WO2017011338A1 - Sortase-mediated coupling of immunogenic polysaccharide-protein conjugates and their use - Google Patents

Sortase-mediated coupling of immunogenic polysaccharide-protein conjugates and their use Download PDF

Info

Publication number
WO2017011338A1
WO2017011338A1 PCT/US2016/041608 US2016041608W WO2017011338A1 WO 2017011338 A1 WO2017011338 A1 WO 2017011338A1 US 2016041608 W US2016041608 W US 2016041608W WO 2017011338 A1 WO2017011338 A1 WO 2017011338A1
Authority
WO
WIPO (PCT)
Prior art keywords
sortase
immunogenic composition
polysaccharide
antigen
carrier protein
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2016/041608
Other languages
French (fr)
Inventor
John J. Mekalanos
Jeremy Andrew IWASHKIW
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Harvard University
Original Assignee
Harvard University
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Harvard University filed Critical Harvard University
Publication of WO2017011338A1 publication Critical patent/WO2017011338A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/02Bacterial antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/02Bacterial antigens
    • A61K39/09Lactobacillales, e.g. aerococcus, enterococcus, lactobacillus, lactococcus, streptococcus
    • A61K39/092Streptococcus
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/195Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K19/00Hybrid peptides, i.e. peptides covalently bound to nucleic acids, or non-covalently bound protein-protein complexes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/60Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
    • A61K2039/6031Proteins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/62Medicinal preparations containing antigens or antibodies characterised by the link between antigen and carrier
    • A61K2039/627Medicinal preparations containing antigens or antibodies characterised by the link between antigen and carrier characterised by the linker
    • YGENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02ATECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
    • Y02A50/00TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
    • Y02A50/30Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change

Definitions

  • the invention relates to immunogenic polysaccharide-protein conjugates, a novel sortase- mediated method of making immunogenic polysaccharide-protein conjugates, and methods of administering immunogenic polysaccharide-protein conjugates.
  • Capsules are surface components of microbes that are typically composed of polymers of organic compounds such as carbohydrates, amino acids, or alcohols. Capsules are quite diverse chemically. The monomeric units that make up capsules (e.g., carbohydrates) can be linked together in various molecular configurations and can be further substituted with phosphate, nitrogen, sulfate, and other chemical modifications. These chemical variations allow capsules to present numerous antigenic targets on the microbial surface, thus allowing escape from the host immune response directed at these targets.
  • Capsules can also be virulence factors which prevent microbes from being phagocytosed and killed by host macrophages and polymorphonuclear leukocytes.
  • Antibodies against capsules provide a potent defense against encapsulated organisms by fixing complement to the microbial surface, which can result in their lysis or their opsonization, uptake, and killing by phagocytic host immune cells.
  • the most potent antibodies against capsules are IgG antibodies.
  • Capsules that fail to induce significant levels of IgG are called T-independent antigens. Covalent coupling of a protein to capsules renders them "T- dependent" and such antigens can elicit an IgG response.
  • immunogenic conjugates directed to capsules and other T-independent antigens that do not evoke strong immune responses or IgG antibodies.
  • immunogenic conjugates are needed to protect against various infectious diseases such as infection by anthrax, pneumococcus, influenzae Type B, meningococcus, and streptococcus.
  • the present invention relates to immunogenic compositions containing a polysaccharide antigen conjugated with a carrier protein in a complex, methods of making such immunogenic compositions, and methods of administering such immunogenic compositions.
  • the invention features an immunogenic composition including a polysaccharide- sortase conjugate, wherein the polysaccharide is an antigen and the sortase is a carrier protein, and wherein the sortase is covalently linked to the polysaccharide antigen through a linker containing a sortase recognition sequence.
  • the invention features an immunogenic composition including a
  • polysaccharide-protein conjugate including a polysaccharide antigen and a carrier protein, wherein the polysaccharide antigen is covalently linked to the carrier protein through a linker containing a sortase recognition sequence and a polyglycine motif present at the N-terminus of the carrier protein.
  • the immunogenic composition includes a sortase selected from sortase A, sortase B, sortase C, and sortase D.
  • the immunogenic composition may include a sortase A, or a fragment thereof.
  • the immunogenic composition may include sortase A having the amino acid sequence of SEQ ID NO: 1 .
  • the immunogenic composition may include a sortase having an amino acid sequence that has at least 90% identity to the amino acid sequence of SEQ ID NO: 1 .
  • the immunogenic composition may include a sortase having an amino acid sequence that has at least 95% identity to the amino acid sequence of SEQ ID NO: 1 .
  • the immunogenic composition may include a sortase having an amino acid sequence that has at least 99% identity to the amino acid sequence of SEQ ID NO: 1 .
  • the immunogenic composition may include a sortase B, or a fragment thereof.
  • the immunogenic composition may include a sortase C, or a fragment thereof.
  • the immunogenic composition may include a sortase D, or a fragment thereof.
  • the immunogenic composition may include a sortase including at least one mutation.
  • the immunogenic composition may include a sortase that includes a substitution.
  • the immunogenic composition may include the sortase recognition sequence having the formula X1 PX2X3 X4, where X1 -X4 are any amino acid.
  • the immunogenic composition may further include the sortase recognition sequence having the formula X1 PX2X3G for a sortase A substrate, where Xi is Leu, lie, Val or Met, X2 is any amino acid, and X3 is Ser, Thr or Ala.
  • the immunogenic composition may include the sortase recognition sequence LPX1TG for a sortase A substrate, where Xi is any amino acid.
  • the immunogenic composition may include the sortase recognition sequence NPX1TX2 for a sortase B substrate, where Xi is Lys or Gin and X2 is Asn, Asp, or Gly.
  • the immunogenic composition may include the sortase recognition sequence LPX1TX2 for a sortase C substrate, where Xi and X ⁇ are any amino acid.
  • the immunogenic composition may include the sortase recognition sequence LPX1TA for a sortase D substrate, where Xi is any amino acid.
  • the immunogenic composition may include the sortase recognition sequence, LAX1TG for a sortase D substrate, where Xi is any amino acid.
  • the invention features an immunogenic composition where the polyglyci motif includes an amino acid sequence selected from GG, GGG, GGGG, and GGGGG.
  • the invention further includes an immunogenic composition where the polyglycine motif includes the amino acid sequence GGGGG.
  • the sortase recognition sequence is linked to the polysaccharide through Z 1 -C(Z 3 )-N(H)-N(H)-(-C(0)-(L-C(0))n-N(H)-N(H)-)m-Z 2 ,
  • Z 2 is a bond to a carbonyl group in the sortase recognition sequence
  • Z 3 is O or NH
  • each of n and m is 0 or 1 , and
  • L when present, is C2-6 alkanediyl or Ce- ⁇ arenediyl.
  • the immunogenic composition of the invention includes carrier protein molecules that are selected from diphtheria toxin, diphtheria toxoid, tetanus toxin, tetanus toxoid, Pseudomonas aeruginosa exotoxin A, cholera toxin B subunit, tetanus toxin fragment C, bacterial flagellin, pneumolysin, an outer membrane protein of Neisseria menningitidis, Pseudomonas aeruginosa Hcp1 protein, Escherichia coli heat labile enterotoxin, shiga-like toxin, human LTB protein, pneumolysin, listeriolysin O, a protein extract from whole bacterial cells, the dominant negative mutant (DNI) of the protective antigen of Bacillus anthracis, and Escherichia coli beta-galactosidase.
  • carrier protein molecules that are selected from diphtheria tox
  • the invention also features an immunogenic composition where the whole bacterial cells are Pseudomonas aeruginosa or Streptococcal cells.
  • the invention includes an immunogenic composition where the bacterial flagellin is the Vibrio cholerae flagellin protein.
  • the invention includes an immunogenic composition where the shiga-like toxin is the Shigella SltB2 protein.
  • the immunogenic composition includes an antigen of interest where the antigen of interest is a polysaccharide, a polyalcohol, or a poly amino acid.
  • the polysaccharide of the immunogenic composition may include at least 18 residues.
  • the polysaccharide of the immunogenic composition may include a Streptococcus pneumoniae polysaccharide, Francisella tularensis polysaccharide, Bacillus anthracis polysaccharide, Haemophilus influenzae polysaccharide, Salmonella typhi polysaccharide, Salmonella species polysaccharide, Shigella polysaccharide, or Neisseria meningitidis polysaccharide.
  • the Streptococcus pneumoniae polysaccharide of the immunogenic composition may be a capsular type 1 , 2, 3, 4, 5, 6A, 6B, 7A, 7B, 7C, 7F, 8, 9A, 9L, 9N, 9V, 10A, 10B, 10F, 1 1 A, 1 1 B, 1 1 C, 1 1 D, 1 1 F, 12A, 12B, 12F, 13, 14, 15A, 15B, 15C, 15F, 16A, 16F, 17A, 17F, 18A, 18B, 18C, 18F, 19A, 19B, 19C, 1 9F, 20, 21 , 22F, 23B, 23F, 24A, 24B, 24F, 25A, 25F, 27, 28A, 28F, 29, 31 , 32A, 32F, 33A, 33B, 33D, 33F, 34, 35A, 35B, 35F, 36, 37, 38, 39, 40, 41 A, 41 F, 42, 43, 44, 45, 46, 47A, 47F, or
  • the antigen of interest of the immunogenic composition is a microbial capsular polymer.
  • the microbial capsular polymer of the immunogenic composition may include a poly- gamma-D-glutamic acid from Bacillus anthracis.
  • the antigen of interest of the immunogenic composition may also include an organic polymer consisting of monomers having at least three atoms where each of the atoms is independently selected from carbon, oxygen, hydrogen, phosphate, nitrogen, and sulfate.
  • the antigen of interest may include an organic polymer that is obtained from a microbe and/or does not occur in nature.
  • the immunogenic composition may further include, e.g., a second antigen of interest or a third antigen of interest.
  • the immunogenic composition may include an antigen of interest including whole cell pathogens where the whole cell pathogens include heat inactivated whole cell pathogens; chemically inactivated whole cell pathogens; and/or Pseudomonas aeruginosa or Streptococcal cells, wherein the Streptococcal cells include Streptococcus pneumonia.
  • the immunogenic composition may further include whole cell pathogens from Streptococcus pneumonia type 1 , 2, 3, 4, 5, 6A, 6B, 7A, 7B, 7C, 7F, 8, 9A, 9L, 9N, 9V, 10A, 10B, 10F, 1 1 A, 1 1 B, 1 C, 1 1 D, 1 1 F, 12A, 12B, 12F, 13, 14, 15A, 15B, 15C, 15F, 16A, 16F, 17A, 17F, 18A, 1 8B, 18C, 18F, 19A, 1 9B, 19C, 19F, 20, 21 , 22F, 23B, 23F, 24A, 24B, 24F, 25A, 25F, 27, 28A, 28F, 29, 31 , 32A, 32F, 33A, 33B, 33D, 33F, 34, 35A, 35B, 35F, 36, 37, 38, 39, 40, 41 A, 41 F, 42, 43, 44, 45, 46, 47A, 47F, or 48.
  • the antigen of interest of the immunogenic composition may include at least one whole cell pathogen selected from the group consisting of Streptococcus pneumonia type 1 , 2, 3, 4, 5, 6A, 6B, 7A, 7B, 7C, 7F, 8, 9A, 9L, 9N, 9V, 1 0A, 10B, 10F, 1 1 A, 1 1 B, 1 1 C, 1 1 D, 1 1 F, 12A, 12B, 12F, 13, 14, 15A, 15B, 1 5C, 15F, 16A, 16F, 17A, 1 7F, 1 8A, 18B, 18C, 18F, 19A, 19B, 19C, 19F, 20, 21 , 22F, 23B, 23F, 24A, 24B, 24F, 25A, 25F, 27, 28A, 28F, 29, 31 , 32A, 32F, 33A, 33B, 33D, 33F, 34, 35A, 35B, 35F, 36, 37, 38, 39, 40, 41 A, 41 F, 42, 43, 44
  • the antigen of interest may also include two or more whole cell pathogens selected from the group consisting of Streptococcus pneumonia type 1 , 2, 3, 4, 5, 6A, 6B, 7A, 7B, 7C, 7F, 8, 9A, 9L, 9N, 9V, 10A, 10B, 10F, 1 1 A, 1 1 B, 1 1 C, 1 1 D, 1 1 F, 12A, 12B, 12F, 13, 14, 15A, 1 5B, 15C, 15F, 1 6A, 16F, 17A, 17F, 18A, 18B, 18C, 18F, 19A, 19B, 19C, 19F, 20, 21 , 22F, 23B, 23F, 24A, 24B, 24F, 25A, 25F, 27, 28A, 28F, 29, 31 , 32A, 32F, 33A, 33B, 33D, 33F, 34, 35A, 35B, 35F, 36, 37, 38, 39, 40, 41 A, 41 F, 42, 43, 44, 45, 46, 47
  • the invention features an immunogenic composition that, when administered to a mammal, elicits a T-cell dependent immune response in the mammal.
  • the molar ratio of the antigen to the carrier protein molecules may be 1 to 1 .
  • the invention further features a pharmaceutical composition in unit dosage form including (i) the immunogenic composition of the invention and (ii) a pharmaceutically acceptable excipient.
  • the pharmaceutical composition does not comprise an adjuvant.
  • the invention features a method of making an immunogenic composition including a polysaccharide-protein conjugate, the method includes mixing a polysaccharide antigen including a sortase recognition sequence and a sortase where the mixing results in formation of a thioester bond between the polysaccharide antigen and the sortase, yielding the polysaccharide-protein conjugate.
  • the method of making an immunogenic composition may further include mixing the polysaccharide-protein conjugate and a carrier protein including a polyglycine motif at its N-terminus where the mixing results in formation of a peptide bond between a terminal carboxyl group of a sortase recognition sequence attached to the polysaccharide antigen and a terminal amino group of the polyglycine motif of the carrier protein.
  • the method of making an immunogenic composition may include the polysaccharide antigen that is a whole cell pathogen. In certain embodiments, the method further includes lysing the whole cell pathogen to produce a polysaccharide-protein conjugate, in which the polysaccharide antigen is not a whole cell pathogen.
  • the immunogenic composition is purified (e.g., to separate the immunogenic composition from unreacted starting materials, reaction byproducts, and/or cellular debris).
  • the method further includes preparing the polysaccharide antigen containing the sortase recognition sequence by mixing a polysaccharide cyanate with a hydrazine-activated sortase recognition sequence, thereby effecting an addition reaction of a hydrazine moiety in the hydrazine-activated sortase recognition sequence to a cyanate group in the polysaccharide cyanate.
  • the invention features the use of the immunogenic composition of the invention to generate an immune response in a subject including administering the pharmaceutical composition of the invention to a subject where the immunogenic composition elicits a T-cell dependent immune response in the subject.
  • the invention also features a method of generating an immune response in a subject including administering the pharmaceutical composition of the invention to a subject where the immunogenic composition elicits a T-cell dependent immune response in the subject.
  • the subject may be an infant, a child, or an adolescent.
  • the pharmaceutical composition is administered to the subject parenterally. In other embodiments, the pharmaceutical composition is administered to the subject orally.
  • administering as used herein in conjunction with an immunogenic conjugate, is meant providing to a subject an immunogenic conjugate in a dose sufficient to induce an immune response in the subject, where the immune response results in the production of antibodies that specifically bind an antigen contained in the immunogenic conjugate.
  • Administering desirably includes parenteral administration (for instance, by subcutaneous, intramuscular, intravenous, or intradermal injection). While administering by a means that physically penetrates the dermal layer is desirable (e.g., a needle, airgun, or abrasion), the immunogenic conjugates of the invention can also be administered by transdermal absorption. Desirably, administration involves inclusion of the appropriate immune adjuvants.
  • Administering also includes enterally (for instance, by oral administration) by ingestion of an immunogenic conjugate in the form of e.g., a liquid, powder, capsule, or tablet.
  • Administering may involve a single administration of an immunogenic conjugate or administering an immunogenic conjugate in multiple doses.
  • a second administration is designed to boost production of antibodies in a subject to reduce the likelihood of infection by an infectious agent.
  • the frequency and quantity of the dosage of immunogenic conjugate depends on the specific activity of the immunogenic conjugate and can be readily determined by routine experimentation.
  • alkanediyl is meant a divalent, saturated hydrocarbon group having a total of 2 to 6 carbon atoms.
  • An alkanediyl may be linear or branched.
  • Non-limiting examples of the alkanediyl groups are: ethane-1 ,2-diyl; propane-1 ,3-diyl; propane-1 ,2-diyl ; 2-methyl-propane-1 ,3-diyl ; butane-1 ,2-diyl; butane- 1 ,3-diyl ; and butane-1 ,4-diyl.
  • arenediyl is meant a divalent, cyclic, aromatic group having a total of 6 to 10 carbon atoms.
  • Non-limiting examples of the arenediyl groups are phenylene and napthylene.
  • amino acid is meant a residue in a polypeptide sequence that can be naturally occurring or synthetic.
  • a naturally occurring amino acid is one encoded by the genetic code.
  • a synthetic amino acid is one that is analogous in chemical structure to a naturally occurring amino acid; or one that has a different chemical structure from a naturally occurring amino acid yet functions similarly to a naturally occurring amino acid.
  • Amino acids may be referred to herein by their single or three letter abbreviations.
  • carrier protein is meant a protein used in an immunogenic composition that invokes an immune response to itself and/or to an antigenic polysaccharide covalently linked with a carrier protein.
  • the carrier protein contains an epitope recognized by a T-cell.
  • enzymes of the sortase family of proteins include multi-antigenic peptides (MAPs), which are branched peptides and include lysine.
  • MAPs multi-antigenic peptides
  • Exemplary desirable carrier proteins include toxins and toxoids (chemical or genetic), which may be mutant.
  • a carrier protein is diphtheria toxin or a mutant thereof, diphtheria toxoid, tetanus toxin or a mutant thereof, tetanus toxoid, Pseudomonas aeruginosa exotoxin A or a mutant thereof, cholera toxin B subunit, tetanus toxin fragment C, bacterial flagellin, pneumolysin, listeriolysin O (and related molecules), an outer membrane protein of Neisseria menningitidis, Pseudomonas aeruginosa Hcp1 protein, Escherichia coli heat labile enterotoxin, shiga-like toxin, human LTB protein, a protein extract from whole bacterial cells, the dominant negative mutant (DNI) of the protective antigen of Bacillus anthracis, or Escherichia coli beta-galactosidase, or any other protein that can be conjugated
  • a carrier protein can also include one or more affinity purification tags.
  • affinity purification tags are known in the art; non-limiting examples of the purification tags are poly-His tags (e.g., oligohistidines having from 5 to 10 His repeating units or from 6 to 9 repeating units), poly-Arg tag, FLAG-tag, calmodulin-tag, S-tag, SBP-tag, TC tag, Strep-tag, VSV-tag (vesicular stomatitis virus tag), Xpress tag, Isopeptag, Halo-tag, GFP-tag, biotin carboxyl carrier protein, chitin binding protein (CBP), maltose binding protein (MBP), glutathione-S-transferase (GST), V5-tag, Myc-tag, and HA-tag.
  • CBP chitin binding protein
  • MBP maltose binding protein
  • GST glutathione-S-transferase
  • V5-tag Myc-tag
  • conjugation is meant an association of two entities, for example, of two molecules such as a polysaccharide and a protein.
  • the association can be, for example, via an indirect (e.g., via a peptide linker) covalent linker connecting both molecules.
  • exemplary desirable conjugations include a polysaccharide and a carrier protein conjugated to each other to form a polysaccharide-protein fusion, where the polysaccharide and carrier protein are conjugated via a linker, e.g., an amino acid sequence connecting a polysaccharide side chain to an amino acid residue of the carrier protein.
  • conjugation of a polysaccharide to a carrier protein is achieved by transpeptidation, where the carrier protein is a sortase enzyme.
  • conjugation of a polysaccharide to a carrier protein is achieved by transamidation, where the carrier protein replaces a sortase covalently linked to a polysaccharide to form a new polysaccharide-carrier protein conjugate.
  • a carrier protein may be covalently linked to a polysaccharide through a linker containing Z 1 -C(Z 3 )-N(H)-N(H)-(-C(0)-(L-C(0)) n - N(H)-N(H)-)m-Z 2 , where Z 1 is a bond to an oxygen atom in the polysaccharide or a the whole cell pathogen, Z 2 is a bond to a carbonyl group in the sortase recognition sequence or in the a carrier protein, e.g., containing sortase (e.g., a C-terminal carbonyl, aspartic acid side chain carbonyl, or glutamic acid side chain carbonyl), Z 3 is O or NH, each of n and m is 0 or 1 , and L, when present, is C2-6 alkanediyl or C6-10 arenediyl.
  • covalently linked is meant the formation of a covalent bond between two molecules, macromolecule
  • DNI is meant the dominant negative mutant (DNI) protein, which is a mutated form of protective antigen (PA) of B. anthracis, as described by Benson et al. (Biochemistry 37:3941 -3948, 1998).
  • electrophilic source of cyanide is meant a compound that upon reaction with a hydroxyl of an alcohol produces a cyanate group.
  • electrophilic sources of cyanide include 1 -cyano-4-dimethylaminopyridinium tetrafluoroborate (CDAP) or cyanogen bromide.
  • hydrazine-activated sortase recognition sequence is meant a sortase recognition sequence that is modified to include H2N-NH- group.
  • hydrazine source agent is meant a compound capable of reacting with a carrier protein to produce a hydrazine-activated sortase recognition sequence.
  • the formula of a hydrazine source agent is H 2 N-N(H)-(-C(0)-(L-C(0)) n -N(H)-N(H)-) m -H, in which each of n and m is 0 or 1 , and L is C2-6 alkanediyl or Ce- ⁇ ⁇ arenediyl.
  • Non-limiting examples of hydrazine source agents are hydrazine and dicarboxylic acid dihydrazides (e.g., succinic acid dihydrazide or adipic acid dihydrazide).
  • infection is meant the invasion of a subject by a microbe, e.g., a bacterium, fungus, parasite, or virus.
  • the infection may include, for example, the excessive multiplication of microbes that are normally present in or on the body of a subject or multiplication of microbes that are not normally present in or on a subject.
  • a subject is suffering from a microbial infection when an excessive amount of a microbial population is present in or on the subject's body or when the presence of a microbial population(s) is damaging the cells or causing pathological symptoms to a tissue of the subject.
  • infectious agent is meant a microbe, such as a bacterium, fungus, parasite, or virus that is capable of causing an infection in a subject.
  • infectious agent is meant a microbe, such as a bacterium, fungus, parasite, or virus that is capable of causing an infection in a subject.
  • immunoogenic is meant a compound that induces an immune response in a subject.
  • the immune response is a T-cell dependent immune response that involves the production of IgG antibodies.
  • microbial capsular polymer is meant a polymer present in or on the capsule coating of a microbe.
  • a microbial capsular polymer is an organic polymer such as a polysaccharide, phosphopolysaccharide, polysaccharide with an amino sugar with a N-acetyl substitution, polysaccharide containing a sulfonylated sugar, another sulfate-modified sugar, or phosphate-modified sugar, polyalcohol, poly amino acid, teichoic acid, and an O side chain of a lipopolysaccharide.
  • monomer is meant a molecular structure capable of forming two or more bonds with like monomers, often yielding a chain or a series of branched, connected chains of repeating monomer substructures, when part of a "polymer.”
  • organic polymer is meant a polymer composed of covalently linked monomers each having three or more of the following atoms: carbon, oxygen, hydrogen, phosphate, nitrogen, and sulfate.
  • an organic polymer is a polysaccharide, phosphopolysaccharide, polysaccharide with an amino sugar with a N-acetyl substitution, polysaccharide containing a sulfonylated sugar, another sulfate- modified sugar, or phosphate-modified sugar, sugar, polyalcohol, polyamino acid, teichoic acid, and an O side chain of lipopolysaccharide.
  • polyalcohol is meant a hydrogenated form of a carbohydrate where a carbonyl group has been reduced to a primary or secondary hydroxyl group.
  • Exemplary polyalcohols are a polyalkylene oxide (PAO), such as a polyalkylene glycols (PAG), including polymethylene glycols, polyethylene glycols (PEG), methoxypolyethylene glycols (MPEG) and polypropylene glycols; poly-vinyl alcohol (PVA);
  • PAO polyalkylene oxide
  • PEG polyalkylene glycols
  • MPEG methoxypolyethylene glycols
  • PVA poly-vinyl alcohol
  • polyethylene-co-maleic acid anhydride polystyrene-co-maleic acid anhydride
  • dextrans including carboxymethyl-dextrans
  • celluloses including methylcellulose, carboxymethylcellulose, ethylcellulose, hydroxyethylcellulose carboxyethylcellulose, and hydroxypropylcellulose
  • hydrolysates of chitosan are examples of polyethylene-co-maleic acid anhydride; polystyrene-co-maleic acid anhydride; dextrans including carboxymethyl-dextrans; celluloses, including methylcellulose, carboxymethylcellulose, ethylcellulose, hydroxyethylcellulose carboxyethylcellulose, and hydroxypropylcellulose; hydrolysates of chitosan;
  • starches such as hydroxyethyl-starches and hydroxy propyl-starches; glycogen; agaroses and derivates thereof; guar gum ; pullulan; insulin ; xanthan gum; carrageenan ; pectin; alginic acid hydrolysates; sorbitol; an alcohol of glucose, mannose, galactose, arabinose, gulose, xylose, threose, sorbose, fructose, glycerol, maltose cellobiose, sucrose, amylose, amylopectin; or mono propylene glycol (MPG).
  • MPG mono propylene glycol
  • polyglycine is meant a (Gly)n sequence. Desirably n is between 2 and 20, or more desirably between 2 and 5, and even more desirably 5 glycine residues.
  • polysaccharide antigen is meant a polymer of saccharides (sugars) derived from capsules of encapsulated bacterial pathogens such as Streptococcus pneumoniae, Francisella tularensis, Bacillus anthracis, Haemophilus influenzae, Salmonella typhi, Salmonella species, Shigella, or Neisseria meningitidis that is specifically bound by an antibody or an antibody fragment.
  • sortase is meant a protein having a catalytic domain with activity capable of i) selectively cleaving a backbone amide bond of a polypeptide (peptidase activity) at a “sortase recognition sequence,” and ii) selectively catalyzing the formation of an amide bond between the terminal carboxyl group created by the cleavage and the free primary amino (R-CH2-NH2-R') group of a glycine
  • Sortases may be derived from enzymes expressed on the surface of Gram- positive bacteria which cleave cell surface proteins and link them to cell wall proteoglycans. Sortases may desirably be derived from one of four families of sortase enzymes including sortase A, sortase B, sortase C, and sortase D.
  • sortase ligation sequence is meant an amino acid sequence that is capable of being selectively ligated to a second amino acid sequence by a sortase.
  • a sortase ligation sequence can be either a sortase recognition sequence or a polyglycine sequence.
  • sortase recognition sequence is meant the consensus sequence for a sortase enzyme substrate.
  • the consensus sequence is X1 PX2X3G for a sortase A substrate, where Xi is Leu, He, Val or Met, P is Pro, X2 is any amino acid, X3 is Ser, Thr or Ala, and G is Gly.
  • the sortase recognition sequence for sortase A is LP X1TG.
  • the consensus sequence is NPX1TX2 for a sortase B substrate, where N is Asn, P is Pro, Xi is Lys or Gin, T is Thr, and X2 is Asn, Asp, or Gly.
  • the sortase recognition sequence for sortase C is LPX1TX2, where L is Leu, P is Pro, Xi and X2 are any amino acid residue, and T is Thr.
  • the consensus sequences for sortase D are LPX1TA or LAX1TG, where L is Leu, P is Pro, Xi is any amino acid, T is Thr, A is Ala, and G is Gly.
  • the sortase recognition sequence is a fragment resulting from the reaction of the sortase recognition sequence with a sortase.
  • a subject is meant an animal that can be infected by a microbe.
  • a subject is a mammal such as a human, monkey, dog, cat, mouse, rat, cow, sheep, goat, or horse.
  • the subject is a human, such as a human child.
  • the subject is a human infant, toddler, pre-pubescent child, pubescent child, young adult, or adult under the age of 55 years old.
  • T-cell independent antigen an antigen which results in the generation of antibodies without the cooperation of T lymphocytes.
  • the T-cell independent antigen desirably directly stimulates B lymphocytes without the cooperation of T lymphocytes.
  • Exemplary desirable T-cell independent antigens include capsular antigen poly-gamma-D-glutamic acid (PGA), alginic acid (algenate), dextran, polysaccharides (PS), poly amino acids, polyalcohols, and nucleic acids.
  • percent (%) identity with respect to a reference polypeptide sequence is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the reference polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent identity to a polypeptide sequence can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN or Megalign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for aligning sequences, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared. For example, for a reference polypeptide of amino acid sequence A, when compared to the derivative polypeptide of amino acid sequence B, the percent identity to an amino acid sequence is calculated as:
  • the immunogenic conjugate compositions of the present invention are simple to make, less expensive, and more adaptive to different antigens of interest and carrier proteins than existing conjugate technologies.
  • the immunogenic conjugates of the present invention do not require that each combination of carrier protein and the antigen intended to evoke an immune response be conjugated by a tailored ligation process unique to their respective chemical properties.
  • immunogenic conjugates have been prohibitively expensive to produce and sell in the developing world, and conventional immunogenic conjugates are difficult to produce cheaply because of the highly specialized chemistry required for each antigen-protein conjugate.
  • the present invention simplifies the method of making these conjugates and reduces the cost of their preparation compared to current immunogenic conjugate technology.
  • the immunogenic conjugates of the present invention also address a need for immunogenic conjugates that can safely induce immunity against previously intractable antigens.
  • Immunogenic conjugates containing TLR (Toll-like receptor) ligands have been shown to evoke immune responses for otherwise intractable antigens, but they tend to be unsafe because TLR ligands are often
  • FIG. 1 is a schematic of a conjugation reaction between a protein (Protein 1 ) and a peptidoglycan (Polysaccharide 1 ) catalyzed by a sortase in Staphylococcus aureus.
  • sortase recognizes a C-terminus peptide signal ("LPXTGXX") on a protein and forms an intermediate conjugate with a protein before recognizing an N-terminus peptide signal (“GGG”) on a peptidoglycan.
  • GGG N-terminus peptide signal
  • sortase covalently links a protein to a peptidoglycan to form a final conjugate.
  • FIG. 1 is a schematic of a conjugation reaction between a protein (Protein 1 ) and a peptidoglycan (Polysaccharide 1 ) catalyzed by a sortase in Staphylococcus aureus.
  • sortase recognizes a C-termin
  • FIG. 2 is a schematic of a conjugation reaction between a polysaccharide (polysaccharide 2) and a protein (protein 2) catalyzed by a sortase.
  • sortase recognizes a C-terminus peptide signal ("LPXTGXX") on a PS and forms an intermediate PS-sortase conjugate (conjugate 1 ).
  • GGG N-terminus recognition sequence
  • sortase covalently links a protein to a PS to form a final PS-protein conjugate (conjugate 2).
  • the invention features novel immunogenic compositions and methods of making and administering such compositions to provide immunity against T-cell independent antigens or antigens which normally invoke weak immune responses, such as, e.g., polysaccharides (PS), polyalcohols, poly amino acids, and other organic polymers.
  • the immunogenic compositions of the invention show the efficacy of a new method for antigenic conjugation.
  • a carrier protein and an antigenic polysaccharide can be conjugated in the presence of an enzyme from the sortase family of proteins.
  • the carrier protein can effectively display and facilitate a robust immune response to the antigenic polysaccharide.
  • the immune response to the antigenic polysaccharide can also be enhanced in the immunogenic conjugate relative to the isolated antigenic polysaccharide.
  • all immunogenic conjugates produced by the method described herein are homogenous in their structure and thus offer compositions with a high and reproducible specific activity.
  • the new conjugation procedures can be applied to a wide range of antigens and carrier proteins to provide improved and highly active immunogenic conjugate compositions.
  • the immunogenic composition of the invention can include an antigen (e.g., a polysaccharide or a whole cell pathogen) covalently linked to a sortase recognition sequence or a carrier protein containing sortase through Z 1 -C(Z 3 )-N(H)-N(H)-(-C(0)-(L-C(0)) n -N(H)-N(H)-) m -Z 2 , where Z 1 is a bond to an oxygen atom in the polysaccharide or a the whole cell pathogen, Z 2 is a bond to a carbonyl group in the sortase recognition sequence or in the a carrier protein containing sortase (e.g., a C-terminal carbonyl, aspartic acid side chain carbonyl, or glutamic acid side chain carbonyl), Z 3 is O or NH, each of n and m is 0 or 1 , and L, when present, is C2-6 alkanediyl or Ce-
  • immunogenic compositions can be prepared by contacting an antigen-cyanate (e.g., prepared by contacting an antigen with an electrophilic source of cyanide, such as cyanogen bromide or 1 -cyano-4-dimethylaminopyridinium tetrafluoroborate (CDAP)) can be contacted with a hydrazine-activated sortase recognition sequence to produce an antigen-sortase recognition sequence conjugate.
  • the antigen-sortase recognition sequence conjugate can be reacted with sortase to produce an antigen-carrier protein conjugate, in which the carrier protein contains sortase.
  • Polysaccharides are polymers of saccharides (sugars).
  • PS derived from capsules are the primary antigenic components involved in protective immunity against encapsulated bacterial pathogens such as Neisseria meningitidis, Streptococcus pneumoniae, Salmonella typhi, and Haemophilus influenzae Type B.
  • Immunization of adolescents and adults with immunogenic conjugates based on microbial PS has been successful in reducing disease burden, but has proven less effective in providing protective immunity to infants and young children (i.e., children less than 24 months of age). Young children have not yet developed a mature adaptive immune repertoire and T cell-independent antigens such as capsular PS are poorly immunogenic and do not lead to long-term protective immune responses (i.e., an immunological memory response) in such young immunogenic conjugate recipients.
  • a T-cell independent antigen such as PS can be converted to a T-cell dependent antigen by chemical coupling of PS to protein; this process is called “conjugation” and involves the formation of covalent bonds between atoms in the PS structure and side chain atoms of amino acids present in the "carrier” protein.
  • conjugates more efficiently promote the induction of B-cell maturation and isotype switching leading to much higher levels of antibody with the correct anti-PS protective profile.
  • Protective antibodies have high affinity for their PS antigens, and typically are of the Immunoglobulin G (IgG) subclass, a long-lived antibody with complement fixing and opsonic effector activity.
  • IgG Immunoglobulin G
  • a non-limiting pathway for induction of an anti-PS IgG immune response is exemplified by a conjugate made between a PS and the carrier protein tetanus toxoid.
  • the carrier protein is bound to the surface of the B-cell that displays the correct PS binding specificity.
  • the carrier protein-PS complex is taken up by these B-cells into the intracellular vacuolar compartment where the carrier is processed by proteolytic degradation.
  • Peptides derived from the carrier protein are transported and loaded into the presentation groove of the MHC-Class II receptor (MHC-II). This MHC-ll-carrier peptide complex is displayed on the surface of the B-cell.
  • T-cells Upon recognition of the MHC-ll-peptide complex by the T-cell receptor (TCR), T-cells become activated and secrete cytokines that provide "help" for the induction of B-cell differentiation. B-cells expand in numbers and differentiate into "plasma cells” which now secrete antibody. Initially Immunoglobulin M (IgM) is produced by plasma cells but eventually the T-cell help causes the plasma cells to class switch and produce other isotype classes of antibody such as IgG. This process continues with plasma cells undergoing mutational changes leading to production of antibody receptors that have even higher affinity for the PS-carrier protein conjugates. As antigen is cleared, only the higher affinity plasma cells are activated by residual PS-carrier protein conjugate remaining in circulation.
  • IgM Immunoglobulin M
  • the process of T-cell dependent maturation of plasma cells continues, leading to the expansion of plasma cell populations which produce high affinity antibodies of the IgG class.
  • the expansion can be easily monitored by measuring the levels of anti-PS IgG antibodies in the serum of an immunized subject, e.g., a human.
  • Memory B-cells which are long lived and specific for the PS.
  • Memory B-cells have a unique property in that they can be immediately activated if exposed to PS. Activation causes memory B-cells to multiply and quickly produce anti-PS IgG.
  • the activation of memory B cells that occurs during a second exposure of to PS antigen is called a "booster response" and is indicative of a long lived “secondary” memory immune response.
  • Primary immunization may stimulate the production of IgM antibodies and some IgG antibodies.
  • secondary immunization i.e., the "booster" shot, memory cells already programmed by the first immunization are stimulated to produce large quantities of IgG, the memory immune response.
  • a T-cell independent antigen generally does not stimulate lasting immunity, i.e., the production of
  • IgG antibodies may stimulate the production of less potent and more temporary IgM antibodies.
  • PS antigens alone do not typically produce booster responses of IgG.
  • PS do produce booster responses if primary immunization is performed with a PS-carrier protein conjugate because memory cells induced by the conjugate have already been programmed to produce IgG.
  • the booster response in immunized animals or humans is thought to mimic the protective response due to exposure to a microbe displaying the PS; this long term memory is critical for an immunogenic conjugate to work in protecting immunized subjects years after their immunization with immunogenic conjugates.
  • PS-carrier protein conjugates are valued for (1 ) their ability to induce high levels of IgG against PS antigens, and (2) their ability to induce memory immune responses against PS antigens.
  • PS antigens typically do not display these properties and thus are inferior antigens.
  • the difficulty in synthesizing immunogenic conjugates and their cost of production has slowed the development of immunogenic conjugates for many bacterial diseases where an immune response to PS may be protective.
  • T-cell independent antigens include homopolymers of amino acids, such as poly-gamma- D-glutamic acid (PGA), and polyalcohols. Indeed most biological polymers are T-cell independent antigens. Polymers can cross-link Immunoglobulin (Ig) receptors on B-cells that recognize them due to the repetitive nature of their chemical structures (and thus epitopes). Thus polymers can activate B-cells for production of anti-polymer IgM in the same way that polysaccharides do.
  • an amino acid homopolymer, poly-gamma-D-glutamic acid (PGA) of Bacillus anthracis is a capsular polymer that is poorly immunogenic and also a T-cell independent antigen.
  • TLRs Toll-like receptors
  • LPS lipopolysaccharides
  • TLR TLR ligand
  • Immunogenic conjugates are difficult to produce cheaply because of the specialized chemistry required.
  • PS-carrier protein conjugation by covalent linkage procedures have numerous drawbacks, including the need for organic solvents and other reagents that can adversely affect the structure and/or epitope presentation of carrier proteins; highly specialized chemical linkage reactions to selectively target a reactive site within the target protein; and time-consuming additional processing steps for carrying out the conjugation.
  • coupling chemistry must be worked out for various PS that is unique for the chemistry of the PS and the carrier protein that has been selected.
  • This coupling chemistry introduces functional groups in the PS that then can be linked to carrier protein typically through the epsilon amino side chains of lysine residues.
  • the PS structure, nature of the carrier protein selected, and the type of linkage chemistry can all affect immunogenicity of the conjugate.
  • one single conjugation method may not be appropriate for all serotypes.
  • the sortase family of bacterial proteins includes well-conserved enzymes encoded by the genomes of numerous Gram positive bacterial organisms. Their enzymatic activity was first described in Staphylococcus aureus. As shown in Fig. 1 , naturally occurring sortases modify surface proteins by recognizing and cleaving a carboxyl-terminal recognition signal. For most substrates of sortase enzymes, the recognition signal consists of the motif LPXTG (Leu-Pro-any amino acid (AA)-Thr-Gly), followed by a highly hydrophobic transmembrane sequence, and a cluster of basic residues such as Arg. Sortase peptidase activity results in cleavage between the T and G residues of the sortase recognition sequence.
  • LPXTG Leu-Pro-any amino acid (AA)-Thr-Gly
  • a sortase active site containing a sulfhydryl group within the Cys residue, is exposed to the carboxyl group of the Thr residue, allowing for formation of a thioester bond between C and T residues.
  • a transamidation reaction between the sortase-protein conjugate and a polysaccharide polymer, peptidoglycan, displaying a polyglycine motif results in a covalent linkage between the carboxyl group of the protein and the amino group of the Gly of the polysaccharide.
  • the formation of this peptide bond leads to the covalent attachment of the protein to the bacterial cell wall (Marraffini et al., Microbiol Mol Biol Rev. 70: 192-221 , 2006).
  • Sortases have been classified into four major families, designated sortase A (SrtA), sortase B (SrtB), sortase C (SrtC), and sortase D (SrtD), respectively, based on sequence alignment and phylogenetic analysis of 61 sortases from Gram-positive bacterial genomes (Dramsi et al., Res Microbiol. 156: 289-97, 2005).
  • Sortase A of Staphylococcus aureus recognizes a LPXTG like sequence motif located near the C-terminus of the target proteins, cleaves at the Thr-Gly peptide bond, and catalyzes the formation of a new peptide bond between a threonyl carboxyl and an amino group of the peptidoglycan penta-glycine cross-bridges (Marraffini et al., Microbiol Mol Biol Rev. 70: 192-221 , 2006; Ton-That et al., Proc Natl Acad Sci USA. 96: 12424-12429, 1999).
  • the immunogenic composition of the invention encompasses embodiments relating to a SrtA, SrtB, SrtC, and/or SrtD from any bacterial species or strain, as well as evolved sortases that have been modified from their wild type amino acid sequences to include at least one mutation in the encoding sequence, examples of which are provided herein.
  • the conjugation of an antigen (e.g., a polysaccharide or a whole cell pathogen) to a sortase recognition sequence may be performed using a cyanylation-mediated conjugation method. Specifically, contacting an antigen-cyanate with a hydrazine-activated sortase recognition sequence can produce a conjugate, where the antigen is linked to the sortase recognition sequence through the linker Z 1 -C(Z 3 )- N(H)-N(H)-(-C(0)-(L-C(0))n-N(H)-N(H)-)m-Z 2 , as defined herein.
  • an antigen e.g., a polysaccharide or a whole cell pathogen
  • the antigen-cyanate can be prepared through the cyanylation of the antigen with an electrophilic source of cyanide (e.g., cyanogen bromide or CDAP).
  • the hydrazine-activated sortase recognition sequence can be prepared by reacting the sortase recognition sequence with a hydrazine source agent (e.g., H2N-N(H)-(-C(0)-(L-C(0)) n - N(H)-N(H)-)m-H) under the reaction conditions known in the art for hydrazide formation (e.g., using a coupling agent, such as EDC).
  • a coupling agent such as EDC
  • one non-limiting cyanylation-mediated conjugation protocol includes dissolution of a hydrazine source agent (e.g., dicarboxylic acid dihydrazide, such as succinic acid dihydrazide or adipic acid dihydrazide) in about neutral pH phosphate buffer (e.g., pH of 7.2) containing sodium chloride (e.g., about 0.15M sodium chloride), dissolving a sortase recognition sequence in this solution, adding a peptide coupling agent (e.g., 1 -ethyl-3-(3- dimethylaminopropyl)carbodiimide (EDC)), and allowing the resulting reaction mixture to react for a sufficient time period (e.g., about 2 to 4 hours).
  • a hydrazine source agent e.g., dicarboxylic acid dihydrazide, such as succinic acid dihydrazide or adipic acid dihydrazide
  • neutral pH phosphate buffer
  • the resulting hydrazine-activated sortase recognition sequence can be purified, e.g., by dialysis or gel filtration using a desalting resin.
  • the antigen-sortase recognition sequence conjugate can be reacted with a sortase to produce an antigen-carrier protein conjugate, in which the carrier protein contains sortase.
  • the antigen-carrier protein conjugate can then be reacted with another carrier protein, as described herein.
  • preparation of a whole cell-carrier protein conjugates can facilitate the preparation of polysaccharide-carrier protein conjugates, as, after the conjugation, the whole cell-carrier protein conjugate can be subjected to lysing conditions known in the art, and the resulting
  • polysaccharide-carrier protein conjugate can be purified away from the cellular debris and reaction byproducts using, e.g., affinity purification using solid support having affinity for the carrier protein (e.g., if the carrier protein includes one or more affinity purification tags, or if the solid support includes antibodies specific to the carrier protein).
  • affinity purification using solid support having affinity for the carrier protein (e.g., if the carrier protein includes one or more affinity purification tags, or if the solid support includes antibodies specific to the carrier protein).
  • the immunogenic conjugates of the invention have the potent immunological properties of typical PS-carrier protein immunogenic conjugates but desirably differ from previously known immunogenic conjugates in that an antigen of interest, e.g., PS or capsular organic polymer, may be coupled to a desired carrier protein without utilizing differing chemical linkages specialized to produce each combination. Rather, as depicted in Fig. 2, a novel sortase reaction is performed that is the reverse of a sortase reaction in nature where an antigenic polysaccharide is coupled to a sortase or a carrier protein.
  • an antigen of interest e.g., PS or capsular organic polymer
  • an antigen of interest e.g., PS or capsular organic polymers
  • a sortase which is then optionally capable of coupling the antigen with a carrier protein by a peptide bond.
  • a PS-carrier protein conjugate may be formed by first covalently linking a sortase to a soluble antigen, e.g., PS or capsular organic polymers: these immunogenic conjugates are referred to as a PS-sortase immunogenic conjugates (conjugate 1 in Fig. 2).
  • the novel PS-sortase conjugate may be enzymatically stabilized by chemical cross-linking, for example, such that sortase is the carrier protein of the immunogenic conjugate.
  • an un- stabilized PS-sortase immunogenic conjugate in the presence of a secondary carrier protein may catalyze the covalent linkage between the antigenic PS and the secondary carrier protein to produce a novel PS- carrier protein conjugate: these immunogenic conjugates are referred to as PS-carrier protein immunogenic conjugates (conjugate 2 in Fig. 2).
  • the immunogenic conjugates of the invention include a polysaccharide antigen conjugated to a sortase carrier protein capable of stimulating an immune response. In another desirable embodiment, the immunogenic conjugates of the invention include a polysaccharide antigen conjugated to a carrier protein capable of stimulating an immune response.
  • Immunogenic conjugates of the invention may be prepared by attaching a sortase recognition sequence to a polysaccharide.
  • the polysaccharide becomes a sortase substrate and is covalently linked to a sortase by a sortase ligation sequence.
  • the thio-ester linkage between the PS and sortase conjugate may be stabilized to prevent reversal of the covalent bond formed.
  • enzymatic stabilization by photo cross-linking e.g., ultraviolet (UV) cross-linking
  • chemical cross-linking e.g., formaldehyde, glutaraldehyde, and formaldehyde/glutaraldehyde cross-linking
  • UV ultraviolet
  • chemical cross-linker e.g., formaldehyde, glutaraldehyde, and formaldehyde/glutaraldehyde cross-linking
  • a chemical cross-linker such as formaldehyde
  • crosslinks the basic amino acid lysine residues of sortase further stabilizing the enzymatic conjugate.
  • a carrier protein of interest may be attached to a polyglycine motif to enable covalent linkage between itself and the PS.
  • a covalent bond between an antigenic PS and the carrier protein is formed by a sortase ligation sequence, which produces the PS-carrier protein conjugate.
  • a synthetic peptide By attaching a synthetic peptide to a PS, an antigenic polysaccharide may be covalently linked to any sortase enzyme.
  • attachment of a polyglycine motif to a carrier protein enables the covalent linkage of an antigenic polysaccharide to any carrier protein, when a first PS-sortase conjugate is formed. Exemplary and preferred carrier proteins and polysaccharide antigens of interest are described herein.
  • the methods of making immunogenic conjugates described herein are less complex than immunogenic conjugate technology because its chemistry depends only on the covalent-linking chemistry of a sortase recognition peptide of the antigenic PS with that of the Cys residue of a sortase active site; or the polyglycine motif of the carrier protein (e.g., DNI, cholera toxin B subunit, diphtheria toxin, tetanus toxin Fragment C, or Escherichia coli beta-galactosidase). Furthermore, multiple antigenic
  • polysaccharides can be coupled to a carrier protein ; or, a mixture of carrier proteins can be conjugated to the antigenic PS in a single reaction or multiple sequential reactions.
  • a carrier protein or, a mixture of carrier proteins can be conjugated to the antigenic PS in a single reaction or multiple sequential reactions.
  • Immunogenic conjugates of the invention may be made using a combination of a sortase recognition peptide and polyglycine motif, such as, e.g., those described herein, to covalently link any carrier protein, such as, e.g., those described herein, in the presence of one or more antigens of interest, such as, e.g., those described herein. If one antigen of interest is used, the immunogenic conjugate of the invention is said to be monovalent. If more than one antigen of interest is used, the immunogenic conjugate of the invention is said to be multivalent.
  • immunogenic compositions described herein may be used with any antigenic polysaccharide capable of being covalently linked by a free carboxyl group, e.g., any capsular polymer or any polymer, attached to a sortase recognition peptide, and any carrier protein capable of being covalently-linked by a free amino group, e.g., carrier proteins attached to a polyglycine motif.
  • any antigenic polysaccharide capable of being covalently linked by a free carboxyl group e.g., any capsular polymer or any polymer, attached to a sortase recognition peptide
  • carrier protein capable of being covalently-linked by a free amino group
  • carrier proteins attached to a polyglycine motif e.g., carrier proteins attached to a polyglycine motif
  • Tetanus toxoid is one possible carrier protein.
  • This toxin is detoxified by treatment with formaldehyde, a reagent that reacts with amino groups of proteins.
  • Other desirable carrier proteins include the cholera toxin B subunit (available from SBL Vaccin AB), diphtheria toxin, tetanus toxin Fragment C (available from Sigma Aldrich), DNI, or beta-galactosidase from Escherichia coli (available from Sigma Aldrich).
  • immunogenic conjugates of the invention may include whole cell encapsulated pathogens as the antigen, eliminating the need for purification and characterization of antigenic PS.
  • Whole cell encapsulated pathogens may be killed by a chemical, e.g., formaldehyde, treatment or by heat-inactivation and subsequently conjugated to sortase as described herein.
  • the immunogenic conjugates of the invention may be used to immunize against, for example, Pneumococcus infection, Streptococcus (groups A and B) infection, Haemophilus influenzae type B ("HiB") infection, meningococcal (e.g., Neisseria meningitides) infection, and may be used as O antigen immunogenic conjugates from Gram negative bacteria (e.g., Pseudomonas aeruginosa, Francisella tularensis (Thirumalapura et al., J.
  • Gram negative bacteria e.g., Pseudomonas aeruginosa, Francisella tularensis (Thirumalapura et al., J.
  • Peptide linkers used in the immunogenic conjugates of the invention desirably are polypeptide sequences that are substrates for a sortase enzyme.
  • an immunogenic conjugate composition is provided including an antigenic polysaccharide covalently linked to a carrier protein by a peptide bond of a sortase ligation sequence.
  • the immunogenic conjugate of the invention has the formula: PS-L-CP, where PS is an antigenic polysaccharide; L is a peptide linker; and CP is a carrier protein.
  • the covalent linkage between an antigenic polysaccharide and a carrier protein may consist of a peptide bond at the carboxyl-terminus of a synthetic peptide attached to a side chain of an antigenic polysaccharide.
  • PS side chain groups capable of attachment include, but are not limited to, vicinal hydroxyls, non-vicinal hydroxyls, carboxyl groups, amino groups and reducing sugar aldehydes.
  • Examples of a synthetic peptide utilized in the present invention include a sortase recognition sequence with a carboxyl-terminus, such that prior to linkage with the carrier protein, includes a sortase A, B, C or D recognition motif.
  • such a synthetic peptide may, in certain embodiments, be engineered to include the sortase recognition sequence LPXTG, where X is any amino acid, and includes but is not limited to residues with amino, carboxyl, thiol, halogen, and azide groups, such that these groups may chemically react with an activated polysaccharide.
  • the sortase recognition sequence may be modified to include reactive residues located at the N-terminal of, internal to, or C-terminal of the synthetic peptide, such that the residues allow for covalent modification of a polysaccharide.
  • the sortase recognition sequence of the invention may further be covalently linked to a chemically activated antigenic polysaccharide.
  • Antigenic polysaccharides of the invention may be chemically activated with periodate, cyanogen borohydride, or carbodiimide reagents.
  • a covalently linked polysaccharide to a synthetic peptide is mixed with a sortase enzyme capable of recognizing the peptide sequence.
  • a sortase enzyme is covalently linked to a polysaccharide by a sortase ligation sequence of LPXT, where X is any amino acid.
  • a peptide linker of the invention may additionally include a polyglycine motif with a peptide sequence of GGGGG. Such a polyglycine motif is covalently bound to a free primary amino group (NH2-R) of a desired carrier protein and is recognized by a sortase enzyme.
  • a carrier protein of the invention may encompass a carrier protein further chemically modified to covalently link the carrier protein with at least one peptide and/or at least one protein that displays the polyglycine motif.
  • a covalently linked carrier protein to a polyglycine motif is mixed with a polysaccharide covalently linked to a sortase enzyme that is capable of recognizing the polyglycine motif.
  • an antigenic polysaccharide and a carrier protein include the sortase ligation sequence LPXT at the covalent linkage.
  • a sortase ligation sequence includes a sortase recognition sequence. In some embodiments, a sortase ligation sequence is located C-terminal of an antigenic PS. In some embodiments, a sortase ligation sequence includes a polyglycine motif of 2, 3, 4 or 5 Gly residues. In some embodiments, a sortase ligation sequence is located N-terminal of a carrier protein. In other embodiments, a sortase ligation sequence is located C-terminal of an antigenic polysaccharide, and N- terminal of a carrier protein. In some embodiments, an immunogenic conjugation includes formation of an amide bond between a C-terminal carboxyl group of a cleaved sortase recognition sequence and an N-terminal amino group of a polyglycine sequence.
  • a sortase recognition sequence is a sortase A recognition sequence having a consensus sequence Xi PX2X3G, where Xi is Leu, He, Val or Met, P is Pro, X2 is any amino acid, X3 is Ser, Thr or Ala, and G is Gly. In further embodiments, X2 is Asp, Glu, Ala, Gin, Lys or Met.
  • a sortase recognition sequence is a sortase A recognition sequence having the consensus sequence LPX1TG, where Xi is any amino acid. Exemplary sortase A recognition sequences include but are not limited to the following sequences: LPKTG, LPATG, LPNTG, LPETG, LPNAG, LPNTA, LGATG, IPNTG, or IPETG.
  • a sortase recognition sequence is a sortase B recognition sequence having a consensus sequence NPX1TX2, where N is Asn, P is Pro, Xi is Lys or Gin, T is Thr, and X2 is Asn, Asp, or Gly.
  • a sortase B recognition sequence is NPQTN.
  • Exemplary sortase B recognition sequences include but are not limited to the following sequences: NPKTG, NSKTA, NPQTG, NAKTN, or NPQSS
  • a sortase recognition sequence is a sortase C recognition sequence and may utilize as its substrate LPX1TX2, where L is Leu, P is Pro, and T is Thr, as a recognition motif, with each Xi and X2 independently representing any amino acid residue.
  • a sortase recognition sequence is a sortase D recognition sequence.
  • consensus sequences for sortase D are LPX1TA or LAX1TG, where L is Leu, P is Pro, Xi is any amino acid, T is Thr, A is Ala, and G is Gly.
  • immunogenic conjugate may include a combination of any of the above sortase recognition sequences.
  • the invention may include an antigenic
  • sortase recognition sequences linked to an antigenic polysaccharide may be the same sequence or include any of the differing sequences, such as recognition sequences provided for SrtA, SrtB, SrtC, and/or SrtD.
  • an antigenic polypeptide of the invention is covalently linked to at least one carrier protein.
  • Carrier proteins used in the immunogenic conjugates of the invention desirably are proteins that, either alone or in combination with an antigen, invoke an immune response in a subject.
  • the carrier protein contains at least one epitope recognized by a T-cell.
  • the epitope is capable of inducing a T-cell response in a subject, and induce B-cells to produce antibodies against the entire antigen of interest.
  • Epitopes as used in describing this invention include any determinant on an antigen that is responsible for its specific interaction with an antibody molecule or fragment thereof.
  • Epitopic determinants usually consist of chemically active surface groupings of molecules such as amino acids or sugar side chains and have specific three-dimensional structural characteristics as well as specific charge characteristics.
  • a protein or polypeptide generally is capable of stimulating T-cells.
  • a carrier protein that lacks an epitope recognized by a T-cell may also be immunogenic.
  • the carrier protein desirably is sufficiently foreign to elicit a strong immune response to the immunogenic conjugate.
  • the carrier protein used is a molecule that is capable of imparting immunogenicity to the antigen of interest.
  • a carrier protein is one that is inherently highly immunogenic.
  • a carrier protein that has a high degree of immunogenicity and is able to maximize antibody production to the antigens complexed with it is desirable.
  • Various carrier proteins of the invention include, e.g., toxins and toxoids (chemical or genetic), which may or may not be mutant, such as anthrax toxin, PA and DNI (PharmAthene, Inc.), diphtheria toxoid (Massachusetts State Biological Labs; Serum Institute of India, Ltd.) or CRM 197, tetanus toxin, tetanus toxoid (Massachusetts State Biological Labs; Serum Institute of India, Ltd.), tetanus toxin fragment Z, exotoxin A or mutants of exotoxin A of Pseudomonas aeruginosa, bacterial flagellin, pneumolysin, an outer membrane protein of Neisseria meningitidis (strain available from the ATCC (American Type Culture Collection, Manassas, Va.)), Pseudomonas aeruginosa Hcp1 protein,
  • the carrier protein is the cholera toxin B subunit (available from SBL Vaccin AB), diphtheria toxin (Connaught, Inc.), tetanus toxin Fragment C (available from Sigma Aldrich), DNI, or beta-galactosidase from Escherichia coli (available from Sigma Aldrich).
  • Other desirable carrier proteins include bovine serum albumin (BSA), P40, and chicken riboflavin.
  • exemplary carrier proteins are commercially available from Sigma Aldrich.
  • Other exemplary carrier proteins are MAPs (multi-antigenic peptides), which are branched peptides. By using a MAP, cross-linking density is maximized because of multiple branched amino acid residues.
  • An exemplary amino acid that can be used to form a MAP is, but is not limited to, lysine.
  • BSA and keyhole limpet hemocyanin (KLH) have commonly been used as carriers in the development of immunogenic conjugates when experimenting with animals.
  • Carrier proteins which have been used in the preparation of therapeutic immunogenic conjugates include, but are not limited to, a number of toxins of pathogenic bacteria and their toxoids.
  • Carrier proteins of the invention may also include any protein not derived from humans and not present in any human food substance.
  • DNI is used as the carrier protein because it is nontoxic leaving no need to detoxify the protein before use. Furthermore, the use of DNI is desirable because DNI may also induce a protective immune response to B. anthracis, in addition to the protective immune response to the antigen of interest.
  • a carrier protein may include one or more affinity purification tags.
  • Purification tags are known in the art.
  • Non-limiting examples of the purification tags are poly-His tags (e.g., oligohistidines having from 5 to 10 His repeating units or from 6 to 9 repeating units), FLAG-tag, calmodulin-tag, S-tag, SBP-tag, TC tag, Strep-tag, VSV-tag, Xpress tag, Isopeptag, Halo-tag, GFP-tag, biotin carboxyl carrier protein, chitin binding protein (CBP), maltose binding protein (MBP), glutathione-S-transferase (GST), V5-tag, Myc-tag, and HA-tag.
  • CBP chitin binding protein
  • MBP maltose binding protein
  • GST glutathione-S-transferase
  • carrier proteins of the invention include members of the sortase family of enzymes because sortases may also induce a protective immune response to Gram-positive bacterium in addition to the protective immune response to the antigen of interest.
  • a sortase carrier protein may be derived from a sortase A, sortase B, sortase C, or sortase D.
  • Carrier proteins of the invention may also include a catalytically active fragment, derivative, or variant of a sortase A, sortase B, sortase C, or sortase D.
  • the carrier protein of the invention may include a soluble fragment of sortase A including the C-terminal catalytic domain.
  • the carrier protein of the invention may include a central catalytic domain of a sortase B.
  • the sortase carrier protein may also be isolated from but not limited to one of the following bacterial strains: Bacillus anthracis, Bacillus cereus, Bacillus halodurans, Clostridium acetobuty lieu m (SortaseD), Clostridium perfringens, Clostridium tetani (SortaseD),
  • Streptococcus gordonii Streptococcus mutans, Streptococcus phenumoniae, Streptococcus pyogenes, and Streptococcus suis.
  • NCBI National Cancer Institute
  • the carrier protein of the invention may include a sortase A derived from class A sortases, e.g., S. aureus sortase A.
  • class A sortases e.g., S. aureus sortase A.
  • the prototypical class A sortase, S. aureus sortase A has been purified and characterized (Ton-That et al., Proc. Natl. Acad. Sci. USA. 96:12424-12429, 1999), and the gene that encodes it has been cloned and sequenced (Mazmanian, et al., Science. 285:760-763, 1 999.)
  • the gene has been assigned accession number AF162687, and the protein sequence has accession number AAD48437.1 .
  • Additional exemplary sequences of class A sortases from a variety of other bacterial species are available under the following GenBank accession numbers: S. pyogenes (Spyog) Srt
  • the carrier protein of the invention features a sortase B derived from class B sortases identified from the Streptococcus, Bacillus, Staphylococcus, Clostridia, and Listeria genera, among others.
  • Exemplary sequences of several class B sortases are available at GenBank accession numbers as follows: S. pyogenes, NP 268518; B. anthracis, NP 846988; C. perfringens, NP_561429; E. faecalis, AAQ16264; Staphylococcus aureus subsp. aureus MRSA252, CAG401 10; L. monocytogenes, CAD00259.
  • the carrier protein of the invention may include a sortase C derived from class C sortases found among species in the Streptococcus, Enterococci, Bacillus, and Clostridia genera. Exemplary sequences of several class C sortases are available under the following accession numbers: S. pyogenes, AAL1 1468; C. diphtheriae, NP_940532.1 ; Streptococcus suis, BAB83966.
  • the invention features a sortase D carrier protein derived from class D sortases found among species in the Streptomyces, Corynebacterium, Clostridium, and Bacillus genera. Sequences of several class D sortases are available under the following accession numbers:
  • sortases and the nucleotide sequences that encode them are known to those of skill in the art and are disclosed in a number of references cited herein, the entire contents of all of which are incorporated herein by reference.
  • sortase and any sortase recognition motif can be used in some embodiments of this invention, including, but not limited to, the sortases and sortase recognition motifs described in Ploegh et al., International PCT Patent Application, PCT/US2010/000274, filed Feb. 1 , 2010, published as
  • the carrier protein of the invention may also include evolved sortases.
  • An evolved sortase exhibits enhanced reaction kinetics, for example, in that it catalyzes a transpeptidation reaction at a greater speed or turnover rate than the respective wild type sortase.
  • An evolved sortase may exhibit a modified substrate preference, for example, in that it utilizes a different substrate (e.g., a polypeptide comprising an altered sortase recognition sequence) or binds a given substrate with higher or lower affinity, or with higher or lower specificity than the respective wild type sortase.
  • the evolved sortase recognizes a sortase recognition sequence that the respective wild type sortase does not recognize or bind. See, e.g., Liu et al., United States Patent Application, 13/922,812, filed Jun. 20, 2013, published as US2014/0057317A1 on Feb. 27, 2014, the entire contents of each of which are incorporated herein by reference, for exemplary sortases, recognition motifs, reagents, and methods for directed evolution of bond-forming sortases.
  • some embodiments of the invention provide a sortase comprising a polypeptide sequence of S. aureus Sortase A (SEQ ID NO: 1 ) that is homologous to the polypeptide sequence of a wild type Sortase A (NP 647265.1 ), or a fragment thereof, as provided below:
  • the polypeptide sequence of the provided sortase may include one or more amino acid mutations as compared to the wild type sequence of the respective sortase (e.g., the sequence of SEQ ID NO: 1 ).
  • the evolved sortase sequence provided may include 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, 1 5, 16, 1 7, 18, 19, 20, 25, or more mutations.
  • the polypeptide sequence of the provided sortase is at least 90% identity (e.g., 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 99.5%) to a wild type sortase sequence (e.g., the sequence of SEQ ID NO: 1 ).
  • an evolved S. aureus sortase A is provided.
  • An evolved sortase A, or a fragment thereof, may include a mutation relative to the sequence of SEQ ID NO: 1 described herein, for example, P86L, P94S, P94R, N98S, A104T, E106G, A1 1 8T, F122S, F122Y, D124G, N127S, K134R, F154R, D160N, D165A, K173E, G174S, K177E 1182V K1 90E, or K196T, or any combination of any one of these mutations.
  • an evolved sortase is provided herein that includes 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, 15, 16, 17, 18, or all 19 of these mutations.
  • the aforementioned amino acid substitution may provide an evolved sortase that efficiently uses substrates not bound by the respective parent wild type sortase. For example, in some
  • an evolved sortase is provided that is derived from a wild type S. aureus sortase A as the parent sortase A, which utilizes substrates including a C-terminal sortase recognition motif of the sequence LPXTG and substrates including an N-terminal polyglycine motif in a transpeptidation reaction.
  • the evolved sortases utilize a substrate different from those used by the parent sortase, e.g., substrates including a C-terminal LPXS, LAXT, LAXTG, MPXT, MPXTG, LAXS, LAXSG, NPXT, NPXTG, NAXT, NAXTG, NAXS, NAXSG, LPXP, LPXPG, or LPXTA motif.
  • substrates including a C-terminal LPXS, LAXT, LAXTG, MPXT, MPXTG, LAXS, LAXSG, NPXT, NPXTG, NAXT, NAXTG, NAXS, NAXSG, LPXP, LPXPG, or LPXTA motif.
  • composition of the immunogenic conjugate of the invention and methods of making and administering such immunogenic conjugates can be used for any antigen of interest, e.g., a
  • the antigen of interest carries no primary groups that can be destroyed by the chemical reactions employed by the method of making immunogenic conjugates, e.g., the denaturing of an antigen caused by the destruction of antigen disulfide bonds by borohydride reduction.
  • the antigen of interest is an organic polymer consisting of monomers having at least three atoms, where each of the atoms is independently selected from carbon, oxygen, hydrogen, phosphate, nitrogen, and sulfate.
  • antigens of interest include organic polymers such as polysaccharides (e.g., polysaccharides having at least 18 residues), phosphopolysaccharides, polysaccharides with amino sugars with N-acetyl substitutions, polysaccharides containing sulfonylated sugars, other sulfate-modified sugars, or phosphate-modified sugars, polyalcohols, poly amino acids, teichoic acids, O side chains of organic polymers such as polysaccharides (e.g., polysaccharides having at least 18 residues), phosphopolysaccharides, polysaccharides with amino sugars with N-acetyl substitutions, polysaccharides containing sulfonylated sugars, other sulfate-modified sugars, or phosphate-modified sugars, polyalcohols, poly amino acids, teichoic acids, O side chains of organic polymers such as polysaccharides (e
  • Exemplary antigens of interest also include capsular organic polymers including those synthesized by microbes, e.g., bacteria, fungi, parasites, and viruses, and then purified from such a biological source using standard methods.
  • Exemplary antigens of interest include microbial capsular organic polymers including those purified from bacterial organisms such as Bacillus species (including B. anthracis) (Wang and Lucas, Infect. Immun. 72(9):5460-5463, 2004), Streptococcus pneumoniae (Bentley et al., PLoS Genet. 2(3):e31 , Epub 2006; Kolkman et al., J. Biochemistry 123:937-945, 1998; and Kong et al., J. Med. Microbiol. 54:351 -356, 2005), Shigella (Zhao et al., Carbohydr. Res.
  • the Francisella tularensis polysaccharide is the O antigen.
  • the microbial capsular polymer is poly-gamma-D-glutamic acid (PGA) from Bacillus anthracis.
  • the Streptococcus pneumoniae polysaccharide is one of capsular types described in Kong et al. (J. Med. Microbiol. 54:35-356, 2005).
  • Streptococcus pneumoniae polysaccharide capsular type desirably is 1 (e.g., 1 -g or 1 -q), 2 (e.g., 2-g, 2-q, or 2-41 A), 3 (e.g., 3-g, 3-q, 3-c, or 3-nz), 4, 5 (e.g., 5-q, 5-c, 5-qap, or 5-g), 6A (e.g., 6A-g, 6A-cl, 6A-c2, 6A-n, 6A-qap, 6A-6B-g, 6A-6B-q, or 6A-6B-S), 6B (e.g., 6B-c, 6A-6B-g, 6A-6B- q, or 6A-6B-S), 7F (e.g., 7F-7A), 7A (e.g., 7A-cn or 7F-7A), 7B (e.g., 7B-40), 7C (e.g., 7C-19C-24B
  • 33F e.g., 33F-g, 33F-q, 33F-chw, 33F-33B, or 33F-33A-35A
  • 33A e.g., 33F-33A-35A
  • 33B e.g., 33B-q, 33B-s, or 33F-33B
  • 33D 34 (e.g., 34-ca or 34s), 35F (e.g., 35F-47F), 35A (e.g., 33F-33A-35A), 35B (e.g., 17F- 35B-35C-42), 36, 37 (e.g., 37-g or 37-ca), 38 (e.g., 25F-38), 39 (e.g., 39-cnl or 39-cn2), 40 (e.g., 7B-40), 41 F (e.g., 41 F-cn or 41 F-s), 41 A (e.g., 2-41 A), 42 (e.g., 17B-35B-
  • exemplary antigens of interest include killed whole cell encapsulated pathogens such as Bacillus species (including B. anthracis) (Wang and Lucas, Infect. Immun. 72(9):5460-5463, 2004), Streptococcus pneumoniae (Bentley et al., PLoS Genet. 2(3):e31 , Epub 2006; Kolkman et al., J. Biochemistry 123:937-945, 1998; and Kong et al., J. Med. Microbiol. 54:351 -356, 2005), Shigella (Zhao et al., Carbohydr. Res.
  • Bacillus species including B. anthracis
  • Streptococcus pneumoniae Bentley et al., PLoS Genet. 2(3):e31 , Epub 2006
  • Kolkman et al. J. Biochemistry 123:937-945, 1998
  • Kong et al. J. Med. Microbiol. 54:351 -356
  • Whole cell pathogens may contain, but are not limited to, one or more of the aforementioned antigens of interest, e.g., microbial capsular organic polymers, O-antigen, and PGA.
  • Immunogenic Conjugate Compositions antigenic PS-carrier protein
  • the immunogenic conjugates of the invention may be used in combination, for example, in pediatric immunizations.
  • the immunogenic conjugates of the invention may be used to immunize against, for example, Pneumococcus infection, Haemophilus influenzae type B ("HiB") infection, Streptococcus (groups A and B) infection, meningococcal (e.g., Neisseria meningitides) infection, and may be used as O antigen immunogenic conjugates from Gram negative bacteria (e.g., Pseudomonas aeruginosa, Francisella tularensis, Shigella species, Salmonella species, Acinetobacter species, Burkholderia species, and Escherichia coli).
  • Gram negative bacteria e.g., Pseudomonas aeruginosa, Francisella tularensis, Shigella species, Salmonella species, Acinetobacter species, Bur
  • the immunogenic conjugate formulation desirably includes at least one carrier protein, at least one antigen of interest, and a pharmaceutically acceptable carrier or excipient (e.g., aluminum phosphate, sodium chloride, or sterile water).
  • An immunogenic conjugate composition may also include an adjuvant system for enhancing the immunogenicity of the formulation, such as oil in a water system and other systems known in the art or other pharmaceutically acceptable excipients.
  • a carrier protein-antigenic PS complex that is insoluble under physiological conditions is desirable to slowly release the antigen after administration to a subject. Such a complex desirably is delivered in a suspension containing
  • the carrier protein-antigenic PS complex may also be soluble under physiological conditions.
  • the immunogenic conjugate is in a volume of about 0.5 ml_ for subcutaneous injection, 0.1 ml_ for intradermal injection, or 0.002-0.02 ml_ for percutaneous administration.
  • a 0.5 ml dose of the immunogenic conjugate may contain approximately 2-500 ⁇ g of the antigen covalently linked with approximately 2-500 ⁇ g of the carrier protein.
  • approximately 10 ⁇ g of the antigen are conjugated with approximately 10 ⁇ g of the carrier protein.
  • the molar ratio of antigen to carrier protein desirably is 1 :1 (e.g., 1 part antigen to 1 part carrier protein).
  • the immunogenic conjugate may be administered parenterally (for instance, by subcutaneous, intramuscular, intravenous, or intradermal injection). While delivery by a means that physically penetrates the dermal layer is desirable (e.g., a needle, airgun, or abrasion), the immunogenic conjugates of the invention can also be administered by transdermal absorption.
  • the immunogenic conjugates of the invention may be administered to a subject, e.g., by intramuscular injection, intradermal injection, or transcutaneous immunization with appropriate immune adjuvants.
  • Immunogenic conjugates of the invention may be administered, one or more times, often including a second administration designed to boost production of antibodies in a subject to prevent infection by an infectious agent.
  • the frequency and quantity of immunogenic conjugate dosage depends on the specific activity of the immunogenic conjugate and can be readily determined by routine experimentation. While the age at which the first dosage is administered generally is two-months, an immunogenic conjugate may be administered to infants as young as six weeks of age. For children who are beyond the age of a routine infant vaccination schedule, the immunogenic conjugates of the invention may be administered according to the following exemplary schedule.
  • a booster dose is desirably given as early as four years following the last dose in subjects who are at a high risk for infection; or 1 0 years after the last dose to previously immunized adults and children above fifteen years of age.
  • the formulations may be presented in unit-dose or multi-dose containers, for example, sealed ampoules and vials and may be stored in a freeze-dried (lyophilized) condition requiring only the addition of the sterile liquid carrier immediately prior to use.
  • Immunogenic conjugates of the invention can be formulated in pharmacologically acceptable vehicles, e.g., alum hydroxide gel, adjuvant preparation, or saline, and then administered, e.g., by intramuscular injection, intradermal injection, or transcutaneous immunization with appropriate immune adjuvants.
  • pharmacologically acceptable vehicles e.g., alum hydroxide gel, adjuvant preparation, or saline
  • Immunogenic Conjugate Compositions whole cell pathogen-carrier protein
  • the immunogenic conjugates of the invention may be used in combination, for example, in pediatric immunizations.
  • the immunogenic conjugates of the invention may be used to immunize against, for example, Pneumococcus infection, Haemophilus influenzae type B ("HiB") infection, Streptococcus (groups A and B) infection, meningococcal (e.g., Neisseria meningitides) infection, and may be used as O antigen whole cell pathogen immunogenic conjugates from Gram negative bacteria (e.g., Pseudomonas aeruginosa, Francisella tularensis, Shigella species, Salmonella species, Acinetobacter species, Burkholderia species, and Escherichia coli).
  • Gram negative bacteria e.g., Pseudomonas aeruginosa, Francisella tularensis, Shigella species, Salmonella species, Acine
  • the formulation includes at least one inactivated whole cell pathogen including the antigenic polysaccharide of interest, at least one carrier protein, and a pharmaceutically acceptable buffer (e.g., bicarbonate buffer) to neutralize gastric acid.
  • a pharmaceutically acceptable buffer e.g., bicarbonate buffer
  • the immunogenic conjugate preparation is mixed with a buffer, e.g., 5.6 g of sodium hydrogen carbonate granules dissolved in 150 ml_ of sterile water.
  • the immunogenic conjugate contains about 1 mg of whole cell pathogen immunogenic conjugate in a single dose for oral administration.
  • a 1 mg dose of the immunogenic conjugate may contain at least 1 x 1 0 9 whole cell pathogens or a range of 1 x 10 9 to 1 x 10 1 1 whole cell pathogens covalently linked with approximately 2-500 ⁇ g of the carrier protein.
  • the immunogenic conjugates of the invention may be administered to a subject enterally (for instance, by oral administration) by ingestion of an immunogenic conjugate in the form of a e.g., liquid, powder, capsule, or tablet.
  • Immunogenic conjugates of the invention may be administered, one or more times, often including a second administration designed to boost production of antibodies in a subject to prevent infection by an infectious agent.
  • the frequency and quantity of immunogenic conjugate dosage depends on the specific activity of the immunogenic conjugate and can be readily determined by routine experimentation.
  • the age at which the first dosage is administered generally is two-years.
  • the immunogenic conjugates of the invention may be administered according to the following exemplary schedule.
  • a booster dose is desirably given as early as six months following the last dose in subjects who are at a high risk for infection; or five years after the last dose to previously immunized adults and children above two years of age.
  • kits that include an immunogenic conjugate described herein.
  • kits of the invention can also include instructions for using the kits in the immunization methods described herein.
  • the efficacy of the immunization schedule may be determined by using standard methods for measuring the antibody titer in the subject.
  • mean antibody titers desirably IgG titers
  • IgG titers of approximately 1 ⁇ / ⁇ are considered indicative of long-term protection.
  • the antigenic polysaccharide-carrier protein complexes for use in the immunogenic conjugate compositions described herein are desirably between 1 0 nm and 100 ⁇ in diameter.
  • Viruses can be 100 nm in diameter and are immunogenic.
  • Whole bacteria are 1 -1 0 ⁇ in diameter and are also immunogenic.
  • a small clump of bacteria can be about 100 ⁇ in diameter.
  • an antigenic polysaccharide-carrier protein complex in an immunogenic conjugate composition desirably is between 100 nm and 10 ⁇ in diameter. This complex may be soluble or insoluble.
  • An immunogenic conjugate can be prepared from an antigenic polysaccharide (PS) displaying a sortase recognition peptide and a sortase.
  • PS polysaccharide
  • polysaccharides are first chemically activated with periodate, cyanogen borohydride, or carbodiimide reagents to allow for attachment of a sortase recognition peptide to PS using conventional chemistry.
  • the sortase recognition peptide is a synthetic peptide that displays the LPXTGXX sequence but which then has unique N- terminal, internal, or C-terminal residues that allow for the covalent modification of activated
  • the chemical groups of these residues include amino, carboxyl, thiol, halogen, and azide groups, as well as others. These chemical groups are selected to react with activated PS.
  • the PS covalently linked to the sortase recognition peptide is mixed with a sortase, for instance SrtA, to covalently attach sortase to the PS by a thioester bond. This reaction produces a PS-sortase conjugate (Fig. 2 conjugate 1 ).
  • the PS-sortase conjugate may be enzymatically stabilized by treatment with a chemical cross-linking agent such as formalin or glutaraldehyde, further entrapping the antigenic polysaccharide to form a protein cross-linked cage or mesh.
  • a chemical cross-linking agent such as formalin or glutaraldehyde
  • a 10% neutral buffered formalin is prepared by diluting a 37% aqueous formaldehyde solution with phosphate buffered saline (PBS) to about 3.7-4.0% formaldehyde.
  • PBS phosphate buffered saline
  • the PS-sortase immunogenic conjugate is treated with excess 10% formalin for about 10 minutes at room temperature to cross-link the antigen to the sortase.
  • fixation is quenched by addition of excess 1 .25 M glycine in PBS.
  • An immunogenic conjugate can be prepared from an antigenic polysaccharide (PS) displaying a sortase recognition peptide and a carrier protein.
  • PS polysaccharide
  • polysaccharides are first chemically activated with periodate, cyanogen borohydride, or carbodiimide reagents to allow for attachment of a sortase recognition peptide to PS using conventional chemistry.
  • the sortase recognition peptide is a synthetic peptide that displays the LPXTGXX sequence but which then has unique N-terminal, internal, or C-terminal residues that allow for the covalent modification of activated polysaccharides.
  • the chemical groups of these residues include amino, carboxyl, thiol, halogen, and azide groups, as well as others.
  • a second immunogenic conjugate can be prepared from conjugate 1 .
  • a carrier protein is engineered to display polyglycine motif, where at least two glycine repeats are coupled to a carrier protein amino acid residue by a peptide bond.
  • the carrier protein may be modified with glycine repeats by sandwiching the glycine repeats between the carrier protein and a small ubiquitin-like modifier (SUMO) peptide.
  • SUMOylation occurs when the C-terminal carboxyl group of a double-glycine motif in SUMO and the epsilon-amino group of a lysine residue in a carrier protein form an isopeptide bond.
  • the SUMO protease cleaves immediately following the glycine repeat precursor at the C-terminus of the SUMO peptide. This reaction produces a polyglycine-modified carrier protein.
  • the polyglycine decorated carrier protein is
  • the sortase-mediated immunogenic conjugation method can be performed in situ on the surface of the polysaccharide-encapsulated organism, such as Streptococcus pneumonia.
  • the polysaccharide-encapsulated organism such as Streptococcus pneumonia.
  • about 10 9 -10 1 1 cells of 23 S. pneumoniae serotypes (1 , 2, 3, 4, 5, 6B, 7F, 8, 9N, 9V, 1 0A, 1 1 A, 12F, 14, 1 5B, 17F, 1 8C, 19F, 19A, 20, 22F, 23F and 33F) are heat-inactivated by incubation of the cells at 55 s - 60 s C for 30 minutes.
  • the cells may be chemically-inactivated by treatment with 55 ⁇ _ of 10% neutral buffered formalin per 1 ml_ of bacterial cell suspension.
  • the cells are incubated in formalin for at 37 s C for one hour. Subsequently, the inactivated cells are washed in PBS and or additional gentle biologically compatible buffers and reagents. The killed cells are then modified to attach the sortase recognition peptide to the surface polysaccharides of the cells.
  • the polysaccharide purification and characterization steps are eliminated, and the whole cells conjugated to sortase or the carrier protein(s) of interest are incorporated into the immunogenic conjugate essentially as described in Example 1 or Example 2.
  • the 23 valent pneumococcal whole cell immunogenic conjugate can be absorbed mucosally and thus allows for oral administration of the preparation.
  • the sortase-mediated immunogenic conjugation method can be applied to capsular antigens of various structures and ionic charges.
  • generation of an immunogenic conjugate against Streptococcus pneumonia can be produced by first purchasing 23 types of Streptococcus pneumonia PS from the American Type Culture Collection (ATCC), which are manufactured by Merck, Inc. These PS vary widely in their molecular structure and include PS that are strongly anionic, partially cationic, neutral in charge, phosphorylated, linear, have branching structures, and modified in various other ways.
  • ATCC American Type Culture Collection
  • PS corresponds to the thirteen capsular types in the Wyeth product Prevnar13 ® (1 , 3, 4, 5, 6A, 6B, 7F, 9V, 14, 1 8C, 19A, 19F, and 23F) and can be assayed for their ability to induce IL-6 production by mouse macrophages. Since PS can also be contaminated with a TLR agonist, phenol extraction and ethanol precipitation can be performed to "clean up" (remove residual unknown TLR agonists) commercially prepared S. pneumoniae PS.
  • PSs that are devoid of IL-6 induction activity are used for production of immunogenic conjugates.
  • each of the 23 capsular types is used to make an immunogenic conjugate using a sortase, essentially by the method described in Example 1 .
  • a one to one ratio of PS to a dominant negative mutant (DNI) carrier protein is used (approximately 1 :1 by dry weight) for these initial immunogenic conjugate preparations.
  • DNI dominant negative mutant
  • Each preparation is characterized by SDS-PAGE for evidence of covalent-linkage between pneumococcal PS and a carrier protein such as DNI.
  • DNI dominant negative mutant
  • other carrier proteins are used to make immunogenic conjugates.
  • ten different immunogenic conjugates using five different matrix proteins and two different antigens are made as follows.
  • the selection of the five matrix proteins is based on their current use in FDA-approved vaccines or other properties that allow them to serve as tracers for measuring the stability of immunogenic conjugate preparations.
  • the following matrix proteins are used (1 ) cholera toxin B subunit (available from SBL Vaccin AB), (2) diphtheria toxin, (3) tetanus toxin Fragment C, "Frag C” (available from Sigma Aldrich), (4) DNI, and (5) beta-galactosidase from Escherichia coli (available from Sigma Aldrich).
  • capsular antigens poly-D-glutamic acid from Bacillus anthracis and Streptococcus pneumoniae capsule type 14 (Suarez et al., Appl. Environ. Micobiol. 67:969-971 , 2001 ) are used. Each capsule antigen is combined with each of the five selected matrix proteins to produce 10 distinct immunogenic conjugates. All immunogenic conjugate preparations that show evidence of covalent protein linkage (e.g., in SDS-PAGE) are tested for their immunogenicity.
  • Immunogenic conjugates can be tested for their ability to induce, in mice, isotype antibody switching to IgG as is observed in conventional conjugate vaccines. All antigens can be absorbed to alum and then typically groups of 5 mice per immunogenic conjugate preparation are used. Mice are pre- bled to obtain baseline immune responses to the test antigens. Mice are then immunized three times (at day 0, 7, 14) by a standard IP injection protocol, and blood is collected at days 10, 20, 30, and 60 days post primary immunization. Mouse sera are analyzed by standard ELISA assay for IgG against the PS and carrier proteins used.
  • mice immunized with only PS are included to assess the ability of various immunogenic conjugate preparations to induce anti-PS IgG compared with the non-conjugated PS which should be poorly- or non-immunogenic.
  • Promising immunogenic conjugates i.e., immunogenic conjugates that induce high levels of IgG against PSs
  • undergo more careful immunological analysis which seeks to establish the kinetics and dose response aspects of the immune response to the immunogenic conjugate in mice.
  • the functionality of the antibody responses induced with immunogenic conjugates can be assessed.
  • functionality can be assessed by measuring the ability of the anti-PS antibody to opsonize encapsulated S. pneumococcus and lead to bacterial killing after phagocytosis by
  • the PS-carrier protein immunogenic conjugate can be modified to further stimulate the immune response, and ultimately improve the efficacy of the immunization, by addition of an adjuvant.
  • the immunogenic conjugate can be absorbed by an alum adjuvant such as aluminum hydroxide gel.
  • the immunogenic can be combined with an emulsion adjuvant such as squalene based oil in water nano emulsion.
  • Adjuvants such as these can be used to create a delivery system for the immunogenic conjugate and function to create depots that trap the conjugated antigen-carrier protein at the site of injection to allow for its slow release. This allows for extended stimulation of the immune system by enabling the immunogenic conjugate to persist at the site of injection, increasing the recruitment and activation of immune cells.

Landscapes

  • Chemical & Material Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • Biochemistry (AREA)
  • Microbiology (AREA)
  • Biophysics (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Mycology (AREA)
  • Epidemiology (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Immunology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Peptides Or Proteins (AREA)

Abstract

Disclosed are immunogenic compositions containing a polysaccharide-sortase conjugate. The polysaccharide is an antigen, and the sortase is a carrier protein. The sortase is covalently linked to the polysaccharide antigen by a linker including a sortase recognition sequence. Also disclosed are immunogenic compositions containing a polysaccharide-protein conjugate, the conjugate containing a polysaccharide antigen and a carrier protein. The polysaccharide antigen is covalently linked to the carrier protein by a linker including a sortase recognition sequence and a polyglycine motif present at the N-terminus of the carrier protein. Also disclosed are pharmaceutical compositions containing the immunogenic composition and a pharmaceutically acceptable excipient, methods of making the immunogenic compositions, and methods of generating immune response in a subject using the pharmaceutical composition.

Description

SORTASE-MEDIATED COUPLING OF IMMUNOGENIC POLYSACCHARIDE-PROTEIN
CONJUGATES AND THEIR USE
STATEMENT AS TO FEDERALLY FUNDED RESEARCH This invention was made with government support under grant number U19 AM 09764 awarded by the National Institutes of Health. The government has certain rights in the invention.
FIELD OF THE INVENTION
The invention relates to immunogenic polysaccharide-protein conjugates, a novel sortase- mediated method of making immunogenic polysaccharide-protein conjugates, and methods of administering immunogenic polysaccharide-protein conjugates.
BACKGROUND OF THE INVENTION Many antigens, particularly those associated with a pathogen's capsule layer stimulate little or no immune response and complicate efforts to create effective immunogenic conjugates against those antigens. Capsules are surface components of microbes that are typically composed of polymers of organic compounds such as carbohydrates, amino acids, or alcohols. Capsules are quite diverse chemically. The monomeric units that make up capsules (e.g., carbohydrates) can be linked together in various molecular configurations and can be further substituted with phosphate, nitrogen, sulfate, and other chemical modifications. These chemical variations allow capsules to present numerous antigenic targets on the microbial surface, thus allowing escape from the host immune response directed at these targets. Capsules can also be virulence factors which prevent microbes from being phagocytosed and killed by host macrophages and polymorphonuclear leukocytes. Antibodies against capsules provide a potent defense against encapsulated organisms by fixing complement to the microbial surface, which can result in their lysis or their opsonization, uptake, and killing by phagocytic host immune cells. The most potent antibodies against capsules are IgG antibodies. Capsules that fail to induce significant levels of IgG are called T-independent antigens. Covalent coupling of a protein to capsules renders them "T- dependent" and such antigens can elicit an IgG response.
There is a need for safe, synthetically accessible, cost-effective immunogenic conjugates directed to capsules and other T-independent antigens that do not evoke strong immune responses or IgG antibodies. Such immunogenic conjugates are needed to protect against various infectious diseases such as infection by anthrax, pneumococcus, influenzae Type B, meningococcus, and streptococcus.
SUMMARY OF THE INVENTION
The present invention relates to immunogenic compositions containing a polysaccharide antigen conjugated with a carrier protein in a complex, methods of making such immunogenic compositions, and methods of administering such immunogenic compositions. In a first aspect, the invention features an immunogenic composition including a polysaccharide- sortase conjugate, wherein the polysaccharide is an antigen and the sortase is a carrier protein, and wherein the sortase is covalently linked to the polysaccharide antigen through a linker containing a sortase recognition sequence.
In a second aspect, the invention features an immunogenic composition including a
polysaccharide-protein conjugate, the conjugate including a polysaccharide antigen and a carrier protein, wherein the polysaccharide antigen is covalently linked to the carrier protein through a linker containing a sortase recognition sequence and a polyglycine motif present at the N-terminus of the carrier protein.
In some embodiments, the immunogenic composition includes a sortase selected from sortase A, sortase B, sortase C, and sortase D. The immunogenic composition may include a sortase A, or a fragment thereof. The immunogenic composition may include sortase A having the amino acid sequence of SEQ ID NO: 1 . The immunogenic composition may include a sortase having an amino acid sequence that has at least 90% identity to the amino acid sequence of SEQ ID NO: 1 . The immunogenic composition may include a sortase having an amino acid sequence that has at least 95% identity to the amino acid sequence of SEQ ID NO: 1 . The immunogenic composition may include a sortase having an amino acid sequence that has at least 99% identity to the amino acid sequence of SEQ ID NO: 1 . The immunogenic composition may include a sortase B, or a fragment thereof. The immunogenic composition may include a sortase C, or a fragment thereof. The immunogenic composition may include a sortase D, or a fragment thereof.
In additional embodiments, the immunogenic composition may include a sortase including at least one mutation. The immunogenic composition may include a sortase that includes a substitution. The immunogenic composition may include the sortase recognition sequence having the formula X1 PX2X3 X4, where X1 -X4 are any amino acid. The immunogenic composition may further include the sortase recognition sequence having the formula X1 PX2X3G for a sortase A substrate, where Xi is Leu, lie, Val or Met, X2 is any amino acid, and X3 is Ser, Thr or Ala. The immunogenic composition may include the sortase recognition sequence LPX1TG for a sortase A substrate, where Xi is any amino acid. The immunogenic composition may include the sortase recognition sequence NPX1TX2 for a sortase B substrate, where Xi is Lys or Gin and X2 is Asn, Asp, or Gly. The immunogenic composition may include the sortase recognition sequence LPX1TX2 for a sortase C substrate, where Xi and X∑are any amino acid. The immunogenic composition may include the sortase recognition sequence LPX1TA for a sortase D substrate, where Xi is any amino acid. The immunogenic composition may include the sortase recognition sequence, LAX1TG for a sortase D substrate, where Xi is any amino acid.
In other embodiments, the invention features an immunogenic composition where the polyglyci motif includes an amino acid sequence selected from GG, GGG, GGGG, and GGGGG. The invention further includes an immunogenic composition where the polyglycine motif includes the amino acid sequence GGGGG. In certain embodiments, the sortase recognition sequence is linked to the polysaccharide through Z1-C(Z3)-N(H)-N(H)-(-C(0)-(L-C(0))n-N(H)-N(H)-)m-Z2,
where Z1 is a bond to an oxygen atom in the polysaccharide,
Z2 is a bond to a carbonyl group in the sortase recognition sequence,
Z3 is O or NH,
each of n and m is 0 or 1 , and
L, when present, is C2-6 alkanediyl or Ce-ιο arenediyl.
In another embodiment, the immunogenic composition of the invention includes carrier protein molecules that are selected from diphtheria toxin, diphtheria toxoid, tetanus toxin, tetanus toxoid, Pseudomonas aeruginosa exotoxin A, cholera toxin B subunit, tetanus toxin fragment C, bacterial flagellin, pneumolysin, an outer membrane protein of Neisseria menningitidis, Pseudomonas aeruginosa Hcp1 protein, Escherichia coli heat labile enterotoxin, shiga-like toxin, human LTB protein, pneumolysin, listeriolysin O, a protein extract from whole bacterial cells, the dominant negative mutant (DNI) of the protective antigen of Bacillus anthracis, and Escherichia coli beta-galactosidase. The invention also features an immunogenic composition where the whole bacterial cells are Pseudomonas aeruginosa or Streptococcal cells. The invention includes an immunogenic composition where the bacterial flagellin is the Vibrio cholerae flagellin protein. The invention includes an immunogenic composition where the shiga-like toxin is the Shigella SltB2 protein.
In additional embodiments, the immunogenic composition includes an antigen of interest where the antigen of interest is a polysaccharide, a polyalcohol, or a poly amino acid. The polysaccharide of the immunogenic composition may include at least 18 residues. The polysaccharide of the immunogenic composition may include a Streptococcus pneumoniae polysaccharide, Francisella tularensis polysaccharide, Bacillus anthracis polysaccharide, Haemophilus influenzae polysaccharide, Salmonella typhi polysaccharide, Salmonella species polysaccharide, Shigella polysaccharide, or Neisseria meningitidis polysaccharide. The Streptococcus pneumoniae polysaccharide of the immunogenic composition may be a capsular type 1 , 2, 3, 4, 5, 6A, 6B, 7A, 7B, 7C, 7F, 8, 9A, 9L, 9N, 9V, 10A, 10B, 10F, 1 1 A, 1 1 B, 1 1 C, 1 1 D, 1 1 F, 12A, 12B, 12F, 13, 14, 15A, 15B, 15C, 15F, 16A, 16F, 17A, 17F, 18A, 18B, 18C, 18F, 19A, 19B, 19C, 1 9F, 20, 21 , 22F, 23B, 23F, 24A, 24B, 24F, 25A, 25F, 27, 28A, 28F, 29, 31 , 32A, 32F, 33A, 33B, 33D, 33F, 34, 35A, 35B, 35F, 36, 37, 38, 39, 40, 41 A, 41 F, 42, 43, 44, 45, 46, 47A, 47F, or 48. The immunogenic composition of the invention may further include a Francisella tularensis polysaccharide that is an O antigen.
In further embodiments, the antigen of interest of the immunogenic composition is a microbial capsular polymer. The microbial capsular polymer of the immunogenic composition may include a poly- gamma-D-glutamic acid from Bacillus anthracis. The antigen of interest of the immunogenic composition may also include an organic polymer consisting of monomers having at least three atoms where each of the atoms is independently selected from carbon, oxygen, hydrogen, phosphate, nitrogen, and sulfate. The antigen of interest may include an organic polymer that is obtained from a microbe and/or does not occur in nature. The immunogenic composition may further include, e.g., a second antigen of interest or a third antigen of interest. The immunogenic composition may include an antigen of interest including whole cell pathogens where the whole cell pathogens include heat inactivated whole cell pathogens; chemically inactivated whole cell pathogens; and/or Pseudomonas aeruginosa or Streptococcal cells, wherein the Streptococcal cells include Streptococcus pneumonia. The immunogenic composition may further include whole cell pathogens from Streptococcus pneumonia type 1 , 2, 3, 4, 5, 6A, 6B, 7A, 7B, 7C, 7F, 8, 9A, 9L, 9N, 9V, 10A, 10B, 10F, 1 1 A, 1 1 B, 1 C, 1 1 D, 1 1 F, 12A, 12B, 12F, 13, 14, 15A, 15B, 15C, 15F, 16A, 16F, 17A, 17F, 18A, 1 8B, 18C, 18F, 19A, 1 9B, 19C, 19F, 20, 21 , 22F, 23B, 23F, 24A, 24B, 24F, 25A, 25F, 27, 28A, 28F, 29, 31 , 32A, 32F, 33A, 33B, 33D, 33F, 34, 35A, 35B, 35F, 36, 37, 38, 39, 40, 41 A, 41 F, 42, 43, 44, 45, 46, 47A, 47F, or 48. The antigen of interest of the immunogenic composition may include at least one whole cell pathogen selected from the group consisting of Streptococcus pneumonia type 1 , 2, 3, 4, 5, 6A, 6B, 7A, 7B, 7C, 7F, 8, 9A, 9L, 9N, 9V, 1 0A, 10B, 10F, 1 1 A, 1 1 B, 1 1 C, 1 1 D, 1 1 F, 12A, 12B, 12F, 13, 14, 15A, 15B, 1 5C, 15F, 16A, 16F, 17A, 1 7F, 1 8A, 18B, 18C, 18F, 19A, 19B, 19C, 19F, 20, 21 , 22F, 23B, 23F, 24A, 24B, 24F, 25A, 25F, 27, 28A, 28F, 29, 31 , 32A, 32F, 33A, 33B, 33D, 33F, 34, 35A, 35B, 35F, 36, 37, 38, 39, 40, 41 A, 41 F, 42, 43, 44, 45, 46, 47A, 47F, and 48. The antigen of interest may also include two or more whole cell pathogens selected from the group consisting of Streptococcus pneumonia type 1 , 2, 3, 4, 5, 6A, 6B, 7A, 7B, 7C, 7F, 8, 9A, 9L, 9N, 9V, 10A, 10B, 10F, 1 1 A, 1 1 B, 1 1 C, 1 1 D, 1 1 F, 12A, 12B, 12F, 13, 14, 15A, 1 5B, 15C, 15F, 1 6A, 16F, 17A, 17F, 18A, 18B, 18C, 18F, 19A, 19B, 19C, 19F, 20, 21 , 22F, 23B, 23F, 24A, 24B, 24F, 25A, 25F, 27, 28A, 28F, 29, 31 , 32A, 32F, 33A, 33B, 33D, 33F, 34, 35A, 35B, 35F, 36, 37, 38, 39, 40, 41 A, 41 F, 42, 43, 44, 45, 46, 47A, 47F, and 48.
The invention features an immunogenic composition that, when administered to a mammal, elicits a T-cell dependent immune response in the mammal. In the immunogenic composition of the invention, the molar ratio of the antigen to the carrier protein molecules may be 1 to 1 .
The invention further features a pharmaceutical composition in unit dosage form including (i) the immunogenic composition of the invention and (ii) a pharmaceutically acceptable excipient. In some embodiments the pharmaceutical composition does not comprise an adjuvant.
In another aspect, the invention features a method of making an immunogenic composition including a polysaccharide-protein conjugate, the method includes mixing a polysaccharide antigen including a sortase recognition sequence and a sortase where the mixing results in formation of a thioester bond between the polysaccharide antigen and the sortase, yielding the polysaccharide-protein conjugate. The method of making an immunogenic composition may further include mixing the polysaccharide-protein conjugate and a carrier protein including a polyglycine motif at its N-terminus where the mixing results in formation of a peptide bond between a terminal carboxyl group of a sortase recognition sequence attached to the polysaccharide antigen and a terminal amino group of the polyglycine motif of the carrier protein. The method of making an immunogenic composition may include the polysaccharide antigen that is a whole cell pathogen. In certain embodiments, the method further includes lysing the whole cell pathogen to produce a polysaccharide-protein conjugate, in which the polysaccharide antigen is not a whole cell pathogen. In particular embodiments, the immunogenic composition is purified (e.g., to separate the immunogenic composition from unreacted starting materials, reaction byproducts, and/or cellular debris). In further embodiments, the method further includes preparing the polysaccharide antigen containing the sortase recognition sequence by mixing a polysaccharide cyanate with a hydrazine-activated sortase recognition sequence, thereby effecting an addition reaction of a hydrazine moiety in the hydrazine-activated sortase recognition sequence to a cyanate group in the polysaccharide cyanate.
In additional embodiments, the invention features the use of the immunogenic composition of the invention to generate an immune response in a subject including administering the pharmaceutical composition of the invention to a subject where the immunogenic composition elicits a T-cell dependent immune response in the subject. The invention also features a method of generating an immune response in a subject including administering the pharmaceutical composition of the invention to a subject where the immunogenic composition elicits a T-cell dependent immune response in the subject. The subject may be an infant, a child, or an adolescent. In certain embodiments, the pharmaceutical composition is administered to the subject parenterally. In other embodiments, the pharmaceutical composition is administered to the subject orally.
DEFINITIONS
By "administering" as used herein in conjunction with an immunogenic conjugate, is meant providing to a subject an immunogenic conjugate in a dose sufficient to induce an immune response in the subject, where the immune response results in the production of antibodies that specifically bind an antigen contained in the immunogenic conjugate. Administering desirably includes parenteral administration (for instance, by subcutaneous, intramuscular, intravenous, or intradermal injection). While administering by a means that physically penetrates the dermal layer is desirable (e.g., a needle, airgun, or abrasion), the immunogenic conjugates of the invention can also be administered by transdermal absorption. Desirably, administration involves inclusion of the appropriate immune adjuvants.
Administering also includes enterally (for instance, by oral administration) by ingestion of an immunogenic conjugate in the form of e.g., a liquid, powder, capsule, or tablet. Administering may involve a single administration of an immunogenic conjugate or administering an immunogenic conjugate in multiple doses. Desirably, a second administration is designed to boost production of antibodies in a subject to reduce the likelihood of infection by an infectious agent. The frequency and quantity of the dosage of immunogenic conjugate depends on the specific activity of the immunogenic conjugate and can be readily determined by routine experimentation.
By "alkanediyl" is meant a divalent, saturated hydrocarbon group having a total of 2 to 6 carbon atoms. An alkanediyl may be linear or branched. Non-limiting examples of the alkanediyl groups are: ethane-1 ,2-diyl; propane-1 ,3-diyl; propane-1 ,2-diyl ; 2-methyl-propane-1 ,3-diyl ; butane-1 ,2-diyl; butane- 1 ,3-diyl ; and butane-1 ,4-diyl.
By "arenediyl" is meant a divalent, cyclic, aromatic group having a total of 6 to 10 carbon atoms. Non-limiting examples of the arenediyl groups are phenylene and napthylene.
By "amino acid" is meant a residue in a polypeptide sequence that can be naturally occurring or synthetic. A naturally occurring amino acid is one encoded by the genetic code. A synthetic amino acid is one that is analogous in chemical structure to a naturally occurring amino acid; or one that has a different chemical structure from a naturally occurring amino acid yet functions similarly to a naturally occurring amino acid. Amino acids may be referred to herein by their single or three letter abbreviations. The single letter abbreviation for a particular amino acid, its corresponding amino acid, and three letter abbreviation are as follows: A, alanine (Ala); C, cysteine (Cys); D, aspartic acid (Asp); E, glutamic acid (Glu); F, phenylalanine (Phe); G, glycine (Gly); H, histidine (His); I, isoleucine (lie) ; K, lysine (Lys); L, leucine (Leu); M, methionine (Met); N, asparagine (Asn); P, proline (Pro); Q, glutamine (Gin); R, arginine (Arg); S, serine (Ser); T, threonine (Thr); V, valine (Val); W, tryptophan (Trp); and Y, tyrosine (Tyr).
By "antigen" as used herein is meant any molecule or combination of molecules that is specifically bound by an antibody or an antibody fragment. By "boost the production of antibodies" is meant the activation of memory B-cells that occurs during a second exposure to an antigen, called a "booster response," and is indicative of a long lived "secondary" memory immune response, resulting in the long lived production of antibodies. By "carrier protein" is meant a protein used in an immunogenic composition that invokes an immune response to itself and/or to an antigenic polysaccharide covalently linked with a carrier protein. Desirably, the carrier protein contains an epitope recognized by a T-cell. Also encompassed by the definition of a carrier protein are enzymes of the sortase family of proteins. Desirably, a carrier protein includes multi-antigenic peptides (MAPs), which are branched peptides and include lysine. Exemplary desirable carrier proteins include toxins and toxoids (chemical or genetic), which may be mutant.
Desirably, a carrier protein is diphtheria toxin or a mutant thereof, diphtheria toxoid, tetanus toxin or a mutant thereof, tetanus toxoid, Pseudomonas aeruginosa exotoxin A or a mutant thereof, cholera toxin B subunit, tetanus toxin fragment C, bacterial flagellin, pneumolysin, listeriolysin O (and related molecules), an outer membrane protein of Neisseria menningitidis, Pseudomonas aeruginosa Hcp1 protein, Escherichia coli heat labile enterotoxin, shiga-like toxin, human LTB protein, a protein extract from whole bacterial cells, the dominant negative mutant (DNI) of the protective antigen of Bacillus anthracis, or Escherichia coli beta-galactosidase, or any other protein that can be conjugated by a peptide linker. A carrier protein can also include one or more affinity purification tags. Affinity purification tags are known in the art; non-limiting examples of the purification tags are poly-His tags (e.g., oligohistidines having from 5 to 10 His repeating units or from 6 to 9 repeating units), poly-Arg tag, FLAG-tag, calmodulin-tag, S-tag, SBP-tag, TC tag, Strep-tag, VSV-tag (vesicular stomatitis virus tag), Xpress tag, Isopeptag, Halo-tag, GFP-tag, biotin carboxyl carrier protein, chitin binding protein (CBP), maltose binding protein (MBP), glutathione-S-transferase (GST), V5-tag, Myc-tag, and HA-tag. The affinity tags have been described in Terpe Appl. Microbioll. Biotechnol., 60:523-533, 2003; Schmidt et al., Nat. Protocol., 2:1528-1535, 2007; the disclosure of which is incorporated herein by reference.
By "conjugated" or "conjugation" is meant an association of two entities, for example, of two molecules such as a polysaccharide and a protein. The association can be, for example, via an indirect (e.g., via a peptide linker) covalent linker connecting both molecules. Exemplary desirable conjugations include a polysaccharide and a carrier protein conjugated to each other to form a polysaccharide-protein fusion, where the polysaccharide and carrier protein are conjugated via a linker, e.g., an amino acid sequence connecting a polysaccharide side chain to an amino acid residue of the carrier protein.
Desirably, conjugation of a polysaccharide to a carrier protein is achieved by transpeptidation, where the carrier protein is a sortase enzyme. Desirably, conjugation of a polysaccharide to a carrier protein is achieved by transamidation, where the carrier protein replaces a sortase covalently linked to a polysaccharide to form a new polysaccharide-carrier protein conjugate. A carrier protein may be covalently linked to a polysaccharide through a linker containing Z1-C(Z3)-N(H)-N(H)-(-C(0)-(L-C(0))n- N(H)-N(H)-)m-Z2, where Z1 is a bond to an oxygen atom in the polysaccharide or a the whole cell pathogen, Z2 is a bond to a carbonyl group in the sortase recognition sequence or in the a carrier protein, e.g., containing sortase (e.g., a C-terminal carbonyl, aspartic acid side chain carbonyl, or glutamic acid side chain carbonyl), Z3 is O or NH, each of n and m is 0 or 1 , and L, when present, is C2-6 alkanediyl or C6-10 arenediyl. By "covalently linked" is meant the formation of a covalent bond between two molecules, macromolecules, or combination of molecules, e.g., between a polysaccharide and a carrier protein.
By "DNI" is meant the dominant negative mutant (DNI) protein, which is a mutated form of protective antigen (PA) of B. anthracis, as described by Benson et al. (Biochemistry 37:3941 -3948, 1998).
By "electrophilic source of cyanide" is meant a compound that upon reaction with a hydroxyl of an alcohol produces a cyanate group. Non-limiting examples of the electrophilic sources of cyanide include 1 -cyano-4-dimethylaminopyridinium tetrafluoroborate (CDAP) or cyanogen bromide.
By "hydrazine-activated sortase recognition sequence" is meant a sortase recognition sequence that is modified to include H2N-NH- group.
By "hydrazine source agent" is meant a compound capable of reacting with a carrier protein to produce a hydrazine-activated sortase recognition sequence. In some embodiments, the formula of a hydrazine source agent is H2N-N(H)-(-C(0)-(L-C(0))n-N(H)-N(H)-)m-H, in which each of n and m is 0 or 1 , and L is C2-6 alkanediyl or Ce-ι ο arenediyl. Non-limiting examples of hydrazine source agents are hydrazine and dicarboxylic acid dihydrazides (e.g., succinic acid dihydrazide or adipic acid dihydrazide). By "infection" is meant the invasion of a subject by a microbe, e.g., a bacterium, fungus, parasite, or virus. The infection may include, for example, the excessive multiplication of microbes that are normally present in or on the body of a subject or multiplication of microbes that are not normally present in or on a subject. A subject is suffering from a microbial infection when an excessive amount of a microbial population is present in or on the subject's body or when the presence of a microbial population(s) is damaging the cells or causing pathological symptoms to a tissue of the subject.
By "infectious agent" is meant a microbe, such as a bacterium, fungus, parasite, or virus that is capable of causing an infection in a subject. By "immunogenic" is meant a compound that induces an immune response in a subject.
Desirably, the immune response is a T-cell dependent immune response that involves the production of IgG antibodies.
By "microbial capsular polymer" is meant a polymer present in or on the capsule coating of a microbe. Desirably, a microbial capsular polymer is an organic polymer such as a polysaccharide, phosphopolysaccharide, polysaccharide with an amino sugar with a N-acetyl substitution, polysaccharide containing a sulfonylated sugar, another sulfate-modified sugar, or phosphate-modified sugar, polyalcohol, poly amino acid, teichoic acid, and an O side chain of a lipopolysaccharide. By "monomer" is meant a molecular structure capable of forming two or more bonds with like monomers, often yielding a chain or a series of branched, connected chains of repeating monomer substructures, when part of a "polymer."
By "organic polymer" is meant a polymer composed of covalently linked monomers each having three or more of the following atoms: carbon, oxygen, hydrogen, phosphate, nitrogen, and sulfate.
Desirably, an organic polymer is a polysaccharide, phosphopolysaccharide, polysaccharide with an amino sugar with a N-acetyl substitution, polysaccharide containing a sulfonylated sugar, another sulfate- modified sugar, or phosphate-modified sugar, sugar, polyalcohol, polyamino acid, teichoic acid, and an O side chain of lipopolysaccharide. By "polyalcohol" is meant a hydrogenated form of a carbohydrate where a carbonyl group has been reduced to a primary or secondary hydroxyl group. Exemplary polyalcohols are a polyalkylene oxide (PAO), such as a polyalkylene glycols (PAG), including polymethylene glycols, polyethylene glycols (PEG), methoxypolyethylene glycols (MPEG) and polypropylene glycols; poly-vinyl alcohol (PVA);
polyethylene-co-maleic acid anhydride; polystyrene-co-maleic acid anhydride; dextrans including carboxymethyl-dextrans; celluloses, including methylcellulose, carboxymethylcellulose, ethylcellulose, hydroxyethylcellulose carboxyethylcellulose, and hydroxypropylcellulose; hydrolysates of chitosan;
starches such as hydroxyethyl-starches and hydroxy propyl-starches; glycogen; agaroses and derivates thereof; guar gum ; pullulan; insulin ; xanthan gum; carrageenan ; pectin; alginic acid hydrolysates; sorbitol; an alcohol of glucose, mannose, galactose, arabinose, gulose, xylose, threose, sorbose, fructose, glycerol, maltose cellobiose, sucrose, amylose, amylopectin; or mono propylene glycol (MPG).
By "polyglycine" is meant a (Gly)n sequence. Desirably n is between 2 and 20, or more desirably between 2 and 5, and even more desirably 5 glycine residues. By "polysaccharide antigen" is meant a polymer of saccharides (sugars) derived from capsules of encapsulated bacterial pathogens such as Streptococcus pneumoniae, Francisella tularensis, Bacillus anthracis, Haemophilus influenzae, Salmonella typhi, Salmonella species, Shigella, or Neisseria meningitidis that is specifically bound by an antibody or an antibody fragment. By "sortase" is meant a protein having a catalytic domain with activity capable of i) selectively cleaving a backbone amide bond of a polypeptide (peptidase activity) at a "sortase recognition sequence," and ii) selectively catalyzing the formation of an amide bond between the terminal carboxyl group created by the cleavage and the free primary amino (R-CH2-NH2-R') group of a glycine
(transamidase activity). Sortases may be derived from enzymes expressed on the surface of Gram- positive bacteria which cleave cell surface proteins and link them to cell wall proteoglycans. Sortases may desirably be derived from one of four families of sortase enzymes including sortase A, sortase B, sortase C, and sortase D.
By "sortase ligation sequence" is meant an amino acid sequence that is capable of being selectively ligated to a second amino acid sequence by a sortase. A sortase ligation sequence can be either a sortase recognition sequence or a polyglycine sequence. By "sortase recognition sequence" is meant the consensus sequence for a sortase enzyme substrate. Desirably, the consensus sequence is X1 PX2X3G for a sortase A substrate, where Xi is Leu, He, Val or Met, P is Pro, X2 is any amino acid, X3 is Ser, Thr or Ala, and G is Gly. Desirably, the sortase recognition sequence for sortase A is LP X1TG. Desirably the consensus sequence is NPX1TX2 for a sortase B substrate, where N is Asn, P is Pro, Xi is Lys or Gin, T is Thr, and X2 is Asn, Asp, or Gly.
Desirably, the sortase recognition sequence for sortase C is LPX1TX2, where L is Leu, P is Pro, Xi and X2 are any amino acid residue, and T is Thr. Desirably the consensus sequences for sortase D are LPX1TA or LAX1TG, where L is Leu, P is Pro, Xi is any amino acid, T is Thr, A is Ala, and G is Gly. In the immunogenic compositions containing a polysaccharide covalently linked to a carrier protein, the sortase recognition sequence is a fragment resulting from the reaction of the sortase recognition sequence with a sortase.
By "subject" is meant an animal that can be infected by a microbe. Desirably, a subject is a mammal such as a human, monkey, dog, cat, mouse, rat, cow, sheep, goat, or horse. In a desirable embodiment, the subject is a human, such as a human child. Desirably, the subject is a human infant, toddler, pre-pubescent child, pubescent child, young adult, or adult under the age of 55 years old.
By "T-cell independent antigen" is meant an antigen which results in the generation of antibodies without the cooperation of T lymphocytes. The T-cell independent antigen desirably directly stimulates B lymphocytes without the cooperation of T lymphocytes. Exemplary desirable T-cell independent antigens include capsular antigen poly-gamma-D-glutamic acid (PGA), alginic acid (algenate), dextran, polysaccharides (PS), poly amino acids, polyalcohols, and nucleic acids.
The term "percent (%) identity" with respect to a reference polypeptide sequence is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the reference polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent identity to a polypeptide sequence can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN or Megalign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for aligning sequences, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared. For example, for a reference polypeptide of amino acid sequence A, when compared to the derivative polypeptide of amino acid sequence B, the percent identity to an amino acid sequence is calculated as:
100 times the fraction X/Y,
where X is the number of amino acid sequence residues scored as identical matches between A and B, and where Y is the total number of amino acid residues in the polypeptide sequence of B. Advantages
Compared to existing immunogenic conjugate technologies, the immunogenic conjugate compositions of the present invention are simple to make, less expensive, and more adaptive to different antigens of interest and carrier proteins than existing conjugate technologies.
The immunogenic conjugates of the present invention do not require that each combination of carrier protein and the antigen intended to evoke an immune response be conjugated by a tailored ligation process unique to their respective chemical properties. Polysaccharide (PS)-protein
immunogenic conjugates have been prohibitively expensive to produce and sell in the developing world, and conventional immunogenic conjugates are difficult to produce cheaply because of the highly specialized chemistry required for each antigen-protein conjugate. Thus, the present invention simplifies the method of making these conjugates and reduces the cost of their preparation compared to current immunogenic conjugate technology.
The immunogenic conjugates of the present invention also address a need for immunogenic conjugates that can safely induce immunity against previously intractable antigens. Immunogenic conjugates containing TLR (Toll-like receptor) ligands have been shown to evoke immune responses for otherwise intractable antigens, but they tend to be unsafe because TLR ligands are often
proinflammatory, toxic in even small doses, reactogenic, and likely to cause adverse symptoms compared to immunogenic conjugates of the invention.
Other features and advantages of the invention will be apparent from the following detailed description, the drawings, and the claims.
BRIEF DESCRIPTION OF THE DRAWINGS
FIG. 1 is a schematic of a conjugation reaction between a protein (Protein 1 ) and a peptidoglycan (Polysaccharide 1 ) catalyzed by a sortase in Staphylococcus aureus. In this model, sortase recognizes a C-terminus peptide signal ("LPXTGXX") on a protein and forms an intermediate conjugate with a protein before recognizing an N-terminus peptide signal ("GGG") on a peptidoglycan. In the final step, sortase covalently links a protein to a peptidoglycan to form a final conjugate. FIG. 2 is a schematic of a conjugation reaction between a polysaccharide (polysaccharide 2) and a protein (protein 2) catalyzed by a sortase. In this model, sortase recognizes a C-terminus peptide signal ("LPXTGXX") on a PS and forms an intermediate PS-sortase conjugate (conjugate 1 ). In the presence of a protein containing an N-terminus recognition sequence ("GGG"), sortase covalently links a protein to a PS to form a final PS-protein conjugate (conjugate 2).
DETAILED DESCRIPTION
The invention features novel immunogenic compositions and methods of making and administering such compositions to provide immunity against T-cell independent antigens or antigens which normally invoke weak immune responses, such as, e.g., polysaccharides (PS), polyalcohols, poly amino acids, and other organic polymers. The immunogenic compositions of the invention show the efficacy of a new method for antigenic conjugation. Specifically, a carrier protein and an antigenic polysaccharide can be conjugated in the presence of an enzyme from the sortase family of proteins. Thus, the carrier protein can effectively display and facilitate a robust immune response to the antigenic polysaccharide. The immune response to the antigenic polysaccharide can also be enhanced in the immunogenic conjugate relative to the isolated antigenic polysaccharide. Unlike other chemical conjugations, all immunogenic conjugates produced by the method described herein are homogenous in their structure and thus offer compositions with a high and reproducible specific activity. Thus, the new conjugation procedures can be applied to a wide range of antigens and carrier proteins to provide improved and highly active immunogenic conjugate compositions. The immunogenic composition of the invention can include an antigen (e.g., a polysaccharide or a whole cell pathogen) covalently linked to a sortase recognition sequence or a carrier protein containing sortase through Z1-C(Z3)-N(H)-N(H)-(-C(0)-(L-C(0))n-N(H)-N(H)-)m-Z2, where Z1 is a bond to an oxygen atom in the polysaccharide or a the whole cell pathogen, Z2 is a bond to a carbonyl group in the sortase recognition sequence or in the a carrier protein containing sortase (e.g., a C-terminal carbonyl, aspartic acid side chain carbonyl, or glutamic acid side chain carbonyl), Z3 is O or NH, each of n and m is 0 or 1 , and L, when present, is C2-6 alkanediyl or Ce-ιο arenediyl. These immunogenic compositions can be prepared by contacting an antigen-cyanate (e.g., prepared by contacting an antigen with an electrophilic source of cyanide, such as cyanogen bromide or 1 -cyano-4-dimethylaminopyridinium tetrafluoroborate (CDAP)) can be contacted with a hydrazine-activated sortase recognition sequence to produce an antigen-sortase recognition sequence conjugate. The antigen-sortase recognition sequence conjugate can be reacted with sortase to produce an antigen-carrier protein conjugate, in which the carrier protein contains sortase.
Polysaccharides are polymers of saccharides (sugars). PS derived from capsules are the primary antigenic components involved in protective immunity against encapsulated bacterial pathogens such as Neisseria meningitidis, Streptococcus pneumoniae, Salmonella typhi, and Haemophilus influenzae Type B. Immunization of adolescents and adults with immunogenic conjugates based on microbial PS has been successful in reducing disease burden, but has proven less effective in providing protective immunity to infants and young children (i.e., children less than 24 months of age). Young children have not yet developed a mature adaptive immune repertoire and T cell-independent antigens such as capsular PS are poorly immunogenic and do not lead to long-term protective immune responses (i.e., an immunological memory response) in such young immunogenic conjugate recipients.
A T-cell independent antigen such as PS can be converted to a T-cell dependent antigen by chemical coupling of PS to protein; this process is called "conjugation" and involves the formation of covalent bonds between atoms in the PS structure and side chain atoms of amino acids present in the "carrier" protein. Such "immunogenic conjugates" more efficiently promote the induction of B-cell maturation and isotype switching leading to much higher levels of antibody with the correct anti-PS protective profile. Protective antibodies have high affinity for their PS antigens, and typically are of the Immunoglobulin G (IgG) subclass, a long-lived antibody with complement fixing and opsonic effector activity. A non-limiting pathway for induction of an anti-PS IgG immune response is exemplified by a conjugate made between a PS and the carrier protein tetanus toxoid. In this model, only B-cells that display antibody receptors that recognize the PS bind the PS-carrier protein conjugate. Thus, the carrier protein is bound to the surface of the B-cell that displays the correct PS binding specificity. The carrier protein-PS complex is taken up by these B-cells into the intracellular vacuolar compartment where the carrier is processed by proteolytic degradation. Peptides derived from the carrier protein are transported and loaded into the presentation groove of the MHC-Class II receptor (MHC-II). This MHC-ll-carrier peptide complex is displayed on the surface of the B-cell. Upon recognition of the MHC-ll-peptide complex by the T-cell receptor (TCR), T-cells become activated and secrete cytokines that provide "help" for the induction of B-cell differentiation. B-cells expand in numbers and differentiate into "plasma cells" which now secrete antibody. Initially Immunoglobulin M (IgM) is produced by plasma cells but eventually the T-cell help causes the plasma cells to class switch and produce other isotype classes of antibody such as IgG. This process continues with plasma cells undergoing mutational changes leading to production of antibody receptors that have even higher affinity for the PS-carrier protein conjugates. As antigen is cleared, only the higher affinity plasma cells are activated by residual PS-carrier protein conjugate remaining in circulation. The process of T-cell dependent maturation of plasma cells continues, leading to the expansion of plasma cell populations which produce high affinity antibodies of the IgG class. The expansion can be easily monitored by measuring the levels of anti-PS IgG antibodies in the serum of an immunized subject, e.g., a human.
Eventually the maturation and switching process leads to the production of Memory B-cells which are long lived and specific for the PS. Memory B-cells have a unique property in that they can be immediately activated if exposed to PS. Activation causes memory B-cells to multiply and quickly produce anti-PS IgG. The activation of memory B cells that occurs during a second exposure of to PS antigen is called a "booster response" and is indicative of a long lived "secondary" memory immune response. Primary immunization may stimulate the production of IgM antibodies and some IgG antibodies. Upon secondary immunization, i.e., the "booster" shot, memory cells already programmed by the first immunization are stimulated to produce large quantities of IgG, the memory immune response. A T-cell independent antigen generally does not stimulate lasting immunity, i.e., the production of
IgG antibodies, but may stimulate the production of less potent and more temporary IgM antibodies. As such, PS antigens alone do not typically produce booster responses of IgG. However, PS do produce booster responses if primary immunization is performed with a PS-carrier protein conjugate because memory cells induced by the conjugate have already been programmed to produce IgG. Indeed, the booster response in immunized animals or humans is thought to mimic the protective response due to exposure to a microbe displaying the PS; this long term memory is critical for an immunogenic conjugate to work in protecting immunized subjects years after their immunization with immunogenic conjugates. Thus, PS-carrier protein conjugates are valued for (1 ) their ability to induce high levels of IgG against PS antigens, and (2) their ability to induce memory immune responses against PS antigens. PS antigens typically do not display these properties and thus are inferior antigens. The difficulty in synthesizing immunogenic conjugates and their cost of production has slowed the development of immunogenic conjugates for many bacterial diseases where an immune response to PS may be protective.
Other T-cell independent antigens include homopolymers of amino acids, such as poly-gamma- D-glutamic acid (PGA), and polyalcohols. Indeed most biological polymers are T-cell independent antigens. Polymers can cross-link Immunoglobulin (Ig) receptors on B-cells that recognize them due to the repetitive nature of their chemical structures (and thus epitopes). Thus polymers can activate B-cells for production of anti-polymer IgM in the same way that polysaccharides do. For example, an amino acid homopolymer, poly-gamma-D-glutamic acid (PGA) of Bacillus anthracis, is a capsular polymer that is poorly immunogenic and also a T-cell independent antigen. Immunogenic conjugates composed of PGA linked to protein carriers are highly immunogenic, able to induce anti-PGA IgG and immunological memory to PGA. Hence, most polymers respond like PS in terms of their immunogenicity because they cannot be processed and displayed in the context of MHC-II and thus cannot recruit T-cell help. An exception is found in some naturally-occurring polymers that interact with another class of receptor termed Toll-like receptors (TLRs). Once activated, TLRs can induce production of cytokines by host cells and produce changes in the adaptive immune response. Some PS are covalently attached to TLR ligands or contaminated with such ligands. For example, lipopolysaccharides (LPS) are PS that are highly immunogenic and induce IgG and memory responses; the lipid A moiety of LPS is a TLR ligand and may be responsible for the immunological properties. Immunogenic conjugates are difficult to produce cheaply because of the specialized chemistry required. PS-carrier protein conjugation by covalent linkage procedures have numerous drawbacks, including the need for organic solvents and other reagents that can adversely affect the structure and/or epitope presentation of carrier proteins; highly specialized chemical linkage reactions to selectively target a reactive site within the target protein; and time-consuming additional processing steps for carrying out the conjugation. Typically, coupling chemistry must be worked out for various PS that is unique for the chemistry of the PS and the carrier protein that has been selected. This coupling chemistry introduces functional groups in the PS that then can be linked to carrier protein typically through the epsilon amino side chains of lysine residues. For conventional PS-protein immunogenic conjugates, the PS structure, nature of the carrier protein selected, and the type of linkage chemistry can all affect immunogenicity of the conjugate. As such, for example, in the case of pneumococcal disease where each of the 90+ known serotypes has a different PS structure (Bentley et al., PLOS Genetics 2(3):e31 262-269, 2006), one single conjugation method may not be appropriate for all serotypes. Reproducibly synthesizing immunogenic conjugates with reproducible immunological properties involves careful control of the PS structure, the nature of the carrier selected, and the type of linkage chemistry, all of which dramatically increase the cost of manufacture of immunogenic conjugates. Thus, there is a need for a simplified, reproducible, cost-effective mechanism of producing PS-protein conjugates.
The sortase family of bacterial proteins includes well-conserved enzymes encoded by the genomes of numerous Gram positive bacterial organisms. Their enzymatic activity was first described in Staphylococcus aureus. As shown in Fig. 1 , naturally occurring sortases modify surface proteins by recognizing and cleaving a carboxyl-terminal recognition signal. For most substrates of sortase enzymes, the recognition signal consists of the motif LPXTG (Leu-Pro-any amino acid (AA)-Thr-Gly), followed by a highly hydrophobic transmembrane sequence, and a cluster of basic residues such as Arg. Sortase peptidase activity results in cleavage between the T and G residues of the sortase recognition sequence. Furthermore, a sortase active site, containing a sulfhydryl group within the Cys residue, is exposed to the carboxyl group of the Thr residue, allowing for formation of a thioester bond between C and T residues. A transamidation reaction between the sortase-protein conjugate and a polysaccharide polymer, peptidoglycan, displaying a polyglycine motif results in a covalent linkage between the carboxyl group of the protein and the amino group of the Gly of the polysaccharide. The formation of this peptide bond leads to the covalent attachment of the protein to the bacterial cell wall (Marraffini et al., Microbiol Mol Biol Rev. 70: 192-221 , 2006).
Sortases have been classified into four major families, designated sortase A (SrtA), sortase B (SrtB), sortase C (SrtC), and sortase D (SrtD), respectively, based on sequence alignment and phylogenetic analysis of 61 sortases from Gram-positive bacterial genomes (Dramsi et al., Res Microbiol. 156: 289-97, 2005). Sortase A of Staphylococcus aureus recognizes a LPXTG like sequence motif located near the C-terminus of the target proteins, cleaves at the Thr-Gly peptide bond, and catalyzes the formation of a new peptide bond between a threonyl carboxyl and an amino group of the peptidoglycan penta-glycine cross-bridges (Marraffini et al., Microbiol Mol Biol Rev. 70: 192-221 , 2006; Ton-That et al., Proc Natl Acad Sci USA. 96: 12424-12429, 1999). The immunogenic composition of the invention encompasses embodiments relating to a SrtA, SrtB, SrtC, and/or SrtD from any bacterial species or strain, as well as evolved sortases that have been modified from their wild type amino acid sequences to include at least one mutation in the encoding sequence, examples of which are provided herein.
The conjugation of an antigen (e.g., a polysaccharide or a whole cell pathogen) to a sortase recognition sequence may be performed using a cyanylation-mediated conjugation method. Specifically, contacting an antigen-cyanate with a hydrazine-activated sortase recognition sequence can produce a conjugate, where the antigen is linked to the sortase recognition sequence through the linker Z1-C(Z3)- N(H)-N(H)-(-C(0)-(L-C(0))n-N(H)-N(H)-)m-Z2, as defined herein. The antigen-cyanate can be prepared through the cyanylation of the antigen with an electrophilic source of cyanide (e.g., cyanogen bromide or CDAP). The hydrazine-activated sortase recognition sequence can be prepared by reacting the sortase recognition sequence with a hydrazine source agent (e.g., H2N-N(H)-(-C(0)-(L-C(0))n- N(H)-N(H)-)m-H) under the reaction conditions known in the art for hydrazide formation (e.g., using a coupling agent, such as EDC). For a general description of the cyanylation-mediated conjugation reactions, see Bioconjugate Techniques, 3rd ed.; eds.: Hermanson; Academic Press, London, UK, incorporated herein by reference. For example, one non-limiting cyanylation-mediated conjugation protocol includes dissolution of a hydrazine source agent (e.g., dicarboxylic acid dihydrazide, such as succinic acid dihydrazide or adipic acid dihydrazide) in about neutral pH phosphate buffer (e.g., pH of 7.2) containing sodium chloride (e.g., about 0.15M sodium chloride), dissolving a sortase recognition sequence in this solution, adding a peptide coupling agent (e.g., 1 -ethyl-3-(3- dimethylaminopropyl)carbodiimide (EDC)), and allowing the resulting reaction mixture to react for a sufficient time period (e.g., about 2 to 4 hours). The resulting hydrazine-activated sortase recognition sequence can be purified, e.g., by dialysis or gel filtration using a desalting resin. The antigen-sortase recognition sequence conjugate can be reacted with a sortase to produce an antigen-carrier protein conjugate, in which the carrier protein contains sortase. The antigen-carrier protein conjugate can then be reacted with another carrier protein, as described herein. Advantageously, preparation of a whole cell-carrier protein conjugates can facilitate the preparation of polysaccharide-carrier protein conjugates, as, after the conjugation, the whole cell-carrier protein conjugate can be subjected to lysing conditions known in the art, and the resulting
polysaccharide-carrier protein conjugate can be purified away from the cellular debris and reaction byproducts using, e.g., affinity purification using solid support having affinity for the carrier protein (e.g., if the carrier protein includes one or more affinity purification tags, or if the solid support includes antibodies specific to the carrier protein).
Immunogenic Conjugates
The immunogenic conjugates of the invention have the potent immunological properties of typical PS-carrier protein immunogenic conjugates but desirably differ from previously known immunogenic conjugates in that an antigen of interest, e.g., PS or capsular organic polymer, may be coupled to a desired carrier protein without utilizing differing chemical linkages specialized to produce each combination. Rather, as depicted in Fig. 2, a novel sortase reaction is performed that is the reverse of a sortase reaction in nature where an antigenic polysaccharide is coupled to a sortase or a carrier protein. In the immunogenic conjugates of the invention, an antigen of interest, e.g., PS or capsular organic polymers, is covalently linked by a thioester bond to a sortase which is then optionally capable of coupling the antigen with a carrier protein by a peptide bond. For example, a PS-carrier protein conjugate may be formed by first covalently linking a sortase to a soluble antigen, e.g., PS or capsular organic polymers: these immunogenic conjugates are referred to as a PS-sortase immunogenic conjugates (conjugate 1 in Fig. 2). The novel PS-sortase conjugate may be enzymatically stabilized by chemical cross-linking, for example, such that sortase is the carrier protein of the immunogenic conjugate. Alternatively, an un- stabilized PS-sortase immunogenic conjugate in the presence of a secondary carrier protein may catalyze the covalent linkage between the antigenic PS and the secondary carrier protein to produce a novel PS- carrier protein conjugate: these immunogenic conjugates are referred to as PS-carrier protein immunogenic conjugates (conjugate 2 in Fig. 2).
In desirable embodiments, the immunogenic conjugates of the invention include a polysaccharide antigen conjugated to a sortase carrier protein capable of stimulating an immune response. In another desirable embodiment, the immunogenic conjugates of the invention include a polysaccharide antigen conjugated to a carrier protein capable of stimulating an immune response.
Immunogenic conjugates of the invention may be prepared by attaching a sortase recognition sequence to a polysaccharide. In the presence of a sortase, the polysaccharide becomes a sortase substrate and is covalently linked to a sortase by a sortase ligation sequence. In desirable embodiments, the thio-ester linkage between the PS and sortase conjugate may be stabilized to prevent reversal of the covalent bond formed. Methods of enzymatic stabilization by photo cross-linking, e.g., ultraviolet (UV) cross-linking, or chemical cross-linking, e.g., formaldehyde, glutaraldehyde, and formaldehyde/glutaraldehyde cross-linking, are well known in the art. Once the PS-sortase immunogenic conjugate is formed, treatment with, for instance, a chemical cross-linker such as formaldehyde, crosslinks the basic amino acid lysine residues of sortase, further stabilizing the enzymatic conjugate. Further, a carrier protein of interest may be attached to a polyglycine motif to enable covalent linkage between itself and the PS. By mixing of the non-cross-linked PS-sortase conjugate with a carrier protein attached to a polyglycine motif, a covalent bond between an antigenic PS and the carrier protein is formed by a sortase ligation sequence, which produces the PS-carrier protein conjugate. By attaching a synthetic peptide to a PS, an antigenic polysaccharide may be covalently linked to any sortase enzyme. Further, attachment of a polyglycine motif to a carrier protein enables the covalent linkage of an antigenic polysaccharide to any carrier protein, when a first PS-sortase conjugate is formed. Exemplary and preferred carrier proteins and polysaccharide antigens of interest are described herein.
The methods of making immunogenic conjugates described herein are less complex than immunogenic conjugate technology because its chemistry depends only on the covalent-linking chemistry of a sortase recognition peptide of the antigenic PS with that of the Cys residue of a sortase active site; or the polyglycine motif of the carrier protein (e.g., DNI, cholera toxin B subunit, diphtheria toxin, tetanus toxin Fragment C, or Escherichia coli beta-galactosidase). Furthermore, multiple antigenic
polysaccharides can be coupled to a carrier protein ; or, a mixture of carrier proteins can be conjugated to the antigenic PS in a single reaction or multiple sequential reactions. Thus, the method described herein enables multiplexing of the immunogenic conjugate, further reducing the cost of production.
Immunogenic conjugates of the invention may be made using a combination of a sortase recognition peptide and polyglycine motif, such as, e.g., those described herein, to covalently link any carrier protein, such as, e.g., those described herein, in the presence of one or more antigens of interest, such as, e.g., those described herein. If one antigen of interest is used, the immunogenic conjugate of the invention is said to be monovalent. If more than one antigen of interest is used, the immunogenic conjugate of the invention is said to be multivalent. The methods of making immunogenic compositions described herein may be used with any antigenic polysaccharide capable of being covalently linked by a free carboxyl group, e.g., any capsular polymer or any polymer, attached to a sortase recognition peptide, and any carrier protein capable of being covalently-linked by a free amino group, e.g., carrier proteins attached to a polyglycine motif.
Tetanus toxoid is one possible carrier protein. This toxin is detoxified by treatment with formaldehyde, a reagent that reacts with amino groups of proteins. Other desirable carrier proteins include the cholera toxin B subunit (available from SBL Vaccin AB), diphtheria toxin, tetanus toxin Fragment C (available from Sigma Aldrich), DNI, or beta-galactosidase from Escherichia coli (available from Sigma Aldrich). Further, immunogenic conjugates of the invention may include whole cell encapsulated pathogens as the antigen, eliminating the need for purification and characterization of antigenic PS. Whole cell encapsulated pathogens may be killed by a chemical, e.g., formaldehyde, treatment or by heat-inactivation and subsequently conjugated to sortase as described herein. The immunogenic conjugates of the invention may be used to immunize against, for example, Pneumococcus infection, Streptococcus (groups A and B) infection, Haemophilus influenzae type B ("HiB") infection, meningococcal (e.g., Neisseria meningitides) infection, and may be used as O antigen immunogenic conjugates from Gram negative bacteria (e.g., Pseudomonas aeruginosa, Francisella tularensis (Thirumalapura et al., J. Med. Microbiol. 54:693-695, 2005; Vinogradov and Perry, Carbohydr. Res. 339:1643-1 648, 2004; Vinogradov et al., Carbohydr. Res. 214:289-297, 1991 ), Shigella species, Salmonella species, Acinetobacter species, Burkholderia species, and Escherichia coli).
Peptide Linkers
Peptide linkers used in the immunogenic conjugates of the invention desirably are polypeptide sequences that are substrates for a sortase enzyme. In a further embodiment, an immunogenic conjugate composition is provided including an antigenic polysaccharide covalently linked to a carrier protein by a peptide bond of a sortase ligation sequence. Desirably, the immunogenic conjugate of the invention has the formula: PS-L-CP, where PS is an antigenic polysaccharide; L is a peptide linker; and CP is a carrier protein. For example, the covalent linkage between an antigenic polysaccharide and a carrier protein may consist of a peptide bond at the carboxyl-terminus of a synthetic peptide attached to a side chain of an antigenic polysaccharide. Exemplary PS side chain groups capable of attachment include, but are not limited to, vicinal hydroxyls, non-vicinal hydroxyls, carboxyl groups, amino groups and reducing sugar aldehydes. Examples of a synthetic peptide utilized in the present invention include a sortase recognition sequence with a carboxyl-terminus, such that prior to linkage with the carrier protein, includes a sortase A, B, C or D recognition motif.
For example, such a synthetic peptide may, in certain embodiments, be engineered to include the sortase recognition sequence LPXTG, where X is any amino acid, and includes but is not limited to residues with amino, carboxyl, thiol, halogen, and azide groups, such that these groups may chemically react with an activated polysaccharide. The sortase recognition sequence may be modified to include reactive residues located at the N-terminal of, internal to, or C-terminal of the synthetic peptide, such that the residues allow for covalent modification of a polysaccharide. The sortase recognition sequence of the invention may further be covalently linked to a chemically activated antigenic polysaccharide. Antigenic polysaccharides of the invention may be chemically activated with periodate, cyanogen borohydride, or carbodiimide reagents.
In other desirable embodiments, a covalently linked polysaccharide to a synthetic peptide is mixed with a sortase enzyme capable of recognizing the peptide sequence. In another desirable embodiment, a sortase enzyme is covalently linked to a polysaccharide by a sortase ligation sequence of LPXT, where X is any amino acid. A peptide linker of the invention may additionally include a polyglycine motif with a peptide sequence of GGGGG. Such a polyglycine motif is covalently bound to a free primary amino group (NH2-R) of a desired carrier protein and is recognized by a sortase enzyme. A carrier protein of the invention may encompass a carrier protein further chemically modified to covalently link the carrier protein with at least one peptide and/or at least one protein that displays the polyglycine motif. In other desirable embodiments, a covalently linked carrier protein to a polyglycine motif is mixed with a polysaccharide covalently linked to a sortase enzyme that is capable of recognizing the polyglycine motif. In some embodiments, an antigenic polysaccharide and a carrier protein include the sortase ligation sequence LPXT at the covalent linkage.
In some embodiments, a sortase ligation sequence includes a sortase recognition sequence. In some embodiments, a sortase ligation sequence is located C-terminal of an antigenic PS. In some embodiments, a sortase ligation sequence includes a polyglycine motif of 2, 3, 4 or 5 Gly residues. In some embodiments, a sortase ligation sequence is located N-terminal of a carrier protein. In other embodiments, a sortase ligation sequence is located C-terminal of an antigenic polysaccharide, and N- terminal of a carrier protein. In some embodiments, an immunogenic conjugation includes formation of an amide bond between a C-terminal carboxyl group of a cleaved sortase recognition sequence and an N-terminal amino group of a polyglycine sequence.
In some embodiments, a sortase recognition sequence is a sortase A recognition sequence having a consensus sequence Xi PX2X3G, where Xi is Leu, He, Val or Met, P is Pro, X2 is any amino acid, X3 is Ser, Thr or Ala, and G is Gly. In further embodiments, X2 is Asp, Glu, Ala, Gin, Lys or Met. In some embodiments, a sortase recognition sequence is a sortase A recognition sequence having the consensus sequence LPX1TG, where Xi is any amino acid. Exemplary sortase A recognition sequences include but are not limited to the following sequences: LPKTG, LPATG, LPNTG, LPETG, LPNAG, LPNTA, LGATG, IPNTG, or IPETG.
In some embodiments, a sortase recognition sequence is a sortase B recognition sequence having a consensus sequence NPX1TX2, where N is Asn, P is Pro, Xi is Lys or Gin, T is Thr, and X2 is Asn, Asp, or Gly. In further embodiments, a sortase B recognition sequence is NPQTN. Exemplary sortase B recognition sequences include but are not limited to the following sequences: NPKTG, NSKTA, NPQTG, NAKTN, or NPQSS
In some embodiments, a sortase recognition sequence is a sortase C recognition sequence and may utilize as its substrate LPX1TX2, where L is Leu, P is Pro, and T is Thr, as a recognition motif, with each Xi and X2 independently representing any amino acid residue.
In some embodiments, a sortase recognition sequence is a sortase D recognition sequence. In some embodiments, consensus sequences for sortase D are LPX1TA or LAX1TG, where L is Leu, P is Pro, Xi is any amino acid, T is Thr, A is Ala, and G is Gly.
Additional embodiments of the immunogenic conjugate may include a combination of any of the above sortase recognition sequences. For example, the invention may include an antigenic
polysaccharide covalently linked to at least one sortase recognition sequence. Furthermore, sortase recognition sequences linked to an antigenic polysaccharide may be the same sequence or include any of the differing sequences, such as recognition sequences provided for SrtA, SrtB, SrtC, and/or SrtD. In additional embodiments, an antigenic polypeptide of the invention is covalently linked to at least one carrier protein. Carrier Proteins
Carrier proteins used in the immunogenic conjugates of the invention desirably are proteins that, either alone or in combination with an antigen, invoke an immune response in a subject. Desirably, the carrier protein contains at least one epitope recognized by a T-cell. Desirably, the epitope is capable of inducing a T-cell response in a subject, and induce B-cells to produce antibodies against the entire antigen of interest. Epitopes as used in describing this invention, include any determinant on an antigen that is responsible for its specific interaction with an antibody molecule or fragment thereof. Epitopic determinants usually consist of chemically active surface groupings of molecules such as amino acids or sugar side chains and have specific three-dimensional structural characteristics as well as specific charge characteristics. To have immunogenic properties, a protein or polypeptide generally is capable of stimulating T-cells. However, a carrier protein that lacks an epitope recognized by a T-cell may also be immunogenic.
By selecting a carrier protein that is known to elicit a strong immunogenic response, a diverse population of subjects can be treated by an immunogenic conjugate described herein. The carrier protein desirably is sufficiently foreign to elicit a strong immune response to the immunogenic conjugate.
Typically, the carrier protein used is a molecule that is capable of imparting immunogenicity to the antigen of interest. In a desirable embodiment, a carrier protein is one that is inherently highly immunogenic. Thus, a carrier protein that has a high degree of immunogenicity and is able to maximize antibody production to the antigens complexed with it is desirable.
Various carrier proteins of the invention include, e.g., toxins and toxoids (chemical or genetic), which may or may not be mutant, such as anthrax toxin, PA and DNI (PharmAthene, Inc.), diphtheria toxoid (Massachusetts State Biological Labs; Serum Institute of India, Ltd.) or CRM 197, tetanus toxin, tetanus toxoid (Massachusetts State Biological Labs; Serum Institute of India, Ltd.), tetanus toxin fragment Z, exotoxin A or mutants of exotoxin A of Pseudomonas aeruginosa, bacterial flagellin, pneumolysin, an outer membrane protein of Neisseria meningitidis (strain available from the ATCC (American Type Culture Collection, Manassas, Va.)), Pseudomonas aeruginosa Hcp1 protein,
Escherichia coli heat labile enterotoxin, shiga-like toxin, human LTB protein, a protein extract from whole bacterial cells, and any other protein that can be cross-linked by a peptide linker. Desirably, the carrier protein is the cholera toxin B subunit (available from SBL Vaccin AB), diphtheria toxin (Connaught, Inc.), tetanus toxin Fragment C (available from Sigma Aldrich), DNI, or beta-galactosidase from Escherichia coli (available from Sigma Aldrich). Other desirable carrier proteins include bovine serum albumin (BSA), P40, and chicken riboflavin. (Unless otherwise indicated, the exemplary carrier proteins are commercially available from Sigma Aldrich.) Other exemplary carrier proteins are MAPs (multi-antigenic peptides), which are branched peptides. By using a MAP, cross-linking density is maximized because of multiple branched amino acid residues. An exemplary amino acid that can be used to form a MAP is, but is not limited to, lysine. Both BSA and keyhole limpet hemocyanin (KLH) have commonly been used as carriers in the development of immunogenic conjugates when experimenting with animals. Carrier proteins which have been used in the preparation of therapeutic immunogenic conjugates include, but are not limited to, a number of toxins of pathogenic bacteria and their toxoids. Examples include diphtheria and tetanus toxins and their medically acceptable corresponding toxoids. Other candidates are proteins antigenically similar to bacterial toxins referred to as cross-reacting materials (CRMs). Carrier proteins of the invention may also include any protein not derived from humans and not present in any human food substance.
In another embodiment, DNI is used as the carrier protein because it is nontoxic leaving no need to detoxify the protein before use. Furthermore, the use of DNI is desirable because DNI may also induce a protective immune response to B. anthracis, in addition to the protective immune response to the antigen of interest.
A carrier protein may include one or more affinity purification tags. Purification tags are known in the art. Non-limiting examples of the purification tags are poly-His tags (e.g., oligohistidines having from 5 to 10 His repeating units or from 6 to 9 repeating units), FLAG-tag, calmodulin-tag, S-tag, SBP-tag, TC tag, Strep-tag, VSV-tag, Xpress tag, Isopeptag, Halo-tag, GFP-tag, biotin carboxyl carrier protein, chitin binding protein (CBP), maltose binding protein (MBP), glutathione-S-transferase (GST), V5-tag, Myc-tag, and HA-tag.
Sortases
Other exemplary carrier proteins of the invention include members of the sortase family of enzymes because sortases may also induce a protective immune response to Gram-positive bacterium in addition to the protective immune response to the antigen of interest. A sortase carrier protein may be derived from a sortase A, sortase B, sortase C, or sortase D. Carrier proteins of the invention may also include a catalytically active fragment, derivative, or variant of a sortase A, sortase B, sortase C, or sortase D. For example, the carrier protein of the invention may include a soluble fragment of sortase A including the C-terminal catalytic domain. In another exemplary embodiment, the carrier protein of the invention may include a central catalytic domain of a sortase B.
Examples of suitable sortases are described in Dramsi et al., Res. Microbiol. 156:289-297, 2005; Comfort et al., Infect. Immun., 72:2710-2722, 2004; Chen et al., Proc. Natl. Acad. Sci. USA. 108:1 1399- 1 1404, 201 1 ; and Pallen et al., Trends in Microbiology. 9: 97-1 01 , 2001 , the entire contents of each of which are incorporated herein by reference. The sortase carrier protein may also be isolated from but not limited to one of the following bacterial strains: Bacillus anthracis, Bacillus cereus, Bacillus halodurans, Clostridium acetobuty lieu m (SortaseD), Clostridium perfringens, Clostridium tetani (SortaseD),
Enterococcus faecalis, Lactobacillus plantarum, Lactococcus lactis, Listeria innocua, Listeria
monocytogenes, Staphylococcus aureus, Staphylococcus epidermis, Streptococcus agalactiae,
Streptococcus gordonii, Streptococcus mutans, Streptococcus phenumoniae, Streptococcus pyogenes, and Streptococcus suis.
The sequences of many sortases and of the naturally occurring nucleic acids that encode them are found in publicly available databases such as those of the National Center for Biotechnology
Information (NCBI) available at Entrez (http://www.ncbi.nlm.nih.gov/Entrez), e.g., GenBank. The sequences of sortase proteins having the accession numbers provided herein are hereby incorporated by reference.
The carrier protein of the invention may include a sortase A derived from class A sortases, e.g., S. aureus sortase A. The prototypical class A sortase, S. aureus sortase A, has been purified and characterized (Ton-That et al., Proc. Natl. Acad. Sci. USA. 96:12424-12429, 1999), and the gene that encodes it has been cloned and sequenced (Mazmanian, et al., Science. 285:760-763, 1 999.) The gene has been assigned accession number AF162687, and the protein sequence has accession number AAD48437.1 . Additional exemplary sequences of class A sortases from a variety of other bacterial species are available under the following GenBank accession numbers: S. pyogenes (Spyog) SrtA,
AAK34025; S. gordonii (Sgord) SrtA, AAG41 778; L. lactis (Llact) hypO, AAK0521 1 ; S. aureus (Saure) SrtA, AAD48437; and A. naeslundii (Anaes) fimbria-associated protein (fimassoc), AAC13546;
Staphylococcus aureus subsp. aureus MSSA476, CAG44229. In additional embodiments, the carrier protein of the invention features a sortase B derived from class B sortases identified from the Streptococcus, Bacillus, Staphylococcus, Clostridia, and Listeria genera, among others. Exemplary sequences of several class B sortases are available at GenBank accession numbers as follows: S. pyogenes, NP 268518; B. anthracis, NP 846988; C. perfringens, NP_561429; E. faecalis, AAQ16264; Staphylococcus aureus subsp. aureus MRSA252, CAG401 10; L. monocytogenes, CAD00259.
The carrier protein of the invention may include a sortase C derived from class C sortases found among species in the Streptococcus, Enterococci, Bacillus, and Clostridia genera. Exemplary sequences of several class C sortases are available under the following accession numbers: S. pyogenes, AAL1 1468; C. diphtheriae, NP_940532.1 ; Streptococcus suis, BAB83966.
In some embodiments, the invention features a sortase D carrier protein derived from class D sortases found among species in the Streptomyces, Corynebacterium, Clostridium, and Bacillus genera. Sequences of several class D sortases are available under the following accession numbers:
Streptomyces coelicolor, NP_628037; B. subtilis, CAB 12748, C. tetani, NP_781831 .
The amino acid sequences of sortases and the nucleotide sequences that encode them are known to those of skill in the art and are disclosed in a number of references cited herein, the entire contents of all of which are incorporated herein by reference. Those of skill in the art will appreciate that any sortase and any sortase recognition motif can be used in some embodiments of this invention, including, but not limited to, the sortases and sortase recognition motifs described in Ploegh et al., International PCT Patent Application, PCT/US2010/000274, filed Feb. 1 , 2010, published as
WO/2010/087994 on Aug. 5, 2010 (e.g., paragraphs [0089]-[0101 ]); and Ploegh et al., International Patent Application PCT/US201 1 /033303, filed Apr. 20, 201 1 , published as WO/201 1 /133704 on Oct. 27, 201 1 (e.g., paragraphs [0085-0094]); the entire contents of each of which are incorporated herein by reference. The carrier protein of the invention may also include evolved sortases. An evolved sortase exhibits enhanced reaction kinetics, for example, in that it catalyzes a transpeptidation reaction at a greater speed or turnover rate than the respective wild type sortase. An evolved sortase may exhibit a modified substrate preference, for example, in that it utilizes a different substrate (e.g., a polypeptide comprising an altered sortase recognition sequence) or binds a given substrate with higher or lower affinity, or with higher or lower specificity than the respective wild type sortase. For instance, the evolved sortase recognizes a sortase recognition sequence that the respective wild type sortase does not recognize or bind. See, e.g., Liu et al., United States Patent Application, 13/922,812, filed Jun. 20, 2013, published as US2014/0057317A1 on Feb. 27, 2014, the entire contents of each of which are incorporated herein by reference, for exemplary sortases, recognition motifs, reagents, and methods for directed evolution of bond-forming sortases.
For example, some embodiments of the invention provide a sortase comprising a polypeptide sequence of S. aureus Sortase A (SEQ ID NO: 1 ) that is homologous to the polypeptide sequence of a wild type Sortase A (NP 647265.1 ), or a fragment thereof, as provided below:
SEQ ID NO: 1 :
MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSK VAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVY FKVGNETRKYKMTSIRDVKPTDVEVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK.
In some embodiments, the polypeptide sequence of the provided sortase may include one or more amino acid mutations as compared to the wild type sequence of the respective sortase (e.g., the sequence of SEQ ID NO: 1 ). For example, the evolved sortase sequence provided may include 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, 1 5, 16, 1 7, 18, 19, 20, 25, or more mutations. In some embodiments, the polypeptide sequence of the provided sortase is at least 90% identity (e.g., 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 99.5%) to a wild type sortase sequence (e.g., the sequence of SEQ ID NO: 1 ).
For example, in a desirable embodiment of the invention an evolved S. aureus sortase A is provided. An evolved sortase A, or a fragment thereof, may include a mutation relative to the sequence of SEQ ID NO: 1 described herein, for example, P86L, P94S, P94R, N98S, A104T, E106G, A1 1 8T, F122S, F122Y, D124G, N127S, K134R, F154R, D160N, D165A, K173E, G174S, K177E 1182V K1 90E, or K196T, or any combination of any one of these mutations. In some embodiments, an evolved sortase is provided herein that includes 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, 15, 16, 17, 18, or all 19 of these mutations. The aforementioned amino acid substitution may provide an evolved sortase that efficiently uses substrates not bound by the respective parent wild type sortase. For example, in some
embodiments, an evolved sortase is provided that is derived from a wild type S. aureus sortase A as the parent sortase A, which utilizes substrates including a C-terminal sortase recognition motif of the sequence LPXTG and substrates including an N-terminal polyglycine motif in a transpeptidation reaction. In some embodiments, the evolved sortases utilize a substrate different from those used by the parent sortase, e.g., substrates including a C-terminal LPXS, LAXT, LAXTG, MPXT, MPXTG, LAXS, LAXSG, NPXT, NPXTG, NAXT, NAXTG, NAXS, NAXSG, LPXP, LPXPG, or LPXTA motif. Antigens of Interest
The composition of the immunogenic conjugate of the invention and methods of making and administering such immunogenic conjugates can be used for any antigen of interest, e.g., a
polysaccharide, polyalcohol, or poly amino acid. Desirably, the antigen of interest carries no primary groups that can be destroyed by the chemical reactions employed by the method of making immunogenic conjugates, e.g., the denaturing of an antigen caused by the destruction of antigen disulfide bonds by borohydride reduction. In yet other desirable embodiments of the invention, the antigen of interest is an organic polymer consisting of monomers having at least three atoms, where each of the atoms is independently selected from carbon, oxygen, hydrogen, phosphate, nitrogen, and sulfate. Exemplary antigens of interest include organic polymers such as polysaccharides (e.g., polysaccharides having at least 18 residues), phosphopolysaccharides, polysaccharides with amino sugars with N-acetyl substitutions, polysaccharides containing sulfonylated sugars, other sulfate-modified sugars, or phosphate-modified sugars, polyalcohols, poly amino acids, teichoic acids, O side chains of
lipopolysaccharides.
Exemplary antigens of interest also include capsular organic polymers including those synthesized by microbes, e.g., bacteria, fungi, parasites, and viruses, and then purified from such a biological source using standard methods. Exemplary antigens of interest include microbial capsular organic polymers including those purified from bacterial organisms such as Bacillus species (including B. anthracis) (Wang and Lucas, Infect. Immun. 72(9):5460-5463, 2004), Streptococcus pneumoniae (Bentley et al., PLoS Genet. 2(3):e31 , Epub 2006; Kolkman et al., J. Biochemistry 123:937-945, 1998; and Kong et al., J. Med. Microbiol. 54:351 -356, 2005), Shigella (Zhao et al., Carbohydr. Res.
342(9):1275-1279, Epub 2007), Haemophilus influenzae, Neisseria meningitidis, Staphylococcus aureus, Salmonella, (including Salmonella typhi), Streptococcus pyogenes, Escherichia coli (Zhao et al.,
Carbohydr. Res. 342(9):1275-1279, Epub 2007), Francisella tularensis, and Pseudomonas aeruginosa, and fungal organisms such as Cryptococcus and Candida, as well as many other microorganisms (see, e.g., Ovodov, Biochemistry (Mosc.) 71 (9):937-954, 2006; Lee et al., Adv. Exp. Med. Biol. 491 :453-471 , 2001 ; and Lee, Mol. Immunol. 24(10):1005-101 9, 1987). Exemplary antigens of interest also include polymers that do not occur in nature and thus are non-biological in origin.
In other particularly desirable embodiments, the Francisella tularensis polysaccharide is the O antigen. Desirably, the microbial capsular polymer is poly-gamma-D-glutamic acid (PGA) from Bacillus anthracis. In desirable embodiments of the invention, the Streptococcus pneumoniae polysaccharide is one of capsular types described in Kong et al. (J. Med. Microbiol. 54:35-356, 2005). For example, Streptococcus pneumoniae polysaccharide capsular type desirably is 1 (e.g., 1 -g or 1 -q), 2 (e.g., 2-g, 2-q, or 2-41 A), 3 (e.g., 3-g, 3-q, 3-c, or 3-nz), 4, 5 (e.g., 5-q, 5-c, 5-qap, or 5-g), 6A (e.g., 6A-g, 6A-cl, 6A-c2, 6A-n, 6A-qap, 6A-6B-g, 6A-6B-q, or 6A-6B-S), 6B (e.g., 6B-c, 6A-6B-g, 6A-6B- q, or 6A-6B-S), 7F (e.g., 7F-7A), 7A (e.g., 7A-cn or 7F-7A), 7B (e.g., 7B-40), 7C (e.g., 7C-19C-24B), 8 (e.g., 8-g or 8-s), 9A (e.g., 9A-9V), 9L, 9N, 9V (e.g., 9A-9V), 9V and 14, 10F (e.g., 10F-q, lOF-ca, or lOF-IOC), 10A (e.g., 10A-17A or 10A-23F), 10B (e.g., lOB-IOC), HF, I IA (e.g., I IA-ηζ or 1 1 A-1 1 D-18F), HB (e.g., 1 IB-1 1 C), HC (e.g., 1 IB-1 1 C or HC-cn), HD (e.g., 1 1 A-1 1 D-18F), 12F (e.g., 12F-q or 12F-12A-12B), 12A (e.g., 12A-cn, 12A-46, or 12F-12A-12B), 12B (e.g., 12F-12A-12B), 13 (e.g., 13-20), 14 (e.g., 14-g, 14-q, 14-v, or 14-c), 1 5F (e.g., 15F-cnl or 15F-cn2), 1 5A (e.g., 15A-cal, 15A-ca2, or l5A-chw), 1 5B (e.g., 15B-C, 15B-15C, 15B-15C-22F- 22A), 15C (e.g., 15C- ca, 1 5C-ql, 15C-q2, 15C-q3, 15C-S, 15B-15C, or 15B-15C-22F-22A), 16F (e.g., 16F-q or 1 6F-nz), 16A, 17F (e.g., 17F-n and 17F-35B-35C-42), 17A (e.g., 17A-ca or 10A-17A), 18F (e.g., 18F-ca, 18F-W, or 1 IA-I ID- 18F), 18A (e.g., 1 8A-nz or 18A-q), 18B (e.g., 18B-18C), 18C (e.g., 18B-18C), 19F (e.g., 1 9F-gl, 19F-g2, 19F-g3, 19F-q, 19F-n, or 19F-C), 19A (e.g., 19A-g, 19A-, or 19A-ca), 19B, 1 9C (e.g., 19C-cnl, 19C-cn2, or 7C- 19C-24B), 20 (e.g., 13-20), 21 (e.g., 21 -ca or 21 -cn), 22F (e.g., 15B-15C- 22F-22A), 23F (e.g., 23F-C, 10A-23F, or 23F-23A), 23B (e.g., 23B-C or 23B-q), 24F (e.g., 24F-cnl, 24F- cn2, or 24F-cn3), 24A, 24B (e.g., 7C-19C-24B), 25F (e.g., 25F-38), 25A, 27, 28F (e.g., 28F-28A or 28F- cn), 28A (e.g., 28F-28A), 29 (e.g., 29-ca or 29-q), 31 , 32F (e.g., 32F- 32A), 32A (e.g., 32A-cn or 32F-
32A), 33F (e.g., 33F-g, 33F-q, 33F-chw, 33F-33B, or 33F-33A-35A), 33A (e.g., 33F-33A-35A), 33B (e.g., 33B-q, 33B-s, or 33F-33B), 33D, 34 (e.g., 34-ca or 34s), 35F (e.g., 35F-47F), 35A (e.g., 33F-33A-35A), 35B (e.g., 17F- 35B-35C-42), 36, 37 (e.g., 37-g or 37-ca), 38 (e.g., 25F-38), 39 (e.g., 39-cnl or 39-cn2), 40 (e.g., 7B-40), 41 F (e.g., 41 F-cn or 41 F-s), 41 A (e.g., 2-41 A), 42 (e.g., 17B-35B-35C- 42), 43, 44, 45, 46 (e.g., 46-s or 12A-46), 47F (e.g., 35F-47F), 47 A, 48 (e.g., 48-cnl or 48-cn2), or GenBank Accession Number AF532714 or AF53271 5.
Alternatively, exemplary antigens of interest include killed whole cell encapsulated pathogens such as Bacillus species (including B. anthracis) (Wang and Lucas, Infect. Immun. 72(9):5460-5463, 2004), Streptococcus pneumoniae (Bentley et al., PLoS Genet. 2(3):e31 , Epub 2006; Kolkman et al., J. Biochemistry 123:937-945, 1998; and Kong et al., J. Med. Microbiol. 54:351 -356, 2005), Shigella (Zhao et al., Carbohydr. Res. 342(9):1275-1279, Epub 2007), Haemophilus influenzae, Neisseria meningitidis, Staphylococcus aureus, Salmonella, (including Salmonella typhi), Streptococcus pyogenes, Escherichia coli (Zhao et al., Carbohydr. Res. 342(9):1275-1279, Epub 2007), Francisella tularensis, and
Pseudomonas aeruginosa, and fungal organisms such as Cryptococcus and Candida, as well as many other microorganisms (see, e.g., Ovodov, Biochemistry (Mosc.) 71 (9):937-954, 2006; Lee et al., Adv. Exp. Med. Biol. 491 :453-471 , 2001 ; and Lee, Mol. Immunol. 24(10):1005-1019, 1987). Whole cell pathogens may contain, but are not limited to, one or more of the aforementioned antigens of interest, e.g., microbial capsular organic polymers, O-antigen, and PGA.
Immunogenic Conjugate Compositions: antigenic PS-carrier protein The immunogenic conjugates of the invention may be used in combination, for example, in pediatric immunizations. In addition, the immunogenic conjugates of the invention may be used to immunize against, for example, Pneumococcus infection, Haemophilus influenzae type B ("HiB") infection, Streptococcus (groups A and B) infection, meningococcal (e.g., Neisseria meningitides) infection, and may be used as O antigen immunogenic conjugates from Gram negative bacteria (e.g., Pseudomonas aeruginosa, Francisella tularensis, Shigella species, Salmonella species, Acinetobacter species, Burkholderia species, and Escherichia coli).
The immunogenic conjugate formulation desirably includes at least one carrier protein, at least one antigen of interest, and a pharmaceutically acceptable carrier or excipient (e.g., aluminum phosphate, sodium chloride, or sterile water). An immunogenic conjugate composition may also include an adjuvant system for enhancing the immunogenicity of the formulation, such as oil in a water system and other systems known in the art or other pharmaceutically acceptable excipients. A carrier protein-antigenic PS complex that is insoluble under physiological conditions is desirable to slowly release the antigen after administration to a subject. Such a complex desirably is delivered in a suspension containing
pharmaceutically acceptable excipients. However, the carrier protein-antigenic PS complex may also be soluble under physiological conditions.
Typically the immunogenic conjugate is in a volume of about 0.5 ml_ for subcutaneous injection, 0.1 ml_ for intradermal injection, or 0.002-0.02 ml_ for percutaneous administration. A 0.5 ml dose of the immunogenic conjugate may contain approximately 2-500 μg of the antigen covalently linked with approximately 2-500 μg of the carrier protein. In a desirable embodiment, in a 0.5 ml dose, approximately 10 μg of the antigen are conjugated with approximately 10 μg of the carrier protein. The molar ratio of antigen to carrier protein desirably is 1 :1 (e.g., 1 part antigen to 1 part carrier protein). If there is a concern that the peptides or conjugates may be degraded in the stomach, the immunogenic conjugate may be administered parenterally (for instance, by subcutaneous, intramuscular, intravenous, or intradermal injection). While delivery by a means that physically penetrates the dermal layer is desirable (e.g., a needle, airgun, or abrasion), the immunogenic conjugates of the invention can also be administered by transdermal absorption.
In particular, the immunogenic conjugates of the invention may be administered to a subject, e.g., by intramuscular injection, intradermal injection, or transcutaneous immunization with appropriate immune adjuvants. Immunogenic conjugates of the invention may be administered, one or more times, often including a second administration designed to boost production of antibodies in a subject to prevent infection by an infectious agent. The frequency and quantity of immunogenic conjugate dosage depends on the specific activity of the immunogenic conjugate and can be readily determined by routine experimentation. While the age at which the first dosage is administered generally is two-months, an immunogenic conjugate may be administered to infants as young as six weeks of age. For children who are beyond the age of a routine infant vaccination schedule, the immunogenic conjugates of the invention may be administered according to the following exemplary schedule.
Figure imgf000028_0001
A booster dose is desirably given as early as four years following the last dose in subjects who are at a high risk for infection; or 1 0 years after the last dose to previously immunized adults and children above fifteen years of age. The formulations may be presented in unit-dose or multi-dose containers, for example, sealed ampoules and vials and may be stored in a freeze-dried (lyophilized) condition requiring only the addition of the sterile liquid carrier immediately prior to use. Immunogenic conjugates of the invention can be formulated in pharmacologically acceptable vehicles, e.g., alum hydroxide gel, adjuvant preparation, or saline, and then administered, e.g., by intramuscular injection, intradermal injection, or transcutaneous immunization with appropriate immune adjuvants.
Immunogenic Conjugate Compositions: whole cell pathogen-carrier protein The immunogenic conjugates of the invention may be used in combination, for example, in pediatric immunizations. In addition, the immunogenic conjugates of the invention may be used to immunize against, for example, Pneumococcus infection, Haemophilus influenzae type B ("HiB") infection, Streptococcus (groups A and B) infection, meningococcal (e.g., Neisseria meningitides) infection, and may be used as O antigen whole cell pathogen immunogenic conjugates from Gram negative bacteria (e.g., Pseudomonas aeruginosa, Francisella tularensis, Shigella species, Salmonella species, Acinetobacter species, Burkholderia species, and Escherichia coli).
For whole cell pathogen immunogenic conjugates, the formulation includes at least one inactivated whole cell pathogen including the antigenic polysaccharide of interest, at least one carrier protein, and a pharmaceutically acceptable buffer (e.g., bicarbonate buffer) to neutralize gastric acid. In this formulation, the immunogenic conjugate preparation is mixed with a buffer, e.g., 5.6 g of sodium hydrogen carbonate granules dissolved in 150 ml_ of sterile water.
Typically the immunogenic conjugate contains about 1 mg of whole cell pathogen immunogenic conjugate in a single dose for oral administration. A 1 mg dose of the immunogenic conjugate may contain at least 1 x 1 09 whole cell pathogens or a range of 1 x 109 to 1 x 101 1 whole cell pathogens covalently linked with approximately 2-500 μg of the carrier protein.
In particular, the immunogenic conjugates of the invention may be administered to a subject enterally (for instance, by oral administration) by ingestion of an immunogenic conjugate in the form of a e.g., liquid, powder, capsule, or tablet. Immunogenic conjugates of the invention may be administered, one or more times, often including a second administration designed to boost production of antibodies in a subject to prevent infection by an infectious agent. The frequency and quantity of immunogenic conjugate dosage depends on the specific activity of the immunogenic conjugate and can be readily determined by routine experimentation. The age at which the first dosage is administered generally is two-years. The immunogenic conjugates of the invention may be administered according to the following exemplary schedule.
Figure imgf000029_0001
A booster dose is desirably given as early as six months following the last dose in subjects who are at a high risk for infection; or five years after the last dose to previously immunized adults and children above two years of age.
The invention also includes kits that include an immunogenic conjugate described herein. The kits of the invention can also include instructions for using the kits in the immunization methods described herein.
The efficacy of the immunization schedule may be determined by using standard methods for measuring the antibody titer in the subject. In general, mean antibody titers (desirably IgG titers) of approximately 1 μς/ιηΙ are considered indicative of long-term protection.
The antigenic polysaccharide-carrier protein complexes for use in the immunogenic conjugate compositions described herein are desirably between 1 0 nm and 100 μιτι in diameter. Viruses can be 100 nm in diameter and are immunogenic. Whole bacteria are 1 -1 0 μιτι in diameter and are also immunogenic. A small clump of bacteria can be about 100 μιτι in diameter. In particular embodiments, an antigenic polysaccharide-carrier protein complex in an immunogenic conjugate composition desirably is between 100 nm and 10 μιτι in diameter. This complex may be soluble or insoluble.
The invention is described herein below by reference to specific examples, embodiments and figures, the purpose of which is to illustrate the invention rather than to limit its scope. The following examples are not to be construed as limiting.
EXAMPLES Example 1: Sortase-mediated Immunogenic Conjugate 1 Preparations
An immunogenic conjugate can be prepared from an antigenic polysaccharide (PS) displaying a sortase recognition peptide and a sortase. For this reaction, polysaccharides are first chemically activated with periodate, cyanogen borohydride, or carbodiimide reagents to allow for attachment of a sortase recognition peptide to PS using conventional chemistry. The sortase recognition peptide is a synthetic peptide that displays the LPXTGXX sequence but which then has unique N- terminal, internal, or C-terminal residues that allow for the covalent modification of activated
polysaccharides. The chemical groups of these residues include amino, carboxyl, thiol, halogen, and azide groups, as well as others. These chemical groups are selected to react with activated PS. Once modified, the PS covalently linked to the sortase recognition peptide is mixed with a sortase, for instance SrtA, to covalently attach sortase to the PS by a thioester bond. This reaction produces a PS-sortase conjugate (Fig. 2 conjugate 1 ). To prevent reversal of the sortase-PS thioester bond, the PS-sortase conjugate may be enzymatically stabilized by treatment with a chemical cross-linking agent such as formalin or glutaraldehyde, further entrapping the antigenic polysaccharide to form a protein cross-linked cage or mesh. To cross-link the antigenic PS-sortase immunogenic conjugate, a 10% neutral buffered formalin is prepared by diluting a 37% aqueous formaldehyde solution with phosphate buffered saline (PBS) to about 3.7-4.0% formaldehyde. The PS-sortase immunogenic conjugate is treated with excess 10% formalin for about 10 minutes at room temperature to cross-link the antigen to the sortase.
Subsequently, the fixation is quenched by addition of excess 1 .25 M glycine in PBS.
Example 2: Sortase-mediated Immunogenic Conjugate 2 Preparations
An immunogenic conjugate can be prepared from an antigenic polysaccharide (PS) displaying a sortase recognition peptide and a carrier protein. For this reaction, polysaccharides are first chemically activated with periodate, cyanogen borohydride, or carbodiimide reagents to allow for attachment of a sortase recognition peptide to PS using conventional chemistry. The sortase recognition peptide is a synthetic peptide that displays the LPXTGXX sequence but which then has unique N-terminal, internal, or C-terminal residues that allow for the covalent modification of activated polysaccharides. The chemical groups of these residues include amino, carboxyl, thiol, halogen, and azide groups, as well as others. These chemical groups are selected to react with activated PS. Once modified, the PS covalently linked to the sortase recognition peptide is mixed with a sortase, for instance SrtA, to covalently attach sortase to the PS by a thioester bond. This reaction produces a PS-sortase conjugate (Fig. 2 conjugate 1 ).
A second immunogenic conjugate can be prepared from conjugate 1 . For this reaction, a carrier protein is engineered to display polyglycine motif, where at least two glycine repeats are coupled to a carrier protein amino acid residue by a peptide bond. The carrier protein may be modified with glycine repeats by sandwiching the glycine repeats between the carrier protein and a small ubiquitin-like modifier (SUMO) peptide. SUMOylation occurs when the C-terminal carboxyl group of a double-glycine motif in SUMO and the epsilon-amino group of a lysine residue in a carrier protein form an isopeptide bond. Upon addition of the SUMO protease that recognizes the SUMO peptide, the SUMO protease cleaves immediately following the glycine repeat precursor at the C-terminus of the SUMO peptide. This reaction produces a polyglycine-modified carrier protein. The polyglycine decorated carrier protein is
subsequently mixed with the PS-sortase conjugate (Fig. 1 conjugate 1 ) and sortase transfers itself off the recognition peptide modified PS and attaches the polyglycine modified carrier protein to the PS. Thus, this reaction produces a second PS-carrier protein conjugate (Fig. 2 conjugate 2) that is covalently linked by a peptide bond. Example 3: Whole cell bacterial conjugate and oral administration
The sortase-mediated immunogenic conjugation method can be performed in situ on the surface of the polysaccharide-encapsulated organism, such as Streptococcus pneumonia. For instance, about 109-101 1 cells of 23 S. pneumoniae serotypes (1 , 2, 3, 4, 5, 6B, 7F, 8, 9N, 9V, 1 0A, 1 1 A, 12F, 14, 1 5B, 17F, 1 8C, 19F, 19A, 20, 22F, 23F and 33F) are heat-inactivated by incubation of the cells at 55s - 60s C for 30 minutes. Alternatively, the cells may be chemically-inactivated by treatment with 55 μΙ_ of 10% neutral buffered formalin per 1 ml_ of bacterial cell suspension. The cells are incubated in formalin for at 37s C for one hour. Subsequently, the inactivated cells are washed in PBS and or additional gentle biologically compatible buffers and reagents. The killed cells are then modified to attach the sortase recognition peptide to the surface polysaccharides of the cells. By this approach, the polysaccharide purification and characterization steps are eliminated, and the whole cells conjugated to sortase or the carrier protein(s) of interest are incorporated into the immunogenic conjugate essentially as described in Example 1 or Example 2. The 23 valent pneumococcal whole cell immunogenic conjugate can be absorbed mucosally and thus allows for oral administration of the preparation.
Example 4: Generation and Characterization of Sortase-mediated Immunogenic Conjugates
The sortase-mediated immunogenic conjugation method can be applied to capsular antigens of various structures and ionic charges. For example, generation of an immunogenic conjugate against Streptococcus pneumonia can be produced by first purchasing 23 types of Streptococcus pneumonia PS from the American Type Culture Collection (ATCC), which are manufactured by Merck, Inc. These PS vary widely in their molecular structure and include PS that are strongly anionic, partially cationic, neutral in charge, phosphorylated, linear, have branching structures, and modified in various other ways. A subset of these PS correspond to the thirteen capsular types in the Wyeth product Prevnar13 ® (1 , 3, 4, 5, 6A, 6B, 7F, 9V, 14, 1 8C, 19A, 19F, and 23F) and can be assayed for their ability to induce IL-6 production by mouse macrophages. Since PS can also be contaminated with a TLR agonist, phenol extraction and ethanol precipitation can be performed to "clean up" (remove residual unknown TLR agonists) commercially prepared S. pneumoniae PS.
Removal of the contaminants is confirmed by testing the treated PSs for induction of IL-6 by peritoneal macrophages by standard methods. PSs that are devoid of IL-6 induction activity are used for production of immunogenic conjugates. Following examination of the 23 pneumococcal PS, each of the 23 capsular types is used to make an immunogenic conjugate using a sortase, essentially by the method described in Example 1 . A one to one ratio of PS to a dominant negative mutant (DNI) carrier protein is used (approximately 1 :1 by dry weight) for these initial immunogenic conjugate preparations. Each preparation is characterized by SDS-PAGE for evidence of covalent-linkage between pneumococcal PS and a carrier protein such as DNI. For some capsular types (e.g., 6B and 23F), other carrier proteins are used to make immunogenic conjugates.
For example, ten different immunogenic conjugates using five different matrix proteins and two different antigens are made as follows. The selection of the five matrix proteins is based on their current use in FDA-approved vaccines or other properties that allow them to serve as tracers for measuring the stability of immunogenic conjugate preparations. The following matrix proteins are used (1 ) cholera toxin B subunit (available from SBL Vaccin AB), (2) diphtheria toxin, (3) tetanus toxin Fragment C, "Frag C" (available from Sigma Aldrich), (4) DNI, and (5) beta-galactosidase from Escherichia coli (available from Sigma Aldrich). As capsular antigens poly-D-glutamic acid from Bacillus anthracis and Streptococcus pneumoniae capsule type 14 (Suarez et al., Appl. Environ. Micobiol. 67:969-971 , 2001 ) are used. Each capsule antigen is combined with each of the five selected matrix proteins to produce 10 distinct immunogenic conjugates. All immunogenic conjugate preparations that show evidence of covalent protein linkage (e.g., in SDS-PAGE) are tested for their immunogenicity.
Immunogenic conjugates can be tested for their ability to induce, in mice, isotype antibody switching to IgG as is observed in conventional conjugate vaccines. All antigens can be absorbed to alum and then typically groups of 5 mice per immunogenic conjugate preparation are used. Mice are pre- bled to obtain baseline immune responses to the test antigens. Mice are then immunized three times (at day 0, 7, 14) by a standard IP injection protocol, and blood is collected at days 10, 20, 30, and 60 days post primary immunization. Mouse sera are analyzed by standard ELISA assay for IgG against the PS and carrier proteins used. In these experiments, control groups of mice immunized with only PS are included to assess the ability of various immunogenic conjugate preparations to induce anti-PS IgG compared with the non-conjugated PS which should be poorly- or non-immunogenic. Promising immunogenic conjugates (i.e., immunogenic conjugates that induce high levels of IgG against PSs) undergo more careful immunological analysis, which seeks to establish the kinetics and dose response aspects of the immune response to the immunogenic conjugate in mice.
Alternatively, promising immunogenic conjugates and their corresponding controls can be sent to commercial vendors for production of rabbit anti-sera. Similar immunoassays are performed to assess the immunogenicity, class of antibody induced, and kinetics of immune response in rabbits. In these experiments the control is the commercial product Prevnar13® which is an alum absorbed mixture of 13 different conventional conjugate PS vaccines coupled to CRM197, the nontoxic mutant protein related to diphtheria toxin.
The functionality of the antibody responses induced with immunogenic conjugates can be assessed. For example, functionality can be assessed by measuring the ability of the anti-PS antibody to opsonize encapsulated S. pneumococcus and lead to bacterial killing after phagocytosis by
macrophages. Protection of animals from lethal challenge with S. pneumococcus is another way to demonstrate the efficacy of the immunogenic conjugate in immunized animals.
Example 5: Combination of Immunogenic Conjugates with Adjuvants
The PS-carrier protein immunogenic conjugate can be modified to further stimulate the immune response, and ultimately improve the efficacy of the immunization, by addition of an adjuvant. The immunogenic conjugate can be absorbed by an alum adjuvant such as aluminum hydroxide gel.
Additionally, the immunogenic can be combined with an emulsion adjuvant such as squalene based oil in water nano emulsion. Adjuvants such as these can be used to create a delivery system for the immunogenic conjugate and function to create depots that trap the conjugated antigen-carrier protein at the site of injection to allow for its slow release. This allows for extended stimulation of the immune system by enabling the immunogenic conjugate to persist at the site of injection, increasing the recruitment and activation of immune cells.
OTHER EMBODIMENTS All publications and patents cited in this specification, as well as U.S. Provisional Application No.
62/1 91 ,028, are incorporated herein by reference as if each individual publication or patent were specifically and individually indicated to be incorporated by reference in its entirety.
Various modifications and variations of the described invention will be apparent to those skilled in the art without departing from the scope and spirit of the invention. Although the invention has been described in connection with specific embodiments, it should be understood that the invention as claimed should not be unduly limited to such specific embodiments. Indeed, various modifications of the described modes for carrying out the invention that are obvious to those skilled in the art are intended to be within the scope of the invention.
Other embodiments are in the claims.

Claims

CLAIMS What is claimed is:
1 . An immunogenic composition comprising a polysaccharide-sortase conjugate, wherein said polysaccharide is an antigen and said sortase is a carrier protein, and wherein said sortase is covalently linked to said polysaccharide antigen by a linker comprising a sortase recognition sequence.
2. An immunogenic composition comprising a polysaccharide-protein conjugate, said conjugate comprising a polysaccharide antigen and a carrier protein, wherein said polysaccharide antigen is covalently linked to said carrier protein by a linker comprising a sortase recognition sequence and a polyglycine motif present at the N-terminus of said carrier protein.
3. The immunogenic composition of claim 1 or 2, wherein said sortase is selected from the group consisting of sortase A, sortase B, sortase C, and sortase D.
4. The immunogenic composition of claim 3, wherein said sortase is sortase A, or a fragment thereof.
5. The immunogenic composition of claim 4, wherein said sortase A comprises the amino acid sequence of SEQ ID NO: 1 .
6. The immunogenic composition of claim 5, wherein said sortase comprises an amino acid sequence that has at least 90% identity to the amino acid sequence of SEQ ID NO: 1 .
7. The immunogenic composition of claim 6, wherein said sortase comprises an amino acid sequence that has at least 95% identity to the amino acid sequence of SEQ ID NO: 1 .
8. The immunogenic composition of claim 7, wherein said sortase comprises an amino acid sequence that has at least 99% identity to the amino acid sequence of SEQ ID NO: 1 .
9. The immunogenic composition of claim 3, wherein said sortase is sortase B, or a fragment thereof.
10. The immunogenic composition of claim 3, wherein said sortase is sortase C, or a fragment thereof.
1 1 . The immunogenic composition of claim 3, wherein said sortase is sortase D, or a fragment thereof.
12. The immunogenic composition of any one of claims 1 to 1 1 , wherein said sortase comprises at least one mutation
13. The immunogenic composition of any one of claims 1 to 12, wherein said sortase comprises a substitution.
14. The immunogenic composition of claim 1 or claim 2, wherein said sortase recognition sequence has the formula X1 PX2X3 X4, where X1 -X4 are any amino acid.
15. The immunogenic composition of claim 14, wherein said sortase recognition sequence has the formula X1 PX2X3G for a sortase A substrate, where Xi is Leu, lie, Val or Met, X2 IS any amino acid, and X3 is Ser, Thr or Ala.
16. The immunogenic composition of claim 15, wherein the sortase recognition sequence is LPX1TG for a sortase A substrate, where Xi is any amino acid.
17. The immunogenic composition of claim 14, wherein the sortase recognition sequence is NPX1TX2 for a sortase B substrate, where Xi is Lys or Gin and X2 is Asn, Asp, or Gly.
18. The immunogenic composition of claim 14, wherein the sortase recognition sequence is LPX1TX2 for a sortase C substrate, where Xi and X∑are any amino acid.
19. The immunogenic composition of claim 14, wherein the sortase recognition sequence is LPX1TA for a sortase D substrate, where Xi is any amino acid.
20. The immunogenic composition of claim 14, wherein the sortase recognition sequence is LAX1TG for a sortase D substrate, where Xi is any amino acid.
21 . The immunogenic composition of claim 2, wherein the polyglycine motif comprises an amino acid sequence selected from the group consisting of GG, GGG, GGGG, and GGGGG.
22. The immunogenic composition of claim 21 , wherein the polyglycine motif comprises the amino acid sequence GGGGG.
23. The immunogenic composition of any one of claims 1 to 22, wherein said sortase recognition sequence is linked to said polysaccharide through Z1-C(Z3)-N(H)-N(H)-(-C(0)-(L-C(0))n-N(H)-N(H)- wherein Z1 is a bond to an oxygen atom in said polysaccharide antigen,
Z2 is a bond to a carbonyl group in said sortase recognition sequence,
Z3 is O or NH,
each of n and m is 0 or 1 , and
L, when present, is C2-6 alkanediyl or Ce-ιο arenediyl.
24. The immunogenic composition of any one of claims 1 to 23, wherein said carrier protein molecules are selected from the group consisting of diphtheria toxin, diphtheria toxoid, tetanus toxin, tetanus toxoid, Pseudomonas aeruginosa exotoxin A, cholera toxin B subunit, tetanus toxin fragment C, bacterial flagellin, pneumolysin, an outer membrane protein of Neisseria menningitidis, Pseudomonas aeruginosa Hcp1 protein, Escherichia coli heat labile enterotoxin, shiga-like toxin, human LTB protein, pneumolysin, listeriolysin O, a protein extract from whole bacterial cells, the dominant negative mutant (DNI) of the protective antigen of Bacillus anthracis, and Escherichia coli beta-galactosidase.
25. The immunogenic composition of claim 24, wherein said whole bacterial cells are Pseudomonas aeruginosa or Streptococcal cells.
26. The immunogenic composition of claim 24, wherein said bacterial flagellin is the Vibrio cholerae flagellin protein.
27. The immunogenic composition of claim 24, wherein said shiga-like toxin is the Shigella SltB2 protein.
28. The immunogenic composition of claim 24, wherein said carrier protein molecules are pneumolysin.
29. The immunogenic composition of claim 24, wherein said carrier protein molecules are listeriolysin O.
30. The immunogenic composition of claim 24, wherein said carrier protein molecules are diphtheria toxin.
31 . The immunogenic composition of claim 24, wherein said carrier protein molecules are diphtheria toxoid.
32. The immunogenic composition of claim 24, wherein said carrier protein molecules are tetanus toxin.
33. The immunogenic composition of claim 24, wherein said carrier protein molecules are tetanus toxoid.
34. The immunogenic composition of any one of claims 1 to 33, wherein said antigen of interest is a polysaccharide, a polyalcohol, or a poly amino acid.
35. The immunogenic composition of claim 34, wherein said polysaccharide comprises at least 18 residues.
36. The immunogenic composition of claim 34, wherein said polysaccharide is a Streptococcus pneumoniae polysaccharide, Francisella tularensis polysaccharide, Bacillus anthracis polysaccharide, Haemophilus influenzae polysaccharide, Salmonella typhi polysaccharide, Salmonella species polysaccharide, Shigella polysaccharide, or Neisseria meningitidis polysaccharide.
37. The immunogenic composition of claim 34, wherein said Streptococcus pneumoniae polysaccharide is capsular type 1 , 2, 3, 4, 5, 6A, 6B, 7A, 7B, 7C, 7F, 8, 9A, 9L, 9N, 9V, 10A, 10B, 10F, 1 1 A, 1 1 B, 1 1 C, 1 1 D, 1 1 F, 12A, 12B, 12F, 13, 14, 1 5A, 15B, 15C, 1 5F, 1 6A, 16F, 17A, 17F, 18A, 1 8B, 18C, 18F, 19A, 19B, 19C, 19F, 20, 21 , 22F, 23B, 23F, 24A, 24B, 24F, 25A, 25F, 27, 28A, 28F, 29, 31 , 32A, 32F, 33A, 33B, 33D, 33F, 34, 35A, 35B, 35F, 36, 37, 38, 39, 40, 41 A, 41 F, 42, 43, 44, 45, 46, 47A, 47F, or 48.
38. The immunogenic composition of claim 36, wherein said Francisella tularensis polysaccharide is O antigen.
39. The immunogenic composition of any one of claims 34 to 38, wherein said antigen of interest is a microbial capsular polymer.
40. The immunogenic composition of claim 39, wherein said microbial capsular polymer is poly- gamma-D-glutamic acid from Bacillus anthracis.
41 . The immunogenic composition of any one of claims 34 to 40, wherein said antigen of interest is an organic polymer consisting of monomers having at least three atoms, wherein each of said atoms is independently selected from the group consisting of carbon, oxygen, hydrogen, phosphate, nitrogen, and sulfate.
42. The immunogenic composition of claim 41 , wherein said organic polymer is obtained from a microbe.
43. The immunogenic composition of claim 41 , wherein said organic polymer does not occur in nature.
44. The immunogenic composition of any one of claims 1 to 43, wherein said immunogenic composition further comprises a second antigen of interest.
45. The immunogenic composition of any one of claims 1 to 44, wherein said immunogenic composition further comprises a third antigen of interest.
46. The immunogenic composition of any one of claims 1 to 45, wherein said antigen of interest comprises whole cell pathogens.
47. The immunogenic composition of claim 46, wherein said whole cell pathogens comprise heat inactivated whole cell pathogens.
48. The immunogenic composition of claim 46, wherein said whole cell pathogens comprise chemically inactivated whole cell pathogens.
49. The immunogenic composition of any one of claims 46 to 48, wherein said whole cell pathogens comprise Pseudomonas aeruginosa or Streptococcal cells.
50. The immunogenic composition of claim 49, wherein said Streptococcal cells comprise
Streptococcus pneumonia.
51 . The immunogenic composition of claim 50, wherein said whole cell pathogens are Streptococcus pneumonia type 1 , 2, 3, 4, 5, 6A, 6B, 7A, 7B, 7C, 7F, 8, 9A, 9L, 9N, 9V, 1 0A, 10B, 10F, 1 1 A, 1 1 B, 1 1 C, 1 1 D, 1 1 F, 12A, 12B, 12F, 13, 14, 15A, 15B, 1 5C, 15F, 16A, 16F, 17A, 1 7F, 1 8A, 18B, 18C, 18F, 19A,
19B, 19C, 19F, 20, 21 , 22F, 23B, 23F, 24A, 24B, 24F, 25A, 25F, 27, 28A, 28F, 29, 31 , 32A, 32F, 33A, 33B, 33D, 33F, 34, 35A, 35B, 35F, 36, 37, 38, 39, 40, 41 A, 41 F, 42, 43, 44, 45, 46, 47A, 47F, or 48.
52. The immunogenic composition of claim 51 , wherein said antigen of interest comprises at least one whole cell pathogen selected from the group consisting of Streptococcus pneumonia type 1 , 2, 3, 4, 5, 6A, 6B, 7A, 7B, 7C, 7F, 8, 9A, 9L, 9N, 9V, 10A, 10B, 1 0F, 1 1 A, 1 1 B, 1 1 C, 1 1 D, 1 1 F, 12A, 12B, 12F, 13, 14, 1 5A, 15B, 15C, 15F, 16A, 16F, 17A, 17F, 18A, 18B, 18C, 18F, 19A, 19B, 19C, 1 9F, 20, 21 , 22F, 23B, 23F, 24A, 24B, 24F, 25A, 25F, 27, 28A, 28F, 29, 31 , 32A, 32F, 33A, 33B, 33D, 33F, 34, 35A, 35B, 35F, 36, 37, 38, 39, 40, 41 A, 41 F, 42, 43, 44, 45, 46, 47A, 47F, and 48.
53. The immunogenic composition of claim 52, wherein said antigen of interest comprises two or more whole cell pathogens selected from the group consisting of Streptococcus pneumonia type 1 , 2, 3, 4, 5, 6A, 6B, 7A, 7B, 7C, 7F, 8, 9A, 9L, 9N, 9V, 10A, 1 0B, 10F, 1 1 A, 1 1 B, 1 1 C, 1 1 D, 1 1 F, 12A, 12B, 12F, 13, 14, 1 5A, 15B, 15C, 15F, 16A, 16F, 17A, 17F, 18A, 18B, 18C, 18F, 19A, 19B, 19C, 1 9F, 20, 21 , 22F, 23B, 23F, 24A, 24B, 24F, 25A, 25F, 27, 28A, 28F, 29, 31 , 32A, 32F, 33A, 33B, 33D, 33F, 34, 35A, 35B, 35F, 36, 37, 38, 39, 40, 41 A, 41 F, 42, 43, 44, 45, 46, 47A, 47F, and 48.
54. The immunogenic composition of any one of claims 1 to 53, wherein said complex, when administered to a mammal, elicits a T-cell dependent immune response in said mammal.
55. The immunogenic composition of any one of claims 1 to 54, wherein the molar ratio of said antigen to said carrier protein molecules is 1 to 1 .
56. A pharmaceutical composition in unit dosage form comprising (i) the immunogenic composition of any one of claim 1 to 55 and (ii) a pharmaceutically acceptable excipient.
57. The pharmaceutical composition of claim 56, wherein said pharmaceutical composition does not comprise an adjuvant.
58. A method of making an immunogenic composition of claim 1 or 2 comprising a polysaccharide- protein conjugate, said method comprising mixing a sortase and a polysaccharide antigen comprising a sortase recognition sequence, wherein said mixing results in formation of a thioester bond between said polysaccharide antigen and said sortase, yielding said polysaccharide-protein conjugate.
59. The method of claim 58, said method further comprising mixing said polysaccharide-protein conjugate and a carrier protein comprising a polyglycine motif at its N-terminus, wherein said mixing results in formation of a peptide bond between a terminal carboxyl group of a sortase recognition sequence attached to said polysaccharide antigen and a terminal amino group of said polyglycine motif of said carrier protein.
60. The method of claim 58 or 59, wherein said polysaccharide antigen is a whole cell pathogen.
61 . The method of claim 60, said method further comprising lysing said whole cell pathogen to produce a polysaccharide-protein conjugate, wherein said polysaccharide antigen in said polysaccharide- protein conjugate is not a whole cell pathogen.
62. The method of any one of claims 58 to 61 , said method further comprising purifying said immunogenic composition.
63. The method of any one of claims 58 to 62, said method further comprising preparing said polysaccharide antigen comprising said sortase recognition sequence by mixing a polysaccharide cyanate with a hydrazine-activated sortase recognition sequence, thereby effecting an addition reaction of a hydrazine moiety in said hydrazine-activated sortase recognition sequence to a cyanate group in said polysaccharide cyanate.
64. A method of generating an immune response in a subject comprising administering the pharmaceutical composition of claim 57 to a subject, wherein said immunogenic composition elicits a T- cell dependent immune response in said subject.
65. The method of claim 64, wherein said subject is an infant, a child, or an adolescent.
66. The method of claim 64 or 65, wherein said pharmaceutical composition is administered to said subject parenterally.
67. The method of claim 64 or 65, wherein said pharmaceutical composition is administered to said subject orally.
PCT/US2016/041608 2015-07-10 2016-07-08 Sortase-mediated coupling of immunogenic polysaccharide-protein conjugates and their use Ceased WO2017011338A1 (en)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201562191028P 2015-07-10 2015-07-10
US62/191,028 2015-07-10

Publications (1)

Publication Number Publication Date
WO2017011338A1 true WO2017011338A1 (en) 2017-01-19

Family

ID=57757503

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2016/041608 Ceased WO2017011338A1 (en) 2015-07-10 2016-07-08 Sortase-mediated coupling of immunogenic polysaccharide-protein conjugates and their use

Country Status (1)

Country Link
WO (1) WO2017011338A1 (en)

Cited By (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11116828B2 (en) 2017-12-06 2021-09-14 Merck Sharp & Dohme Corp. Compositions comprising Streptococcus pneumoniae polysaccharide-protein conjugates and methods of use thereof
WO2022166913A1 (en) * 2021-02-04 2022-08-11 Westlake Therapeutics (Hangzhou) Co. Limited Modified red blood cells and uses thereof for treating hyperuricemia and gout
US11642406B2 (en) 2018-12-19 2023-05-09 Merck Sharp & Dohme Llc Compositions comprising Streptococcus pneumoniae polysaccharide-protein conjugates and methods of use thereof
US11912790B2 (en) 2018-07-11 2024-02-27 Immunity Pharma Ltd. Peptide compounds and therapeutic uses of same

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20140057317A1 (en) * 2012-06-21 2014-02-27 President And Fellows Of Harvard College Evolution of bond-forming enzymes
WO2014070865A1 (en) * 2012-10-30 2014-05-08 President And Fellows Of Harvard College Sortase-catalyzed immobilization, release, and replacement of functional molecules on solid surfaces
US20140302084A1 (en) * 2011-08-05 2014-10-09 The University Of Chicago Immunogenic protein conjugates and method for making and using the same

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20140302084A1 (en) * 2011-08-05 2014-10-09 The University Of Chicago Immunogenic protein conjugates and method for making and using the same
US20140057317A1 (en) * 2012-06-21 2014-02-27 President And Fellows Of Harvard College Evolution of bond-forming enzymes
WO2014070865A1 (en) * 2012-10-30 2014-05-08 President And Fellows Of Harvard College Sortase-catalyzed immobilization, release, and replacement of functional molecules on solid surfaces

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
GARUFI ET AL.: "Sortase-Conjugation Generates a Capsule Vaccine that Protects Guinea Pigs Against Bacillus anthracis", VACCINE, vol. 30, 14 May 2012 (2012-05-14), pages 3435 - 3444, XP028412714 *
MARRAFFINI ET AL.: "Sortases and the Art of Anchoring Proteins to the Envelopes of Gram-Positive Bacteria", MICROBIOLOGY AND MOLECULAR BIOLOGY REVIEWS, vol. 70, 1 March 2006 (2006-03-01), pages 192 - 221, XP002459580 *

Cited By (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11116828B2 (en) 2017-12-06 2021-09-14 Merck Sharp & Dohme Corp. Compositions comprising Streptococcus pneumoniae polysaccharide-protein conjugates and methods of use thereof
US11850278B2 (en) 2017-12-06 2023-12-26 Merck Sharp & Dohme Llc Compositions comprising Streptococcus pneumoniae polysaccharide-protein conjugates and methods of use thereof
US12097250B2 (en) 2017-12-06 2024-09-24 Merck Sharp & Dohme Llc Compositions comprising Streptococcus pneumoniae polysaccharide-protein conjugates and methods of use thereof
US11912790B2 (en) 2018-07-11 2024-02-27 Immunity Pharma Ltd. Peptide compounds and therapeutic uses of same
US11642406B2 (en) 2018-12-19 2023-05-09 Merck Sharp & Dohme Llc Compositions comprising Streptococcus pneumoniae polysaccharide-protein conjugates and methods of use thereof
US12016914B2 (en) 2018-12-19 2024-06-25 Merck Sharp & Dohme Llc Compositions comprising Streptococcus pneumoniae polysaccharide-protein conjugates and methods of use thereof
WO2022166913A1 (en) * 2021-02-04 2022-08-11 Westlake Therapeutics (Hangzhou) Co. Limited Modified red blood cells and uses thereof for treating hyperuricemia and gout

Similar Documents

Publication Publication Date Title
EP2056871B1 (en) Protein matrix vaccines and methods of making and administering such vaccines
RU2634405C2 (en) Immunogenic composition
KR20240110660A (en) Polypeptide-antigen conjugates with non-natural amino acids
US20120231086A1 (en) Protein matrix vaccines of improved immunogenicity
MX2013013358A (en) Protein matrix vaccine compositions including polycations.
Khatuntseva et al. Glycoconjugate vaccines for prevention of Haemophilus influenzae type b diseases
Xu et al. Development of an enzyme-mediated, site-specific method to conjugate toll-like receptor 2 agonists onto protein antigens: toward a broadly protective, four component, group A streptococcal self-adjuvanting lipoprotein–fusion combination vaccine
BE1024282B1 (en) IMMUNOGENIC COMPOSITIONS
WO2018009906A1 (en) Whole cell-protein conjugates and methods of making the same
HK1249403A1 (en) Protein matrix vaccines and methods of making and administering such vac-cines
BE1023004B1 (en) PROCESSING PROCESS
BE1023004A1 (en) PROCESSING PROCESS
HK1197033B (en) Protein matrix vaccine compositions including polycations

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 16824957

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 16824957

Country of ref document: EP

Kind code of ref document: A1