WO2017017012A1 - Novel trypsin isoforms and their use - Google Patents

Novel trypsin isoforms and their use Download PDF

Info

Publication number
WO2017017012A1
WO2017017012A1 PCT/EP2016/067531 EP2016067531W WO2017017012A1 WO 2017017012 A1 WO2017017012 A1 WO 2017017012A1 EP 2016067531 W EP2016067531 W EP 2016067531W WO 2017017012 A1 WO2017017012 A1 WO 2017017012A1
Authority
WO
WIPO (PCT)
Prior art keywords
trypsin
isoforms
amino acid
cod
seq
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2016/067531
Other languages
French (fr)
Inventor
Agusta GUDMUNDSDOTTIR
Asgeir Asgeirsson
Bjarki STEFANSSON
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Zymetech Ehf
Original Assignee
Zymetech Ehf
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Family has litigation
First worldwide family litigation filed litigation Critical https://patents.darts-ip.com/?family=53758073&utm_source=google_patent&utm_medium=platform_link&utm_campaign=public_patent_search&patent=WO2017017012(A1) "Global patent litigation dataset” by Darts-ip is licensed under a Creative Commons Attribution 4.0 International License.
Priority to DK16745663.1T priority Critical patent/DK3325618T3/en
Priority to BR112018001404-4A priority patent/BR112018001404A2/en
Priority to CN202111184339.8A priority patent/CN113846079B/en
Priority to KR1020187004156A priority patent/KR20180032588A/en
Priority to RU2018106533A priority patent/RU2739945C2/en
Priority to EP20169710.9A priority patent/EP3736331A1/en
Application filed by Zymetech Ehf filed Critical Zymetech Ehf
Priority to RS20201012A priority patent/RS60711B1/en
Priority to MX2018000570A priority patent/MX390126B/en
Priority to AU2016299760A priority patent/AU2016299760B2/en
Priority to HRP20201290TT priority patent/HRP20201290T1/en
Priority to PL16745663T priority patent/PL3325618T3/en
Priority to EP16745663.1A priority patent/EP3325618B1/en
Priority to US15/746,897 priority patent/US11179311B2/en
Priority to SI201630894T priority patent/SI3325618T1/en
Priority to CA2992821A priority patent/CA2992821A1/en
Priority to ES16745663T priority patent/ES2813551T3/en
Priority to JP2018522869A priority patent/JP6869979B2/en
Priority to CN201680042929.8A priority patent/CN107849551B/en
Publication of WO2017017012A1 publication Critical patent/WO2017017012A1/en
Priority to DKPA201870049A priority patent/DK180405B1/en
Anticipated expiration legal-status Critical
Priority to US17/502,921 priority patent/US11918674B2/en
Ceased legal-status Critical Current

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14—Hydrolases (3)
    • C12N9/48—Hydrolases (3) acting on peptide bonds (3.4)
    • C12N9/50—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25)
    • C12N9/64—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from animal tissue
    • C12N9/6402—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from animal tissue from non-mammals
    • C12N9/6405—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from animal tissue from non-mammals not being snakes
    • C12N9/6408—Serine endopeptidases (3.4.21)
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14—Hydrolases (3)
    • C12N9/48—Hydrolases (3) acting on peptide bonds (3.4)
    • C12N9/50—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25)
    • C12N9/64—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from animal tissue
    • C12N9/6421—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from animal tissue from mammals
    • C12N9/6424—Serine endopeptidases (3.4.21)
    • C12N9/6427—Chymotrypsins (3.4.21.1; 3.4.21.2); Trypsin (3.4.21.4)
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/1703—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • A61K38/1706—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from fish
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/43—Enzymes; Proenzymes; Derivatives thereof
    • A61K38/46—Hydrolases (3)
    • A61K38/48—Hydrolases (3) acting on peptide bonds (3.4)
    • A61K38/482—Serine endopeptidases (3.4.21)
    • A61K38/4826—Trypsin (3.4.21.4) Chymotrypsin (3.4.21.1)
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/06—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
    • A61K47/08—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite containing oxygen, e.g. ethers, acetals, ketones, quinones, aldehydes, peroxides
    • A61K47/10—Alcohols; Phenols; Salts thereof, e.g. glycerol; Polyethylene glycols [PEG]; Poloxamers; PEG/POE alkyl ethers
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K8/00—Cosmetics or similar toiletry preparations
    • A61K8/18—Cosmetics or similar toiletry preparations characterised by the composition
    • A61K8/30—Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds
    • A61K8/33—Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds containing oxygen
    • A61K8/34—Alcohols
    • A61K8/345—Alcohols containing more than one hydroxy group
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K8/00—Cosmetics or similar toiletry preparations
    • A61K8/18—Cosmetics or similar toiletry preparations characterised by the composition
    • A61K8/30—Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds
    • A61K8/64—Proteins; Peptides; Derivatives or degradation products thereof
    • A61K8/66—Enzymes
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00—Drugs for disorders of the respiratory system
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00—Drugs for dermatological disorders
    • A61P17/02—Drugs for dermatological disorders for treating wounds, ulcers, burns, scars, keloids, or the like
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00—Drugs for dermatological disorders
    • A61P17/04—Antipruritics
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00—Drugs for dermatological disorders
    • A61P17/06—Antipsoriatics
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00—Drugs for dermatological disorders
    • A61P17/12—Keratolytics, e.g. wart or anti-corn preparations
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00—Drugs for skeletal disorders
    • A61P19/02—Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P21/00—Drugs for disorders of the muscular or neuromuscular system
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00—Drugs for disorders of the nervous system
    • A61P25/04—Centrally acting analgesics, e.g. opioids
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/04—Antibacterial agents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/10—Antimycotics
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12—Antivirals
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12—Antivirals
    • A61P31/14—Antivirals for RNA viruses
    • A61P31/16—Antivirals for RNA viruses for influenza or rhinoviruses
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P33/00—Antiparasitic agents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P33/00—Antiparasitic agents
    • A61P33/02—Antiprotozoals, e.g. for leishmaniasis, trichomoniasis, toxoplasmosis
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00—Drugs for immunological or allergic disorders
    • A61P37/02—Immunomodulators
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00—Drugs for immunological or allergic disorders
    • A61P37/02—Immunomodulators
    • A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00—Drugs for disorders of the cardiovascular system
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61Q—SPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
    • A61Q19/00—Preparations for care of the skin
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12Y—ENZYMES
    • C12Y304/00—Hydrolases acting on peptide bonds, i.e. peptidases (3.4)
    • C12Y304/21—Serine endopeptidases (3.4.21)
    • C12Y304/21004—Trypsin (3.4.21.4)

Definitions

  • the present invention relates to the novel trypsin ZT isoforms.
  • the invention relates to the use of trypsin ZT isoforms in medical devices, pharmaceuticals and cosmetics.
  • Proteinases are enzymes that are defined by their ability to cleave proteins.
  • Proteinases can cleave substrates at different amino residues within a protein sequence demonstrating a difference in substrate specificity. Trypsins are proteinases and are partly specified by their preference in cleaving C-terminal to arginine or lysine residues (Olsen, Ong et al., 2004, Mol Cell Proteomics 3: 608-614).
  • the Multiplex Substrate Profiling method reveals cleavage sites of proteinases and discloses the critical importance of residues surrounding their cleavage site for their specificity (O'Donoghue, Eroy-Reveles et al., 2012, Nat Methods 9: 1095-1 100).
  • WO 96/24371 discloses the use of a krill-derived multifunctional proteolytic enzyme and a family of crustacean and fish derived proteolytic enzymes having structural similarity to the multifunctional enzyme derived from Antarctic krill.
  • the document also relates to methods of purifying the multifunctional enzyme and to pharmaceutical, cosmetic and other uses of the multifunctional enzyme.
  • Structural similarity to the multifunctional enzyme derived from Antarctic krill is defined in that document as at least 70% homology with the krill derived multifunctional hydrolase.
  • WO 2000078332 discloses the use of cod derived trypsins and chymotrypsins in pharmaceutical compositions or medicaments for local and topical application to treat internal diseases and disorders and cosmetic use of such enzymes. The topical use for treating local, internal disorders, without the enzyme having to penetrate through open wounds or mucous tissue, was found to be effective.
  • the serine proteinases disclosed in WO 2000078332 are proteinases that have at least 90% amino acid sequence homology with trypsin I, trypsin II, trypsin III, trypsin IV derived from Atlantic cod and proteinases that are chymotrypsin having at least 90% amino acid sequence homology with any of chymotrypsin A and chymotrypsin B isolated from Atlantic cod.
  • a complementary DNA (cDNA) encoding trypsin Y was isolated from an Atlantic cod cDNA library (Spilliaert and Gudmundsdottir, 1999, Mar Biotechnol (NY) 1 : 598-607). Cod trypsin Y has approximately 45% identity to the two Atlantic cod trypsin I and X (WO
  • the present invention provides novel trypsin isoforms, called trypsin ZT isoforms. Such isoforms are derivable from fish, such as the Atlantic cod, or derivable in recombinant form using protein expression systems.
  • the present invention further provides compositions comprising at least one isolated cod trypsin ZT isoform according to the invention, together with suitable excipients and carriers.
  • the inventors have identified unexpected, beneficial and unique characteristics of the novel trypsin ZT isoforms over trypsins known previously. These characteristics provide an advantage in using trypsin ZT isoforms for various applications in medical devices, pharmaceuticals and cosmetics.
  • the present invention provides said trypsin ZT isoforms per se and for use in treating or preventing diseases caused by pathogenic organisms. This is particularly relevant for use in treating or preventing a disease in the upper respiratory tract caused by pathogenic microorganisms.
  • trypsin ZT isoforms can for example be used in medical devices or as active ingredient(s) in a pharmaceutical.
  • the present invention provides said trypsin ZT isoforms for use in the treatment of wound infections and wounds from burns, for use in removing dead or peeling skin from otherwise healthy skin for example in a medical device, as a pharmaceutical or as a cosmetic.
  • the present invention further provides methods of preparing cod trypsin ZT isoforms of the present invention.
  • trypsin ZT isoforms prefer cleavage at Arg
  • Trypsin I prefers cleavage at Lys residues compared to trypsin ZT isoforms.
  • Arginine and lysine rich amino acid sequences are frequently found in viral-, bacterial- and parasite sequences that are associated with infection.
  • trypsin ZT isoforms are much better adapted to cleave peptides containing several consecutive basic amino acid residues (Arg and Lys) compared to trypsin I. Based on the data, trypsin ZT isoforms can act as antimicrobial agenst against viruses and bacteria as they can cleave at clustered basic amino acid residues such as lysine and arginine.
  • the present invention provides novel trypsin isoforms, called trypsin ZT isoforms.
  • Such isoforms are derivable from fish, such as the Atlantic cod, or derivable in recombinant form using protein expression systems.
  • the present invention relates to using such trypsin ZT isoforms for treatment and prevention of disease and to the cosmetic field.
  • the invention relates to novel Atlantic cod trypsin ZT isoforms, useful as pharmaceuticals, in medical devices, and cosmetics.
  • FIG1 shows isolation of trypsin ZT isoforms with anion exchange chromatography. Chromatogram from a MonoQ separation of benzamidine purified cod trypsin isoforms showing absorbance at 280 nm vs. elution volume. Cod trypsin isoforms were loaded on a MonoQ column and proteins eluted with a salt gradient (dotted line). Arrow shows the peak containing trypsin ZT isoforms.
  • the column was equilibrated with a buffer (20 mM Tris, 10 mM CaCI 2 , pH 8.0), and the enzymes were eluted with a linear 0-150 mM NaCI gradient in 40 column volumes, linear 150-620 mM NaCI in 6 column volumes, 620-850 mM NaCI in 10 column volumes at a flow rate of 1 mL/min.
  • FIG 2 shows SDS-PAGE of cod trypsin ZT isoforms.
  • Trypsin 1 , trypsin 5 and trypsin 7 are purified and isolated cod trypsin X isoforms.
  • Cod trypsin X is closely related to cod trypsin I, differ by about eight amino acid residues.
  • the proteins were resolved by SDS- PAGE and the gel silver stained. The bars and numbers on the left show the migration and molecular weight in kDa of standard proteins (Dalton Mark Vll-L) separated on the gel.
  • FIG 3 shows Western blot analysis of cod trypsin X (trypsin 1 , trypsin 5 and trypsin 7) and trypsin ZT isoforms. Cod trypsin X and trypsin ZT isoforms were subjected to SDS- PAGE. Following transfer, samples were immunoblotted with trypsin l/X (top panel) and trypsin ZT isoform (bottom panel) reacting antibodies. This shows that trypsin ZT isoforms were separated from trypsin l/X using anion exchange.
  • the polyclonal antibody that reacts against trypsin ZT isoforms does not cross-react with trypsin l/X and the peptide antibody raised against trypsin l/X does not cross-react with trypsin ZT isoforms.
  • FIG 4 shows a Venn diagram illustrating shared and unique cleavages generated by trypsin ZT and trypsin I at three different time points in a multiplex substrate profiling analysis.
  • the figure shows that at all time points there are shared cleavage sites and unique cleavage sites for trypsin ZT and trypsin I in the 124 defined peptides (each containing 14 amino acid residues) within the library.
  • the data demonstrates that the substrate specificity of trypsin ZT is different from that of trypsin I.
  • FIG 5 shows antiviral activity of trypsin ZT against enterovirus (Coxsackievirus B2).
  • the Y axis shows the percentage of wells infected compared to control and the X axis shows control (left bar) and treatment with trypsin ZT isoforms (right bar).
  • trypsin ZT isoforms The inventors have identified novel trypsin isoforms termed trypsin ZT isoforms.
  • Trypsin ZT includes at least the following isoforms: Atlantic cod trypsin ZT-1 isoform, Atlantic cod trypsin ZT-2 isoform, Atlantic cod trypsin ZT-3 isoform and Atlantic cod trypsin ZT-4 isoform. All four Atlantic cod trypsin ZT isoforms have a similar molecular mass of about 25 kDa.
  • the Atlantic cod trypsin ZT isoforms of the present invention are represented by the following amino acid sequences: SEQ ID NO:1
  • Xi is selected from I and V;
  • X 2 is selected from Q and H;
  • X 3 is selected from D and E;
  • X 4 is selected from R and N;
  • X 5 is L
  • X 6 is selected from T and P;
  • X 7 is selected from D and A;
  • X 8 is selected from E and Q;
  • X 9 is selected from A and S;
  • X 10 is selected from V and M;
  • X11 is selected from A and V;
  • X 12 is selected from Y and F;
  • Xi 3 is selected from A and V;
  • Xi4 is selected from Q and R;
  • Xi 5 is selected from L and E;
  • X16 is selected from Yand S;
  • X 17 is selected from Y and F.
  • SEQ ID NO:2 The Atlantic cod trypsin ZT-1 isoform IVGGHECEPNSRPFMASLNYGYHFCGGVLINDQWVLSVAHCWYNPYYMQVMLGEHDLRV FEGTEQLVKTNTIFWHELYDYQTLDYDMMMIKLYHPVEVTQSVAPISLPTGPPDGGMLCSV SGWGNMAMGEEVNLPTRLQCLDVPIVEPVACQASYPGMISPRMMCVGFMDGGRDVCNG DS GSPLVCEGVLTGLVSWGRGC AEPNSPGVYVKVYEFLSWIQTTLDANP
  • Trypsin ZT isoforms of the present invention have less than 50% amino acid identity with the trypsins disclosed in WO 2000078332 and less than 45% homology with the chymotrypsins disclosed in WO 2000078332.
  • the above trypsin ZT isoforms represents the active variants of these trypsins, i.e. variants that have been activated when the N terminus of the trypsins have been cleaved off.
  • These trypsins are proteins expressed in the pyloric caeca (pancreatic tissue in fish) with a number of amino acids on the N terminal end that are important for secretion out of the cells and for keeping the enzyme inactive.
  • the full length trypsin ZT isoforms are also disclosed herein as
  • Proteinases can cleave substrates at different amino residues within a peptide sequence demonstrating a difference in substrate specificity. Trypsins are specified by their preference in cleaving C-terminal to arginine or lysine residues. Unexpectedly, multiplex substrate profiling on trypsin ZT isoforms revealed that amino acids surrounding arginine or lysine in a substrate have a different effect on its cleavage compared to trypsin I.
  • trypsin ZT isoforms or trypsin I were incubated (5, 15 and 60 min.) with a library of peptides (124 defined peptides, 14-mer sequences, total of 1612 peptide bonds) with an extensive physiochemical diversity (O'Donoghue, Eroy-Reveles et al., 2012, Nat Methods 9: 1095- 1 100). After incubation, cleavage sites were identified by mass spectrometry analysis. The results are presented in the following examples and show that there are numerous cleavage sites unique to trypsin ZT compared trypsin I.
  • Trypsin ZT isoforms have specific antimicrobial properties. Based on the values generated and presented in the examples, it can be seen that trypsin ZT isoforms are much better adapted in cleaving peptides containing several consecutive positively charged residues (arginine or lysine) compared to trypsin I. Those types of sequences (lysine and arginine rich amino acid sequence) are frequently found in viral proteins (Suzuki, Orba et al., 2010, PLoS Pathog 6: e1000801 , Jiang, Cun et al., 2012, J Virol 86: 7256-7267, Gallaher and Garry, 2015, Viruses 7: 285-305).
  • Viroporins is a group of proteins that interact with plasma membranes modifying permeability and can promote the release of viral particles. Clustered lysine and/or arginine residues are important for the activity of viroporins. Based on the multiplex substrate profiling analysis, trypsin ZT isoforms can act as antiviral agents against RNA viruses as it can cleave these clustered basic amino acid residues . Viroporins have been described as present in a number of virus families, including the Flaviviridae, Picornaviridae, Retroviridae,
  • Viruses that contain lysine and arginine rich viroporins that would be a target for trypsin ZT isoforms include human immunodeficiency virus (HIV), rotavirus, Ebola, Reston virus (RESTV), Lloviu virus (LLOV), Sudan virus (SUDV), Bundibugyo (BDBV), Tai Forest virus (TAFV) (Suzuki, Orba et al., 2010, PLoS Pathog 6: e1000801 , Gallaher and Garry, 2015, Viruses 7: 285-305).
  • the viroporins are found in a wide variety of DNA and RNA viruses such as
  • Paramecium bursaria chlorella virus 1 simian virus 40 (SV40), human polyoma JC (JCV), severe acute respiratory syndrome coronavirus (SARS-CoV) (Kang, Moroni et al., 2004, Proc Natl Acad Sci U S A 101 : 5318-5324, Liao, Tarn et al., 2006, Adv Exp Med Biol 581 : 199- 202, Daniels, Sadowicz et al., 2007, PLoS Pathog 3: e98).
  • SV40 simian virus 40
  • JCV human polyoma JC
  • SARS-CoV severe acute respiratory syndrome coronavirus
  • agnoproteins Highly basic viral proteins, termed agnoproteins, have recently have been identified from DNA viruses such as from the Polyomaviridae and Papillomaviridae family (Royle, Dobson et al., 2015, Viruses 7: 5375-5387). These proteins show a number of viroporin characteristics. conserveed sequences have been identified in agnoproteins that contain a number of clustered basic amino acid residues (Royle, Dobson et al., 2015, Viruses 7: 5375- 5387).
  • trypsin ZT isoforms can act as antiviral agents against DNA viruses as it can cleave these clustered basic amino acid residues (Royle, Dobson et al., 2015, Viruses 7: 5375-5387).
  • viruses and bacteria have developed mechanisms to gain cell entry using cell penetrating peptides or proteins (Milletti, 2012, Drug Discov Today 17: 850-860).
  • the viruses include pestiviruses of the Flaviviridae family, herpes virus (HSV-1 ), human
  • HIV-1 immunodeficiency virus
  • RSV human respiratory syncytial virus
  • BLAST Basic Local Alignment Search Tool
  • the Haemophilus genus includes viruses such as the respiratory syncytial virus (RSV) and human parainfluenza viruses and viruses that cause mumps and measles.
  • the Coronaviridae family includes viruses that cause Severe Acute Respiratory Syndrome (SARS).
  • the Haemophilus genus of bacteria includes Haemophilus parainfluenzae that is associated with endocarditis, meningitis, and bacteremia.
  • the Plasmodium genus includes Plasmodium falciparum that causes malaria.
  • medical device is meant, but not limited to, any instrument, apparatus, appliance, software, material or other article for the purpose of diagnosis, prevention, monitoring, treatment, or alleviation of disease, such as diagnosis, monitoring, treatment, alleviation of or compensation; for an injury or handicap, such as investigation, replacement or modification of the anatomy or of a physiological process; control of conception; including devices that do not achieve their principal intended action in or on the human body by pharmacological, immunological or metabolic means - but may be assisted in their function by such means.
  • the present invention relates to the novel trypsin ZT isoforms.
  • the invention describes unpredicted and unique protein cleaving properties of trypsin ZT isoforms that make it valuable in medical applications.
  • the invention relates to the novel Atlantic cod trypsin ZT isoforms, useful as pharmaceuticals, in medical devices, and cosmetics.
  • an isolated cod trypsin ZT isoform comprising an amino acid sequence according to SEQ ID NO:1 , or an amino acid sequence with 80% sequence homology or more, thereof. Typically, such sequence homology is 85, 90, 95 or 99% homologous to the amino acid sequence of SEQ ID NO:1.
  • an isolated cod trypsin ZT isoform selected from trypsin ZT-1 , comprising an amino acid sequence according to SEQ ID NO:2; trypsin ZT-2 comprising an amino acid sequence according to SEQ ID NO:3; trypsin ZT-3 comprising an amino acid sequence according to SEQ ID NO:4; and trypsin ZT-4, comprising an amino acid sequence according to SEQ ID NO:5, or an amino acid sequence with 80% sequence homology or more, thereof. Included are also amino acid sequences with 80% sequence homology or more, to amino acid sequences set out in SEQ ID NOS:2-5. Typically, such sequence homology is 85, 90, 95 or 99% homologous to the amino acid sequence of SEQ ID NOS:2-5.
  • a composition comprising at least one cod trypsin ZT isoform according to the invention, together with suitable excipients and carriers.
  • Said cod trypsin ZT isoform may be selected from cod trypsin ZT-1 , comprising an amino acid sequence according to SEQ ID NO:2; cod trypsin ZT-2 comprising an amino acid sequence according to SEQ ID NO:3; cod trypsin ZT-3 comprising an amino acid sequence according to SEQ ID NO:4; and cod trypsin ZT-4 comprising an amino acid sequence according to SEQ ID NO:5.
  • cod trypsin ZT-1 comprising an amino acid sequence according to SEQ ID NO:2
  • cod trypsin ZT-2 comprising an amino acid sequence according to SEQ ID NO:3
  • cod trypsin ZT-3 comprising an amino acid sequence according to SEQ ID NO:4
  • cod trypsin ZT-4 comprising an amino acid sequence according to SEQ ID NO:5.
  • Included are also amino acid sequences with 80%
  • said composition comprises said cod trypsin ZT isoforms present in admixture with other cod trypsins.
  • said cod trypsin ZT isoforms comprises at least 5% (w/w) of the total content of cod trypsins in said composition, such as at least 10, 15, 20, 25, 30, 35, 40, 45 or 50% or more (w/w) of the total content of cod trypsins in said
  • Said composition is typically administered topically, as a lotion, a hydrogel, a mouth spray or a nasal spray.
  • Said composition may further comprise a polyvalent alcohol, such as glycerol.
  • a polyvalent alcohol such as glycerol.
  • composition for use in treating or preventing a disease caused by a pathogenic organism selected from the group consisting of a virus, a bacterium, a fungus, a parasite and a protozoan.
  • composition for use in treating or preventing a disease in the upper respiratory tract caused by pathogenic organisms such as viruses, bacteria and fungus.
  • said composition for use in treating or preventing pain, acute inflammation, chronic inflammation, arthritis, inflamed joints, bursitis, osteoarthritis, rheumatoid arthritis, juvenile rheumatoid arthritis, septic arthritis, fibromyalgia, systemic lupus erythematosus, phlebitis, tendinitis, rash, psoriasis, acne, eczema, facial seborrheic eczema, eczema of the hands, face or neck, foreskin infections, athlete's foot, fistulae infections, infected topical ulcers, navel infections in newborns, wrinkles, scars, kelloids, boils, warts and allergic itch, hemorrhoids, a fungal infection and an immunological disorder including an autoimmune disease.
  • composition for use in the treatment of wound infections and wounds from burns.
  • composition for use in removing dead or peeling skin from otherwise healthy skin.
  • composition for cosmetic use Said composition may further comprise an additional cosmetically active compound.
  • a method of treating disease comprising administering a therapeutically effective amount of a composition according to the present invention, to a patient in need thereof.
  • said disease is caused by a pathogenic organism selected from the group consisting of a virus, a bacterium, a fungus, a parasite and a protozoan
  • said disease is a disease in the upper respiratory tract caused by pathogenic organisms such as viruses and bacteria.
  • said disease is selected from pain, acute
  • inflammation chronic inflammation, arthritis, inflamed joints, bursitis, osteoarthritis, rheumatoid arthritis, juvenile rheumatoid arthritis, septic arthritis, fibromyalgia, systemic lupus erythematosus, phlebitis, tendinitis, rash, psoriasis, acne, eczema, facial seborrheic eczema, eczema of the hands, face or neck, foreskin infections, athlete's foot, fistulae infections, infected topical ulcers, navel infections in newborns, wrinkles, scars, kelloids, boils, warts and allergic itch, hemorrhoids, a fungal infection and an immunological disorder including an autoimmune disease.
  • said disease is wound infections or wounds from burns.
  • an isolated cod trypsin ZT isoform selected from full length trypsin ZT-1 , comprising an amino acid sequence according to SEQ ID NO:19; full length trypsin ZT-2 comprising an amino acid sequence according to SEQ ID NO:20; full length trypsin ZT-3 comprising an amino acid sequence according to SEQ ID NO:21 ; and full length trypsin ZT-4, comprising an amino acid sequence according to SEQ ID NO:22.
  • a method of preparing cod trypsin ZT isoforms comprising an amino acid sequence according to any one of SEQ ID NO:2 to SEQ ID NO:5, comprising
  • said method further comprises at least one step using an anionic exchange resin after said affinity chromatography step (ii).
  • said cod trypsin ZT isoforms are selected from trypsin ZT-1 , comprising an amino acid sequence according to SEQ ID NO:2; trypsin ZT-2 comprising an amino acid sequence according to SEQ ID NO:3; trypsin ZT-3 comprising an amino acid sequence according to SEQ ID NO:4; and trypsin ZT-4 comprising an amino acid sequence according to SEQ ID NO:5, or a mixture thereof.
  • Cod viscera is typically used to purify and isolate trypsin ZT isoforms.
  • the inventors have identified novel methods described below, useful for a commercial scale production of trypsin ZT isoforms.
  • Extraction is conducted at a pH of 6-8 at a temperature below 10°C.
  • Cod viscera is mixed with water at a ratio (w/w) of 1 :6 to 1 :20.
  • the extract is separated from the leftover offal and further clarified by sedimentation and filtration. This is followed by microfiltration and ultrafiltration resulting a solution containing trypsin ZT isoforms that is used for chromatography separation that may include several steps.
  • An affinity chromatography is conducted, preferably by amino benzamidine affinity chromatography, to purify trypsin ZT isoforms. Trypsin ZT isoforms can then be further purified with anion exchange chromatography.
  • trypsin ZT isoforms or mixtures of purified cod trypsins containing trypsin ZT isoforms is in a preparation of hydrogel or lotion and water containing 0 to 90% (vol/vol) of a polyvalent alcohol (polyol) such as glycerol.
  • a suitable concentration of trypsin ZT isoforms constitutes at least 1 to 100 protein concentration ratio to other trypsin forms, preferably 5%, or higher (w/w) of the total content of cod trypsins.
  • the trypsin activity is 0.1 to 10,000 enzyme units of activity for CBZ-Gly-Pro-Arg-pNA (carbobenzoxy Gly-Pro- Arg-para nitroanilide) per 100 milliliters of the final hydrogel/lotion preparation.
  • the invention further provides (a) methods relating to certain conditions using effective amounts of the purified trypsin ZT isoforms described above, (b) compositions or substances for use in such methods, (c) pharmaceutical or medical device compositions containing effective amounts of trypsin ZT isoforms for use in such methods, and (d) uses of the enzyme or enzyme composition for manufacturing a medicament (pharmaceutical and medical devices) for use in such methods.
  • the methods are inter alia for:
  • dermatological conditions such as e.g. acne, rash, psoriasis or eczema, including facial seborrheic eczema or eczema of the hands, face, scalp or neck, hemorrhoids and the like, where preferably the amount of the trypsin ZT isoforms and other trypsins administered is a dermatological condition treating or preventing effective amount;
  • trypsin ZT isoforms with or without other trypsins are used for example in pressurized metered dose high efficiency inhaler in an effective dose for treatment;
  • treating sunburns where preferably the amount of trypsin ZT isoforms with or without other trypsins administered in a sufficient amount to promote healing
  • treating radiation burns where preferably the amount of trypsin ZT isoforms with or without other trypsins administered in a sufficient amount to promote healing
  • trypsin ZT isoforms with or without other trypsins is administered in a sufficient amount for effective treatment
  • cystic fibrosis cancer
  • a tumor treating effective amount or a tumor metastasis preventing or inhibiting amount of trypsin ZT isoforms
  • atherosclerosis asthma
  • septic shock toxic shock syndrome
  • tissue adhesions such as tendon-sheath
  • abdominal post-surgical or joint adhesions reperfusion injury
  • malaria immune disorder
  • immune disorder such as an autoimmune disease, apoptosis, colitis and enteritis, such as Crohn's disease, where preferably the amount of trypsin ZT isoforms and related peptidases administered are effective
  • trypsin ZT isoforms and related peptidases administered are effective
  • a microbial infection e.g. a viral infection such as a rhinovirus (RV), respiratory syncytial virus (RSV), influenza, herpes virus infection (e.g. HSV-1 , HSV-2, herpes zoster or genital herpes infection), HIV, hepatitis, coronavirus, cytomegalovirus or papilloma virus infection; an infection causing a gastrointestinal disease such as ulcer or diarrhoea; a fungal infection such as systemic, skin, oral, vaginal or esophageal fungal infection, including e.g.
  • a viral infection such as a rhinovirus (RV), respiratory syncytial virus (RSV), influenza, herpes virus infection (e.g. HSV-1 , HSV-2, herpes zoster or genital herpes infection), HIV, hepatitis, coronavirus, cytomegalovirus or papilloma virus infection; an infection causing
  • yeast infection including a fungal nail infection and Candida infections
  • microbial infections of the eye preferably treated with ocular administrations
  • bacterial infections including infection by Helicobacter pylori, Staphylococcus spp., Methicillin-resistant Staphylococcus aureus (MRSA), Streptococcus pneumonia, Haemophilus influenza, Streptococcus mitis, Streptococcus spp., Klebsiella spp., Pseudomonas spp., Neisseria gonorrheae, Haemophilus spp., Chlamydia spp., syphilis and E.
  • MRSA Methicillin-resistant Staphylococcus aureus
  • Streptococcus pneumonia Haemophilus influenza
  • Streptococcus mitis Streptococcus spp.
  • Klebsiella spp. Pseudomonas spp.
  • the administered amount of the cod trypsins is a microbial infection-treating or -preventing effective amount or has inhibitory activity against cell-cell or cell-virus adhesion;
  • removing dental plaque where preferably the amount of trypsin ZT isoforms with or without other trypsins is administered in a dental plaque removing effective amount; and lysing blood clots, where preferably the amount of trypsin ZT isoforms is a clot lysing effective amount.
  • the method comprises administering a composition comprising the trypsin ZT isoforms as described above.
  • the invention provides topical cosmetic and medical compositions comprising trypsin ZT isoforms described above; and gel, cream or suppository composition.
  • the invention further provides a method of inhibiting or prophylactically preventing the transmission of a pathogenic microbe by administering trypsin ZT isoforms with or without other trypsins.
  • trypsin ZT with or without other trypsins is applied to the portion of the body that comprises the primary transmission entryway for the microbe in question.
  • a spray, ointment or wash is applied to a body orifice involved in sexual activity, for instance, to prevent HIV or hepatitis transmission.
  • trypsin ZT isoforms or related peptidases is applied to the upper airways, for example, via an aerosol, to inhibit or prevent the transmission of a common cold virus, such as a rhinovirus or a coronavirus.
  • a common cold virus such as a rhinovirus or a coronavirus.
  • appropriate routes of administration include systemic administration.
  • vaginal infections associated with shock vaginal flushes, creams, gels or suppositories may be used as a method of administration.
  • administration would include without limitation creams, gels or suppositories, in particular but not limited to hydrogels containing glycerol or other polyols.
  • a fungal infection such as systemic, skin, oral, vaginal or esophageal fungal, including for example, yeast infection, including a fungal nail infection and Candida infections and immune disorders including autoimmune diseases by
  • trypsin ZT isoforms with or without other trypsins
  • appropriate routes of administration would include creams, gels or suppositories, in particular but not limited to hydrogels containing glycerol or other polyols.
  • the above objectives are achieved by using a composition containing an effective amount of trypsin ZT isoforms with or without other trypsins which is capable of relieving the pain, inflammation, arthritis, swelling, edema, psoriasis eczema, dermatitis, rash and/or other symptoms of the diseases mentioned in the introductory part. Trypsin ZT isoforms can be obtained at a high yield and in a relatively simple manner from cod viscera.
  • trypsin ZT isoforms can be purified on a commercial scale in a relatively straightforward manner with reasonable yields. Trypsin ZT isoforms without or along with other Atlantic serine proteases can be used for the purpose of the invention.
  • Trypsin ZT isoforms presented in the present disclosure can be desorbed from the affinity matrix by applying conditions that will destabilize the interaction between the enzyme and the affinity ligand. Such conditions include high salt followed by low pH, preferably in 30% or more glycerol. The column eluent is allowed to flow into a neutralizing buffer to stabilize the cod trypsin after the acid elution step. Trypsin ZT isoforms can then be further purified using anion exchange and eluted with increasing salt concentration. By these methods trypsin ZT isoforms with a purity in excess of about 90% can be isolated. The cod trypsin fraction thus obtained contains 2-3 major isoforms as manifested by SDS
  • Trypsin ZT isoforms with or without other trypsins in specific formulations can be used as a pharmaceutical, in medical devices (such as chemical formulations) or in cosmetics depending on intended use.
  • Trypsin ZT isoforms (with or without other trypsins) of the invention are administered topically, orally, rectally, vaginally, by instillation (for instance into the urinary tract or into fistulas), by the pulmonary route e.g. by use of an aerosol (for example by using a pressurized metered-dose inhaler (pMDI)), by application of drops to the eye, or systemically, such as parenterally, including, for example,
  • pMDI pressurized metered-dose inhaler
  • Trypsin ZT isoforms are administered in solution or combined with a pharmaceutically acceptable carrier or excipient according to standard pharmaceutical practice.
  • a pharmaceutically acceptable carrier or excipient for the oral mode
  • trypsin ZT isoforms are used in the form of tablets, capsules, lozenges, chewing gum, troches, powders, syrups, elixirs, aqueous solutions and suspensions, and the like.
  • sterile solutions of trypsin ZT isoforms are usually prepared, and the pH values of the solutions are suitably adjusted and buffered.
  • the total concentration of solutes should be controlled to render the preparation isotonic.
  • ointments or droppable liquids may be delivered by ocular delivery systems known to the art such as applicators or eye droppers.
  • trypsin ZT isoforms are typically administered in a hydrogel, containing 0 to 85% glycerol, such as about 20% to 30% glycerol and possibly up to 85 % glycerol.
  • a suitable dose of trypsin ZT isoforms with or without other trypsins per application ranges from about 0.01 ⁇ g cm 2 to about 1 mg/cm 2 , preferably from about 0.1 ⁇ g cm 2 to about 0.01 mg/cm 2 (using e.g. about 0.01 mg/ml enzyme gel).
  • dosages will generally be selected to maintain a serum level of trypsin ZT isoforms with or without other trypsins between about 0.1 mg/100 ml and about 100 mg/100ml, preferably between about 0.5 mg/100 ml and about 2.0 mg/100 ml.
  • preferably from about 0.1 mg/kg to about 10 mg/kg, more preferably about 1 mg/kg will be used.
  • suitable flushing/instillation solutions of trypsin ZT isoforms will generally have concentrations from about 1 ⁇ g/ml to about 15 mg/ml, preferably from about 100 ⁇ g/ml to about 3 mg/ml.
  • the enzyme composition will generally be applied from about 1 to about 10 times per day, preferably from about 2 to about 5 times per day.
  • trypsin ZT isoforms with or without other trypsins are preferably applied more often than simply at the time at which the wound is first dressed.
  • trypsin ZT isoforms are applied at least about every time the wound dressing is changed.
  • Trypsin ZT isoforms can also be applied at least about every other day, more preferably, every day, or few times per day.
  • a trypsin ZT isoform (with or without other trypsins) hydrogel is preferably applied every day, more preferably twice per day.
  • trypsin ZT isoforms are preferably applied every day more preferably twice every day.
  • Percent Identity was calculated using ClustalW2 (version Clustal2.1 ) when making sequence comparisons (EMBL-EBI website http://www.ebi.ac.uk/Tools/msa/clustalw2/ date 4th of May 2015).
  • CM carboxymethyl
  • GE healthcare carboxymethyl fast flow cation exchange resin
  • p-aminobenzamidine affinity ligand coupled to a sepharose resin
  • the CM and p-aminobenzamidine columns were pre-equilibrated with about 10 column volumes of 25 mM Tris buffer of pH 7.8, containing 2.5 mM calcium chloride (buffer A).
  • the concentrate was pumped onto the CM and p-aminobenzamidine columns at a flow rate of about 100 ml per minute.
  • the purified cod trypsin ZT isoform-containing preparation was homogeneous by SDS PAGE electrophoresis.
  • the purified preparation was filter-sterilized through a 0.22 micron filter and stored frozen at about -20°C.
  • the cod trypsin ZT isoform-containing preparation was filter-sterilized through a 0.22 micron filter and stored frozen at about -20°C.
  • the cod trypsin ZT isoform-containing preparation was applied to an anion exchange chromatography column (MonoQ) and proteins eluted with a salt gradient (FIG 1 ).
  • the column was equilibrated with a buffer (20 mM Tris, 10 mM CaCI 2 , pH 8.0), and the enzymes were eluted with a linear 0-150 mM NaCI gradient in 40 column volumes, linear 150-620 mM NaCI in 6 column volumes, 620-850 mM NaCI in 10 column volumes at a flow rate of 1 mL/min.
  • the proteins in the peak labeled trypsin ZT from FIG 1 were subjected to SDS-PAGE analysis (FIG 2).
  • the protein band on the gel from the trypsin ZT peak was excised from the gel and analyzed using Matrix-Assisted Laser Desorption/lonization Time-of-Flight Mass
  • MS mass spectrometry
  • CVLSGWVRDTMA (-COOH)) (SEQ ID NO: 23) corresponding to residues 228-239 at the extreme C terminus of cod trypsin I and cod trypsin X.
  • the antibodies were affinity purified from rabbit serum using the peptide coupled to a gel bead support.
  • Polyclonal antibodies against trypsin ZT isoforms were made in mouse ascitic fluid as described in Overkamp et al. (Overkamp, Mohammed-Ali et al., 1988, J Immunoassay 9: 51 -68).
  • a purified form of recombinant trypsin ZT-4 was injected intraperitoneally (i.p.) into Balb/C2 mice.
  • mice were sacrificed on day 34 and ascitic fluid collected.
  • the respective antibodies were used in Western blot analysis.
  • Western blot analysis was performed on the proteins in the peak labeled trypsin ZT from FIG 1 (FIG 3). Trypsin ZT isoform antibody reacted against the proteins from the peak labeled trypsin ZT whereas an antibody against trypsin I and trypsin X did not (FIG 3).
  • Table 1 shows peptide masses obtained from MS analysis on protein band from SDS-
  • Table 2 shows peptide masses obtained from MS analysis on protein band from SDS- PAGE gel in Figure 2 (guanidilated sample), see column 1 Mr (expt). Mr stands for relative molecular mass in Da.
  • Columns 2, 3 and 4 show the calculated values (for masses matching to masses in column 1 ) from an in silico trypsin digest of the amino acid sequences of trypsin ZT-1 , trypsin ZT-2, trypsin ZT-3 and trypsin ZT-4.
  • Column 5 shows the sequence of the peptide that give the mass value from the in silico digest.
  • Column 6 shows modifications of the different peptides based on the in silico digest.
  • Proteinases can cleave substrates at different amino residues within a peptide sequence demonstrating a difference in substrate specificity. Trypsins are specified by their preference in cleaving C-terminal to arginine or lysine residues.
  • the cod trypsin isoenzymes were separated by applying benzamidine purified cod trypsin to a MonoQ HR 5/5 ion exchange column.
  • trypsin I the column was equilibrated with 20 mM Tris, 5 mM ethanolamine, 10 mM CaCI 2 , pH 9.1 , and the enzymes were eluted with a linear 0-200 mM NaCI gradient in 80 column volumes, linear 200-1000 mM NaCI gradient in 10 column volumes at a flow rate of 1 mL/min.
  • the sample pH was adjusted to pH 9.1 with 1 M NaOH before application.
  • the column was equilibrated with 25 mM Tris, 25 mM CaCI 2 ,15% (vol/vol) glycerol, pH 7.5, and the enzymes were eluted with a linear 0-150 mM NaCI gradient in 5 column volumes, linear 150-550 mM NaCI gradient in 20 column volumes, linear 500-1000 mM NaCI gradient in 1 column volume at a flow rate of 1 mL/min.
  • composition of both enzyme samples was adjusted so the final concentration of Tris was 60 mM, CaCI 2 30 mM and glycerol 15% (vol/vol) with a pH of 8.5.
  • the purified trypsin ZT isoforms or trypsin I were incubated (5, 15 and 60 min.) with a library of peptides (124 defined peptides, 14-mer sequences, total of 1612 peptide bonds) with an extensive physiochemical diversity as described in O'Donoghue, Eroy-Reveles et al. (O'Donoghue, Eroy-Reveles et al., 2012, Nat Methods 9: 1095-1 100). After incubation, cleavage sites were identified by mass spectrometry analysis (O'Donoghue, Eroy-Reveles et al., 2012, Nat Methods 9: 1095-1 100).
  • the multiplex substrate profiling analysis unexpectedly showed that there are numerous cleavage sites unique to trypsin ZT isoforms compared trypsin I, disclosed in WO 2000078332 (FIG 4 and Table 4). Also, cleavage sites that showed preferential cleavage by trypsin ZT isoforms compared to trypsin I were identified (Table 4). Based on the results from the multiplex substrate profiling analysis, a table containing numerical values based on standard scores (Z-score) ratio at the P4-P4' positions in the substrate was generated where the substrate specificity of trypsin ZT was compared to trypsin I (Table 3).
  • Z- score Positive values reflect a preference for the amino acid residue in a certain P position in favor of trypsin ZT isoforms compared to trypsin I.
  • multiplex substrate profiling on trypsin ZT isoforms revealed that amino acids surrounding arginine or lysine in a substrate have a different effect on its cleavage compared to trypsin I.
  • Table 3 shows numerical values based on standard scores (Z-score) ratio at the P4-P4' positions in the substrate comparing the substrate specificity of trypsin ZT and trypsin I after incubation for 5, 15 and 60 min.
  • Amino acid residues in a substrate undergoing cleavage were designated P1 ,P2, P3, P4 in the N-terminal direction from the cleaved bond (Schechter and Berger, 1967, Biochem Biophys Res Commun 27: 157-162, Schechter and Berger, 1968, Biochem Biophys Res Commun 32: 898-902).
  • the residues in C-terminal direction are designated P1 ', ⁇ 2', ⁇ 3', P4'.
  • the P positions are provided in the columns and the rows show amino acids in the different P positions.
  • Positive values (Z-score) in the table reflect a preference for the amino acid residue in a certain P position in favor of trypsin ZT isoforms compared to trypsin I.
  • Negative values (Z-score) reflect a preference in favor of trypsin I compared trypsin ZT. For example, based on the values from Table 3 it can be seen that trypsin ZT is much better adapted in cleaving peptides containing several consecutive positively charged residues (arginine or lysine) compared to trypsin I.
  • Table 4 shows precursor ion intensities of selected peptides from multiplex profiling after incubation with trypsin ZT or with trypsin I.
  • the precursor ion intensities are peptide peak intensities in the MS before fragmentation that represent a measure of relative abundance for a given species.
  • X in peptide sequence denotes a placeholder for the absence of an amino acid in a peptide sequence.
  • the data shows that trypsin ZT isoforms are exclusively able to cleave three peptide sequences (QGKKAPXX, WGNRSPLE and QAVRPNGM) compared to trypsin I.
  • trypsin ZT isoforms preferentially cleave two peptides compared to trypsin I. Trypsin ZT isoforms were able to cleave XIARQPWN within 5 minutes and FDNRVGKW within 15 minutes whereas cleavage within these two peptides was only detected with trypsin I after 60 minute incubation.
  • Example 2 About 12 liters of ultrafiltered and diafiltered concentrate as obtained in Example 1 was applied to a continuous connected series of about 1 liter packed chromatography columns, the first containing a CM fast flow cation exchange resin (GE healthcare), the second one a p-aminobenzamidine affinity ligand coupled to a sepharose resin (GE healthcare) and the third one DEAE fast flow anion exchange resin (GE healthcare).
  • the CM and p- aminobenzamidine columns were pre-equilibrated with about 10 column volumes of 25 mM Tris buffer of pH 7.8, containing 2.5 mM calcium chloride.
  • the concentrate was pumped onto the CM and p-aminobenzamidine columns at a flow rate of about 100 ml per minute.
  • the cod trypsin fraction was collected into a neutralizing buffer of 200 mM Tris pH 8.5 containing 30% glycerol.
  • the DEAE anion exchange column was pre-equilibrated with about 10 column volumes of 25 mM Tris buffer of pH 7.8, containing 2.5 mM calcium chloride.
  • the cod trypsin fraction was applied to the DEAE anion exchange resin and washed with about 5 column volumes of the equilibration buffer. Trypsin ZT isoforms were then desorbed from the column using up to a 0.9 M NaCI gradient salt solution.
  • the purified cod trypsin ZT isoform preparation was homogeneous by SDS PAGE electrophoresis and FPLC Mono Q
  • the purified cod trypsin ZT isoform containing preparation of Example 2 was mixed with hydrocolloid gel comprising an aqueous gel containing 0.8% w/v Carbomer 940 and 40% glycerol.
  • the cod trypsin preparation was mixed in a 1 :1 ratio with the hydrogel to give a final concentration of 4 enzyme unit per mg (U/mg) of the final gel-enzyme mixture (the enzyme hydrogel ointment), the enzyme unit being determined using Cbz- GPR-pNA as substrate as previously described.
  • the resulting enzyme hydrogel ointment contained about 0.01 mg/ml, or 1 U/ml of the cod trypsin enzymes, 0.4% Carbomer 940, 20% glycerol and 0.04% paraoxybenzoate.
  • Picornaviruses are small single-stranded positive sense RNA viruses that lack a lipid envelope. Enterovirus and rhinovirus are two genera of Picornaviridae. Enterovirus replicates initially in the oropharynx and survives the acidic environment of the stomach. The small intestine is the major invasion site of enterovirus. Rhinovirus replicates in the nasal passages but is destroyed in the acidic environment of the stomach. Rhinovirus and enterovirus have an identical morphology but can be distinguished based on clinical, biophysical and epidemiological studies. Rhinovirus is problematic to handle in cell cultures (Racaniello, 2007, Fields virology, 5th ed: 795-838). Therefore, enterovirus was used as a model for rhinovirus to analyze the antiviral properties of trypsin ZT isoforms.
  • Cod trypsin isoenzymes were separated by applying benzamidine purified cod trypsin to a MonoQ HR 5/5 ion exchange column.
  • the column was equilibrated with 25 mM Tris, 25 mM CaCI 2 , pH 7.5, and the enzymes were eluted with a linear 0-400 mM NaCI gradient in 5 column volumes, linear 400-1000 mM NaCI in 20 column volumes at a flow rate of 1 mL/min.
  • the MA-104 cells were grown in a 96-well microtiter plate to 95% confluency.
  • the enterovirus was diluted from a stock solution to 10 "6 using minimum essential medium (MEM) and 1 .5 mL of the diluted solution was placed in two different vials.
  • the vials were treated with 1 .5 mL of trypsin ZT isoforms and 1.5 mL MEM as positive control.
  • Negative control was MEM (3 mL) without virus. All vials were incubated at 34 °C and 5% C0 2 for 90 min before adding 100 ⁇ of benzamidine agarose solution to remove residual trypsin and incubated for another 30 min.
  • the solution was centrifuged at 5500 rpm for 3 min before placing 2 mL of the supernatant into an Eppendorf vial. 200 ⁇ of the solution was placed in each well, total of 10 wells in the microtiter plate. The plate was incubated for 30 min. After incubation, the media was thrown off and MEM with 1 % newborn calf serum (NCS) added to all the wells. A microscope was used to monitor for the presence of infection.
  • NCS newborn calf serum

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Veterinary Medicine (AREA)
  • Organic Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Medicinal Chemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Zoology (AREA)
  • Immunology (AREA)
  • Wood Science & Technology (AREA)
  • Genetics & Genomics (AREA)
  • Biomedical Technology (AREA)
  • Epidemiology (AREA)
  • Dermatology (AREA)
  • Virology (AREA)
  • Molecular Biology (AREA)
  • General Engineering & Computer Science (AREA)
  • Biochemistry (AREA)
  • Communicable Diseases (AREA)
  • Oncology (AREA)
  • Microbiology (AREA)
  • Biotechnology (AREA)
  • Birds (AREA)
  • Pulmonology (AREA)
  • Marine Sciences & Fisheries (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Neurology (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Orthopedic Medicine & Surgery (AREA)
  • Physical Education & Sports Medicine (AREA)
  • Rheumatology (AREA)

Abstract

The present invention relates to the novel trypsin ZT isoforms. In particular, the invention relates to the use of trypsin ZT isoforms in medical devices, pharmaceuticals and cosmetics.

Description

NOVEL TRYPSIN ISOFORMS AND THEIR USE
Field of the invention
The present invention relates to the novel trypsin ZT isoforms. In particular, the invention relates to the use of trypsin ZT isoforms in medical devices, pharmaceuticals and cosmetics.
Background of the invention
Proteinases are enzymes that are defined by their ability to cleave proteins.
Proteinases can cleave substrates at different amino residues within a protein sequence demonstrating a difference in substrate specificity. Trypsins are proteinases and are partly specified by their preference in cleaving C-terminal to arginine or lysine residues (Olsen, Ong et al., 2004, Mol Cell Proteomics 3: 608-614). The Multiplex Substrate Profiling method reveals cleavage sites of proteinases and discloses the critical importance of residues surrounding their cleavage site for their specificity (O'Donoghue, Eroy-Reveles et al., 2012, Nat Methods 9: 1095-1 100).
U.S. Patent Nos. 4,801 ,451 and 4,963,491 disclose a mixture of exo- and
endopeptidases isolated from Antarctic krill (Euphasia superba) and the use of this mixture as a cleaning solution. 4,801 ,451 discloses the use of such enzymes to remove foreign matter and dead tissue from wounds. WO 85/04809 discloses the use of krill enzymes as a digestion-promoting agent. EP-A1 -01701 15 discloses the use of krill enzymes to dissolve blood clots. However, all of these references disclose impure or poorly characterized materials. A purified peptidase or mixture of purified peptidases is desirable to provide a pharmaceutically useful product.
WO 96/24371 discloses the use of a krill-derived multifunctional proteolytic enzyme and a family of crustacean and fish derived proteolytic enzymes having structural similarity to the multifunctional enzyme derived from Antarctic krill. The document also relates to methods of purifying the multifunctional enzyme and to pharmaceutical, cosmetic and other uses of the multifunctional enzyme. Structural similarity to the multifunctional enzyme derived from Antarctic krill is defined in that document as at least 70% homology with the krill derived multifunctional hydrolase.
WO 2000078332 discloses the use of cod derived trypsins and chymotrypsins in pharmaceutical compositions or medicaments for local and topical application to treat internal diseases and disorders and cosmetic use of such enzymes. The topical use for treating local, internal disorders, without the enzyme having to penetrate through open wounds or mucous tissue, was found to be effective. The serine proteinases disclosed in WO 2000078332 are proteinases that have at least 90% amino acid sequence homology with trypsin I, trypsin II, trypsin III, trypsin IV derived from Atlantic cod and proteinases that are chymotrypsin having at least 90% amino acid sequence homology with any of chymotrypsin A and chymotrypsin B isolated from Atlantic cod.
A complementary DNA (cDNA) encoding trypsin Y was isolated from an Atlantic cod cDNA library (Spilliaert and Gudmundsdottir, 1999, Mar Biotechnol (NY) 1 : 598-607). Cod trypsin Y has approximately 45% identity to the two Atlantic cod trypsin I and X (WO
2000078332). The native trypsin Y and recombinant forms of trypsin Y have previously briefly been described (Palsdottir and Gudmundsdottir, 2007, Protein Expr Purif 51 : 243-252, Palsdottir and Gudmundsdottir, 2008, Food Chemistry 111 : 408-414).
Summary of the invention
The present invention provides novel trypsin isoforms, called trypsin ZT isoforms. Such isoforms are derivable from fish, such as the Atlantic cod, or derivable in recombinant form using protein expression systems. The present invention further provides compositions comprising at least one isolated cod trypsin ZT isoform according to the invention, together with suitable excipients and carriers. The inventors have identified unexpected, beneficial and unique characteristics of the novel trypsin ZT isoforms over trypsins known previously. These characteristics provide an advantage in using trypsin ZT isoforms for various applications in medical devices, pharmaceuticals and cosmetics. The present invention provides said trypsin ZT isoforms per se and for use in treating or preventing diseases caused by pathogenic organisms. This is particularly relevant for use in treating or preventing a disease in the upper respiratory tract caused by pathogenic microorganisms. For that purpose, trypsin ZT isoforms can for example be used in medical devices or as active ingredient(s) in a pharmaceutical. Also, the present invention provides said trypsin ZT isoforms for use in the treatment of wound infections and wounds from burns, for use in removing dead or peeling skin from otherwise healthy skin for example in a medical device, as a pharmaceutical or as a cosmetic. The present invention further provides methods of preparing cod trypsin ZT isoforms of the present invention.
• Based on multiplex substrate profiling, trypsin ZT isoforms prefer cleavage at Arg
residues compared to trypsin I. Trypsin I prefers cleavage at Lys residues compared to trypsin ZT isoforms.
• Multiplex substrate profiling shows that different amino acid residues in the substrate surrounding the cleavage site have a large effect on cleavage (about four amino acids residues on the N terminal side and about four amino acid residues on the C terminal side). Trypsin ZT isoforms prefer certain amino acid residues surrounding the cleavage site over trypsin I.
• Arginine and lysine rich amino acid sequences are frequently found in viral-, bacterial- and parasite sequences that are associated with infection.
• Numerical values based on standard scores (Z-score) ratio (multiplex substrate profiling data) show that trypsin ZT isoforms are much better adapted to cleave peptides containing several consecutive basic amino acid residues (Arg and Lys) compared to trypsin I. Based on the data, trypsin ZT isoforms can act as antimicrobial agenst against viruses and bacteria as they can cleave at clustered basic amino acid residues such as lysine and arginine.
Detailed description of the invention
The present invention provides novel trypsin isoforms, called trypsin ZT isoforms. Such isoforms are derivable from fish, such as the Atlantic cod, or derivable in recombinant form using protein expression systems. The present invention relates to using such trypsin ZT isoforms for treatment and prevention of disease and to the cosmetic field. In particular, the invention relates to novel Atlantic cod trypsin ZT isoforms, useful as pharmaceuticals, in medical devices, and cosmetics.
Brief description of the drawings
FIG1 shows isolation of trypsin ZT isoforms with anion exchange chromatography. Chromatogram from a MonoQ separation of benzamidine purified cod trypsin isoforms showing absorbance at 280 nm vs. elution volume. Cod trypsin isoforms were loaded on a MonoQ column and proteins eluted with a salt gradient (dotted line). Arrow shows the peak containing trypsin ZT isoforms. The column was equilibrated with a buffer (20 mM Tris, 10 mM CaCI2, pH 8.0), and the enzymes were eluted with a linear 0-150 mM NaCI gradient in 40 column volumes, linear 150-620 mM NaCI in 6 column volumes, 620-850 mM NaCI in 10 column volumes at a flow rate of 1 mL/min.
FIG 2 shows SDS-PAGE of cod trypsin ZT isoforms. SDS-PAGE analysis of anion exchange chromatography peak labeled trypsin ZT from Figure 1 . Trypsin 1 , trypsin 5 and trypsin 7 are purified and isolated cod trypsin X isoforms. Cod trypsin X is closely related to cod trypsin I, differ by about eight amino acid residues. The proteins were resolved by SDS- PAGE and the gel silver stained. The bars and numbers on the left show the migration and molecular weight in kDa of standard proteins (Dalton Mark Vll-L) separated on the gel.
FIG 3 shows Western blot analysis of cod trypsin X (trypsin 1 , trypsin 5 and trypsin 7) and trypsin ZT isoforms. Cod trypsin X and trypsin ZT isoforms were subjected to SDS- PAGE. Following transfer, samples were immunoblotted with trypsin l/X (top panel) and trypsin ZT isoform (bottom panel) reacting antibodies. This shows that trypsin ZT isoforms were separated from trypsin l/X using anion exchange. As can be seen in FIG 3, the polyclonal antibody that reacts against trypsin ZT isoforms does not cross-react with trypsin l/X and the peptide antibody raised against trypsin l/X does not cross-react with trypsin ZT isoforms.
FIG 4 shows a Venn diagram illustrating shared and unique cleavages generated by trypsin ZT and trypsin I at three different time points in a multiplex substrate profiling analysis. Number of shared (black) and unique cleavage sites by trypsin ZT (white on the left) and trypsin I (white on the right) after incubation for 5 min. (A), 15 min. (B) and 60 min (C). The figure shows that at all time points there are shared cleavage sites and unique cleavage sites for trypsin ZT and trypsin I in the 124 defined peptides (each containing 14 amino acid residues) within the library. The data demonstrates that the substrate specificity of trypsin ZT is different from that of trypsin I.
FIG 5 shows antiviral activity of trypsin ZT against enterovirus (Coxsackievirus B2). The Y axis shows the percentage of wells infected compared to control and the X axis shows control (left bar) and treatment with trypsin ZT isoforms (right bar).
The inventors have identified novel trypsin isoforms termed trypsin ZT isoforms.
Trypsin ZT includes at least the following isoforms: Atlantic cod trypsin ZT-1 isoform, Atlantic cod trypsin ZT-2 isoform, Atlantic cod trypsin ZT-3 isoform and Atlantic cod trypsin ZT-4 isoform. All four Atlantic cod trypsin ZT isoforms have a similar molecular mass of about 25 kDa. The Atlantic cod trypsin ZT isoforms of the present invention are represented by the following amino acid sequences: SEQ ID NO:1
IX1GGX2X3CEPX4SRPFMASLNYGYHFCGGVLINDQWVLSVAHCWYNPYYMQVMLGEHDL RVFEGTEQLVKTNTIFWHEXsYDYQTLDYDMMMIKLYHPVEVTQSVAPISLPTGPPDGGMLC SVSGWGNMAMGEEVNLPTRLQCLDVPIVEXeVXzCXsAXgYPGMISPRMXioCXnGXizMDGG RDX13CNGDSGSPLVCEGVLTGLVSWGXi4GCAX15PNX16PGVYVKVYEX17LSWIQTTLDANP wherein
Xi is selected from I and V;
X2 is selected from Q and H;
X3 is selected from D and E;
X4 is selected from R and N;
X5 is L;
X6 is selected from T and P;
X7 is selected from D and A;
X8 is selected from E and Q;
X9 is selected from A and S;
X10 is selected from V and M;
X11 is selected from A and V;
X12 is selected from Y and F;
Xi3 is selected from A and V;
Xi4 is selected from Q and R;
Xi5 is selected from L and E;
X16 is selected from Yand S; and
X17 is selected from Y and F.
SEQ ID NO:2 The Atlantic cod trypsin ZT-1 isoform IVGGHECEPNSRPFMASLNYGYHFCGGVLINDQWVLSVAHCWYNPYYMQVMLGEHDLRV FEGTEQLVKTNTIFWHELYDYQTLDYDMMMIKLYHPVEVTQSVAPISLPTGPPDGGMLCSV SGWGNMAMGEEVNLPTRLQCLDVPIVEPVACQASYPGMISPRMMCVGFMDGGRDVCNG DS GSPLVCEGVLTGLVSWGRGC AEPNSPGVYVKVYEFLSWIQTTLDANP
SEQ ID N0:3 The Atlantic cod trypsin ZT-2 isoform
IVGGHECEPNSRPFMASLNYGYHFCGGVLINDQWVLSVAHCWYNPYYMQVMLGEHDLRV FEGTEQLVKTNTIFWHELYDYQTLDYDMMMIKLYHPVEVTQSVAPISLPTGPPDGGMLCSV SGWGNMAMGEEVNLPTRLQCLDVPIVETVDCEAAYPGMISPRMVCAGYMDGGRDACNGD S GSPLVCEGVLTGLVSWGQGC ALPNYPGVYVKVYEYLSWIQTTLDANP
SEQ ID NO:4 The Atlantic cod trypsin ZT-3 isoform
IIGGQDCEPRSRPFMASLNYGYHFCGGVLINDQWVLSVAHCWYNPYYMQVMLGEHDLRVF EGTEQLVKTNTIFWHELYDYQTLDYDMMMIKLYHPVEVTQSVAPISLPTGPPDGGMLCSVS GWGNMAMGEEVNLPTRLQCLDVPIVEPVACQASYPGMISPRMMCVGFMDGGRDVCNGD S GSPLVCEGVLTGLVSWGRGCAEPNSPGVYV KVYEFLSWIQTTLDANP
SEQ ID NO:5 The Atlantic cod trypsin ZT-4 isoform
IIGGQDCEPRSRPFMASLNYGYHFCGGVLINDQWVLSVAHCWYNPYYMQVMLGEHDLRVF EGTEQLVKTNTIFWHELYDYQTLDYDMMMIKLYHPVEVTQSVAPISLPTGPPDGGMLCSVS GWGNMAMGEEVNLPTRLQCLDVPIVETVDCEAAYPGMISPRMVCAGYMDGGRDACNGDS GSPLVCEGVLTGLVSWGQGC ALPNYPGVYVKVYEYLSWIQTTLDANP
Trypsin ZT isoforms of the present invention have less than 50% amino acid identity with the trypsins disclosed in WO 2000078332 and less than 45% homology with the chymotrypsins disclosed in WO 2000078332. The above trypsin ZT isoforms represents the active variants of these trypsins, i.e. variants that have been activated when the N terminus of the trypsins have been cleaved off. These trypsins are proteins expressed in the pyloric caeca (pancreatic tissue in fish) with a number of amino acids on the N terminal end that are important for secretion out of the cells and for keeping the enzyme inactive. The full length trypsin ZT isoforms are also disclosed herein as
SEQ ID NO:19 Uncleaved Atlantic cod trypsin ZT-1 isoform
MIGLALLMLLGAAAAAVPRDVGKIVGGHECEPNSRPFMASLNYGYHFCGGVLINDQWVLSV AHCWYNPYYMQVMLGEHDLRVFEGTEQLVKTNTIFWHELYDYQTLDYDMMMIKLYHPVEV TQSVAPISLPTGPPDGGMLCSVSGWGNMAMGEEVNLPTRLQCLDVPIVEPVACQASYPGM ISPRMMCVGFMDGGRDVCNGDSGSPLVCEGVLTGLVSWGRGCAEPNSPGVYVKVYEFLS WIQTTLDANP SEQ ID NO:20 Uncleaved Atlantic cod trypsin ZT-2 isoform
MIGLALLMLLGAAAAAVPRDVGKIVGGHECEPNSRPFMASLNYGYHFCGGVLINDQWVLSV AHCWYNPYYMQVMLGEHDLRVFEGTEQLVKTNTIFWHELYDYQTLDYDMMMIKLYHPVEV TQSVAPISLPTGPPDGGMLCSVSGWGNMAMGEEVNLPTRLQCLDVPIVETVDCEAAYPGMI SPRMVCAGYMDGGRDACNGDSGSPLVCEGVLTGLVSWGQGCALPNYPGVYVKVYEYLS WIQTTLDANP
SEQ ID NO:21 Uncleaved Atlantic cod trypsin ZT-3 isoform
MIGLALLMLLGAAAAVPREDGRIIGGQDCEPRSRPFMASLNYGYHFCGGVLINDQWVLSVA HCWYNPYYMQVMLGEHDLRVFEGTEQLVKTNTIFWHELYDYQTLDYDMMMIKLYHPVEVT QSVAPISLPTGPPDGGMLCSVSGWGNMAMGEEVNLPTRLQCLDVPIVEPVACQASYPGMI SPRMMCVGFMDGGRDVCNGDSGSPLVCEGVLTGLVSWGRGCAEPNSPGVYVKVYEFLS WIQTTLDANP
SEQ ID NO:22 Uncleaved Atlantic cod trypsin ZT-4 isoform
MIGLALLMLLGAAAAVPREDGRIIGGQDCEPRSRPFMASLNYGYHFCGGVLINDQWVLSVA HCWYNPYYMQVMLGEHDLRVFEGTEQLVKTNTIFWHELYDYQTLDYDMMMIKLYHPVEVT QSVAPISLPTGPPDGGMLCSVSGWGNMAMGEEVNLPTRLQCLDVPIVETVDCEAAYPGMI SPRMVCAGYMDGGRDACNGDSGSPLVCEGVLTGLVSWGQGCALPNYPGVYVKVYEYLS WIQTTLDANP Multiplex substrate profiling is used to analyze the substrate specificity of enzymes
(proteinases) (O'Donoghue, Eroy-Reveles et al., 2012, Nat Methods 9: 1095-1 100).
Proteinases can cleave substrates at different amino residues within a peptide sequence demonstrating a difference in substrate specificity. Trypsins are specified by their preference in cleaving C-terminal to arginine or lysine residues. Unexpectedly, multiplex substrate profiling on trypsin ZT isoforms revealed that amino acids surrounding arginine or lysine in a substrate have a different effect on its cleavage compared to trypsin I. In short, trypsin ZT isoforms or trypsin I were incubated (5, 15 and 60 min.) with a library of peptides (124 defined peptides, 14-mer sequences, total of 1612 peptide bonds) with an extensive physiochemical diversity (O'Donoghue, Eroy-Reveles et al., 2012, Nat Methods 9: 1095- 1 100). After incubation, cleavage sites were identified by mass spectrometry analysis. The results are presented in the following examples and show that there are numerous cleavage sites unique to trypsin ZT compared trypsin I. Also, cleavage sites that showed preferential cleavage by trypsin ZT isoforms compared to trypsin I were identified. Further, the novel trypsin ZT isoforms have a different substrate specificity compared to a trypsin I, disclosed in WO 2000078332. These findings were unexpected. Based on the results from the multiplex substrate profiling analysis, a table containing numerical values based on standard scores (Z-score) ratio at the P4-P4' positions in the substrate was generated where the substrate specificity of trypsin ZT was compared to trypsin I. Positive values (Z-score) reflect a preference for the amino acid residue in a certain P position in favor of trypsin ZT isoforms compared to trypsin I.
Trypsin ZT isoforms have specific antimicrobial properties. Based on the values generated and presented in the examples, it can be seen that trypsin ZT isoforms are much better adapted in cleaving peptides containing several consecutive positively charged residues (arginine or lysine) compared to trypsin I. Those types of sequences (lysine and arginine rich amino acid sequence) are frequently found in viral proteins (Suzuki, Orba et al., 2010, PLoS Pathog 6: e1000801 , Jiang, Cun et al., 2012, J Virol 86: 7256-7267, Gallaher and Garry, 2015, Viruses 7: 285-305).
Viroporins is a group of proteins that interact with plasma membranes modifying permeability and can promote the release of viral particles. Clustered lysine and/or arginine residues are important for the activity of viroporins. Based on the multiplex substrate profiling analysis, trypsin ZT isoforms can act as antiviral agents against RNA viruses as it can cleave these clustered basic amino acid residues . Viroporins have been described as present in a number of virus families, including the Flaviviridae, Picornaviridae, Retroviridae,
Coronaviridae, Reoviridae and Paramyxoviridae (Royle, Dobson et al., 2015, Viruses 7: 5375-5387). Studies have shown that basic residues, lysine or arginine, in viroporins are a critical requirement for their function. The majority of viroporins have been identified in RNA viruses. Viruses that contain lysine and arginine rich viroporins that would be a target for trypsin ZT isoforms include human immunodeficiency virus (HIV), rotavirus, Ebola, Reston virus (RESTV), Lloviu virus (LLOV), Sudan virus (SUDV), Bundibugyo (BDBV), Tai Forest virus (TAFV) (Suzuki, Orba et al., 2010, PLoS Pathog 6: e1000801 , Gallaher and Garry, 2015, Viruses 7: 285-305).
The viroporins are found in a wide variety of DNA and RNA viruses such as
Paramecium bursaria chlorella virus 1 , simian virus 40 (SV40), human polyoma JC (JCV), severe acute respiratory syndrome coronavirus (SARS-CoV) (Kang, Moroni et al., 2004, Proc Natl Acad Sci U S A 101 : 5318-5324, Liao, Tarn et al., 2006, Adv Exp Med Biol 581 : 199- 202, Daniels, Sadowicz et al., 2007, PLoS Pathog 3: e98).
Highly basic viral proteins, termed agnoproteins, have recently have been identified from DNA viruses such as from the Polyomaviridae and Papillomaviridae family (Royle, Dobson et al., 2015, Viruses 7: 5375-5387). These proteins show a number of viroporin characteristics. Conserved sequences have been identified in agnoproteins that contain a number of clustered basic amino acid residues (Royle, Dobson et al., 2015, Viruses 7: 5375- 5387). Based on the multiplex substrate profiling analysis, trypsin ZT isoforms can act as antiviral agents against DNA viruses as it can cleave these clustered basic amino acid residues (Royle, Dobson et al., 2015, Viruses 7: 5375-5387).
Many viruses and bacteria have developed mechanisms to gain cell entry using cell penetrating peptides or proteins (Milletti, 2012, Drug Discov Today 17: 850-860). The viruses include pestiviruses of the Flaviviridae family, herpes virus (HSV-1 ), human
immunodeficiency virus (HIV-1 , hepatitis B and human respiratory syncytial virus (RSV) (Elliott and O'Hare, 1997, Cell 88: 223-233, Oess and Hildt, 2000, Gene Ther 7: 750-758, Langedijk, 2002, J Biol Chem 277: 5308-5314, Langedijk, Olijhoek et al., 2005, International Congress Series 1277: 95-107, Lu, Tager et al., 2006, Anal Biochem 353: 7-14, Godet, Guergnon et al., 2010, PLoS One 5: e13760). Furthermore, these types of proteins have been found in bacteria such as Mycobacterium tuberculosis (Lu, Tager et al., 2006, Anal Biochem 353: 7-14). The cell penetrating peptides (CPP) have in common that they are rich in basic amino acid residues especially arginines (Milletti, 2012, Drug Discov Today 17: 850- 860). Porins are outer membrane proteins that play a crucial role in bacterial pathogenicity and for protection and are for that reason useful targets for therapeutics (Galdiero, Falanga et al., 2012, Curr Protein Pept Sci 13: 843-854). These proteins often contain consecutive arginine amino acid residues. Based on the multiplex substrate profiling analysis trypsin ZT isoforms can act as antimicrobial agents against viruses and bacteria as it can cleave clustered basic amino acid residues.
Parasites depend on virulence determinants such as proteins containing arginine rich domains for example Toxoplasma gondii (Fentress, Steinfeldt et al., 2012, Cell Microbiol 14: 1921 -1933). Multiplex substrate profiling analysis showed that trypsin ZT isoforms would be beneficial against parasites by acting against such proteins. The Basic Local Alignment Search Tool (BLAST) was used to search for some of the unique and preferential amino acid sequences cleaved by trypsin ZT isoforms. The search results demonstrated that these types of sequences are found in many pathogens including viruses (e.g. from the Paramyxoviridae and Coronaviridae family of viruses), bacteria (e.g. Haemophilus genus) and parasites (e.g. Plasmodium genus). The Paramyxoviridae family includes viruses such as the respiratory syncytial virus (RSV) and human parainfluenza viruses and viruses that cause mumps and measles. The Coronaviridae family includes viruses that cause Severe Acute Respiratory Syndrome (SARS). The Haemophilus genus of bacteria includes Haemophilus parainfluenzae that is associated with endocarditis, meningitis, and bacteremia. The Plasmodium genus includes Plasmodium falciparum that causes malaria.
By the phrase "medical device" is meant, but not limited to, any instrument, apparatus, appliance, software, material or other article for the purpose of diagnosis, prevention, monitoring, treatment, or alleviation of disease, such as diagnosis, monitoring, treatment, alleviation of or compensation; for an injury or handicap, such as investigation, replacement or modification of the anatomy or of a physiological process; control of conception; including devices that do not achieve their principal intended action in or on the human body by pharmacological, immunological or metabolic means - but may be assisted in their function by such means.
The present invention relates to the novel trypsin ZT isoforms. The invention describes unpredicted and unique protein cleaving properties of trypsin ZT isoforms that make it valuable in medical applications. In particular, the invention relates to the novel Atlantic cod trypsin ZT isoforms, useful as pharmaceuticals, in medical devices, and cosmetics.
In one aspect of the invention, there is provided an isolated cod trypsin ZT isoform comprising an amino acid sequence according to SEQ ID NO:1 , or an amino acid sequence with 80% sequence homology or more, thereof. Typically, such sequence homology is 85, 90, 95 or 99% homologous to the amino acid sequence of SEQ ID NO:1. In one embodiment of this aspect there is provided an isolated cod trypsin ZT isoform, selected from trypsin ZT-1 , comprising an amino acid sequence according to SEQ ID NO:2; trypsin ZT-2 comprising an amino acid sequence according to SEQ ID NO:3; trypsin ZT-3 comprising an amino acid sequence according to SEQ ID NO:4; and trypsin ZT-4, comprising an amino acid sequence according to SEQ ID NO:5, or an amino acid sequence with 80% sequence homology or more, thereof. Included are also amino acid sequences with 80% sequence homology or more, to amino acid sequences set out in SEQ ID NOS:2-5. Typically, such sequence homology is 85, 90, 95 or 99% homologous to the amino acid sequence of SEQ ID NOS:2-5.
In one aspect of the invention, there is provided a composition comprising at least one cod trypsin ZT isoform according to the invention, together with suitable excipients and carriers. Said cod trypsin ZT isoform may be selected from cod trypsin ZT-1 , comprising an amino acid sequence according to SEQ ID NO:2; cod trypsin ZT-2 comprising an amino acid sequence according to SEQ ID NO:3; cod trypsin ZT-3 comprising an amino acid sequence according to SEQ ID NO:4; and cod trypsin ZT-4 comprising an amino acid sequence according to SEQ ID NO:5. Included are also amino acid sequences with 80% sequence homology or more, to amino acid sequences set out in SEQ ID NOS:2-5. Typically, such sequence homology is 85, 90, 95 or 99% homologous to the amino acid sequence of SEQ ID NOS:2-5.
Typically, said composition comprises said cod trypsin ZT isoforms present in admixture with other cod trypsins. Preferably, said cod trypsin ZT isoforms comprises at least 5% (w/w) of the total content of cod trypsins in said composition, such as at least 10, 15, 20, 25, 30, 35, 40, 45 or 50% or more (w/w) of the total content of cod trypsins in said
composition.
Said composition is typically administered topically, as a lotion, a hydrogel, a mouth spray or a nasal spray. Said composition may further comprise a polyvalent alcohol, such as glycerol. In one embodiment of this aspect, there is provided said composition for use in therapy.
In one embodiment of this aspect, there is provided said composition for use in treating or preventing a disease caused by a pathogenic organism selected from the group consisting of a virus, a bacterium, a fungus, a parasite and a protozoan.
In one embodiment of this aspect, there is provided said composition for use in treating or preventing a disease in the upper respiratory tract caused by pathogenic organisms such as viruses, bacteria and fungus.
In one embodiment of this aspect, there is provided said composition for use in treating or preventing pain, acute inflammation, chronic inflammation, arthritis, inflamed joints, bursitis, osteoarthritis, rheumatoid arthritis, juvenile rheumatoid arthritis, septic arthritis, fibromyalgia, systemic lupus erythematosus, phlebitis, tendinitis, rash, psoriasis, acne, eczema, facial seborrheic eczema, eczema of the hands, face or neck, foreskin infections, athlete's foot, fistulae infections, infected topical ulcers, navel infections in newborns, wrinkles, scars, kelloids, boils, warts and allergic itch, hemorrhoids, a fungal infection and an immunological disorder including an autoimmune disease.
In one embodiment of this aspect, there is provided said composition for use in the treatment of wound infections and wounds from burns.
In one embodiment of this aspect, there is provided said composition for use in removing dead or peeling skin from otherwise healthy skin.
In one embodiment of this aspect, there is provided said composition for cosmetic use. Said composition may further comprise an additional cosmetically active compound.
In one aspect of the invention, there is provided a method of treating disease, comprising administering a therapeutically effective amount of a composition according to the present invention, to a patient in need thereof. In one embodiment of this aspect, said disease is caused by a pathogenic organism selected from the group consisting of a virus, a bacterium, a fungus, a parasite and a protozoan
In one embodiment of this aspect, said disease is a disease in the upper respiratory tract caused by pathogenic organisms such as viruses and bacteria.
In one embodiment of this aspect, said disease is selected from pain, acute
inflammation, chronic inflammation, arthritis, inflamed joints, bursitis, osteoarthritis, rheumatoid arthritis, juvenile rheumatoid arthritis, septic arthritis, fibromyalgia, systemic lupus erythematosus, phlebitis, tendinitis, rash, psoriasis, acne, eczema, facial seborrheic eczema, eczema of the hands, face or neck, foreskin infections, athlete's foot, fistulae infections, infected topical ulcers, navel infections in newborns, wrinkles, scars, kelloids, boils, warts and allergic itch, hemorrhoids, a fungal infection and an immunological disorder including an autoimmune disease.
In one embodiment of this aspect, said disease is wound infections or wounds from burns.
In one aspect of the invention, there is provided an isolated cod trypsin ZT isoform, selected from full length trypsin ZT-1 , comprising an amino acid sequence according to SEQ ID NO:19; full length trypsin ZT-2 comprising an amino acid sequence according to SEQ ID NO:20; full length trypsin ZT-3 comprising an amino acid sequence according to SEQ ID NO:21 ; and full length trypsin ZT-4, comprising an amino acid sequence according to SEQ ID NO:22.
In one aspect of the invention, there is provided a method of preparing cod trypsin ZT isoforms comprising an amino acid sequence according to any one of SEQ ID NO:2 to SEQ ID NO:5, comprising
(i) extracting trypsin ZT from cod viscera,
(ii) applying the extract to at least one or more chromatography steps, including an
affinity chromatography step using a p-aminobenzamidine affinity ligand, and (iii) desorbing and eluting cod trypsin ZT isoforms bound to the p-aminobenzamidine affinity ligand.
In one embodiment of this aspect, said method further comprises at least one step using an anionic exchange resin after said affinity chromatography step (ii).
In one embodiment of this aspect, said cod trypsin ZT isoforms are selected from trypsin ZT-1 , comprising an amino acid sequence according to SEQ ID NO:2; trypsin ZT-2 comprising an amino acid sequence according to SEQ ID NO:3; trypsin ZT-3 comprising an amino acid sequence according to SEQ ID NO:4; and trypsin ZT-4 comprising an amino acid sequence according to SEQ ID NO:5, or a mixture thereof.
Cod viscera is typically used to purify and isolate trypsin ZT isoforms. The inventors have identified novel methods described below, useful for a commercial scale production of trypsin ZT isoforms. Extraction is conducted at a pH of 6-8 at a temperature below 10°C. Cod viscera is mixed with water at a ratio (w/w) of 1 :6 to 1 :20. The extract is separated from the leftover offal and further clarified by sedimentation and filtration. This is followed by microfiltration and ultrafiltration resulting a solution containing trypsin ZT isoforms that is used for chromatography separation that may include several steps.
An affinity chromatography is conducted, preferably by amino benzamidine affinity chromatography, to purify trypsin ZT isoforms. Trypsin ZT isoforms can then be further purified with anion exchange chromatography.
One method of application of trypsin ZT isoforms or mixtures of purified cod trypsins containing trypsin ZT isoforms, is in a preparation of hydrogel or lotion and water containing 0 to 90% (vol/vol) of a polyvalent alcohol (polyol) such as glycerol. A suitable concentration of trypsin ZT isoforms constitutes at least 1 to 100 protein concentration ratio to other trypsin forms, preferably 5%, or higher (w/w) of the total content of cod trypsins. The trypsin activity is 0.1 to 10,000 enzyme units of activity for CBZ-Gly-Pro-Arg-pNA (carbobenzoxy Gly-Pro- Arg-para nitroanilide) per 100 milliliters of the final hydrogel/lotion preparation. The invention further provides (a) methods relating to certain conditions using effective amounts of the purified trypsin ZT isoforms described above, (b) compositions or substances for use in such methods, (c) pharmaceutical or medical device compositions containing effective amounts of trypsin ZT isoforms for use in such methods, and (d) uses of the enzyme or enzyme composition for manufacturing a medicament (pharmaceutical and medical devices) for use in such methods.
The methods are inter alia for:
treating or preventing pathogenic disease caused by viruses, bacteria and fungi that for example occur in the upper respiratory tract, lower respiratory tract and in lungs;
treating or prophylactically preventing dermatological conditions such as e.g. acne, rash, psoriasis or eczema, including facial seborrheic eczema or eczema of the hands, face, scalp or neck, hemorrhoids and the like, where preferably the amount of the trypsin ZT isoforms and other trypsins administered is a dermatological condition treating or preventing effective amount;
treating lung diseases where trypsin ZT isoforms with or without other trypsins are used for example in pressurized metered dose high efficiency inhaler in an effective dose for treatment;
treating or prophylactically preventing wound infection and debriding wounds (by applying to the wound a microbial infection-preventing effective amount of trypsin ZT isoforms with or without other trypsins or by enhancing the healing of wounds by
administering a microbe inhibiting effective amount of trypsin ZT isoforms with or without other trypsins, when treated the wound can be substantially freed of necrotic tissue;
treating burns, where preferably the amount of trypsin ZT isoforms with or without other trypsins administered in a sufficient amount to promote healing;
treating sunburns, where preferably the amount of trypsin ZT isoforms with or without other trypsins administered in a sufficient amount to promote healing; treating radiation burns, where preferably the amount of trypsin ZT isoforms with or without other trypsins administered in a sufficient amount to promote healing;
removing dead or peeling skin from otherwise healthy skin to improve the skin's appearance, where preferably the amount of trypsin ZT isoforms with or without other trypsins is administered in a dead skin removing effective amount;
treating cracked heels, where preferably the amount of trypsin ZT isoforms with or without other trypsins is administered in a sufficient amount for effective treatment;
for management of irritated skin, such as dry patches, itching, redness and blemishes, where preferably the amount of trypsin ZT isoforms with or without other trypsins is administered in a sufficient amount for effective treatment;
treating or prophylactically preventing cystic fibrosis, cancer, e.g. by administering a tumor treating effective amount or a tumor metastasis preventing or inhibiting amount of trypsin ZT isoforms, atherosclerosis, asthma, septic shock, toxic shock syndrome, tissue adhesions such as tendon-sheath, abdominal post-surgical or joint adhesions, reperfusion injury, malaria, immune disorder such as an autoimmune disease, apoptosis, colitis and enteritis, such as Crohn's disease, where preferably the amount of trypsin ZT isoforms and related peptidases administered are effective;
treating or prophylactically preventing a microbial infection, e.g. a viral infection such as a rhinovirus (RV), respiratory syncytial virus (RSV), influenza, herpes virus infection (e.g. HSV-1 , HSV-2, herpes zoster or genital herpes infection), HIV, hepatitis, coronavirus, cytomegalovirus or papilloma virus infection; an infection causing a gastrointestinal disease such as ulcer or diarrhoea; a fungal infection such as systemic, skin, oral, vaginal or esophageal fungal infection, including e.g. yeast infection, including a fungal nail infection and Candida infections; microbial infections of the eye, preferably treated with ocular administrations; bacterial infections including infection by Helicobacter pylori, Staphylococcus spp., Methicillin-resistant Staphylococcus aureus (MRSA), Streptococcus pneumonia, Haemophilus influenza, Streptococcus mitis, Streptococcus spp., Klebsiella spp., Pseudomonas spp., Neisseria gonorrheae, Haemophilus spp., Chlamydia spp., syphilis and E. coli infections and bacterial infections causing chancroid; opportunistic microbial infections in immunocompromised patients where preferably the administered amount of the cod trypsins is a microbial infection-treating or -preventing effective amount or has inhibitory activity against cell-cell or cell-virus adhesion;
treating or prophylactically preventing an indication selected from the group consisting of pain, inflammation, acute or chronic inflammation, arthritis, inflamed joints, bursitis, osteoarthritis, rheumatoid arthritis, juvenile rheumatoid arthritis, septic arthritis, fibromyalgia, systemic lupus erythematosus and phlebitis where preferably the amount is treating or preventing effective amount;
removing dental plaque, where preferably the amount of trypsin ZT isoforms with or without other trypsins is administered in a dental plaque removing effective amount; and lysing blood clots, where preferably the amount of trypsin ZT isoforms is a clot lysing effective amount.
The method comprises administering a composition comprising the trypsin ZT isoforms as described above.
The invention provides topical cosmetic and medical compositions comprising trypsin ZT isoforms described above; and gel, cream or suppository composition.
The invention further provides a method of inhibiting or prophylactically preventing the transmission of a pathogenic microbe by administering trypsin ZT isoforms with or without other trypsins. Preferably, trypsin ZT with or without other trypsins is applied to the portion of the body that comprises the primary transmission entryway for the microbe in question. In one embodiment, a spray, ointment or wash is applied to a body orifice involved in sexual activity, for instance, to prevent HIV or hepatitis transmission. In another embodiment, trypsin ZT isoforms or related peptidases is applied to the upper airways, for example, via an aerosol, to inhibit or prevent the transmission of a common cold virus, such as a rhinovirus or a coronavirus. The method of extra-corporeally treating a tissue, body fluid or composition of cells to remove cell adhesion components reduces the immune rejection of tissue, body fluid or composition of cells that is transplanted from one individual to another. In another aspect, such treatments remove or inactivate the cell adhesion components found in the treated tissue, body fluid or composition of cells involved in a microbial infection.
In treating or prophylactically preventing septic shock or toxic shock syndrome by administering trypsin ZT isoforms or related peptidases, appropriate routes of administration include systemic administration. For vaginal infections associated with shock, vaginal flushes, creams, gels or suppositories may be used as a method of administration.
In treating or prophylactically preventing pain, inflammation, acute or chronic
inflammation, arthritis, inflamed joints, bursitis, osteoarthritis, rheumatoid arthritis, juvenile rheumatoid arthritis, septic arthritis, fibromyalgia, systemic lupus erythematosus, phlebitis by administering trypsin ZT isoforms or related peptidases, appropriate routes of
administration would include without limitation creams, gels or suppositories, in particular but not limited to hydrogels containing glycerol or other polyols.
In treating or prophylactically preventing rash, psoriasis, acne, eczema, including facial seborrheic eczema or eczema of the hands, face, scalp or neck, foreskin infections, athlete's foot, fistulae infections, infected topical ulcers, navel infections in newborns, wrinkles, scars and kelloids, boils, warts and allergic itch, hemorrhoids and the like, wounds, wound infections, wounds from burns, removing dead or peeling skin from otherwise healthy skin to improve the skin's appearance, a fungal infection such as systemic, skin, oral, vaginal or esophageal fungal, including for example, yeast infection, including a fungal nail infection and Candida infections and immune disorders including autoimmune diseases by
administering trypsin ZT isoforms with or without other trypsins, appropriate routes of administration would include creams, gels or suppositories, in particular but not limited to hydrogels containing glycerol or other polyols. The above objectives are achieved by using a composition containing an effective amount of trypsin ZT isoforms with or without other trypsins which is capable of relieving the pain, inflammation, arthritis, swelling, edema, psoriasis eczema, dermatitis, rash and/or other symptoms of the diseases mentioned in the introductory part. Trypsin ZT isoforms can be obtained at a high yield and in a relatively simple manner from cod viscera. It has been found that trypsin ZT isoforms can be purified on a commercial scale in a relatively straightforward manner with reasonable yields. Trypsin ZT isoforms without or along with other Atlantic serine proteases can be used for the purpose of the invention.
Trypsin ZT isoforms presented in the present disclosure can be desorbed from the affinity matrix by applying conditions that will destabilize the interaction between the enzyme and the affinity ligand. Such conditions include high salt followed by low pH, preferably in 30% or more glycerol. The column eluent is allowed to flow into a neutralizing buffer to stabilize the cod trypsin after the acid elution step. Trypsin ZT isoforms can then be further purified using anion exchange and eluted with increasing salt concentration. By these methods trypsin ZT isoforms with a purity in excess of about 90% can be isolated. The cod trypsin fraction thus obtained contains 2-3 major isoforms as manifested by SDS
electrophoresis, which yields two bands and MALDI-TOF mass spectrometry analysis. The molecular mass of trypsin ZT isoforms is about 25 kDa, whereas the calculated isoelectric point is 4.35 - 4.49 depending on the isoform.
Trypsin ZT isoforms with or without other trypsins in specific formulations can be used as a pharmaceutical, in medical devices (such as chemical formulations) or in cosmetics depending on intended use. Trypsin ZT isoforms (with or without other trypsins) of the invention are administered topically, orally, rectally, vaginally, by instillation (for instance into the urinary tract or into fistulas), by the pulmonary route e.g. by use of an aerosol (for example by using a pressurized metered-dose inhaler (pMDI)), by application of drops to the eye, or systemically, such as parenterally, including, for example,
intramuscularly, subcutaneously, intraperitoneally, intraarterially or intravenously. Trypsin ZT isoforms are administered in solution or combined with a pharmaceutically acceptable carrier or excipient according to standard pharmaceutical practice. For the oral mode
of administration, trypsin ZT isoforms are used in the form of tablets, capsules, lozenges, chewing gum, troches, powders, syrups, elixirs, aqueous solutions and suspensions, and the like. For parenteral administration, sterile solutions of trypsin ZT isoforms are usually prepared, and the pH values of the solutions are suitably adjusted and buffered. For intravenous use, the total concentration of solutes should be controlled to render the preparation isotonic. For ocular administration, ointments or droppable liquids may be delivered by ocular delivery systems known to the art such as applicators or eye droppers. For pulmonary administration, diluents and/or carriers will be selected to be appropriate to allow the formation of an aerosol. For topical administrations, trypsin ZT isoforms are typically administered in a hydrogel, containing 0 to 85% glycerol, such as about 20% to 30% glycerol and possibly up to 85 % glycerol.
For topical treatments, a suitable dose of trypsin ZT isoforms with or without other trypsins per application ranges from about 0.01 μg cm2 to about 1 mg/cm2, preferably from about 0.1 μg cm2 to about 0.01 mg/cm2 (using e.g. about 0.01 mg/ml enzyme gel). For systematic treatments, dosages will generally be selected to maintain a serum level of trypsin ZT isoforms with or without other trypsins between about 0.1 mg/100 ml and about 100 mg/100ml, preferably between about 0.5 mg/100 ml and about 2.0 mg/100 ml. In an alternative measure of preferred systematic administration amounts, preferably from about 0.1 mg/kg to about 10 mg/kg, more preferably about 1 mg/kg, will be used. For vaginal and urinary tract treatments, suitable flushing/instillation solutions of trypsin ZT isoforms will generally have concentrations from about 1 μg/ml to about 15 mg/ml, preferably from about 100 μg/ml to about 3 mg/ml. For all treatments, the enzyme composition will generally be applied from about 1 to about 10 times per day, preferably from about 2 to about 5 times per day. These values, of course, will vary with a number of factors including the type and severity of the disease, and the age, weight and medical condition of the patient, as will be recognized by those of ordinary skill in the medical arts. It is believed that substantially higher doses can be used without substantial adverse effect.
For wound healing, trypsin ZT isoforms with or without other trypsins are preferably applied more often than simply at the time at which the wound is first dressed. Preferably, trypsin ZT isoforms are applied at least about every time the wound dressing is changed. Trypsin ZT isoforms can also be applied at least about every other day, more preferably, every day, or few times per day. For dermatological situations such as eczema, psoriasis and the like, a trypsin ZT isoform (with or without other trypsins) hydrogel is preferably applied every day, more preferably twice per day. For acute or chronic inflammation, arthritis, inflamed joints, bursitis, osteoarthritis, and the like, trypsin ZT isoforms are preferably applied every day more preferably twice every day.
Numerous methods for determining percent homology of proteins are known in the art. Percent Identity was calculated using ClustalW2 (version Clustal2.1 ) when making sequence comparisons (EMBL-EBI website http://www.ebi.ac.uk/Tools/msa/clustalw2/ date 4th of May 2015).
The invention will now be described by a number of non-limiting examples. EXAMPLE 1.
Preparation of a mixture of proteases from cod
About 100 kg of frozen Atlantic cod viscera were thawed and added to a four-fold volume of cold potable water in an extraction tank and the pH adjusted to around pH 6 with sodium hydroxide solution. The mixture was stirred for about 10 hours at 0 to 5°C. After a brief period of crude sedimentation (about 30 minutes) the aqueous extract was run off the remaining insoluble viscera with a pump and collected in a sedimentation tank. The aqueous extract was allowed to stand in the cooled sedimentation tank to sediment for about 40 to 80 hours. The supernatant was decanted from the supernatant tank to a holding tank using a pump. The supernatant was concentrated 10 to 20-fold by ultrafiltration and diafiltered to an acceptable level of ionic strength with conductivity below about 2.5 mS/cm. About 10-15 liters of ultrafiltered and diafiltered protein concentrate was obtained.
EXAMPLE 2.
Purification of cod trypsin ZT isoforms from concentrated cod viscera extract
About 12 liters of ultrafiltered and diafiltered concentrate as obtained in Example 1 was applied to a continuous, connected series of about 1 liter packed chromatography columns, the first containing a carboxymethyl (CM) fast flow cation exchange resin (GE healthcare) and the second one a p-aminobenzamidine affinity ligand coupled to a sepharose resin (GE healthcare). The CM and p-aminobenzamidine columns were pre-equilibrated with about 10 column volumes of 25 mM Tris buffer of pH 7.8, containing 2.5 mM calcium chloride (buffer A). The concentrate was pumped onto the CM and p-aminobenzamidine columns at a flow rate of about 100 ml per minute. When the application of the concentrated solution onto the columns was completed, residual material was washed off the continuous column system with about 8 liters of buffer A. After this wash was completed, the p-aminobenzamidine affinity column was disconnected from the CM column and washed with about 5 column volumes of a high salt solution of 25 mM Tris buffer pH 7.5 containing 0.5 M NaCI and 2.5 mM calcium chloride. The cod trypsins were then desorbed from the affinity ligand and eluted off the column with an acid solution of 25 mM acetic acid pH 3.2 containing 10 mM calcium chloride and 30% glycerol.
The purified cod trypsin ZT isoform-containing preparation was homogeneous by SDS PAGE electrophoresis. The purified preparation was filter-sterilized through a 0.22 micron filter and stored frozen at about -20°C. The cod trypsin ZT isoform-containing preparation was filter-sterilized through a 0.22 micron filter and stored frozen at about -20°C. The cod trypsin ZT isoform-containing preparation was applied to an anion exchange chromatography column (MonoQ) and proteins eluted with a salt gradient (FIG 1 ). The column was equilibrated with a buffer (20 mM Tris, 10 mM CaCI2, pH 8.0), and the enzymes were eluted with a linear 0-150 mM NaCI gradient in 40 column volumes, linear 150-620 mM NaCI in 6 column volumes, 620-850 mM NaCI in 10 column volumes at a flow rate of 1 mL/min. The proteins in the peak labeled trypsin ZT from FIG 1 were subjected to SDS-PAGE analysis (FIG 2). The protein band on the gel from the trypsin ZT peak was excised from the gel and analyzed using Matrix-Assisted Laser Desorption/lonization Time-of-Flight Mass
Spectrometry (MALDI-TOF MS). The mass spectrometry (MS) analysis revealed identity to trypsin ZT-1 , trypsin ZT-2, trypsin ZT-3 and trypsin ZT-4 (Table 1 and Table 2). Antibodies against trypsin I and trypsin X were prepared in rabbits against a peptide ((NH2-)
CVLSGWVRDTMA (-COOH)) (SEQ ID NO: 23) corresponding to residues 228-239 at the extreme C terminus of cod trypsin I and cod trypsin X. The antibodies were affinity purified from rabbit serum using the peptide coupled to a gel bead support. Polyclonal antibodies against trypsin ZT isoforms were made in mouse ascitic fluid as described in Overkamp et al. (Overkamp, Mohammed-Ali et al., 1988, J Immunoassay 9: 51 -68). A purified form of recombinant trypsin ZT-4 was injected intraperitoneally (i.p.) into Balb/C2 mice. The mice were sacrificed on day 34 and ascitic fluid collected. The respective antibodies were used in Western blot analysis. Western blot analysis was performed on the proteins in the peak labeled trypsin ZT from FIG 1 (FIG 3). Trypsin ZT isoform antibody reacted against the proteins from the peak labeled trypsin ZT whereas an antibody against trypsin I and trypsin X did not (FIG 3).
Table 1 shows peptide masses obtained from MS analysis on protein band from SDS-
PAGE gel in Figure 2 (non guanidilated sample), see column 1 Mr (expt). Mr stands for relative molecular mass in Da. Columns 2, 3 and 4 show the calculated values (for masses matching to masses in column 1 ) from an in silico trypsin digest of the amino acid sequences trypsin ZT-1 , trypsin ZT-2, trypsin ZT-3 and trypsin ZT-4. Column 5 shows the sequence of the peptide that give the mass value from the in silico digest. Column 6 shows modifications of the different peptides based on the in silico digest.
Table 1 .
Figure imgf000028_0001
The sequences in Table 1 are as follows:
Figure imgf000029_0001
Table 2 shows peptide masses obtained from MS analysis on protein band from SDS- PAGE gel in Figure 2 (guanidilated sample), see column 1 Mr (expt). Mr stands for relative molecular mass in Da. Columns 2, 3 and 4 show the calculated values (for masses matching to masses in column 1 ) from an in silico trypsin digest of the amino acid sequences of trypsin ZT-1 , trypsin ZT-2, trypsin ZT-3 and trypsin ZT-4. Column 5 shows the sequence of the peptide that give the mass value from the in silico digest. Column 6 shows modifications of the different peptides based on the in silico digest.
Figure imgf000030_0001
The sequences in Table 2 are as follows:
Figure imgf000031_0001
EXAMPLE 3.
Multiplex substrate profiling on trypsin ZT isoforms
Multiplex substrate profiling was used to analyze the substrate specificity of enzymes (proteinases) (O'Donoghue, Eroy-Reveles et al., 2012, Nat Methods 9: 1095-1 100).
Proteinases can cleave substrates at different amino residues within a peptide sequence demonstrating a difference in substrate specificity. Trypsins are specified by their preference in cleaving C-terminal to arginine or lysine residues.
Enzyme isoforms
The cod trypsin isoenzymes were separated by applying benzamidine purified cod trypsin to a MonoQ HR 5/5 ion exchange column. For isolation of trypsin I, the column was equilibrated with 20 mM Tris, 5 mM ethanolamine, 10 mM CaCI2, pH 9.1 , and the enzymes were eluted with a linear 0-200 mM NaCI gradient in 80 column volumes, linear 200-1000 mM NaCI gradient in 10 column volumes at a flow rate of 1 mL/min. The sample pH was adjusted to pH 9.1 with 1 M NaOH before application.
For isolation of trypsin ZT isoforms, the column was equilibrated with 25 mM Tris, 25 mM CaCI2,15% (vol/vol) glycerol, pH 7.5, and the enzymes were eluted with a linear 0-150 mM NaCI gradient in 5 column volumes, linear 150-550 mM NaCI gradient in 20 column volumes, linear 500-1000 mM NaCI gradient in 1 column volume at a flow rate of 1 mL/min.
The composition of both enzyme samples (trypsin ZT and trypsin I) was adjusted so the final concentration of Tris was 60 mM, CaCI2 30 mM and glycerol 15% (vol/vol) with a pH of 8.5.
Multiplex substrate profiling analysis
The purified trypsin ZT isoforms or trypsin I were incubated (5, 15 and 60 min.) with a library of peptides (124 defined peptides, 14-mer sequences, total of 1612 peptide bonds) with an extensive physiochemical diversity as described in O'Donoghue, Eroy-Reveles et al. (O'Donoghue, Eroy-Reveles et al., 2012, Nat Methods 9: 1095-1 100). After incubation, cleavage sites were identified by mass spectrometry analysis (O'Donoghue, Eroy-Reveles et al., 2012, Nat Methods 9: 1095-1 100).
Results
The multiplex substrate profiling analysis unexpectedly showed that there are numerous cleavage sites unique to trypsin ZT isoforms compared trypsin I, disclosed in WO 2000078332 (FIG 4 and Table 4). Also, cleavage sites that showed preferential cleavage by trypsin ZT isoforms compared to trypsin I were identified (Table 4). Based on the results from the multiplex substrate profiling analysis, a table containing numerical values based on standard scores (Z-score) ratio at the P4-P4' positions in the substrate was generated where the substrate specificity of trypsin ZT was compared to trypsin I (Table 3). Positive values (Z- score) reflect a preference for the amino acid residue in a certain P position in favor of trypsin ZT isoforms compared to trypsin I. Unexpectedly, multiplex substrate profiling on trypsin ZT isoforms revealed that amino acids surrounding arginine or lysine in a substrate have a different effect on its cleavage compared to trypsin I.
Table 3 shows numerical values based on standard scores (Z-score) ratio at the P4-P4' positions in the substrate comparing the substrate specificity of trypsin ZT and trypsin I after incubation for 5, 15 and 60 min. Amino acid residues in a substrate undergoing cleavage were designated P1 ,P2, P3, P4 in the N-terminal direction from the cleaved bond (Schechter and Berger, 1967, Biochem Biophys Res Commun 27: 157-162, Schechter and Berger, 1968, Biochem Biophys Res Commun 32: 898-902). The residues in C-terminal direction are designated P1 ', Ρ2', Ρ3', P4'. The P positions are provided in the columns and the rows show amino acids in the different P positions. Positive values (Z-score) in the table reflect a preference for the amino acid residue in a certain P position in favor of trypsin ZT isoforms compared to trypsin I. Negative values (Z-score) reflect a preference in favor of trypsin I compared trypsin ZT. For example, based on the values from Table 3 it can be seen that trypsin ZT is much better adapted in cleaving peptides containing several consecutive positively charged residues (arginine or lysine) compared to trypsin I. Again, those types of sequences, that is lysine- and arginine-rich amino acid sequences, are frequently found in protein toxins, proteins and peptides involved in pathogenesis (Suzuki, Orba et al., 2010, PLoS Pathog 6: e1000801 , Fentress, Steinfeldt et al., 2012, Cell Microbiol 14: 1921 -1933, Jiang, Cun et al., 2012, J Virol 86: 7256-7267, Milletti, 2012, Drug Discov Today 17: 850-860, Gallaher and Garry, 2015, Viruses 7: 285-305). As previously mentioned, trypsin ZT isoforms have therefore properties beneficial against proteins responsible for the pathogenicity of many microorganisms. Table 3.
5 min. Amino acid
Position P4 P3 P2 PI PI' P2' P3' P4'
G -0,60 0,88 0,48 0,26 -1,21 0,11 0,97 0,08
A 0,01 0,48 1,92 -0,57 2,31 1,01 -0,62 -0,14
S -0,06 -0,04 0,43 0,23 0,25 -0,52 -1,47 0,32
P -1,04 -0,59 0,39 -0,16 0,25 1,86 -0,30 -0,50
V 0,99 -1,14 -1,88 0,23 0,43 0,54 0,01 0,38
T 0,05 -1,40 0,43 0,72 0,48 -0,02 -1,39 -0,06
L -0,50 0,48 -2,26 0,25 -0,75 -0,43 0,88 0,91
1 1,42 -0,51 -0,31 0,72 -0,67 -0,36 -0,04 -0,62
N 0,95 0,93 -0,47 -0,15 -1,33 -0,79 -0,56 0,02
D 0,33 0,43 0,24 -0,48 -0,02 -0,53 -0,52 -0,69
Q -1,38 -0,89 -0,87 0,70 -0,01 -0,55 -0,01 1,10
K -0,12 0,38 1,88 -6,09 1,02 -1,11 -0,14 -0,27
E 0,38 -0,66 -0,96 0,30 -0,53 -1,06 0,48 -0,09
M -1,91 -1,27 -0,28 0,25 -0,79 -0,86 0,33 0,38
H -0,09 0,38 0,92 0,25 -0,39 0,58 0,38 1,49
F 0,49 -0,41 -0,26 0,72 -0,01 -0,42 -0,58 0,10
R -0,69 -0,09 -0,07 2,69 1,95 0,99 0,12 0,27
Y -0,60 0,75 1,04 0,23 -0,15 -0,42 0,95 -0,12
W 1,00 0,64 -0,84 -0,15 -0,59 1,00 1,36 -0,53
Table 3 continued.
15 min. Amino acid
Position P4 P3 P2 PI PI' P2' P3' P4'
G 0,33 1,65 -0,27 0,48 -0,64 0,60 1,79 -0,36
A -0,34 -0,66 1,33 -0,52 1,88 -0,60 -1,05 0,17
S 0,30 -0,41 0,73 0,44 0,51 0,03 -1,16 0,55
P 0,26 -0,62 0,23 0,12 0,54 1,70 0,66 -0,79
V 0,55 -0,08 -0,75 0,44 0,36 0,97 0,97 0,81
T 0,04 -0,25 -0,50 0,89 0,44 0,81 -1,21 -0,63
L 0,49 0,11 -1,57 0,18 0,18 0,44 0,73 0,73
1 -1,07 -0,89 -0,97 0,44 -0,54 0,12 0,32 0,04
N -0,86 0,81 0,96 0,89 -1,50 0,67 -1,74 -0,89
D -1,45 -0,43 0,07 -0,03 0,11 -2,02 0,42 -0,76
Q -0,32 -0,71 -1,07 0,89 -0,28 -0,49 0,43 0,73
K -0,72 -0,16 1,35 -6,74 0,96 -1,11 0,25 0,48
E 0,25 -0,72 -0,01 0,54 -0,39 -1,35 -1,49 0,25
M -0,89 -0,59 -0,16 0,47 0,25 -2,23 0,19 1,55
H 0,33 0,26 1,26 0,89 -0,67 0,29 -0,19 0,40
F 1,34 0,15 -0,82 0,89 -0,33 -0,36 -0,26 0,20
R -0,67 -0,17 -0,82 -1,11 2,17 1,35 0,65 -0,78
Y 0,30 0,40 0,58 0,44 -1,00 0,57 0,89 -1,07
W 0,49 -0,26 -1,38 0,13 -1,83 -0,57 0,36 0,50
Table 3 continued.
60 min. Amino acid
Position P4 P3 P2 PI PI' P2' P3' P4'
G 0,45 0,80 -1,05 0,26 -0,27 0,71 0,65 -0,93
A 0,05 -0,74 1,65 -0,30 2,33 0,39 -0,43 -1,56
S -0,30 0,57 0,52 0,52 0,60 -1,19 -0,08 0,59
P -0,72 0,42 -1,24 -0,05 0,90 2,28 -0,28 -0,57
V -0,25 0,51 -0,09 0,84 -0,55 1,03 -0,19 0,91
T 0,49 -0,07 0,91 0,52 -0,54 0,80 -1,21 0,13
L -0,23 -0,47 -0,73 -0,06 0,66 0,22 0,41 0,38
1 -0,73 -0,53 0,04 0,20 0,44 0,20 0,85 0,61
N -0,90 0,15 0,28 -0,05 -1,49 -0,43 -1,18 -0,18
D -1,33 -0,03 -0,16 1,32 -0,70 -1,42 -0,26 0,67
Q 0,63 -0,44 -1,36 0,85 0,33 -0,17 -1,15 1,09
K 0,43 -0,02 1,24 -7,02 0,97 -1,46 0,73 0,90
E -0,01 -1,45 -0,21 0,54 -1,36 -1,64 -1,11 -0,36
M -1,39 -0,36 0,01 0,24 -0,24 -0,93 -0,37 0,79
H 0,79 -1,38 1,23 0,85 -1,06 -0,30 0,47 0,57
F 0,48 0,15 -1,67 0,52 -0,06 0,19 0,85 -0,07
R -0,46 -0,02 -0,91 -0,91 1,67 0,91 1,50 -0,11
Y 0,73 0,41 0,25 0,52 -1,36 0,58 1,60 -2,25
W 0,85 1,02 0,09 0,90 -0,21 0,03 -0,49 -0,42
Table 4 shows precursor ion intensities of selected peptides from multiplex profiling after incubation with trypsin ZT or with trypsin I. The precursor ion intensities are peptide peak intensities in the MS before fragmentation that represent a measure of relative abundance for a given species. X in peptide sequence denotes a placeholder for the absence of an amino acid in a peptide sequence. The data shows that trypsin ZT isoforms are exclusively able to cleave three peptide sequences (QGKKAPXX, WGNRSPLE and QAVRPNGM) compared to trypsin I. Furthermore, the data show that trypsin ZT isoforms preferentially cleave two peptides compared to trypsin I. Trypsin ZT isoforms were able to cleave XIARQPWN within 5 minutes and FDNRVGKW within 15 minutes whereas cleavage within these two peptides was only detected with trypsin I after 60 minute incubation.
Table 4.
Figure imgf000037_0001
EXAMPLE 4.
Purification of cod trypsin ZT isoforms from concentrated cod viscera extract
About 12 liters of ultrafiltered and diafiltered concentrate as obtained in Example 1 was applied to a continuous connected series of about 1 liter packed chromatography columns, the first containing a CM fast flow cation exchange resin (GE healthcare), the second one a p-aminobenzamidine affinity ligand coupled to a sepharose resin (GE healthcare) and the third one DEAE fast flow anion exchange resin (GE healthcare). The CM and p- aminobenzamidine columns were pre-equilibrated with about 10 column volumes of 25 mM Tris buffer of pH 7.8, containing 2.5 mM calcium chloride. The concentrate was pumped onto the CM and p-aminobenzamidine columns at a flow rate of about 100 ml per minute. When the application of the concentrated solution onto the columns was completed, residual material was washed off the continuous column system with about 8 liters of buffer A. After this wash was completed, the p-aminobenzamidine affinity column was disconnected from the CM column and washed with about 5 column volumes of a high salt solution of 25 mM Tris buffer pH 7.5 containing 0.5 M NaCI and 2.5 mM calcium chloride. The cod trypsins were then desorbed from the affinity ligand and eluted off the column with an acid solution of 25 mM acetic acid pH 3.2 containing 10 mM calcium chloride and 30% glycerol. The cod trypsin fraction was collected into a neutralizing buffer of 200 mM Tris pH 8.5 containing 30% glycerol. The DEAE anion exchange column was pre-equilibrated with about 10 column volumes of 25 mM Tris buffer of pH 7.8, containing 2.5 mM calcium chloride. The cod trypsin fraction was applied to the DEAE anion exchange resin and washed with about 5 column volumes of the equilibration buffer. Trypsin ZT isoforms were then desorbed from the column using up to a 0.9 M NaCI gradient salt solution. The purified cod trypsin ZT isoform preparation was homogeneous by SDS PAGE electrophoresis and FPLC Mono Q
chromatography. The purified preparation was filter-sterilized through a 0.22 micron filter and stored frozen at about -20°C. EXAMPLE 5.
Preparation of a hydrogel preparation of cod trypsins, including cod trypsin ZT isoforms
The purified cod trypsin ZT isoform containing preparation of Example 2 was mixed with hydrocolloid gel comprising an aqueous gel containing 0.8% w/v Carbomer 940 and 40% glycerol. The cod trypsin preparation was mixed in a 1 :1 ratio with the hydrogel to give a final concentration of 4 enzyme unit per mg (U/mg) of the final gel-enzyme mixture (the enzyme hydrogel ointment), the enzyme unit being determined using Cbz- GPR-pNA as substrate as previously described. Thus, the resulting enzyme hydrogel ointment contained about 0.01 mg/ml, or 1 U/ml of the cod trypsin enzymes, 0.4% Carbomer 940, 20% glycerol and 0.04% paraoxybenzoate. EXAMPLE 6.
Antiviral activity of trypsin ZT isoforms against enterovirus as a model for rhinovirus
Picornaviruses are small single-stranded positive sense RNA viruses that lack a lipid envelope. Enterovirus and rhinovirus are two genera of Picornaviridae. Enterovirus replicates initially in the oropharynx and survives the acidic environment of the stomach. The small intestine is the major invasion site of enterovirus. Rhinovirus replicates in the nasal passages but is destroyed in the acidic environment of the stomach. Rhinovirus and enterovirus have an identical morphology but can be distinguished based on clinical, biophysical and epidemiological studies. Rhinovirus is problematic to handle in cell cultures (Racaniello, 2007, Fields virology, 5th ed: 795-838). Therefore, enterovirus was used as a model for rhinovirus to analyze the antiviral properties of trypsin ZT isoforms.
Materials and Methods
Enterovirus stock solution
Enterovirus (Coxsackievirus B2) was isolated from a patient at the University Hospital of Iceland, department of Virology and grown in MA-104 cells (African green monkey kidney cells) or Vero cells (African green monkey kidney cells). The Coxsackievirus B2 was titrated (TCIDso = 8,23) according to Reed-Muench (REED and MUENCH, 1938, American Journal of Epidemiology 27: 493-497). Enzyme isoforms
Cod trypsin isoenzymes were separated by applying benzamidine purified cod trypsin to a MonoQ HR 5/5 ion exchange column. For isolation of trypsin ZT isoforms, the column was equilibrated with 25 mM Tris, 25 mM CaCI2, pH 7.5, and the enzymes were eluted with a linear 0-400 mM NaCI gradient in 5 column volumes, linear 400-1000 mM NaCI in 20 column volumes at a flow rate of 1 mL/min. Treatment
The MA-104 cells were grown in a 96-well microtiter plate to 95% confluency. The enterovirus was diluted from a stock solution to 10"6 using minimum essential medium (MEM) and 1 .5 mL of the diluted solution was placed in two different vials. The vials were treated with 1 .5 mL of trypsin ZT isoforms and 1.5 mL MEM as positive control. Negative control was MEM (3 mL) without virus. All vials were incubated at 34 °C and 5% C02 for 90 min before adding 100 μί of benzamidine agarose solution to remove residual trypsin and incubated for another 30 min. The solution was centrifuged at 5500 rpm for 3 min before placing 2 mL of the supernatant into an Eppendorf vial. 200 μί of the solution was placed in each well, total of 10 wells in the microtiter plate. The plate was incubated for 30 min. After incubation, the media was thrown off and MEM with 1 % newborn calf serum (NCS) added to all the wells. A microscope was used to monitor for the presence of infection.
Results
Trypsin ZT isoforms were very effective as antiviral agents against enterovirus
(Coxsackievirus B2) that was used as a model for rhinovirus. The results are presented FIG 5.

Claims

Claims
1 . An isolated cod trypsin ZT isoform comprising an amino acid sequence according to SEQ ID NO:1 , or an amino acid sequence with 80% sequence homology or more, thereof.
2. The isolated cod trypsin ZT isoform according to claim 1 , selected from cod trypsin ZT-1 , comprising an amino acid sequence according to SEQ ID NO:2; cod trypsin ZT- 2 comprising an amino acid sequence according to SEQ ID NO:3; cod trypsin ZT-3 comprising an amino acid sequence according to SEQ ID NO:4; and cod trypsin ZT-4 comprising an amino acid sequence according to SEQ ID NO:5, or an amino acid sequence with 80% sequence homology or more, thereof.
3. A composition comprising at least one cod trypsin ZT isoform according to claim 1 or 2, together with suitable excipients and carriers.
4. The composition according to claim 3, wherein said cod trypsin ZT isoform(s) are present in admixture with other cod trypsins.
5. The composition according to claim 4, wherein said cod trypsin ZT isoform(s)
comprises at least 5% (w/w) of the total content of cod trypsins in said composition.
6. The composition according to any one of claims 3 to 5, which is administered
topically, as a lotion, a hydrogel, a mouth spray or a nasal spray.
7. The composition according to any one of claims 3 to 6, further comprising a
polyvalent alcohol, such as glycerol.
8. A composition according to any one of claims 3 to 7, for use in therapy.
9. A composition according to any one of claims 3 to 7, for use in treating or preventing a disease caused by a pathogenic organism selected from the group consisting of a virus, a bacterium, a fungus, a parasite and a protozoan.
10. A composition according to any one of claims 3 to 7, for use in treating or preventing a disease in the upper respiratory tract caused by pathogenic organisms such as viruses, bacteria and fungus.
1 1 . A composition according to any one of claims 3 to 7, for use in treating or preventing pain, acute inflammation, chronic inflammation, arthritis, inflamed joints, bursitis, osteoarthritis, rheumatoid arthritis, juvenile rheumatoid arthritis, septic arthritis, fibromyalgia, systemic lupus erythematosus, phlebitis, tendinitis, rash, psoriasis, acne, eczema, facial seborrheic eczema, eczema of the hands, face or neck, foreskin infections, athlete's foot, fistulae infections, infected topical ulcers, navel infections in newborns, wrinkles, scars, kelloids, boils, warts and allergic itch, hemorrhoids, a fungal infection and an immunological disorder including an autoimmune disease.
12. A composition according to any one of claims 3 to 7, for use in the treatment of
wound infections and wounds from burns.
13. A composition according to any one of claims 3 to 7, for use in removing dead or peeling skin from otherwise healthy skin.
14. A composition according to any one of claims 3 to 7, for cosmetic use.
15. The composition for cosmetic use, according claim 14, said composition further comprising an additional cosmetically active compound.
16. A method of treating disease, comprising administering a therapeutically effective amount of a composition according to any one of claims 3 to 7, to a patient in need thereof.
17. The method according claim 16, wherein said disease is caused by a pathogenic organism selected from the group consisting of a virus, a bacterium, a fungus, a parasite and a protozoan.
18. The method according claim 16, wherein said disease is a disease in the upper respiratory tract caused by pathogenic organisms such as viruses and bacteria.
19. The method according claim 16, wherein said disease is selected from pain, acute inflammation, chronic inflammation, arthritis, inflamed joints, bursitis, osteoarthritis, rheumatoid arthritis, juvenile rheumatoid arthritis, septic arthritis, fibromyalgia, systemic lupus erythematosus, phlebitis, tendinitis, rash, psoriasis, acne, eczema, facial seborrheic eczema, eczema of the hands, face or neck, foreskin infections, athlete's foot, fistulae infections, infected topical ulcers, navel infections in newborns, wrinkles, scars, kelloids, boils, warts and allergic itch, hemorrhoids, a fungal infection and an immunological disorder including an autoimmune disease.
20. The method according claim 16, wherein said disease is wound infections or wounds from burns.
21 . A method of preparing cod trypsin ZT isoforms comprising an amino acid sequence according to any one of SEQ ID NO:2 to SEQ ID NO:5, comprising
(i) preparing an aqueous extract of cod viscera,
(ii) subjecting the aqueous extract to at least one or chromatography step,
including an affinity chromatography step using a p-aminobenzamidine affinity ligand, and
(iii) desorbing and eluting cod trypsin ZT isoforms bound to the p- aminobenzamidine affinity ligand.
22. The method according to claim 21 , further comprising at least one step using an anionic exchange resin after said affinity chromatography step (ii).
23. The method according to claim 21 , further comprising at least one step using a cation exchange resin prior to the affinity chromatography step (ii).
24. The method according to any one of claims 21 to 23, wherein said desorbed and eluted cod trypsin ZT isoforms are sterile filtered using a filter with 0.45 μηη or smaller pore size.
25. The method according to any one of claims 21 to 24, wherein said cod trypsin ZT isoforms are selected from trypsin ZT-1 , comprising an amino acid sequence according to SEQ ID NO:2; trypsin ZT-2 comprising an amino acid sequence according to SEQ ID NO:3; trypsin ZT-3 comprising an amino acid sequence according to SEQ ID NO:4; and trypsin ZT-4, comprising an amino acid sequence according to SEQ ID NO:5, or a mixture thereof.
PCT/EP2016/067531 2015-07-24 2016-07-22 Novel trypsin isoforms and their use Ceased WO2017017012A1 (en)

Priority Applications (20)

Application Number Priority Date Filing Date Title
CN201680042929.8A CN107849551B (en) 2015-07-24 2016-07-22 Novel trypsin isoforms and uses thereof
HRP20201290TT HRP20201290T1 (en) 2015-07-24 2016-07-22 NEW FORMS OF TRIPSIN AND THEIR USES
CN202111184339.8A CN113846079B (en) 2015-07-24 2016-07-22 Novel trypsin isoforms and uses thereof
KR1020187004156A KR20180032588A (en) 2015-07-24 2016-07-22 Novel trypsin isoforms and uses thereof
RU2018106533A RU2739945C2 (en) 2015-07-24 2016-07-22 Novel trypsin isoforms and use thereof
EP20169710.9A EP3736331A1 (en) 2015-07-24 2016-07-22 Novel trypsin isoforms and their use
BR112018001404-4A BR112018001404A2 (en) 2015-07-24 2016-07-22 innovative trypsin isoforms and their use
RS20201012A RS60711B1 (en) 2015-07-24 2016-07-22 Novel trypsin isoforms and their use
MX2018000570A MX390126B (en) 2015-07-24 2016-07-22 NEW TRYPSIN ISOFORMS AND THEIR USE.
AU2016299760A AU2016299760B2 (en) 2015-07-24 2016-07-22 Novel trypsin isoforms and their use
PL16745663T PL3325618T3 (en) 2015-07-24 2016-07-22 Novel trypsin isoforms and their use
DK16745663.1T DK3325618T3 (en) 2015-07-24 2016-07-22 Novel trypsin isoforms and their use
ES16745663T ES2813551T3 (en) 2015-07-24 2016-07-22 New isoforms of trypsin and their use
US15/746,897 US11179311B2 (en) 2015-07-24 2016-07-22 Trypsin isoforms and their use
SI201630894T SI3325618T1 (en) 2015-07-24 2016-07-22 Novel trypsin isoforms and their use
CA2992821A CA2992821A1 (en) 2015-07-24 2016-07-22 Novel trypsin isoforms and their use
EP16745663.1A EP3325618B1 (en) 2015-07-24 2016-07-22 Novel trypsin isoforms and their use
JP2018522869A JP6869979B2 (en) 2015-07-24 2016-07-22 New trypsin isoforms and their use
DKPA201870049A DK180405B1 (en) 2015-07-24 2018-01-24 Novel trypsin isoforms and their use
US17/502,921 US11918674B2 (en) 2015-07-24 2021-10-15 Trypsin isoforms and their use

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
EP15178208.3 2015-07-24
EP15178208.3A EP3121272A1 (en) 2015-07-24 2015-07-24 Novel fish trypsin isoforms and their use

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US15/746,897 A-371-Of-International US11179311B2 (en) 2015-07-24 2016-07-22 Trypsin isoforms and their use
US17/502,921 Division US11918674B2 (en) 2015-07-24 2021-10-15 Trypsin isoforms and their use

Publications (1)

Publication Number Publication Date
WO2017017012A1 true WO2017017012A1 (en) 2017-02-02

Family

ID=53758073

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2016/067531 Ceased WO2017017012A1 (en) 2015-07-24 2016-07-22 Novel trypsin isoforms and their use

Country Status (19)

Country Link
US (2) US11179311B2 (en)
EP (3) EP3121272A1 (en)
JP (2) JP6869979B2 (en)
KR (1) KR20180032588A (en)
CN (2) CN107849551B (en)
AU (1) AU2016299760B2 (en)
BR (1) BR112018001404A2 (en)
CA (1) CA2992821A1 (en)
DK (3) DK3325618T3 (en)
ES (1) ES2813551T3 (en)
HR (1) HRP20201290T1 (en)
HU (1) HUE050121T2 (en)
MX (1) MX390126B (en)
PL (1) PL3325618T3 (en)
PT (1) PT3325618T (en)
RS (1) RS60711B1 (en)
RU (1) RU2739945C2 (en)
SI (1) SI3325618T1 (en)
WO (1) WO2017017012A1 (en)

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2018138292A1 (en) 2017-01-26 2018-08-02 Enzymatica Ab A polypeptide having protease activity for use in treating otitis
WO2019135003A1 (en) 2018-01-08 2019-07-11 Enzymatica Ab Peptides having protease activity for use in the treatment or prevention of coronavirus infection
WO2019154937A1 (en) 2018-02-07 2019-08-15 Enzymatica Ab Esters of hydroxy-benzoic acids for use in the treatment of rhinovirus
US11179311B2 (en) 2015-07-24 2021-11-23 Enzymatica Ab Trypsin isoforms and their use
RU2783315C2 (en) * 2018-02-22 2022-11-11 Санофи-Авентис Дойчланд Гмбх Porcine trypsin options

Families Citing this family (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP3387844B2 (en) 1999-01-29 2003-03-17 株式会社ノダ Structure for storing timber and flooring
US20190201344A1 (en) * 2017-12-28 2019-07-04 Consegna Pharma Inc. Long acting opioid antagonists
CA3139871A1 (en) * 2019-05-13 2020-11-19 Bioseutica B.V. Purified fish proteases with high specific activities and its process of production
US11441261B2 (en) 2020-09-10 2022-09-13 WABESO Enhanced Enzymatics, Inc. Self-sterilizing fabrics incorporating anti-viral cold-active proteases
EP4380549B1 (en) * 2021-08-03 2024-11-13 ZYMIQ Technology AB Peptidase formulation for treatment of microbial infections in the upper respiratory tract
WO2024044679A2 (en) * 2022-08-24 2024-02-29 Ohio State Innovation Foundation Methods of synthesizing peptides with free n-terminal cysteine and products thereof

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2000078332A2 (en) * 1999-06-18 2000-12-28 Jon Bragi Bjarnason Fish serine proteinases and their pharmaceutical and cosmetic use

Family Cites Families (15)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
SE8302268L (en) 1983-04-22 1984-10-23 Lars G I Hellgren NEW COMBINATION OF PROTEOLYTIC AND LIPOLYTIC ENZYMES SUITABLE AS A LAUNCH COMPOSITION
JPS59501908A (en) 1982-10-25 1984-11-15 ヘルグレン・ラルス・グスタ−ヴ・インゲ Enzyme composition for cleaning
SE454566B (en) 1984-04-24 1988-05-16 Lars G I Hellgren PHARMACEUTICAL COMPOSITION CONTAINING AN ACTIVE AMOUNT OF WATER-SOLUBLE PROTEINASES EXTRACTED FROM A WATER-LIVING ANIMAL SELECTED BY THE EUPHAUSIACEAE OR GENERAL MALLOTUS
JPS6130527A (en) 1984-07-20 1986-02-12 Kao Corp Thrombolytic agent
US6030612A (en) 1994-11-22 2000-02-29 Phairson Medical Inc. Antimicrobial uses of multifunctional enzyme
US7070953B1 (en) 1999-10-20 2006-07-04 Nordur Ehf Protein hydrolysates produced with the use of cod proteases
RU2286171C1 (en) * 2005-04-12 2006-10-27 Эдуард Артемович Макарян Preparation for preventing and treating respiratory and gastrointestinal infectious diseases of bacterial and viral etiology in farm animals and method for preventing and treating respiratory and gastrointestinal infectious diseases of bacterial and viral etiology in farm animals
NZ596269A (en) * 2006-07-05 2012-12-21 Catalyst Biosciences Inc Protease screening methods and proteases identified thereby
CN101250574A (en) * 2007-03-22 2008-08-27 中国海洋大学 A kind of preparation method of step molecular weight cod skin collagen peptide
WO2011063394A2 (en) 2009-11-23 2011-05-26 Olmstead Stephen F Compositions and methods comprising serratia peptidase for inhibition and treatment of biofilms related to certain conditions
GB0921288D0 (en) * 2009-12-04 2010-01-20 Health Prot Agency Therapies for preventing or suppressing clostridium difficile infection
WO2012164380A2 (en) 2011-05-31 2012-12-06 Hutchison Biofilm Medical Solutions Limited Dispersion and detachment of cell aggregates
CN102228126B (en) * 2011-06-10 2013-03-13 天津市虎豹调味品酿造有限公司何庄分公司 Method for preparing cod bone protein hydrolysate
CN103320485B (en) * 2013-06-03 2015-12-23 王南平 A kind of preparation method of fish-skin collagen for medical biomaterial
EP3121272A1 (en) * 2015-07-24 2017-01-25 Zymetech ehf. Novel fish trypsin isoforms and their use

Patent Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2000078332A2 (en) * 1999-06-18 2000-12-28 Jon Bragi Bjarnason Fish serine proteinases and their pharmaceutical and cosmetic use

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
DATABASE UniProt [online] 24 June 2015 (2015-06-24), XP002751139, Database accession no. Q8JFQ7 *
SPILLIAERT R ET AL: "Atlantic cod trypsin Y-member of a novel trypsin group", 1 January 1999, MARINE BIOTECHNOLOGY, SPRINGER VERLAG, NEW YORK, NY, US, PAGE(S) 598 - 607, ISSN: 1436-2228, XP009187291 *

Cited By (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11179311B2 (en) 2015-07-24 2021-11-23 Enzymatica Ab Trypsin isoforms and their use
US11918674B2 (en) 2015-07-24 2024-03-05 Enzymatica Ab Trypsin isoforms and their use
WO2018138292A1 (en) 2017-01-26 2018-08-02 Enzymatica Ab A polypeptide having protease activity for use in treating otitis
WO2019135003A1 (en) 2018-01-08 2019-07-11 Enzymatica Ab Peptides having protease activity for use in the treatment or prevention of coronavirus infection
CN111565743A (en) * 2018-01-08 2020-08-21 酶公司 Peptides for treating or preventing protease activity of coronavirus infection
WO2019154937A1 (en) 2018-02-07 2019-08-15 Enzymatica Ab Esters of hydroxy-benzoic acids for use in the treatment of rhinovirus
RU2783315C2 (en) * 2018-02-22 2022-11-11 Санофи-Авентис Дойчланд Гмбх Porcine trypsin options

Also Published As

Publication number Publication date
RU2018106533A (en) 2019-08-26
JP2021106603A (en) 2021-07-29
DK201870049A1 (en) 2018-02-05
US20200197288A1 (en) 2020-06-25
JP2018520707A (en) 2018-08-02
EP3325618B1 (en) 2020-05-27
DK181080B1 (en) 2022-11-29
PT3325618T (en) 2020-09-04
MX390126B (en) 2025-03-20
HUE050121T2 (en) 2020-11-30
RS60711B1 (en) 2020-09-30
KR20180032588A (en) 2018-03-30
US11918674B2 (en) 2024-03-05
CA2992821A1 (en) 2017-02-02
AU2016299760B2 (en) 2021-11-18
SI3325618T1 (en) 2020-12-31
CN113846079A (en) 2021-12-28
EP3325618A1 (en) 2018-05-30
CN107849551A (en) 2018-03-27
DK180405B1 (en) 2021-04-14
MX2018000570A (en) 2018-08-09
RU2018106533A3 (en) 2020-01-30
AU2016299760A1 (en) 2018-02-01
US11179311B2 (en) 2021-11-23
CN107849551B (en) 2021-11-02
PL3325618T3 (en) 2020-11-16
JP7116823B2 (en) 2022-08-10
EP3121272A1 (en) 2017-01-25
BR112018001404A2 (en) 2018-09-11
CN113846079B (en) 2024-12-03
RU2739945C2 (en) 2020-12-30
EP3736331A1 (en) 2020-11-11
US20220062148A1 (en) 2022-03-03
JP6869979B2 (en) 2021-05-12
DK202070808A1 (en) 2021-02-26
ES2813551T3 (en) 2021-03-24
DK3325618T3 (en) 2020-08-10
RU2020142400A (en) 2021-02-11
HRP20201290T1 (en) 2020-11-13

Similar Documents

Publication Publication Date Title
US11918674B2 (en) Trypsin isoforms and their use
CN1356907A (en) Fish serine protease and its application in pharmacy and cosmetics
KR101853463B1 (en) Method for purifying botulinum toxin
CN1824301A (en) Purified ustading and its preparation method and medicinal composition containing said ustading
AU2008323041A1 (en) New synthetic arginine substituted peptides and their use
CN104560924B (en) A kind of pillworm fibrinolysin and its application
CN120040553A (en) Anti-aging composition containing plant polypeptide and preparation method thereof
CN106167797B (en) Freeze-dried preparation of human plasminogen and preparation method thereof
RU2814729C2 (en) Novel isoform of trypsin and use thereof
CN104892723B (en) Preparation method of hairtail liver antibacterial peptide
JPH029600B2 (en)
RU2268736C1 (en) Method for production of alpha-1-antitrypsin and product useful in medicine
JP2915032B2 (en) Novel Serine Protease Inhibitor Protein, Pharmaceuticals Containing the Same, DNA Sequence Encoding for the Protein, and Methods for Producing These Proteins, Pharmaceuticals and DNA Sequences
CN1336385A (en) Giant well bombinator proteinase inhibitor and its prepn. and pharmaceutical application
CN117964693A (en) Chlorella blood pressure lowering peptide and its composition, preparation method and application
CN122011105A (en) ACE (angiotensin converting enzyme) inhibitory peptide and application thereof
CN120699137A (en) A method for efficiently extracting hirudin from living leeches
JPH07233197A (en) PROTEIN HAVING CELL GROWTH PROMOTING ACTION AND MACROPHAGE MIGRATION ACTIVITY, PROCESS AND USE THEREOF

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 16745663

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: MX/A/2018/000570

Country of ref document: MX

ENP Entry into the national phase

Ref document number: 2992821

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2018522869

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 122021011489

Country of ref document: BR

WWE Wipo information: entry into national phase

Ref document number: PA202070808

Country of ref document: DK

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2016299760

Country of ref document: AU

Date of ref document: 20160722

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 20187004156

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2018106533

Country of ref document: RU

Ref document number: 2016745663

Country of ref document: EP

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112018001404

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 112018001404

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20180123