2022-12-29 | Gilead Sciences, Inc. | Diacylglyercol kinase modulating compounds |
| WO2022271684A1 (en) | 2021-06-23 | 2022-12-29 | Gilead Sciences, Inc. | Diacylglyercol kinase modulating compounds |
| WO2022271650A1 (en) | 2021-06-23 | 2022-12-29 | Gilead Sciences, Inc. | Diacylglyercol kinase modulating compounds |
| WO2025240246A1 (en) | 2024-05-13 | 2025-11-20 | Gilead Sciences, Inc. | Combination therapies with ribavirin |
| WO2025240242A1 (en) | 2024-05-13 | 2025-11-20 | Gilead Sciences, Inc. | Combination therapies with ribavirin |
| WO2025240243A1 (en) | 2024-05-13 | 2025-11-20 | Gilead Sciences, Inc. | Combination therapies with bulevirtide and an inhibitory nucleic acid targeting hepatitis b virus |
| WO2025240244A1 (en) | 2024-05-13 | 2025-11-20 | Gilead Sciences, Inc. | Combination therapies comprising bulevirtide and lonafarnib for use in the treatment of hepatitis d virus infection |
Also Published As
| Publication number | Publication date |
|---|---|
| KR20180030911A (en) | 2018-03-26 |
| PH12018500097A1 (en) | 2018-07-23 |
| CN108235685A (en) | 2018-06-29 |
| MX2018001268A (en) | 2018-07-06 |
| CA2993908A1 (en) | 2017-02-02 |
| EP3328407A1 (en) | 2018-06-06 |
| IL256775A (en) | 2018-03-29 |
| HK1247850A1 (en) | 2018-10-05 |
| BR112018001640A2 (en) | 2018-09-18 |
| JP2018523652A (en) | 2018-08-23 |
| RU2018105846A (en) | 2019-08-28 |
| US20180177872A1 (en) | 2018-06-28 |
| CL2018000223A1 (en) | 2018-07-13 |
| AU2016298823A1 (en) | 2018-02-08 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20180177872A1 (en) | Combination of PD-1 antagonist with an EGFR inhibitor | |
| AU2020256466B2 (en) | Antibody molecules to LAG-3 and uses thereof | |
| US20240343808A1 (en) | Antibody molecules to pg-l1 and methods of treating cancer and infectious diseases | |
| US11001628B2 (en) | Combined use of anti PD-1 and anti M-CSF antibodies in the treatment of cancer | |
| AU2015209145B2 (en) | Antibody molecules to PD-1 and uses thereof | |
| AU2017279046B2 (en) | Therapeutic uses of a c-Raf inhibitor | |
| IL267625A (en) | Antagonistic antibodies against icos and their uses | |
| KR20200021087A (en) | Antibody Molecules for CD73 and Uses thereof | |
| IL293119A (en) | Methods for treating cancer by anti-oxo40 antibodies in combination with anti-pd1 or anti-pdl1 antibodies | |
| TW202243691A (en) | Methods of cancer treatment using anti-tigit antibodies in combination with anti-pd1 antibodies | |
| AU2019240200B2 (en) | Pharmaceutical combinations | |
| CN114728063B (en) | Cancer treatment with anti-OX40 antibodies and multikinase inhibitors | |
| CN114641500B (en) | Methods of treating cancer using a combination of an anti-OX 40 antibody and an anti-TIM 3 antibody | |
| RU2791192C2 (en) | Molecules of antibodies to cd73 and their application ways | |
| HK40074321A (en) | Methods of cancer treatment using anti-ox40 antibodies in combination with anti-tim3 antibodies | |
| HK40076999A (en) | Treatment of cancer with anti-ox40 antibodies and multi-kinase inhibitors | |
| HK1247848B (en) | Combined use of anti pd-1 and anti m-csf antibodies in the treatment of cancer |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 16750496 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 256775 Country of ref document: IL |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 12018500097 Country of ref document: PH |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 15877436 Country of ref document: US |
|
| ENP | Entry into the national phase |
Ref document number: 2993908 Country of ref document: CA Ref document number: 2018504285 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2018/001268 Country of ref document: MX |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2016298823 Country of ref document: AU Date of ref document: 20160727 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 20187005362 Country of ref document: KR Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2018105846 Country of ref document: RU Ref document number: 2016750496 Country of ref document: EP |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112018001640 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 112018001640 Country of ref document: BR Kind code of ref document: A2 Effective date: 20180125 |









