WO2016207637A1 - Cell modification and application in therapy - Google Patents
Cell modification and application in therapy Download PDFInfo
- Publication number
- WO2016207637A1 WO2016207637A1 PCT/GB2016/051881 GB2016051881W WO2016207637A1 WO 2016207637 A1 WO2016207637 A1 WO 2016207637A1 GB 2016051881 W GB2016051881 W GB 2016051881W WO 2016207637 A1 WO2016207637 A1 WO 2016207637A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- cell
- cells
- nucleic acid
- gag
- protein
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/44—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material not provided for elsewhere, e.g. haptens, metals, DNA, RNA, amino acids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/69—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the conjugate being characterised by physical or galenical forms, e.g. emulsion, particle, inclusion complex, stent or kit
- A61K47/6901—Conjugates being cells, cell fragments, viruses, ghosts, red blood cells or viral vectors
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/569—Single domain, e.g. dAb, sdAb, VHH, VNAR or nanobody®
Definitions
- the invention relates to methods of producing a population of cells and use of those cells in therapy, including bone and tissue repair.
- hMSCs mesenchymal stem cells
- hMSCs mesenchymal stem cells
- MSCs Mesenchymal stem cells
- osteoblasts bone cells
- chondrocytes cartilage cells
- myocytes muscle cells
- adipocytes fat cells
- An aim of the present invention is to provide a method of producing higher numbers of patient-specific cells for cell therapies, which overcomes the above limitations.
- a method of producing a population of cells comprising: -transiently transforming a cell with nucleic acid arranged to promote cell expansion,
- nucleic acid is linked to a delivery vehicle for cell attachment and internalization, wherein the delivery vehicle comprises :
- glycosaminoglycan (GAG) binding element which is capable of binding to
- a method of transient modification of a cell comprising:
- a transformation complex comprising a nucleic acid linked to a delivery vehicle for cell attachment and internalization, wherein the delivery vehicle comprises:
- glycosaminoglycan (GAG) binding element which is capable of binding to GAG on the surface of the cell
- transiently transforming a cell with nucleic acid, such as RNA, arranged to promote expansion can provide a rapid expansion of cells in one-to- several weeks rather than months from small starting populations.
- the cells produced from the transiently transformed cells will be non-genetically modified as, for example, RNA will not be integrated into the chromosome, will not be replicated, and will be degraded within the cell.
- Such a technology greatly facilitates the possibilities of autologous cell therapies.
- the provision of the delivery molecule in the present invention can increase the efficiency of transduction of the nucleic acid into cells for transient transformation.
- the GAG binding element such as HS-GAG binding element P21 (from a growth factor), in combination with a protein transduction domain, such as 8mer arginine peptide, and a cargo, greatly facilitates the uptake of very large quantities of the nucleic acid into cells. Not only do the cells take up the delivery molecule (by macro-pinocytosis) but the delivery molecules have been shown to traverse the cellular matrix and be delivered to the nucleus.
- the term "cell expansion” is understood to mean the reproduction of a cell into multiple copies of the cell, i.e. in order to form a population of cells derived from the cell. Expansion includes increasing the number of cells in a population. In one embodiment, expansion may comprise at least halving the doubling time of the cells.
- the method may further comprise expanding the cell(s) to form an expanded cell population, for example by incubation following or during transient transformation.
- the incubation may be in any suitable cell growth media, which the skilled person can readily determine based on the cell type to be expanded.
- the incubation may be at a suitable growth temperature and conditions, such as 37°C, 5% C0 2 , humid atmosphere.
- transiently transforming or “transient transformation” is understood that a genetic sequence, for example encoding a gene, is introduced into a cell, but it is not integrated into the chromosome.
- the genetic sequence may function within the cell for a limited time, but it is not reproduced or an inherited genetic change.
- the nucleic acid transiently transformed into the cell may be degraded after a period of time and is not passed onto subsequent generations of the cell during expansion of the cell population.
- RNA is transient as it is eventually degraded in the cell.
- transient immortalisation may be used interchangeably with “transient transformation”.
- the cell may be any cell type that can be promoted to increase expansion by nucleic acid capable of promoting expansion of the cell.
- the cell may comprise a mesenchymal stem cell (MSC).
- MSC mesenchymal stem cell
- the cell may be a pancreatic islet cell.
- the cell may be a hepatocyte .
- the cell may be a retinal pigment cell.
- the cell may be a neuron.
- the cell may be mammalian.
- the cell is a human cell, such as a human mesenchymal stem cell.
- a single cell may be expanded into a population of cells, or multiple cells may be expanded in a population of cells.
- a population of cells may be collected from a patient and the population of cells may be expanded in number.
- the expanded population of cells may not senesce.
- the cells are MSCs
- the expanded population of cells may retain multipotent differentiation into bone, fat and connective tissue.
- the expanded population of cells (during or post-transient transformation) are not tumorogenic.
- one or more of the following properties are exhibited from the cells, the properties selected from:
- the cells may exhibit protein expression from the transiently transformed nucleic acid
- the cells may provide at least 80% capacity for osteogenic, adipogenic and chondrogenic differentiation compared with primary hMSCs;
- the expanded cell population may display normal diploid karyotype (no aneuploidy observed using clinical criteria).
- the cell attributes may comprise retention of the cell morphology and/or retention of the cells differentiation capacity.
- At least 50% of the cells may exhibit protein expression from the transiently transformed nucleic acid. In another embodiment, at least 60% of the cells may exhibit protein expression from the transiently transformed nucleic acid. In one embodiment, at least 100% increase in growth rate of the cells is provided after transient transformation. In another embodiment, at least 120% increase in growth rate of the cells is provided after transient transformation.
- the nucleic acid may comprise RNA, or analogues thereof. In one embodiment, the nucleic acid is RNA.
- the nucleic acid may comprise siRNA, modified messenger RNAs (mRNAs), or micro RNA. In one embodiment, the nucleic acid may not comprise DNA.
- the nucleic acid such as RNA
- the RNA may be modified for translation and stability.
- the RNA may comprise poly-A tail for translation and stabilisation. Additionally, or alternatively the RNA may comprise a cap or cap-analogue for translation and stabilisation.
- a cap-analogue may comprise ARCA cap (anti-reverse cap analogue).
- T7 polymerase may be used to synthesise RNA in vitro incorporating a cap-analogue to improve translation and stability.
- the RNA may comprise modified nucleotides to prevent cell immune response to delivered RNA.
- the RNA may comprise nucleotide changes to prevent immune response. Modifications may comprise the provision of methy-cytosine and/or pseudo-uracil.
- the nucleic acid may be arranged to promote cell expansion by encoding genes capable of temporally immortalizing cells.
- the nucleic acid may encode TERT (telomerase reverse transcriptase), HPV E6/7 or SV40T (simian virus 40 T antigen); or combinations thereof; or functional variants thereof.
- the nucleic acid encodes TERT (telomerase reverse transcriptase) and HPV E6/7.
- the nucleic acid may encode any one of the genes selected from SV40T, TERT, HPV E6/7, BMI 1 , Cyclins (such as D l or 2), Survivin (BIRC5), p53, and Ras; or combinations thereof.
- combinations of genes may be delivered separately to the cell using separate delivery vehicles.
- the delivery vehicle system herein may be referred to as GET (GAG-binding enhanced transduction) or otherwise Heparan-sulfate enhanced transduction domain (HETD)-mediated delivery. These terms may be used interchangeably.
- the GAG binding element may be a heparan sulphate glycosaminoglycan (HS-GAG) binding element, which is capable of binding to HS-GAG on the surface of the cell.
- the most common disaccharide unit within heparan sulfate is composed of a glucuronic acid (GlcA) linked to N-acetylglucosamine (GlcNAc) typically making up around 50% of the total disaccharide units.
- the HS-GAG binding element may comprise at least part of the heparin binding domain of Heparin-Binding EGF-like Growth Factor (HB-EGF).
- the heparin binding domain may comprise P21 of HB-EGF.
- the heparin binding domain may comprise a truncated, extended, or functional variant of P21.
- the HS-GAG binding element may comprise a heparin binding domain of a fibroblast growth factor, or a functional part or variant thereof.
- the HS-GAG binding element may be selected from any of the group comprising FGF, antithrombin, such as ATIII, VEGF, BMPs, Wnts, Shh EGFs, and PDGF; or variants thereof.
- the HS-GAG binding element may comprise any of FGF2, FGF7, or PDGF.
- the HS-GAG binding element may comprise one or more of the heparan binding sulphate domains of any FGF protein (e.g. domains A, B or C).
- the HS-GAG binding element may comprise FGF4.
- the HS-GAG binding element may comprise FGF 1 HBD A (heparan sulphate binding domain A (the first HBD domain of FGF 1)), FGF2 HBD A (heparan sulphate binding domain A), FGF4 HBD A (heparan sulphate binding domain A), FGF 1 HBD C (heparan sulphate binding domain C), FGF2 HBD B (heparan sulphate binding domain B), FGF2 HBD C (heparan sulphate binding domain C), FGF4 HBD C (heparan sulphate binding domain C), FGF7 HBD B (heparan sulphate binding domain B), FGF7 HBD C (heparan sulphate binding domain C), antithrombin, such as ATIII, VEGF, or PDGF, or variants thereof.
- FGF 1 HBD A heparan sulphate binding domain A (the first HBD domain of FGF 1)
- FGF2 HBD A heparan sulphate binding domain A
- the HS-GAG binding element may be selected from any of the group comprising Hepatocyte Growth Factor, Interleukin, morphogens, HS-GAG binding enzymes, Wnt/Wingless, Endostatin, viral protein, such as foot and mouth disease virus protein, annexin V, lipoprotein lipase; or HS-GAG binding fragments thereof.
- the HS-GAG binding element may comprise any protein, peptide or molecule capable of specifically binding HS-GAG.
- variant may be understood by the skilled person to include a functional variant, wherein there may be some sequence differences from the known, reported, disclosed or claimed sequence, but the variant may still bind to HS-GAG. Conservative amino acid substitutions are also envisaged within the meaning of "variant”.
- the HS-GAG binding element may comprise the amino acid sequence KRKKKGKGLGKKRDPCLRKYK (P21) SEQ ID NO. 1).
- the HS-GAG binding element may comprise a sequence having at least 80% identity to SEQ ID NO. 1.
- the HS-GAG binding element may comprise a sequence having at least 90% identity to SEQ ID NO. 1.
- the HS-GAG binding element may comprise a sequence having at least 95% identity to SEQ ID NO. 1.
- the HS-GAG binding element may comprise a sequence having at least 98% identity to SEQ ID NO. 1.
- the HS-GAG binding element may comprise a sequence having at least 99% identity to SEQ ID NO. 1.
- the HS-GAG binding element may comprise the amino acid sequence G R P R E S G K K R K R K R L K P T (PDGF, SEQ ID NO. 3) .
- the HS-GAG binding element may comprise a sequence having at least 80% identity to SEQ ID NO. 3.
- the HS-GAG binding element may comprise a sequence having at least 90% identity to SEQ ID NO. 3.
- the HS-GAG binding element may comprise a sequence having at least 95% identity to SEQ ID NO. 3.
- the HS-GAG binding element may comprise a sequence having at least 98% identity to SEQ ID NO. 3.
- the HS-GAG binding element may comprise a sequence having at least 99% identity to SEQ ID NO. 3.
- the HS-GAG binding element may comprise the amino acid sequence T Y A S A K W T H N G G E M F V A L N Q ((FGF7, HBD B) SEQ ID NO. 5).
- the HS-GAG binding element may comprise a sequence having at least 80% identity to SEQ ID NO. 5.
- the HS-GAG binding element may comprise a sequence having at least 90% identity to SEQ ID NO. 5.
- the HS-GAG binding element may comprise a sequence having at least 95% identity to SEQ ID NO. 5.
- the HS-GAG binding element may comprise a sequence having at least 98% identity to SEQ ID NO. 5.
- the HS-GAG binding element may comprise a sequence having at least 99% identity to SEQ ID NO. 5.
- the HS-GAG binding element may comprise the amino acid sequence T Y R S R K Y T S W Y V A L K R (FGF2 HBD B SEQ ID NO. 7).
- the HS-GAG binding element may comprise a sequence having at least 80% identity to SEQ ID NO. 7.
- the HS-GAG binding element may comprise a sequence having at least 90% identity to SEQ ID NO. 7.
- the HS-GAG binding element may comprise a sequence having at least 95% identity to SEQ ID NO. 7.
- the HS-GAG binding element may comprise a sequence having at least 98% identity to SEQ ID NO. 7.
- the HS-GAG binding element may comprise a sequence having at least 99% identity to SEQ ID NO. 7.
- the GAG binding element may comprise a GAG binding antibody, or a variant or fragment thereof.
- the HS-GAG binding element may comprise a HS-GAG binding antibody, or a variant or fragment thereof.
- the antibody fragment may be an antibody variable domain, an scFv, a diabody, a FAb, a Dab, a F(ab)'2, a heavy-light chain dimer, or a single chain structure.
- the antibody variant may comprise a protein scaffold comprising CDRs, an antibody mimetic, or a DARPin.
- the single-domain antibody may comprise a V H H fragment comprising a CDR1 , CDR2 and CDR3 wherein CDR1 may comprise or consists of the amino acid sequence of GFTVSSNE (SEQ ID NO: 21) or GFAFSSYA (SEQ ID NO: 22);
- CDR2 may comprise or consists of the amino acid sequence of ISGGST (SEQ ID NO: 23) or IGTGGDT (SEQ ID NO: 24); and
- the single-domain antibody may comprise a V H H fragment comprising a CDR1 , CDR2 and CDR3 wherein
- CDR1 may comprise or consists of the amino acid sequence of GFTVSSNE
- CDR2 may comprise or consists of the amino acid sequence of ISGGST (SEQ ID NO: 23);
- CDR3 may comprise or consists of the amino acid sequence of GRRLKD (SEQ ID NO: 25).
- the CDR3 may comprise the amino acid sequence GMRPRL (SEQ ID NO: 27), HAPLRNTRTNT (SEQ ID NO : 28), GSRSSR (SEQ ID NO : 29), GRTVGRN (SEQ ID NO: 30), GKVKLPN (SEQ ID NO: 3 1 ), SGRKGRMR (SEQ ID NO: 32), SLRMNGWRAHQ (SEQ ID NO: 26), or RRYALDY (SEQ ID NO: 33).
- GMRPRL SEQ ID NO: 27
- HAPLRNTRTNT SEQ ID NO : 28
- GSRSSR SEQ ID NO : 29
- GRTVGRN SEQ ID NO: 30
- GKVKLPN SEQ ID NO: 3 1
- SGRKGRMR SEQ ID NO: 32
- SLRMNGWRAHQ SEQ ID NO: 26
- RRYALDY SEQ ID NO: 33
- the single-domain antibody may comprise a V H H fragment comprising a CDR1 , CDR2 and CDR3 wherein
- CDR1 may comprise or consists of the amino acid sequence of GFAFSSYA (SEQ ID NO : 22);
- CDR2 may comprise or consists of the amino acid sequence of IGTGGDT (SEQ ID NO: 24);
- the CDR3 may comprise the amino acid sequence LKQQGIS (SEQ ID NO: 34), AMTQKKPRKLSL (SEQ ID NO: 35), HAPLRNTRTNT (SEQ ID NO: 28), GMRPRL (SEQ ID NO: 27), RRYALDY (SEQ ID NO: 33), or SGRKYFRARDMN (SEQ ID NO: 36).
- the HS-GAG binding element may comprise anti-HS scFv antibodies AO4B08, AO4B05, A04F 12, RB4CB9, RB4CD 12, RB4EA 12, or RB4EG12 (as described in Jenniskens et al (2000.
- the HS-GAG binding element may comprise AO4B08.
- the HS-GAG binding element may comprise CDRl , CDR2 and CDR3 of AO4B08, AO4B05, A04F 12, RB4CB9, RB4CD 12, RB4EA12, or RB4EG12.
- the HS- GAG binding element may comprise CDRl , CDR2 and CDR3 of AO4B08.
- the HS-GAG binding element may comprise HS3A8, LKIV69, EW3D 10, EW4G2, NS4F5, RB4EA 12, HS4E4 or HS4C3 (as described in Wijnhoven et al (2008) Glycoconj J 25 : 177- 185) and Smits, et al (2006. METHODS IN ENZYMOLOGY, VOL. 416, pp . 61 -87) incorporated herein by reference) .
- the HS-GAG binding element may comprise HS4E4 or HS4C3.
- the HS-GAG binding element may comprise CDRl , CDR2 and CDR3 of HS3A8, LKIV69, EW3D 10, EW4G2, NS4F5, RB4EA 12, HS4E4 or HS4C3.
- the HS-GAG binding element may comprise CDRl , CDR2 and CDR3 of HS4E4 or HS4C3.
- the HS-GAG binding element may comprise SEQ ID NO: 15 or 17 (AO4B08).
- the HS-GAG binding element may comprise SEQ ID NO: 1 1 or 13 (HS4C3).
- the HS- GAG binding element may comprise an antibody, or antibody fragment, heavy chain and/or light chain.
- the HS-GAG binding element may comprise an antibody, or antibody fragment, heavy chain, comprising HCDR1 , HCDR2 and HCDR3 chains and/or light chain, comprising LCDR1 , LCDR2 and LCDR3.
- the GAG binding element may not comprise any of the protein transduction domains described herein. In one embodiment, the GAG binding element and the protein transduction domain are different. In one embodiment, the GAG binding element is not TAT.
- the protein transduction domain may be hydrophilic or amphiphilic.
- the protein transduction domain may comprise a majority of hydrophilic amino acid residues.
- the protein transduction domain may comprise a majority of arginine and/or lysine amino acid residues.
- the protein transduction domain may comprise a periodic sequence, having a repeated amino acid sequence motif.
- the protein transduction domain may comprise penetratin, TAT such as HIV derived TAT, MAP, or transportan, pVec, or pep- 1.
- PTD-4 PIRRRKKLRRLK (SEQ ID NO: 41);
- MPG ac-GALFLGFLGAAGSTMGAWSQPKKKRKV-cya SEQ ID NO: 52
- MPG(?NLS) ac- GALFLGFLGAAGSTMGAWSQPKSKRKV-cya SEQ ID NO : 53
- Pep- 1 ac-KETWWETWWTEWSQPKKKRKV-cya SEQ ID NO: 54
- Pep-2 ac-KETWFETWFTEWSQPKKKRKV-cya SEQ ID NO: 55
- the protein transduction domain may comprise polyarginines, such as RxN (4 ⁇ N ⁇ 17) chimera, polylysines, such as KxN (4 ⁇ N ⁇ 17) chimera, (RAca)6R, (RAbu)6R, (RG)6R, (RM)6R, (RT)6R. (RS)6R, R10, (RA)6R, R7, or R8.
- the protein transduction domain may comprise polyarginine or polylysine.
- the protein transduction domain may comprise an arginine and lysine repeat sequence.
- the protein transduction domain may comprise arginine residues, such as consecutive arginine residues.
- the protein transduction domain may consist essentially of arginine residues.
- the protein transduction domain may comprise arginine repeats, such as 4-20 arginine residues.
- the protein transduction domain may comprise 8 arginine residues.
- the protein transduction domain may comprise between about 6 and about 12 arginine residues.
- the protein transduction domain may comprise between about 7 and about 9 arginine residues.
- the protein transduction domain may comprise between about 4 and about 12 amino acid residues.
- the protein transduction domain may comprise between about 6 and about 12 amino acid residues.
- the protein transduction domain may comprise between about 7 and about 9 amino acid residues.
- the protein transduction domain may comprise at least about 4 amino acid residues.
- the protein transduction domain may comprise at least about 6 amino acid residues.
- the protein transduction domain may comprise lysine residues, such as consecutive lysine residues.
- the protein transduction domain may consist essentially of lysine residues.
- the protein transduction domain may comprise lysine repeats, such as 4-20 lysine residues.
- the protein transduction domain may comprise 8 lysine residues.
- the protein transduction domain may comprise between about 4 and about 12 lysine residues.
- the protein transduction domain may comprise between about 6 and about 12 lysine residues.
- the protein transduction domain may comprise between about 7 and about 9 lysine residues.
- the protein transduction domain may comprise Q and R residues, such as consecutive QR repeat residues.
- the protein transduction domain may consist essentially of Q and R residues.
- the protein transduction domain may comprise QR repeats, such as 4-20 QR repeat residues.
- the protein transduction domain may comprise 8 QR repeat residues.
- the protein transduction domain may comprise between about 6 and about 12 QR repeat residues.
- the protein transduction domain may comprise between about 7 and about 9 QR repeat residues.
- the bond or interaction between the nucleic acid and delivery vehicle may be reversible, or degradeable, for example in the intracellular environment.
- the GAG binding element and protein transduction domain may be bound to the nucleic acid by direct chemical conjugation or through a linker molecule. Direct chemical conjugation may comprise a covalent bond.
- the GAG binding element, protein transduction domain may be a single fusion molecule (e.g. it may be encoded and transcribed as a single peptide molecule), with the nucleic acid conjugated thereto.
- the nucleic acid, GAG binding element, and protein transduction domain may be linked together by one or more linker molecules .
- the GAG binding element, protein transduction domain and linker molecule may be a single fusion molecule (e .g. it may be encoded and transcribed as a single peptide molecule), with the nucleic acid conjugated thereto, or complexed therewith.
- the linker molecule may comprise a nucleic acid interacting peptide.
- the nucleic acid interacting peptide may comprise synthetic amphipathic peptide LK15.
- the nucleic acid interacting peptide may comprise KALA peptide.
- the nucleic acid is linked to the GAG binding element and protein transduction domain via a conjugated PEI (polyethylenimine) molecule.
- the delivery vehicle may comprise a marker for identifying and/or tracking the location of the delivery molecule .
- the marker may comprise a fluorescence marker, or a radioisotope.
- the marker may comprise mRFP l (monomeric red fluorescent protein).
- the marker may comprise mNectarine, such as pH-sensitive mNectarine. mNectarine, is appropriate to measure physiological pH changes in mammalian cells, because it has a pKa' of 6.9.
- the marker may comprise a red fluorescent protein (RFP) homologue of avGFP.
- the marker may comprise a fluorescent protein selected from the mFruit series RFPs, derived from tetrameric Discosoma RFP.
- the marker may comprise any of mTangerine, mOrange, mCherry, mStrawberry, yellow FP Citrine. mApple and TagRFP-T.
- the marker may be pH-sensitive.
- the marker may be used to confirm delivery of the delivery molecule into the cell or tissue .
- the marker may be cell-type specific, for example the marker may only be activated or fluoresce in specific cell types.
- the marker may be encoded on the nucleic acid.
- the delivery vehicle may comprise a tag to aid in purification, isolation, detection and/or determination of location.
- the tag may be an affinity tag.
- the tag may be a peptide.
- the tag may be a FLAG-tag / FLAG octapeptide.
- the transduction may be for at least about 1 second.
- the transduction may be for at least about 1 minute .
- the transduction may be for at least about 2 minutes.
- the transduction may be for at least about 10 minutes.
- the transduction may be for at least about 30 minutes.
- the transduction may be for at least about 1 hour.
- the transduction may be for 12 hours or less, such as 8 hours or less.
- the transduction may be for about 6 hours or less.
- the transduction may be for between about 1 hour and 6 hours.
- the transduction may be for less than about 1 hour.
- the transduction may be for less than about 30 minutes.
- the transduction may be for less than about 10 minutes.
- the transduction may be for less than about 1 minute.
- a method of treatment for tissue damage or a bone defect comprising:
- an expanded population of cells for use in a method of treatment or prevention of a disease or treatment for tissue damage or a bone defect comprising:
- the provided cell may be from the patient to be treated.
- the expanded population of cells may be autologous for the patient.
- the expanded population of cells may be administered to the patient by implantation of a scaffold populated with the expanded population of cells .
- the expanded population of cells may be administered to the tissue damage or bone defect of the patient, for example by injection.
- the expanded population of cells may be administered topically for skin regeneration treatments .
- a method of manufacturing an implant for treatment of tissue damage or a bone defect in a patient comprising:
- a method of manufacturing a scaffold-forming composition comprising cells for treatment of tissue damage or a bone defect in a patient comprising :
- a method i manufacturing a wound dressing comprising cells for treatment of tissue damage in patient comprising : - providing a cell;
- an agent for transiently transforming a population of cells comprising:
- nucleic acid is linked to a delivery vehicle for cell attachment and internalization, wherein the delivery vehicle comprises:
- glycosaminoglycan (GAG) binding element which is capable of binding to GAG on the surface of the cell
- the scaffold or scaffold-forming composition may comprise any synthetic or natural polymer capable of solidifying to form a scaffold.
- the scaffold or scaffold-forming composition may comprise a polymer blend (for example a PLGA/PEG blend).
- the scaffold or scaffold-forming composition may comprise a synthetic bone alternative.
- the scaffold may comprise extracellular matrix.
- the scaffold may be a biocompatible scaffold.
- the skilled person will be familiar with a range of scaffold material and compositions suitable for use with seeded cells. For example, Freed et al. ( 1994. Biodegradable polymer scaffolds for tissue engineering. Nature Biotechnology, 12, 689-693) describes suitable scaffold compositions that may be used with this invention, the contents of which are incorporated herein by reference.
- a method of manufacturing a suspension of autologous cells for treatment of a patient in need thereof comprising:
- the cell may be from the patient to be treated.
- the treatment may comprise autologous therapy selected from the group comprising burns/skin grafting; diabetes therapy with pancreatic islet cell expansion; liver therapy with hepatocyte cell expansion; retinal pigment epithelial cell expansion for macular degeneration; and expansion of cardiac progenitors for transplant in ischemia.
- autologous therapy selected from the group comprising burns/skin grafting; diabetes therapy with pancreatic islet cell expansion; liver therapy with hepatocyte cell expansion; retinal pigment epithelial cell expansion for macular degeneration; and expansion of cardiac progenitors for transplant in ischemia.
- the population of cells may be derived from a patient to be treated with the cells.
- the population of cells may to autologous to the patient.
- delivery vehicle for transiently transforming a mesenchymal stem cell with nucleic acid
- the delivery vehicle comprises:
- glycosaminoglycan (GAG) binding element which is capable of binding to GAG on the surface of the cell
- the delivery vehicle is linked to the nucleic acid.
- the transient transformation and/or expansion of the cell may be in vitro.
- the delivery vehicle may be transduced in the presence of, or co-administered with, a vesicle/endosome release agent for promoting release of the delivery molecule from micropinocytic vesicles.
- the vesicle release agent may comprise chloroquine.
- the chloroquine concentration may be between about ⁇ ⁇ and about ⁇ ⁇ .
- the delivery vehicle may further comprise an endosome release agent.
- the endosome release agent may comprise one or more trifluoromethylquinolines, for example four trifluoromethylquinolines as described in Lindberg et al. ⁇ International Journal of Pharmaceutics 441 (2013) 242- 247), which is incorporated herein by reference .
- the endosome release agent may be linked to the delivery vehicle and may comprise the following structure :
- the endosome release agent linked to a delivery vehicle according to the invention may comprise or consist of the following structure (P21 -8R-QN 1) :
- the endosome release agent linked to a delivery vehicle according to the invention may comprise or consist of the following structure (P21 -8R-QN2) :
- the nucleic acid such as RNA
- the cells may return to their original state, whilst retaining the chromosomal DNA modification.
- cells which are proliferating/expanding are more susceptible to stable genetic transfection. Therefore, genetic modifications can be made to cells such as mesenchymal stem cells, which are typically difficult to transform and modify genetically.
- the methods of the invention herein may further comprise a second or third transient transformation step (e .g. one or more serial transformations) .
- a second or third transient transformation step e .g. one or more serial transformations
- FIG 1 Genetic Immortalisation (via Lentivirus) of hMSCs using TERT, E6/7 and SV40T overexpression.
- Figure 2 Project Hypothesis: Transient Immortalisation of hMSCs can be achieved using GET delivery of TERT, E6/7 or SV40T RNA.
- Figure 3 Production of Modified RNAs to direct cell behaviour.
- A) Initially the genes/factors to be expressed are selected.
- B) The open-reading frame (ORF) of the gene is isolated incorporating codon changes to optimise human expression.
- D) PCR is used to insert a 90 adenosine poly-A tail required for translation and RNA stabilisation.
- T7 polymerase is used to synthesise RNA in vitro incorporating a cap-analogue to improve translation and RNA stability, and modified nucleotides to prevent cell immune response to delivered RNA.
- FIG. 4 Transfection of human mesenchymal stem cells (ihMSCs) using GET. Initially we assessed binding capacity of LK15 peptides for plasmid (p)DNA (SIN GFP, to express GFP on transfection), RNA (modRNA) (to express GFP on transfection) and small-inhibitory (si)RNAs (labelled with FAM fluorophore to detect delivery) .
- p plasmid
- RNA modifyRNA
- si)RNAs small-inhibitory
- FIG. 5 Analyses of Trans-ihMSCs (Ana) A) Primary, Genetically, transiently, and post-transiently immortalised hMSCs will be compared. B) Gene expression analyses through Illumina mRNA-Seq, Tri-lineage differentiation, karyotype stability, cell growth and tumorigenicity of the cells will be assessed.
- Figure 6 Transfection of primary human mesenchymal stem cells (hMSCs), long-term passaged (P10) hMSCs and immortalised hMSCs (ihMSCs) using GET or LIPO2000. hMSCs were transfected, long-term hMSCs (P 10) and ihMSCs with P21 -LK15-8R (GET) and pDNA ( 10 ⁇ ⁇ of SIN
- GFP expressing eGFP and quantified transfection SCs by flow cytometry (% transfection efficiency) and compared to lipofectamine (LIPO)2000 as a commercial standard. Error bars indicate s.d.
- pDNA transfections are strongly influenced by proliferation of the cell line transfected. Younger, growing hMSCs (P I) were transfected at low levels, older senescing hMSCs (P 10) have
- FIG. 7 P21 improves PTD-mediated transduction
- mR and mR-8R are described in Fig 1.
- P21 -mR is mRFP with an N-terminal fusion of the P21 domain of heparin-binding EGF (HB-EGF).
- P21 -mR-8R is mRFP with ⁇ -terminal fusion of P21 and C-terminal fusion of 8R.
- P21 to mR-8R significantly improves transduction into NIH3t3 cells. Fluorescence microscopy images of NIH3t3 cells treated with proteins (20 ⁇ g/ml) for twelve hours in standard media conditions. Scale bar, ⁇ ⁇ .
- P21 -mR-8R transduces efficiently into human and mouse embryonic stem cells (HUES7 and CGR-8, respectively) and human induced pluripotent stem cells (IPS2) and mouse cardiomyocyte cell line HL 1 .
- FIG. 8 P21 binds directly to Heparin and cell surface HS-GAG.
- Soluble Heparin in media during transduction inhibits cell membrane interaction and transduction of P21 -containing proteins. Fluorescence microscopy images of
- CS Chondroitin sulphate. Cells were pre-incubated for 1 hour in serum-free media and transduced for 6 hours in serum-free media with or without GAGs.
- Figure 9 GET / HETD-mediated nuclear delivery of Cre Recombinase.
- (a) Schematic of the construct created to mark Cre activity in cells. Cre-mediated excision of a transcriptional STOP region flanked by lox? sites induces the constitutive expression of eGFP. Pr, promoter; Gal, ⁇ -galactosidase; Neo, Neomycin phosphotransferase.
- Pr promoter
- Gal ⁇ -galactosidase
- Neo Neomycin phosphotransferase.
- the NIH3t3 LSL-eGFP cell line was created by transfection and selection of NIH3t3 cells
- Graph shows % recombination (i.e. % of eGFP+ve from total cell population) . Error bars indicate s.d.
- Figure 10 GET / HETD-mediated delivery of domain position protein variants, (a) Schematic of the proteins created to test the effect of domain position on protein delivery to cells, (b) Fusion of P21 and 8R to mR in any orientation significantly improves transduction. Flow cytometry analyses of NIH3t3 and HUES7 cells incubated with the protein variants (20 ⁇ g/ml) for twelve hours. Error bars indicate s.d.
- FIG. 11 GET / HETD-mediated delivery of PTD protein variants,
- 8R is RRRRRRRR (SEQ ID NO: 19)
- TAT HIV- 1 TAT protein
- 8K is KKKKKKKK (SEQ ID NO: 56)
- 8RQ is RQRQRQRQ (SEQ ID NO: 57)
- Fusion of P21 and any PTD to mR significantly improves transduction.
- Figure 12 GET / HETDs can achieve higher intracellular levels of cargo delivery than transgenic systems, (a) Fluorometry of soluble extracts generated from NIH3t3 mR (transgenic NIH3t3 cells transduced with SIN mR) compared with those from NIH3t3 cells transduced for 6 hours with different doses of mR-8R or P21 -mR-8R (0, 10, 20, 50, 100 or 200 ⁇ g/ml in serum-free media) (b) Flow cytometry of NIH3t3 mR (transgenic NIH3t3 cells transduced with SIN mR) compared with those from NIH3t3 cells transduced for 6 hours with different doses of mR-8R or P21 -mR-8R (0, 10, 20, 50, 100 or 20( ⁇ g/ml in serum-free media). Fluorescence is normalised to untreated NIH3t3 cells. Error bars indicate s.d.
- HERD-mediated Cre Recombinase nuclear activity is promoted by vesicle escape but repressed by inhibitors of macropinocytosis or cholesterol depletion.
- NIH3t3 LSL-eGFP cells were pre-incubated in serum-free media (with or without drugs), transduced with Cre proteins (mR-Cre : 100 ⁇ g/ml or P21 -mR- 8R: 10 ⁇ g/ml) for 1 hour in serum-free media (with or without drugs), washed and cultured for 12 hours in full growth media (with or without drugs) and a further 36 hours in full growth media before analyses, (a) Methyl- -cyclodextrin (used to deplete cholesterol) inhibits Cre transduction and recombination.
- Chloroquine promotes the release of Cre from endosomal vesicles and increases recombination (Chloroquine doses were 0, 10 and ⁇ ⁇ ).
- Picogram per millilitre amounts is required to induce recombination with enhanced vesicle escape.
- the dose of transduced P21 -mR- Cre-8R was varied in ten-fold dilutions (0- 100 ⁇ g/ml) with 1 hour incubation in the presence of Chloroquine. All data is presented as % of the maximal recombination. Error bars indicate s.d.
- Figure 14 GET / HETD-mediated transduction increases general cellular macropinocytosis.
- NIH3t3 cells were pre-incubated in serum- free media for 1 hour and transduced with mR, P21 -mR, mR-8R or P21 -mR-8R (20 ⁇ g/ml in serum-free media) containing 70kDa FITC-Dextran (neutral) for 1 hour. Error bars indicate s.d.
- Figure 15 GET of non-protein Cargoes, (a) GET of biotinylated cargoes using monomeric streptavidin (mSA2) . (i) Schematic of the mSA2 proteins engineered to bind to and transduce biotinylated cargoes.
- mSA2 monomeric streptavidin
- P21 -8R was used as a non- interacting control, mSA2 as a non-transducing control, and P21 -mSA2-8R as the test protein,
- (ii) Schematic of the antibody (Ab) complexes of a biotinylated primary ( ) antibody (Goat anti-rabbit; GtaRb) bound to an FITC-conjugated secondary (2 ° ) antibody (Rabbit anti-mouse; Rb aMu) used to test activity
- GET-delivery of Ab complexes were visible by fluorescence microscopy (scale bar, 50 ⁇ ).
- FIG. 18 pH-sensitivity of GET-mNectarine (mNect) proteins demonstrates rapid cell binding and transduction
- (b-c) GET-mNect or GET-mR proteins (20 ⁇ g/ml) were transduced into NIH3t3 cells for lh (to demonstrate membrane binding activity), lh followed by a further 5h incubation without protein ( lh-5h) (to demonstrate transduction activity) or 6h (to demonstrate sustained delivery) .
- Flow cytometry was used to compare intensities of mNect and mR GET-proteins.
- Figure 20 GET is biocompatible in multiple clinically relevant cell types.
- Cell lines were transduced with P21 -mR-8R at 20 or 200 ⁇ g/ml over 24 hours and assessed by trypan blue for cell viability (cell lines were those described in Fig. 1 including rat aortic smooth muscle cells (rSMC) and neonatal cardiomyocytes (rCMs)). Viability remained high in all cell types for both concentrations tested.
- rSMC rat aortic smooth muscle cells
- rCMs neonatal cardiomyocytes
- Figure 21 A: Prussian blue staining of Nanomag particles incubated with 3t3 cells for 24 hours, B : Iron assay results for the amount of iron per cell after the 24 hour incubation.
- Figure 23 Graph showing the increase in transduction of mRFP into cells by modified CPPs (HS-GAG binding domain mRFP 8R) over an unmodified CPP (mRFP 8R) .
- Figure 24 Efficient delivery of mRFP to cells via modified peptides shown to promote GET. Fluorescence microscopy images of NIH3T3, CGR8 and HUES-7 cells treated with P21 mRFP 8R, FGF2B mRFP 8R, FGF7B mRFP 8R and PDGF mRFP 8R peptides (2C ⁇ g/ml) for twelve hours. Scale bar, ⁇ ⁇ .
- Figure 26 Examples of flow cytometry dot plots showing GFP expression of NIH3T3 cells following transfection with pSIN GFP for 6h. Following transfection, cells were fixed at a 48h time-point. Flow cytometry analysis was used to quantify % of GFP positive cells.
- FIG. 27 Transfection optimization of pSIN GFP into NIH3T3 cells by P21 LK15 8R peptide.
- FIG. 29 Transient immortalisation of human MSCs.
- FIG. 31 Transfection 'resets' cellular senescence and triggers cell cycle in aged human MSCs.
- Example 1 There is an unmet clinical need for high numbers of patient-specific cells for cell therapies.
- the solution is the use of transient immortalisation to expand the small cell population to numbers feasible for cell therapies.
- Transgenic systems (like those used in genetic immortalisation for ihMSCs; Fig 2B) have been used for basic research and one example exists in cell therapies (CTX trial of immortalized neural cells for stroke treatment by ReNeuron, UK) 7 . Stable genetic modification has been used by several studies 1 . However these cells are not clinically relevant. Transient immortalisation of clinically valuable cells to generate extensive cell numbers (without losing the primary cell phenotype) will be a step change in what is possible using hMSCs in cell therapies. There are many examples of other cell therapies were large numbers of patient-matched (autologous) cells are required but there is presently no approach to produce them.
- PTDs Protein transduction domains
- This GET (GAG-binding Enhanced Transduction) system can deliver enzymes (Cre, neomycin phosphotransferase), transcription factors (NANOG, MYOD), antibodies, native proteins (Cytochrome-C), magnetic nanoparticles (MNPs) and nucleic acids (plasmid (p)DNA, modified (mod)RNA and siRNA) at efficiencies of up to two- orders of magnitude higher than previously reported in cell types considered hard to transduce, such as mouse embryonic stem cells (mESCs), human ESCs (hESCs), induced pluripotent stem cells (hiPSCs) and human mesenchymal stem cells (hMSCs).
- mESCs mouse embryonic stem cells
- hESCs human ESCs
- hiPSCs induced pluripotent stem cells
- hMSCs human mesenchymal stem cells
- RNAs (Fig 3 & 4) using GET temporarily produces a proliferative phenotype in clinically-relevant cells which are hard and slow to expand to sufficient numbers for human cell therapies.
- Immortalised hMSCs retain differentiation capacity, are non-tumorigenic and proliferate
- RNA does not integrate into the host cell genome and that it is rapidly turned-over meaning that protein-expression from it is transient.
- RNA can be delivered daily to create a situation of constant protein expression and simply ceasing the delivery results in no further protein-expression. Therefore the level and duration of the expressed protein' s activity can tightly and stoichiometrically controlled.
- the efficient, non-toxic and serum-resistant GET transfection system was used to express immortalisation factors in primary hMSCs to promote their proliferation. This is temporary and once GET delivery is stopped, proliferation will return to normal levels but have yielded a significantly larger population of cells that could be used for therapies.
- HB-EGF belongs to the EGF family of cytokines.
- HB-EGF shows a strong affinity to heparin and binds to the same receptor as EGF and TGF-a ⁇ Sakuma, 1997 #76 ⁇ .
- the interaction of HB-EGF with cell surface HS-GAG is essential for its optimal binding to EGFR and for promoting its growth/migratory activity toward vascular smooth muscle cells ⁇ Higashiyama, 1993 #90 ⁇ .
- mice and human pluripotent stem cells CGR-8, HUES7 and IPS2
- cardiomyocytes HL 1
- P21 -tag both tags synergized to produce the high-levels of transduction similar to that seen in other cell lines (Fig. 7c) .
- These motifs were also placed in tandem at N- and C- terminal of mRFP (P21 or 8R first; P21 -8R-mR, 8R-P21 -mR or mR-P21 -8R, mR-8R- P21 ) or switched their termini (i .e .
- 8R-mR-P21 8R-mR-P21
- all variants demonstrating similar synergy and cell transducing behaviour (Fig 10) as seen for P21 -mR-8R.
- 8R was swapped for alternative well characterised PTDs (TAT, 8K and 8RQ ; ⁇ El-Andaloussi, 2005 #36 ⁇ ) and showed that these also synergized with P2 1 (Fig 1 1 ) .
- mRFP l with stable EF l a-promoter driven
- Fig 12 To achieve this soluble protein was extracted from transduced cells and measured amounts by fluorometry (Fig 12a), or flow cytometry was used (Fig 12b). Using 6 hour incubations, mR-8R levels were several times lower ( ⁇ 3-fold; > ⁇ 0.05) than that achieved by viral transgenesis even at the highest tested doses (200 ⁇ g/ml).
- P21 - tagged proteins were significantly depleted in both cell types (-37% and -25% in NIH3t3 and HUES7 cells, respectively; > ⁇ 0.05) with HETD-proteins depleted from media to the highest levels and maj ority of protein removed (-72 and -66% in NIH3t3 and HUES7 cells, respectively; p ⁇ 0.0 ⁇ ) .
- HETDs bind rapidly to cell membranes through HS-GAGs and transduce efficiently into cells, but it was yet to be confirmed if the mode of uptake was through macropinocytosis as for PTDs . Also, what proportion of this protein escaped endosomes and may be considered successfully delivered was not assessed. Previous studies have the avoided issues associated with direct measurement of fluorescent-tagged proteins (such as being unable to distinguish membrane, vesicle or functional cytosolic/nuclear protein) by assaying for the successful nuclear activity of Cre recombinase ⁇ Gump, 2010 #2 ⁇ .
- This system was used to measure Cre-mediated recombination of a /oxP-STOP-/oxP (LSL) enhanced green fluorescent protein (eGFP) reporter gene in live NIH3t3 mouse fibroblast cells (NIH3t3 : LSL-eGFP cells) as an indicator of cellular uptake (Fig 9a) .
- LSL /oxP-STOP-/oxP
- eGFP enhanced green fluorescent protein
- the GET-protein / HETD-protein, P21 -mR-Cre-8R required as little as one minute incubation with cells at a low dose ( ⁇ g/ml) to elicit recombination (4.3 ⁇ 2.5 %; > ⁇ 0.05) confirming that binding and internalization is an efficient and rapid process.
- a moderate dose l C ⁇ g/ml
- GET/ HETD-transduction achieved a functional delivery ⁇ 15-fold (/? ⁇ 0.01) above PTD only levels and completely recombined all NIH3t3 : LSL-eGFP cells (Fig 9d,e). Importantly this activity was ⁇ 340-fold better than mR-Cre (/? ⁇ 0.001).
- Heparinase III, free-heparin and serum-free experiments were repeated using the Cre recombination system. It was confirmed that heparinase III pre- treatment reduced recombination to basal-levels and that media serum plays a role in replenishing cell membrane GAGs depleted by heparinase . Overall these data correlate well with the fluorescence delivery conclusions and show synergy between P21 - and PTD- moieties to achieve significant increases in functional transduction of protein cargo.
- GET protein enters cells by lipid raft macropinocytosis
- NIH3t3 LSL-eGFP cells treated with methyl- ⁇ - cyclodextrin and nystatin were used to deplete or sequester cholesterol, respectively, then transduced HETD-tagged proteins. Both methyl- -cyclodextrin (Fig 13a) and nystatin (Fig 13b) disruption of lipid rafts resulted in a dose-dependent inhibition of functional delivery. These data demonstrates that GET / HETD-mediated transduction specifically requires lipid raft-mediated endocytosis.
- Macropinocytosis is a rapid, lipid raft-dependent and receptor-independent form of endocytosis which requires actin membrane protrusions that envelope into vesicles termed macropinosomes ⁇ Nichols, 2001 #30; Liu, 2002 #28; Conner, 2003 #22 ⁇ .
- macropinocytosis was indeed the endocytotic mechanism of HETD-mediated transduction cells were pre-treated with macropinocytosis-inhibiting compounds (Fig. l la,b).
- Amiloride is a specific inhibitor of the Na + /H + exchange required for macropinocytosis ⁇ West, 1989 #3 1 ⁇ .
- Cytochalasin D is an inhibitor of F-actin elongation which is required for macropinosome-linked membrane protrusions ⁇ Sampath, 1991 #32 ⁇ . Amiloride and Cytochalasin D did not disrupt cell binding of HETD-proteins but resulted in a dose-dependent reduction of functional transduction into cells (Fig 13c and 13d, respectively). These data confirm that P21 enhances the macropinocytotic pathway used by PTD to internalize cargo molecules.
- P21 -mR-8R induced a significant dose dependant increase in fluid-phase dextran uptake over steady-state control levels.
- PTD-tagged versus GET / HETD-tagged activity to stimulate this macropinocytosis was compared.
- P21 -mR-8R enhanced FITC-dextran uptake ⁇ 2.5-fold (p ⁇ 0.05) over the stimulation achieved by the same concentration of mR-8R demonstrating that engagement with HS-GAG through P21 and its subsequent effect on PTD-mediated transduction stimulates macropinocytotic uptake .
- Significant amounts of GET-delivered protein is trapped in Endosomes which can be efficiently released with Chloroquine
- HALO Ha Tag
- Intra- versus extracellular labelling of HALO was confirmed using transgenic over-expression of untagged HALO (for intracellular) and LAMP2b-HALO which is presented on the external cell membrane (for extracellular) and labeling with cell permeant (HALO TAG Oregon Green) or impermeant (HALO TAG Alexafluor 488 ) ligands (Fig 16) .
- GET-HALO proteins were constructed and recombinantly expressed (Fig 17a) and delivered them to cells testing the the internalisation by sensitivity to labelling with the cell impermeant ligand.
- One hour incubation demonstrated that GET-proteins remained mainly extracellularly localised and attached to the cell membrane (Fig 17b) .
- cDNA was obtained for mRFPl (mR) as a kind gift from Prof. R. Y. Tsien (University of California, USA) ⁇ Campbell, 2002 # 12 ⁇ . 8R, TAT, 8K, 8RQ, P21, Cre, NANOG, MYOD and NEO cDNAs were synthesized de novo (Eurofins MWG Operon). cDNAs were cloned into the pGEX6-P l expression vector (Novagen) to create in-frame fusions and expressed proteins in BL21 (DE21) pLysS Escherichia coli (Novagen).
- Recombinant proteins were purified by affinity chromatography using Glutathione-Sepharose resin (GE Healthcare). GST-tags were removed and eluted from resin by PreScissionTM Protease cleavage (GE healthcare) in IX cleavage buffer (50 mM Tris-HCI pH 7.0, 150 mM NaCl, 1 mM EDTA and 1 mM DTT) . Protein concentration was determined using a BCA-based protein assay (BioRad) with absorbance measured at 595nm using recombinant mR protein as a standard. Integrity and full-length protein expression was confirmed by SDS-PAGE.
- NIH3T3 mouse fibroblast cells HEK293T human embryonic kidney cells, C2C 12 mouse myoblast cells, iHMSC immortalised human mesenchymal stem cells (created as described ⁇ Okamoto, 2002 #8 ⁇ ) and MEF murine embryonic fibroblasts (harvested as described ⁇ Anderson, 2007 #9 ⁇ ) were maintained in DMEM with 10% (v/v) fetal calf serum (FCS; Sigma) media supplemented with 2mM L-glutamine, l OOunits/ml penicillin and 100 ⁇ g/ml streptomycin).
- CGR-8 mouse embryonic stem cells (mESCs) and EXT1-/- mESCs (a kind gift from Dr. D. E.
- HL 1 mouse cardiomyocyte cells were maintained as described ⁇ Claycomb, 1998 #7 ⁇ .
- HUES7 human embryonic and IPS2 induced pluripotent stem cells were cultured as previously described ⁇ Dick, 201 1 # 10 ⁇ .
- HUES7fib human fibroblasts derived from HUES7 cells were generated and cultured as previously described ⁇ Dick, 201 1 # 10 ⁇ . All cells were cultured at 37 ° C under 5% C0 2.
- Cell association (membrane and intracellular levels) were assessed by transducing cells for 6 hours in serum-free medium.
- flow cytometry cells were trypsinized, washed and fixed in 4% PFA and for microscopy cells were imaged live after washing in PBS.
- trypsin depletion of cell-surface proteins cells were treated with trypsin/EDTA (Invitrogen) or EDTA-based cell dissociation solution (CDS) (Sigma) for 15 minutes at 37 °C, followed by washes with PBS and IX soybean trypsin inhibitor ( 10 mg/ml in PBS; Sigma) . Cells were then treated with proteins for 1 hour at 37 °C in serum-free medium.
- NIH3t3 cells 5 x 10 6 NIH3t3 cells were plated (in T25 flasks), pre-incubated cells in serum-free DMEM for 1 hour, and transduced them with mR-8R or P21 -mR-8R (0-20( ⁇ g/ml; 1 ml volume) in serum-free DMEM for 6 hours.
- NIH3t3 cells transduced with SIN-mR lentiviruses were used as a control for the levels achieved by transgenic systems ⁇ Dixon, 201 1 # 15 ; Dick, 201 1 # 10 ⁇ .
- Cells were harvested by trypsinization, fixed in 4% PFA for flow cytometry or washed several times in cold PBS with soluble protein extracted in cold HKM buffer (20mM HEPES, pH 7.5, 5mM KC1, 0.5 mM MgCl 2 and 0.5 mM DTT with IX complete EDTA-free protease inhibitor cocktail) for fluorometry ⁇ Medina, 2000 # 14 ⁇ . Extracts were sonicated, centrifuged and NaCl added to yield a final concentration of l OOmM prior to analyses. Fluorometry was used to compare soluble extracts with purified mRFP protein diluted in HKM buffer with l OOmM NaCl as standards. Flow cytometry was used to assess total delivered protein in intact cells.
- Heparin binding activity we incubated 1ml of recombinant proteins (20 ⁇ g/ml) in DMEM with 50 ⁇ 1 of PBS-washed Heparin-sepharose beads (Sigma) for 1 hour at 37 ° C shaking at l OOrpm. Media pre- and post-incubation was compared by fluorometry.
- Heparinase treatment we plated NIH3t3 cells at 2 x 10 5 /well (in 12-well plates) and were pre-incubated in serum-free media for 1 hour with Heparinase III (0- 1 U/ml) or Heparin (0-50 ⁇ g/ml).
- FCS was depleted of P21 -binding material by affinity chromatography. This was achieved by incubating 50 ml FCS with 2 ml Glutathione-Sepharose resin (GE Healthcare) pre-absorbed with GST-P21 protein expressed in Escherichia coli.
- the NIH3t3 LSL-eGFP cell line was created using the pZ/EG plasmid transfection and G-418 selection ⁇ Novak, 2000 #6 ⁇ .
- Cre activity efficiently led to recombination and eGFP activation cells were transduced with SIN-Cre lentiviruses (as described in Dixon et al. 201 1) and >95% of cells were confirmed eGFP-positive 48 hours post-transduction.
- 2 xl O 5 cells/well were plated (in 12-well plates), pre-incubated them in DMEM without serum for 1 hour and treated with Cre proteins (0-500 ⁇ g/ml) in DMEM without serum.
- Cre incubation cells were trypsinized, replated into complete media and incubated for 2 days.
- Cells were pre-treated with drugs for the stated time-period in DMEM without serum, were included in Cre-transduction medium and were added after replating.
- Pre- treatments included: heparin (0-50 ⁇ g/ml), chondroitin sulphate A, B and C (0-50 ⁇ / ⁇ ), chloroquine (0- ⁇ ⁇ ), cytochalasin-D (0- 10 ⁇ ), amiloride (0-5 mM), methyl- -cyclodextrin (0-5mM), and nystatin (0-50 ⁇ g/ml).
- Biotinylated-Goat anti-Rabbit and FITC-Rabbit anti-mouse antibodies (Sigma), pSIN- GFP (Dixon et al. 2014), modified nucleotide RNA (modRNA) for GFP (Miltenyi Biotech) and FAM-labelled siRNA against GAPDH (Sigma), and nanomag-D (250nm) (MircoMod) were complexed with GET-proteins or -peptides and added to cells.
- modified nucleotide RNA modified nucleotide RNA
- siRNA nanomag-D (250nm)
- GET- or LIPO2000 (lipofectamine 2000; Invitrogen) transfection used 10 ⁇ g or 1 ⁇ g nucleic acid per transfection of 100,000 hMSCs in 12 well plates.
- MNPs a final concentration of 25 ⁇ peptide was used in an EDAC/NHS reaction using 2mg MNPs according to manufacturer's instructions.
- Prussian blue was carried out using potassium ferrocyanide (2.5% w/v) in 2.5% w/v HC1.
- SPIONS Superparamagnetic Iron Oxide nanoparticles
- MRI contrast agents 1 and are currently being researched for use in targeted drug delivery 2 , hyperthermia treatment and cell labelling 3 .
- SPIONS have been approved for uses in MRI contrast agents and commercially available products include Lumiren, Resivist and Feridex. 1
- a 3 1 mM EDAC with 0. 1 M NHS dissolved in 0.5M MES buffer was added to Nanomag-D (250 nm) particles in a 1 :5 ratio respectively and mixed for 1 hour.
- the particles are then washed in a 0. 1M MES buffer and 0.2 ⁇ g/ ⁇ l of the required labelling agent dissolved in the same buffer was added to give a 1 : 1 ratio of labelling solution and nanoparticles, an aliquot of the labelling solution was kept for testing labelling efficiency.
- the solution is then continuously mixed at room temperature for 3 hours. Once the particles are labelled a 25 mM glycine solution is added to the particles then further incubated for 30 minutes.
- Confluent cells were split into 12 well plates at 200,000 cells/well and incubated for 24 hours at 37oC. After 24 hours 50 ⁇ g of Nanomag-D iron oxide nanoparticles (250 nm) and either 0, 0.01 , 0.05, 0.1 , 0.5, 2, 1 , 5 and 10 ⁇ of cell penetrating peptide were added to the cells with either 10% FCS DMEM or serum free DMEM media and left for 24 hours for iron nanoparticles to be internalised. After incubation cells were washed in PBS to remove excess nanoparticles then harvested for qualitative Prussian blue staining, quantitative colorimetric iron assay or fluorescence activated flow cytometry.
- Quantitative Colorimetric Iron Assay Cells were labelled, trypsinised and pelleted then all media removed. 40 ⁇ 1 of 37% HCL was added to the cells and heated at 70°C until dissolved, then neutralised with 50 ⁇ 1 of NaOH. Those samples containing a high concentration of iron were diluted 1 : 10 then 40 ⁇ of Quantichrom working reagent was added and the instructions in the Quantichrom iron assay followed.
- Cells were labelled with 50 ⁇ g of Nanomag-D particles, 1 ⁇ P218R and either 0, 0. 1 , 1 and 5 ⁇ g/ml of FitC-BSA. Cells were then fixed cells and run through a Coulter Altra flow cytometer to assess the green fluorescence. Findings were then statistically analysed by Wesal software.
- Nanomag-D (250 nm) particles were successfully labelled with mR, P21mR, 8RmR and P21mR8R.
- the 8R can then aid in the transduction of the nanoparticle by endocytosis. Or the other mechanism could involve the peptide pre binding to the nanoparticle then when in close proximity to a cell membrane the HS has a higher binding efficiency so the P21 then binds to the cell. This may then lead to the particle being internalised.
- the advantages of using the P218R peptide is its efficiency in serum media which is more relatable to the in vivo environment and that the system does not require the use of the functional group on the nanoparticles surface coating.
- the free functional group means that targeting molecules or drugs can be covalently attached to the particle.
- the peptide P218R has been found to cause 100% cell association of nanoparticles. This has been found to be due to a dextran binding mechanism which can be utilised for many applications for example targeting of nanoparticles for specific tissues by attaching antibodies, or drug delivery.
- the first aim of this study was to investigate whether the GET-mediated synergistic increase in delivery of mRFP into cells with P21 8R could be observed when P21 was replaced by growth factor derived HS-GAG binding domains.
- the second aim of this study was to show cell type specific delivery in a heterogeneous population of cells by targeting a specific cell surface HS-epitope .
- Merry et al have demonstrated the utility of a HS-epitope binding antibody in targeting a subpopulation of cells during mesodermal differentiation [ 13] .
- the variable region of this antibody was conjugated to 8R to show an example of cell type specific delivery.
- the third aim of this study was to demonstrate the GET-mediated delivery of therapeutic biomolecules.
- GM relevant growth media
- PBS phosphate buffered valine
- PFA 3.7% /2ara/ormaldehyde
- EBs were then differentiated as EBs for 2.8 days in IMDM with 15% FCS supplemented with 4xl 0 4 M MTG, 300ug/ml transfe rrin, 25ug/ml ascorbic acid and 2mM L-glutamine in Petri-grade dishes. 3h before dissociation, EBs were treated with 50ug/ml of HS4C3 mRFP or HS4C3 mRFP 8R. Following differentiation EBs were separated into single cells by l Omin incubation and agitation in cell dissociation buffer and fixed in PFA. Flow Cytometry Analysis
- P21 -LK15-8R peptide was synthesised using solid phase t-Boc chemistry (Novabiochem (Beeston, Nottinghamshire, UK)) .
- NIH3T3 mouse fibroblast cells were maintained in DMEM with 10% (v/v) fetal calf serum (FCS) media supplemented with 2mM L-glutamine and l OOug/ml streptomyocin. The cells were incubated at 37°C under humidified 5% C0 2 conditions.
- FCS fetal calf serum
- DNA (pSIN GFP) was amplified in E. coli. The DNA was extracted and purified using a QIAGEN Plasmid Maxi kit (Qiagen). DNA was precipitated in 100% ethanol and rehydrated in dH 2 0. Plasmid purity was confirmed using the nanodrop.
- the mixture was then mixed and incubated for 25mins at room temperature.
- the cells were aspirated, washed with PBS and replaced with 400ul Opti-MEM®.
- Each well of cells was treated with l OOul of Lipofectamine2000/DNA complex and incubated 37°C in a 5% C0 2 humidified atmosphere. After 6h, the cells was washed with PBS, trypsinized and fixed with 3.7% PFA. This was repeated with varying volumes of Lipofectamine2000 (3ul and 4.5ul) to find the optimal ratio of Lipofectamine2000 to DNA. Experiments were repeated 3 times.
- YO-PRO- 1 assay can be used to investigate the DNA condensation ability of a DNA binding peptide.
- YO-PRO- 1 is a cyanine dye that binds DNA to form a fluorescent DNA/dye complex. Different (+/-) charge ratios of peptide can be added to the fluorescent DNA/dye complex. As the peptide out competes the dye by binding the DNA a reduction in fluorescence intensity is observed.
- LK15 was fused to P21 8R transduction protein to improve the DNA binding ability of the modified cell penetrating peptide. Fusion of LK15 peptide to TAT has been shown to significantly improve transfection of pDNA into HT29 and HT 1080 cultured cells [ 19] . Enhanced transduction efficiency of Tat-LK15 over Tat is thought to be due to the improved condensation ability of the peptide and DNA, and better transduction of the DNA across the cell membrane [20] .
- the phospholipid bilayer of the cell membrane acts as an impenetrable barrier to nucleic acids and thus pDNA will be conjugated to a modified CPP to facilitate its transport into the cell [2] .
- the GET-mediated transfection of the reporter gene pSIN GFP into NIH 3T3 murine fibroblast cells was optimized in terms of transfection time (3, 6 or 24h), transfection media (with or without serum) and amount of DNA ( 1 , 4 or l Oug) .
- the reporter gene pSIN GFP was transfected into cells using P21 LK15 8R where P21 targets and binds cell surface HS-GAGs, LK15 complexes pSIN GFP and 8R transduces pSIN GFP across the cell membrane .
- the transfection efficiency of pSIN GFP with P21 LK15 8R was compared to the transfection efficiency of commercially used lipid-based transfection reagent lipofectamine2000. Cells were fixed at 48h following transfection to allow time for the transient expression of GFP to be captured and transfection efficiencies were quantified by flow cytometry (Figure 26).
- Example 3 There is an unmet clinical need for high numbers of patient-specific cells for cell therapies.
- RNAs have been delivered ( Figures 29-3 1 ) that temporarily produce a proliferative phenotype in clinically-relevant cells which are hard and slow to expand to sufficient numbers for human cell therapies.
- RNA was synthetically made using modified nucleotides and cap analogues which express well in human cells, are not cytotoxic and do not generate a cellular immune response, specifically in primary cells using the interferon B 18R inhibitor (Fig 29) .
- Clearly RNA is not stability inherited unlike integrated DNA and is more efficient at producing a translated protein product as it is translated in the cytosol rather than needing transcription in nuclei like delivered DNAs.
- RNA expression was demonstrated to be short lived (to background levels by 72h) meaning that RNA can be serially delivered (daily to every 3 days) to create a situation of constant protein expression and simply ceasing the delivery results in no further protein-expression (Fig. 29). Therefore, it has been proven that the level and duration of the expressed protein's activity can tightly and stoichiometrically controlled in the target cell type.
- Transient immortalisation of clinically valuable cells to generate extensive cell numbers is a step change in what is possible using hMSCs in cell therapies.
- aged cells by over passaging them; Fig 3 1. P4- 10.
- stem cell derived from the elderly or diabetic patients are the most difficult to expand.
- PDGF (194-211) nucleotide sequence:
- N cargo nucleic acid sequence of various length (i.e. the number of nucleotide residues may vary), or another molecular entity.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Immunology (AREA)
- Virology (AREA)
- Pharmacology & Pharmacy (AREA)
- Epidemiology (AREA)
- Animal Behavior & Ethology (AREA)
- Hematology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Engineering & Computer Science (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Cell Biology (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
Abstract
The invention relates to a method of producing a population of cells comprising: transiently transforming a cell with nucleic acid arranged to promote cell expansion, wherein the nucleic acid is linked to a delivery vehicle for cell attachment and internalization, wherein the delivery vehicle comprises: a glycosaminoglycan (GAG) binding element, which is capable of binding to GAG on the surface of the cell; and a protein transduction domain. The invention further relates to a population of cells, methods of manufacture of cells and articles, methods of transient modification of a cell, and use of a cell delivery vehicle.
Description
CELL MODIFICATION AND APPLICATION IN THERAPY
The invention relates to methods of producing a population of cells and use of those cells in therapy, including bone and tissue repair.
A number of cell therapies are proposed were large numbers of patient-matched (autologous) cells are required, but there is presently no suitable method to produce them. For example, human adult stem cells such as mesenchymal stem cells (hMSCs; derived from tissues such as bone marrow, fat or isolated from circulating blood) have low proliferative capacity and a finite life-span1. Mesenchymal stem cells (MSCs) are multipotent stromal cells that can differentiate into a variety of cell types, including: osteoblasts (bone cells), chondrocytes (cartilage cells), myocytes (muscle cells) and adipocytes (fat cells). Many regenerative medicine applications employ MSCs however their lack of expandability and senescence significantly inhibits their autologous clinical adoption2. Other cell types such as pancreatic islets, hepatocytes, retinal pigment cells, and neurons are also difficult to expand to a large population for cell therapies.
In particular, many systems simply rely on conventional culture (Fig 2A), in which slow growing cells are pushed to proliferate by media conditions with progressive slowing of growth and eventual senescence. Most therapies cannot feasibly use patient-derived cells. Therefore most approaches employ heterologous donor cells which require patient immunosuppression and a reduction in efficacy and clinical outcome . Even if the desired numbers of patient-specific cells can be produced then they have been exhaustively manipulated over several weeks/months meaning that spontaneous transformation could result leading to considerable safety concerns2. Therefore, there is an unmet clinical need for high numbers of patient-specific cells for cell therapies. An aim of the present invention is to provide a method of producing higher numbers of patient-specific cells for cell therapies, which overcomes the above limitations.
According to a first aspect of the invention, there is provided a method of producing a population of cells comprising:
-transiently transforming a cell with nucleic acid arranged to promote cell expansion,
wherein the nucleic acid is linked to a delivery vehicle for cell attachment and internalization, wherein the delivery vehicle comprises :
- a glycosaminoglycan (GAG) binding element, which is capable of binding to
GAG on the surface of the cell; and
- a protein transduction domain.
According to another aspect of the invention, there is provided a method of transient modification of a cell comprising:
-exposing the cell to a transformation complex comprising a nucleic acid linked to a delivery vehicle for cell attachment and internalization, wherein the delivery vehicle comprises:
- a glycosaminoglycan (GAG) binding element, which is capable of binding to GAG on the surface of the cell; and
- a protein transduction domain.
Advantageously transiently transforming a cell with nucleic acid, such as RNA, arranged to promote expansion can provide a rapid expansion of cells in one-to- several weeks rather than months from small starting populations. Furthermore, the cells produced from the transiently transformed cells will be non-genetically modified as, for example, RNA will not be integrated into the chromosome, will not be replicated, and will be degraded within the cell. Such a technology greatly facilitates the possibilities of autologous cell therapies. There is also less likelihood of spontaneous transformation, for example which can be observed in senescing hMSC cultures. Advantageously, the provision of the delivery molecule in the present invention can increase the efficiency of transduction of the nucleic acid into cells for transient transformation. The GAG binding element, such as HS-GAG binding element P21 (from a growth factor), in combination with a protein transduction domain, such as 8mer arginine peptide, and a cargo, greatly facilitates the uptake of very large quantities of the nucleic acid into cells. Not only do the cells take up the delivery molecule (by macro-pinocytosis) but the delivery molecules have been shown to traverse the cellular matrix and be delivered to the nucleus.
The term "cell expansion" is understood to mean the reproduction of a cell into multiple copies of the cell, i.e. in order to form a population of cells derived from the cell. Expansion includes increasing the number of cells in a population. In one embodiment, expansion may comprise at least halving the doubling time of the cells.
The method may further comprise expanding the cell(s) to form an expanded cell population, for example by incubation following or during transient transformation. The incubation may be in any suitable cell growth media, which the skilled person can readily determine based on the cell type to be expanded. The incubation may be at a suitable growth temperature and conditions, such as 37°C, 5% C02, humid atmosphere.
The term "transiently transforming" or "transient transformation" is understood that a genetic sequence, for example encoding a gene, is introduced into a cell, but it is not integrated into the chromosome. The genetic sequence may function within the cell for a limited time, but it is not reproduced or an inherited genetic change. For example, the nucleic acid transiently transformed into the cell may be degraded after a period of time and is not passed onto subsequent generations of the cell during expansion of the cell population. RNA is transient as it is eventually degraded in the cell. The term "transient immortalisation" may be used interchangeably with "transient transformation".
The cell may be any cell type that can be promoted to increase expansion by nucleic acid capable of promoting expansion of the cell. The cell may comprise a mesenchymal stem cell (MSC). In another embodiment, the cell may be a pancreatic islet cell. In another embodiment, the cell may be a hepatocyte . In another embodiment, the cell may be a retinal pigment cell. In another embodiment, the cell may be a neuron. The cell may be mammalian. In one embodiment, the cell is a human cell, such as a human mesenchymal stem cell.
A single cell may be expanded into a population of cells, or multiple cells may be expanded in a population of cells. For example, a population of cells may be collected from a patient and the population of cells may be expanded in number.
The expanded population of cells may not senesce. In an embodiment where the cells are MSCs, the expanded population of cells may retain multipotent differentiation into bone, fat and connective tissue. In one embodiment, the expanded population of cells (during or post-transient transformation) are not tumorogenic.
In one embodiment one or more of the following properties are exhibited from the cells, the properties selected from:
- at least 40% of the cells may exhibit protein expression from the transiently transformed nucleic acid;
- at least 80% increase in growth rate of the cells after transient transformation;
- gene expression may return to less than 10% variability in the expanded population of cells (post-immortalisation);
- retention of tri-lineage differentiation ability in embodiments providing expanded population of MSCs;
- in embodiments where the cell is an MSC, the cells may provide at least 80% capacity for osteogenic, adipogenic and chondrogenic differentiation compared with primary hMSCs;
-the expanded cell population may display normal diploid karyotype (no aneuploidy observed using clinical criteria); and
- at least about 20% of the cell attributes in the expanded population of cells may return to pre-transient transformation levels.
The cell attributes may comprise retention of the cell morphology and/or retention of the cells differentiation capacity.
In one embodiment, at least 50% of the cells may exhibit protein expression from the transiently transformed nucleic acid. In another embodiment, at least 60% of the cells may exhibit protein expression from the transiently transformed nucleic acid. In one embodiment, at least 100% increase in growth rate of the cells is provided after transient transformation. In another embodiment, at least 120% increase in growth rate of the cells is provided after transient transformation.
The nucleic acid may comprise RNA, or analogues thereof. In one embodiment, the nucleic acid is RNA. The nucleic acid may comprise siRNA, modified messenger
RNAs (mRNAs), or micro RNA. In one embodiment, the nucleic acid may not comprise DNA.
The nucleic acid, such as RNA, may be modified for translation and stability. The RNA may comprise poly-A tail for translation and stabilisation. Additionally, or alternatively the RNA may comprise a cap or cap-analogue for translation and stabilisation. A cap-analogue may comprise ARCA cap (anti-reverse cap analogue). T7 polymerase may be used to synthesise RNA in vitro incorporating a cap-analogue to improve translation and stability. The RNA may comprise modified nucleotides to prevent cell immune response to delivered RNA. For example the RNA may comprise nucleotide changes to prevent immune response. Modifications may comprise the provision of methy-cytosine and/or pseudo-uracil.
The nucleic acid, such as RNA, may be arranged to promote cell expansion by encoding genes capable of temporally immortalizing cells. For example, the nucleic acid may encode TERT (telomerase reverse transcriptase), HPV E6/7 or SV40T (simian virus 40 T antigen); or combinations thereof; or functional variants thereof. In one embodiment, the nucleic acid encodes TERT (telomerase reverse transcriptase) and HPV E6/7. The nucleic acid may encode any one of the genes selected from SV40T, TERT, HPV E6/7, BMI 1 , Cyclins (such as D l or 2), Survivin (BIRC5), p53, and Ras; or combinations thereof.
In one embodiment, combinations of genes may be delivered separately to the cell using separate delivery vehicles.
The delivery vehicle system herein may be referred to as GET (GAG-binding enhanced transduction) or otherwise Heparan-sulfate enhanced transduction domain (HETD)-mediated delivery. These terms may be used interchangeably. The GAG binding element may be a heparan sulphate glycosaminoglycan (HS-GAG) binding element, which is capable of binding to HS-GAG on the surface of the cell.
Heparan sulfate glycosaminoglycan (HS-GAG) is a proteoglycan in which two or three HS chains are attached in close proximity to cell surface or extracellular matrix proteins. It is in this form that HS binds to a variety of protein ligands and regulates a
wide variety of biological activities, including developmental processes, angiogenesis, blood coagulation and tumour metastasis. Heparan sulfate is a member of the glycosaminoglycan family of carbohydrates and is very closely related in structure to heparin. Both consist of a variably sulfated repeating disaccharide unit. The most common disaccharide unit within heparan sulfate is composed of a glucuronic acid (GlcA) linked to N-acetylglucosamine (GlcNAc) typically making up around 50% of the total disaccharide units.
The GAG binding element may have specific affinity for GAG. The HS-GAG binding element may have specific affinity for HS-GAG. The HS-GAG binding element may comprise a heparin binding domain (HBD), or a variant thereof. The heparin binding domain variant may comprise a truncated heparin binding domain, or an extended heparin binding domain. The GAG binding element may comprise any protein, peptide or molecule that specifically or preferentially binds to GAG. The HS-GAG binding element may comprise any protein, peptide or molecule that specifically or preferentially binds to HS-GAG.
The HS-GAG binding element may comprise at least part of the heparin binding domain of Heparin-Binding EGF-like Growth Factor (HB-EGF). The heparin binding domain may comprise P21 of HB-EGF. The heparin binding domain may comprise a truncated, extended, or functional variant of P21.
The HS-GAG binding element may comprise a heparin binding domain of a fibroblast growth factor, or a functional part or variant thereof.
The HS-GAG binding element may be selected from any of the group comprising FGF, antithrombin, such as ATIII, VEGF, BMPs, Wnts, Shh EGFs, and PDGF; or variants thereof. The HS-GAG binding element may comprise any of FGF2, FGF7, or PDGF. The HS-GAG binding element may comprise one or more of the heparan binding sulphate domains of any FGF protein (e.g. domains A, B or C). The HS-GAG binding element may comprise FGF4. The HS-GAG binding element may comprise FGF 1 HBD A (heparan sulphate binding domain A (the first HBD domain of FGF 1)), FGF2 HBD A (heparan sulphate binding domain A), FGF4 HBD A (heparan sulphate binding domain A), FGF 1 HBD C (heparan sulphate binding domain C), FGF2 HBD B (heparan sulphate binding domain B), FGF2 HBD C (heparan sulphate binding
domain C), FGF4 HBD C (heparan sulphate binding domain C), FGF7 HBD B (heparan sulphate binding domain B), FGF7 HBD C (heparan sulphate binding domain C), antithrombin, such as ATIII, VEGF, or PDGF, or variants thereof. The HS-GAG binding element may be selected from any of the group comprising Hepatocyte Growth Factor, Interleukin, morphogens, HS-GAG binding enzymes, Wnt/Wingless, Endostatin, viral protein, such as foot and mouth disease virus protein, annexin V, lipoprotein lipase; or HS-GAG binding fragments thereof. The HS-GAG binding element may comprise any protein, peptide or molecule capable of specifically binding HS-GAG.
A "variant" may be understood by the skilled person to include a functional variant, wherein there may be some sequence differences from the known, reported, disclosed or claimed sequence, but the variant may still bind to HS-GAG. Conservative amino acid substitutions are also envisaged within the meaning of "variant".
The HS-GAG binding element may comprise the amino acid sequence KRKKKGKGLGKKRDPCLRKYK (P21) SEQ ID NO. 1). The HS-GAG binding element may comprise a sequence having at least 80% identity to SEQ ID NO. 1. The HS-GAG binding element may comprise a sequence having at least 90% identity to SEQ ID NO. 1. The HS-GAG binding element may comprise a sequence having at least 95% identity to SEQ ID NO. 1. The HS-GAG binding element may comprise a sequence having at least 98% identity to SEQ ID NO. 1. The HS-GAG binding element may comprise a sequence having at least 99% identity to SEQ ID NO. 1.
The HS-GAG binding element may comprise the amino acid sequence G R P R E S G K K R K R K R L K P T (PDGF, SEQ ID NO. 3) . The HS-GAG binding element may comprise a sequence having at least 80% identity to SEQ ID NO. 3. The HS-GAG binding element may comprise a sequence having at least 90% identity to SEQ ID NO. 3. The HS-GAG binding element may comprise a sequence having at least 95% identity to SEQ ID NO. 3. The HS-GAG binding element may comprise a sequence having at least 98% identity to SEQ ID NO. 3. The HS-GAG binding element may comprise a sequence having at least 99% identity to SEQ ID NO. 3.
The HS-GAG binding element may comprise the amino acid sequence T Y A S A K W T H N G G E M F V A L N Q ((FGF7, HBD B) SEQ ID NO. 5). The HS-GAG binding element may comprise a sequence having at least 80% identity to SEQ ID NO. 5. The HS-GAG binding element may comprise a sequence having at least 90% identity to SEQ ID NO. 5. The HS-GAG binding element may comprise a sequence having at least 95% identity to SEQ ID NO. 5. The HS-GAG binding element may comprise a sequence having at least 98% identity to SEQ ID NO. 5. The HS-GAG binding element may comprise a sequence having at least 99% identity to SEQ ID NO. 5. The HS-GAG binding element may comprise the amino acid sequence T Y R S R K Y T S W Y V A L K R (FGF2 HBD B SEQ ID NO. 7). The HS-GAG binding element may comprise a sequence having at least 80% identity to SEQ ID NO. 7. The HS-GAG binding element may comprise a sequence having at least 90% identity to SEQ ID NO. 7. The HS-GAG binding element may comprise a sequence having at least 95% identity to SEQ ID NO. 7. The HS-GAG binding element may comprise a sequence having at least 98% identity to SEQ ID NO. 7. The HS-GAG binding element may comprise a sequence having at least 99% identity to SEQ ID NO. 7.
Sequence identity may be determined by standard BLAST alignment parameters (provided by http://www.ncbi.nlm.nih.gov/).
The GAG binding element may comprise a GAG binding antibody, or a variant or fragment thereof. The HS-GAG binding element may comprise a HS-GAG binding antibody, or a variant or fragment thereof. The antibody fragment may be an antibody variable domain, an scFv, a diabody, a FAb, a Dab, a F(ab)'2, a heavy-light chain dimer, or a single chain structure. The antibody variant may comprise a protein scaffold comprising CDRs, an antibody mimetic, or a DARPin.
The GAG or HS-GAG binding element may comprise a nanobody (single-domain antigen-binding fragments derived from heavy-chain antibodies that are devoid of light chains and occur naturally in Camelidae).
The single-domain antibody may comprise a VHH fragment comprising a CDR1 , CDR2 and CDR3 wherein
CDR1 may comprise or consists of the amino acid sequence of GFTVSSNE (SEQ ID NO: 21) or GFAFSSYA (SEQ ID NO: 22);
CDR2 may comprise or consists of the amino acid sequence of ISGGST (SEQ ID NO: 23) or IGTGGDT (SEQ ID NO: 24); and
CDR3 may comprise or consists of the amino acid sequence of GRRLKD (SEQ
ID NO: 25) or SLRMNGWRAHQ (SEQ ID NO: 26).
The single-domain antibody may comprise a VHH fragment comprising a CDR1 , CDR2 and CDR3 wherein
CDR1 may comprise or consists of the amino acid sequence of GFTVSSNE
(SEQ ID NO: 21);
CDR2 may comprise or consists of the amino acid sequence of ISGGST (SEQ ID NO: 23); and
CDR3 may comprise or consists of the amino acid sequence of GRRLKD (SEQ ID NO: 25).
Alternatively, the CDR3 may comprise the amino acid sequence GMRPRL (SEQ ID NO: 27), HAPLRNTRTNT (SEQ ID NO : 28), GSRSSR (SEQ ID NO : 29), GRTVGRN (SEQ ID NO: 30), GKVKLPN (SEQ ID NO: 3 1 ), SGRKGRMR (SEQ ID NO: 32), SLRMNGWRAHQ (SEQ ID NO: 26), or RRYALDY (SEQ ID NO: 33).
The single-domain antibody may comprise a VHH fragment comprising a CDR1 , CDR2 and CDR3 wherein
CDR1 may comprise or consists of the amino acid sequence of GFAFSSYA (SEQ ID NO : 22);
CDR2 may comprise or consists of the amino acid sequence of IGTGGDT (SEQ ID NO: 24); and
CDR3 may comprise or consists of the amino acid sequence of SLRMNGWRAHQ (SEQ ID NO: 26).
Alternatively, the CDR3 may comprise the amino acid sequence LKQQGIS (SEQ ID NO: 34), AMTQKKPRKLSL (SEQ ID NO: 35), HAPLRNTRTNT (SEQ ID NO: 28), GMRPRL (SEQ ID NO: 27), RRYALDY (SEQ ID NO: 33), or SGRKYFRARDMN (SEQ ID NO: 36).
The HS-GAG binding element may comprise anti-HS scFv antibodies AO4B08, AO4B05, A04F 12, RB4CB9, RB4CD 12, RB4EA 12, or RB4EG12 (as described in Jenniskens et al (2000. The Journal of Neuroscience, 20( 1 1):4099-41 1 1) and Smits, et al (2006. METHODS IN ENZYMOLOGY, VOL. 416, pp. 61 -87) incorporated herein by reference); or fragments thereof. The HS-GAG binding element may comprise AO4B08. The HS-GAG binding element may comprise CDRl , CDR2 and CDR3 of AO4B08, AO4B05, A04F 12, RB4CB9, RB4CD 12, RB4EA12, or RB4EG12. The HS- GAG binding element may comprise CDRl , CDR2 and CDR3 of AO4B08. The HS-GAG binding element may comprise HS3A8, LKIV69, EW3D 10, EW4G2, NS4F5, RB4EA 12, HS4E4 or HS4C3 (as described in Wijnhoven et al (2008) Glycoconj J 25 : 177- 185) and Smits, et al (2006. METHODS IN ENZYMOLOGY, VOL. 416, pp . 61 -87) incorporated herein by reference) . The HS-GAG binding element may comprise HS4E4 or HS4C3. The HS-GAG binding element may comprise CDRl , CDR2 and CDR3 of HS3A8, LKIV69, EW3D 10, EW4G2, NS4F5, RB4EA 12, HS4E4 or HS4C3. The HS-GAG binding element may comprise CDRl , CDR2 and CDR3 of HS4E4 or HS4C3.
The HS-GAG binding element may comprise SEQ ID NO: 15 or 17 (AO4B08). The HS-GAG binding element may comprise SEQ ID NO: 1 1 or 13 (HS4C3). The HS- GAG binding element may comprise an antibody, or antibody fragment, heavy chain and/or light chain. The HS-GAG binding element may comprise an antibody, or antibody fragment, heavy chain, comprising HCDR1 , HCDR2 and HCDR3 chains and/or light chain, comprising LCDR1 , LCDR2 and LCDR3.
In one embodiment, the GAG binding element may not comprise any of the protein transduction domains described herein. In one embodiment, the GAG binding element and the protein transduction domain are different. In one embodiment, the GAG binding element is not TAT.
The protein transduction domain may be hydrophilic or amphiphilic. The protein transduction domain may comprise a majority of hydrophilic amino acid residues. The protein transduction domain may comprise a majority of arginine and/or lysine amino acid residues. The protein transduction domain may comprise a periodic sequence, having a repeated amino acid sequence motif. The protein transduction domain may
comprise penetratin, TAT such as HIV derived TAT, MAP, or transportan, pVec, or pep- 1.
Where reference is made to a "majority" of residue, this may be understood by the skilled person to include greater than 50% of the residues. A majority may be 55 %, 60%, 70%, 80%, 90% or 95% of the residues.
The protein transduction domain may be selected from any of the group comprising:
Penetratin or Antenapedia PTD RQIKWFQNRRMKWKK (SEQ ID NO: 37); TAT YGRKKRRQRRR (SEQ ID NO: 38);
SynB l RGGRL SYS RRRF S T S TGR (SEQ ID NO: 39);
SynB3 RRLSYSRRRF (SEQ ID NO: 40);
PTD-4 PIRRRKKLRRLK (SEQ ID NO: 41);
PTD-5 RRQRRTSKLMKR (SEQ ID NO : 42);
FHV Coat-(35-49) RRRRNRTRRNRRRVR (SEQ ID NO: 43);
BMV Gag-(7-25) KMTRAQRRAAARRNRWTAR (SEQ ID NO: 44);
HTLV-II Rex-(4- 16) TRRQRTRRARRNR (SEQ ID NO : 45);
D-Tat GRKKRRQRRRPPQ (SEQ ID NO : 46);
R9-Tat GRRRRRRRRRP P Q (SEQ ID NO: 47);
Transportan GWTLNSAGYLLGKINLKALAALAKKIL (SEQ ID NO: 48) chimera;
MAP KLALKLALKLALALKLA (SEQ ID NO : 49);
SBP MGLGLHLLVLAAALQGAWSQPKKKRKV (SEQ ID NO: 50);
FBP GALFLGWLGAAGSTMGAWSQPKKKRKV (SEQ ID NO : 5 1);
MPG ac-GALFLGFLGAAGSTMGAWSQPKKKRKV-cya (SEQ ID NO: 52); MPG(?NLS) ac- GALFLGFLGAAGSTMGAWSQPKSKRKV-cya (SEQ ID NO : 53);
Pep- 1 ac-KETWWETWWTEWSQPKKKRKV-cya (SEQ ID NO: 54); and Pep-2 ac-KETWFETWFTEWSQPKKKRKV-cya (SEQ ID NO: 55).
The protein transduction domain may comprise polyarginines, such as RxN (4<N< 17) chimera, polylysines, such as KxN (4<N< 17) chimera, (RAca)6R, (RAbu)6R, (RG)6R, (RM)6R, (RT)6R. (RS)6R, R10, (RA)6R, R7, or R8.
The protein transduction domain may comprise polyarginine or polylysine. The protein transduction domain may comprise an arginine and lysine repeat sequence. The protein transduction domain may comprise arginine residues, such as consecutive arginine residues. The protein transduction domain may consist essentially of arginine residues. The protein transduction domain may comprise arginine repeats, such as 4-20 arginine residues. The protein transduction domain may comprise 8 arginine residues. The protein transduction domain may comprise between about 6 and about 12 arginine residues. The protein transduction domain may comprise between about 7 and about 9 arginine residues.
The protein transduction domain may comprise between about 4 and about 12 amino acid residues. The protein transduction domain may comprise between about 6 and about 12 amino acid residues. The protein transduction domain may comprise between about 7 and about 9 amino acid residues. The protein transduction domain may comprise at least about 4 amino acid residues. The protein transduction domain may comprise at least about 6 amino acid residues.
The protein transduction domain may comprise lysine residues, such as consecutive lysine residues. The protein transduction domain may consist essentially of lysine residues. The protein transduction domain may comprise lysine repeats, such as 4-20 lysine residues. The protein transduction domain may comprise 8 lysine residues. The protein transduction domain may comprise between about 4 and about 12 lysine residues. The protein transduction domain may comprise between about 6 and about 12 lysine residues. The protein transduction domain may comprise between about 7 and about 9 lysine residues.
The protein transduction domain may comprise Q and R residues, such as consecutive QR repeat residues. The protein transduction domain may consist essentially of Q and R residues. The protein transduction domain may comprise QR repeats, such as 4-20 QR repeat residues. The protein transduction domain may comprise 8 QR repeat residues. The protein transduction domain may comprise between about 6 and about 12 QR repeat residues. The protein transduction domain may comprise between about 7 and about 9 QR repeat residues.
The bond or interaction between the nucleic acid and delivery vehicle may be reversible, or degradeable, for example in the intracellular environment.
The GAG binding element and protein transduction domain may be bound to the nucleic acid by direct chemical conjugation or through a linker molecule. Direct chemical conjugation may comprise a covalent bond. The GAG binding element, protein transduction domain may be a single fusion molecule (e.g. it may be encoded and transcribed as a single peptide molecule), with the nucleic acid conjugated thereto.
The nucleic acid, GAG binding element, and protein transduction domain may be linked together by one or more linker molecules . The GAG binding element, protein transduction domain and linker molecule may be a single fusion molecule (e .g. it may be encoded and transcribed as a single peptide molecule), with the nucleic acid conjugated thereto, or complexed therewith. The linker molecule may comprise a nucleic acid interacting peptide. The nucleic acid interacting peptide may comprise synthetic amphipathic peptide LK15. In another embodiment, the nucleic acid interacting peptide may comprise KALA peptide. In another embodiment, the nucleic acid is linked to the GAG binding element and protein transduction domain via a conjugated PEI (polyethylenimine) molecule.
The delivery vehicle may comprise a marker for identifying and/or tracking the location of the delivery molecule . The marker may comprise a fluorescence marker, or a radioisotope. The marker may comprise mRFP l (monomeric red fluorescent protein). The marker may comprise mNectarine, such as pH-sensitive mNectarine. mNectarine, is appropriate to measure physiological pH changes in mammalian cells, because it has a pKa' of 6.9. The marker may comprise a red fluorescent protein (RFP) homologue of avGFP. The marker may comprise a fluorescent protein selected from the mFruit series RFPs, derived from tetrameric Discosoma RFP. The marker may comprise any of mTangerine, mOrange, mCherry, mStrawberry, yellow FP Citrine. mApple and TagRFP-T. The marker may be pH-sensitive. The marker may be used to confirm delivery of the delivery molecule into the cell or tissue . The marker may be cell-type specific, for example the marker may only be activated or fluoresce in specific cell types. The marker may be encoded on the nucleic acid.
The delivery vehicle may comprise a tag to aid in purification, isolation, detection and/or determination of location. The tag may be an affinity tag. The tag may be a peptide. The tag may be a FLAG-tag / FLAG octapeptide. The transduction may be for at least about 1 second. The transduction may be for at least about 1 minute . The transduction may be for at least about 2 minutes. The transduction may be for at least about 10 minutes. The transduction may be for at least about 30 minutes. The transduction may be for at least about 1 hour. The transduction may be for 12 hours or less, such as 8 hours or less. The transduction may be for about 6 hours or less. The transduction may be for between about 1 hour and 6 hours. The transduction may be for less than about 1 hour. The transduction may be for less than about 30 minutes. The transduction may be for less than about 10 minutes. The transduction may be for less than about 1 minute. According to another aspect of the present invention, there is provided a method of treatment or prevention of a disease comprising:
- providing a cell;
- transiently transforming the cell with nucleic acid for causing expansion of the cell in accordance with the method of the invention;
-expanding the cell to form an expanded population of cells;
-administering the expanded population of cells to the patient.
According to another aspect of the present invention, there is provided a method of treatment for tissue damage or a bone defect comprising:
- providing a cell;
- transiently transforming the cell with nucleic acid for causing expansion of the cell in accordance with the method of the invention;
-expanding the cell to form an expanded population of cells;
-administering the expanded population of cells to the patient.
According to another aspect of the present invention, there is provided an expanded population of cells for use in a method of treatment or prevention of a disease or treatment for tissue damage or a bone defect, the method comprising:
- providing a cell;
- transiently transforming the cell with nucleic acid for causing expansion of the cell in accordance with the method of the invention;
-expanding the cell to form an expanded population of cells;
-administering the expanded population of cells to the patient.
The provided cell may be from the patient to be treated. The expanded population of cells may be autologous for the patient.
The expanded population of cells may be administered to the patient by implantation of a scaffold populated with the expanded population of cells . The expanded population of cells may be administered to the tissue damage or bone defect of the patient, for example by injection. The expanded population of cells may be administered topically for skin regeneration treatments . According to another aspect of the present invention, there is provided a method of manufacturing an implant for treatment of tissue damage or a bone defect in a patient comprising :
- providing a cell;
- transiently transforming the cell with nucleic acid for causing expansion of the cell in accordance with the method of the invention;
- expanding the cell to form an expanded population of cells;
- populating the expanded population of cells into the implant.
According to another aspect of the present invention, there is provided a method of manufacturing a scaffold-forming composition comprising cells for treatment of tissue damage or a bone defect in a patient comprising :
- providing a cell;
- transiently transforming the cell with nucleic acid for causing expansion of the cell in accordance with the method of the invention;
- expanding the cell to form an expanded population of cells;
-mixing the expanded population of cells with a scaffold-forming composition.
According to another aspect of the present invention, there is provided a method i manufacturing a wound dressing comprising cells for treatment of tissue damage in patient comprising :
- providing a cell;
- transiently transforming the cell with nucleic acid for causing expansion of the cell in accordance with the method of the invention;
- expanding the cell to form an expanded population of cells;
-mixing the expanded population of cells with a wound dressing material.
According to another aspect of the invention, there is provided an agent for transiently transforming a population of cells, the agent comprising:
- nucleic acid arranged to promote cell expansion,
wherein the nucleic acid is linked to a delivery vehicle for cell attachment and internalization, wherein the delivery vehicle comprises:
- a glycosaminoglycan (GAG) binding element, which is capable of binding to GAG on the surface of the cell; and
- a protein transduction domain.
According to another aspect of the present invention, there is provided the use of the method of the invention or the use of the agent of the invention for providing a population of cells suitable for seeding onto a scaffold implant or wound dressing. The scaffold or scaffold-forming composition may comprise any synthetic or natural polymer capable of solidifying to form a scaffold. The scaffold or scaffold-forming composition may comprise a polymer blend (for example a PLGA/PEG blend). The scaffold or scaffold-forming composition may comprise a synthetic bone alternative. The scaffold may comprise extracellular matrix. The scaffold may be a biocompatible scaffold. The skilled person will be familiar with a range of scaffold material and compositions suitable for use with seeded cells. For example, Freed et al. ( 1994. Biodegradable polymer scaffolds for tissue engineering. Nature Biotechnology, 12, 689-693) describes suitable scaffold compositions that may be used with this invention, the contents of which are incorporated herein by reference.
According to another aspect of the present invention, there is provided a method of manufacturing a suspension of autologous cells for treatment of a patient in need thereof comprising:
- providing a cell;
- transiently transforming the cell with nucleic acid for causing expansion of the cell in accordance with the method of the invention;
- expanding the cell to form an expanded population of cells which are autologous to the patient.
In accordance with the methods of the invention herein, the cell may be from the patient to be treated.
The treatment may comprise autologous therapy selected from the group comprising burns/skin grafting; diabetes therapy with pancreatic islet cell expansion; liver therapy with hepatocyte cell expansion; retinal pigment epithelial cell expansion for macular degeneration; and expansion of cardiac progenitors for transplant in ischemia.
According to another aspect of the invention, there is provided a population of cells produced by the method of the invention.
The population of cells may be derived from a patient to be treated with the cells. In an embodiment wherein the population of cells is derived from a patient to be treated, the population of cells may to autologous to the patient.
According to another aspect of the invention, there is provided the use of delivery vehicle for transiently transforming a mesenchymal stem cell with nucleic acid, wherein the delivery vehicle comprises:
- a glycosaminoglycan (GAG) binding element, which is capable of binding to GAG on the surface of the cell; and
- a protein transduction domain; and
wherein the delivery vehicle is linked to the nucleic acid. The transient transformation and/or expansion of the cell may be in vitro.
With reference to the methods of the invention, the delivery vehicle may be transduced in the presence of, or co-administered with, a vesicle/endosome release agent for promoting release of the delivery molecule from micropinocytic vesicles. The vesicle release agent may comprise chloroquine. The chloroquine concentration may be between about Ι μΜ and about Ι ΟΟμΜ.
The delivery vehicle may further comprise an endosome release agent. The endosome release agent may comprise one or more trifluoromethylquinolines, for example four trifluoromethylquinolines as described in Lindberg et al. {International Journal of Pharmaceutics 441 (2013) 242- 247), which is incorporated herein by reference . For example, the endosome release agent may be linked to the delivery vehicle and may comprise the following structure :
I , which is arranged to be linked to the delivery vehicle, optionally the link is to a lysine residue of the delivery vehicle.
The endosome release agent linked to a delivery vehicle according to the invention may comprise or consist of the following structure (P21 -8R-QN 1) :
Stearyl-KRKKK1 (QN-K3 [QN]K2 {QN-
K3 [QN] })GKGLGKKRDPCLRKYKRRRRRRRR, alternatively represented as:
Stearvl-KRKKKG GLGK RDPCLRKYKRRRRRRRR-NH,
The endosome release agent linked to a delivery vehicle according to the invention may comprise or consist of the following structure (P21 -8R-QN2) :
Stearyl-KRKKKGKGLGKKRDPCLRKYK1 (QN-K3 [QN]K2 {QN- K3 [QN] } )RRRRRRRR, alternatively represented as:
! tear 1 -KRK KGKGLGKKRDPCLRKYKRRRRRRRR-NH
According to another aspect of the invention, there is provided a method of genetically modifying a cell comprising:
- transiently transforming the cell according to the method of the invention, such that the cell is in an expansion phase to form a population of cells; and
- transforming the cells during the expansion phase with nucleic acid arranged to stably modify the chromosomal DNA of the cell.
Following the transient transformation and expansion into a population of cells, the nucleic acid, such as RNA, may be degraded and the cells may return to their original state, whilst retaining the chromosomal DNA modification.
According to another aspect of the invention, there is provided the use of the method of the invention to transiently transform a cell for achieving a cell expansion phase in order to facilitate stable genetic modification of the cell by transformation with nucleic acid arranged to modify the cell chromosomal DNA.
The nucleic acid for stable genetic modification may comprise DNA. The method of genetically modifying a cell may comprise modifying a mesenchymal stem cell. The method may comprise stable genetic modification of any slow growing cell type. In another embodiment, the method of genetically modifying a cell may comprise modifying an epithelial cell, keratinocyte, beta cell, or cardiac or skeletal myocyte.
Reference to "stably genetically modifying" or "stable genetic modification" is understood to mean stable integration of DNA, mutation, or removal of DNA sequence, for example from the chromosome of the cell. For example, transformed DNA may be integrated into the chromosome, replicated and passed on to generations of the cell.
Advantageously, cells which are proliferating/expanding are more susceptible to stable genetic transfection. Therefore, genetic modifications can be made to cells such as mesenchymal stem cells, which are typically difficult to transform and modify genetically.
The methods of the invention herein may further comprise a second or third transient transformation step (e .g. one or more serial transformations) .
The skilled person will understand that optional features of one embodiment or aspect of the invention may be applicable, where appropriate, to other embodiments or aspects of the invention. Embodiments of the invention will now be described in more detail, by way of example only, with reference to the accompanying drawings.
Figure 1 : Genetic Immortalisation (via Lentivirus) of hMSCs using TERT, E6/7 and SV40T overexpression. A) Primary hMSCs were transduced with TERT, E6/7 or SV40T-expressing lentiviruses which generated a rapid up- regulation in proliferation and population-doubling capacity. B) ihMSC-TERT E6/7 cells retain the ability to differentiate down oestogenic, chondrogenic and adipogenic lineages (Alizerin Red, Alcian Blue and Oil-0 red, respectively). Figure 2: Project Hypothesis: Transient Immortalisation of hMSCs can be achieved using GET delivery of TERT, E6/7 or SV40T RNA. A)
Conventional hMSC culture senesces and yields low cell numbers. Also this long term culture can promote a transformed phenotype. B) Permanent Immortalisation creating ihMSCs yields high cell numbers of genetically modified cells. C) The transient immortalisation process proposed to expand
hMSCs through an immortalised intermediate (Trans-ihMSCs) driven by GET delivery of RNA.
Figure 3: Production of Modified RNAs to direct cell behaviour. A) Initially the genes/factors to be expressed are selected. B) The open-reading frame (ORF) of the gene is isolated incorporating codon changes to optimise human expression. C) The ORF is cloned into an in-house produced vector pEXPRESS which allows the in vitro expression of RNA which contains the human β-actin untranslated regions to enhance translation of protein from the RNA. D) PCR is used to insert a 90 adenosine poly-A tail required for translation and RNA stabilisation. E) T7 polymerase is used to synthesise RNA in vitro incorporating a cap-analogue to improve translation and RNA stability, and modified nucleotides to prevent cell immune response to delivered RNA. F) The synthesised RNA is checked for purity and intactness. G-H) RNA is delivered to cells using the GET system, and the RNA produces the factor protein which affects the cell behaviour (programs the cell) .
Figure 4: Transfection of human mesenchymal stem cells (ihMSCs) using GET. Initially we assessed binding capacity of LK15 peptides for plasmid (p)DNA (SIN GFP, to express GFP on transfection), RNA (modRNA) (to express GFP on transfection) and small-inhibitory (si)RNAs (labelled with FAM fluorophore to detect delivery) . A) Schematic of the GET transfection peptide (P21 -LK 15-8R). B) Delivery of nucleic acid cargoes to hMSCs by GET transfection. After optimising ratios we transfected ihMSCs with P21 -LK15-8R and pDNA ( ^g), modRNA ( ^g) or siRNA ( ^g) and visualised transfection by fluorescence microscopy (scale bar, Ι ΟΟμιη) . (C) Quantification of GET-LK15 transfection of ihMSCs by flow cytometry (% transfection efficiency or relative fluorescence for siRNA) compared to lipofectamine (LIPO)2000 as a commercial standard. Error bars indicate s.d.
Figure 5: Analyses of Trans-ihMSCs (Ana) A) Primary, Genetically, transiently, and post-transiently immortalised hMSCs will be compared. B) Gene expression analyses through Illumina mRNA-Seq, Tri-lineage differentiation, karyotype stability, cell growth and tumorigenicity of the cells will be assessed.
Figure 6 : Transfection of primary human mesenchymal stem cells (hMSCs), long-term passaged (P10) hMSCs and immortalised hMSCs (ihMSCs) using GET or LIPO2000. hMSCs were transfected, long-term hMSCs (P 10) and ihMSCs with P21 -LK15-8R (GET) and pDNA ( 10μ§ of SIN
GFP expressing eGFP) and quantified transfection SCs by flow cytometry (% transfection efficiency) and compared to lipofectamine (LIPO)2000 as a commercial standard. Error bars indicate s.d. pDNA transfections are strongly influenced by proliferation of the cell line transfected. Younger, growing hMSCs (P I) were transfected at low levels, older senescing hMSCs (P 10) have
~ 10-fold less transfection efficiency in comparison. If the same cells are immortalised and induced to grow this resulted in >8-fold increase in transfection efficiency.
Figure 7 P21 improves PTD-mediated transduction, (a) Schematic of the proteins created after screening domains which improve efficiency of protein delivery to cells. mR and mR-8R are described in Fig 1. P21 -mR is mRFP with an N-terminal fusion of the P21 domain of heparin-binding EGF (HB-EGF). P21 -mR-8R is mRFP with Ν-terminal fusion of P21 and C-terminal fusion of 8R. (b) Fusion of
P21 to mR-8R significantly improves transduction into NIH3t3 cells. Fluorescence microscopy images of NIH3t3 cells treated with proteins (20μg/ml) for twelve hours in standard media conditions. Scale bar, Ι ΟΟμιη. (c) P21 -mR-8R transduces efficiently into human and mouse embryonic stem cells (HUES7 and CGR-8, respectively) and human induced pluripotent stem cells (IPS2) and mouse cardiomyocyte cell line HL 1 . Flow cytometry analyses of the mR-8R-inefficiently transduced cell lines treated with proteins mR-8R (20μg/ml) for twelve hours, (d) P21 -mR-8R initially strongly interacts with cell membranes and progressively transduces be localised peri-nuclearly. Fluorescence (top) and confocal laser scanning microscopy (bottom) images of NIH3t3 cells treated with P21 -mR-8R
(20μg/ml) for either 1 hour, 1 hour with washes and a further 5 hours incubation (in serum-free media) or 6 hours treatment. Cells were pre-incubated for 1 hour in serum-free media, transduced for the desired time in serum-free media. Scale bars, 50μιη (top) and Ι Ομιη (bottom), (e) Enhancement of transduction mediated by P21 and 8R are affected by Trypsin proteolysis. Flow cytometry analyses
NIH3t3 cells treated with proteins (2C^g/ml) for 1 hour and a further 5 hour incubation (in serum-free media), with or without l Omin pre-digestion with Trypsin or treatment with non-proteolytic cell dissociation solution (CDS). Cells were pre-incubated for 1 hour in serum-free media, treated with Trypsin and transduced for 1 hour in serum-free media, (f) Cell surface interaction of P21 - containing proteins is disrupted by Tritonxl OO treatment. Flow cytometry analyses NIH3t3 cells treated with proteins (2C^g/ml) for 1 hour and a further 5 hour incubation (in serum-free media) with l Omin pre-treatment of PBS or PBS containing 0. 1 % (v/v) Tritonxl OO (Txl OO). Cells were pre-incubated for 1 hour in serum-free media, treated with PBS or PBS with Tx l OO and transduced for 1 hour in serum-free media. Error bars indicate s.d.
Figure 8 P21 binds directly to Heparin and cell surface HS-GAG. (a) Soluble Heparin in media during transduction inhibits cell membrane interaction and transduction of P21 -containing proteins. Fluorescence microscopy images of
CGR-8 cells treated with P21 -mR-8R (20μg/ml) for 6 hours in serum-free media containing 0 or 50μg/ml Heparin. Scale bar, Ι ΟΟμιη. (b) Flow cytometry analyses NIH3t3 cells treated with P21 -mR-8R (20μg/ml) for 6 hours with or without a variety of GAGs (50μg/ml) in serum-free medium. CS is Chondroitin sulphate. Cells were pre-incubated for 1 hour in serum-free media and transduced for 6 hours in serum-free media with or without GAGs. (c-d) Only high-doses of Heparin inhibit 8R activity whereas P21 activity is inhibited dose-dependently by Heparin in (c) NIH3t3 cells and (d) CGR-8 cells, (e) and (f) Cell surface Heparan sulphate is required for efficient P21 -mediated protein delivery. Heparan sulphates/Heparin-containing FCS inhibits P21 -mediated transduction but can also replace cell surface GAGs and mediate P21 -transduction in cells deficient for Heparan sulphate . Fluorescence microscopy images of CGR-8 cells and EXT1-/- mESCs treated with P21 -mR-8R (20μg/ml) for 6 hours in media containing 0 or 20% FCS . Scale bar, Ι ΟΟμιη. Error bars indicate s.d.
Figure 9 GET / HETD-mediated nuclear delivery of Cre Recombinase. (a) Schematic of the construct created to mark Cre activity in cells. Cre-mediated excision of a transcriptional STOP region flanked by lox? sites induces the constitutive expression of eGFP. Pr, promoter; Gal, β-galactosidase; Neo, Neomycin phosphotransferase. The NIH3t3 LSL-eGFP cell line was created by
transfection and selection of NIH3t3 cells, (b) eGFP expression in untreated NIH3t3 LSP-eGFP cells or those transduced with SIN Cre lentivirus. Left shows fluorescence microscopy and right shows flow cytometry histogram of eGFP expression. Scale bar, 50μιη (c) Scheme of testing transduction of Cre activity in NIH3t3 LSL-eGFP cells. Cells were transduced with Cre proteins for 1 hour, washed and cultured for 2 days before analyses, (d-e) P21 -mR-Cre-8R is efficiently transduced and recombines DNA. (d) Fluorescence microscopy images Cre-transduced NIH3t3 LSL-eGFP with the variety of dosages. Scale bar, 50μιη. (e) Flow cytometry analyses of NIH3t3 LSL-eGFP cells transduced for 1 hour with mR-Cre, mR-Cre-8R and P21 -mR-Cre-8R at a variety of dosages (0, 1 , 10,
100 and 500μg/ml), washed and cultured for 2 days. Graph shows % recombination (i.e. % of eGFP+ve from total cell population) . Error bars indicate s.d.
Figure 10 GET / HETD-mediated delivery of domain position protein variants, (a) Schematic of the proteins created to test the effect of domain position on protein delivery to cells, (b) Fusion of P21 and 8R to mR in any orientation significantly improves transduction. Flow cytometry analyses of NIH3t3 and HUES7 cells incubated with the protein variants (20μg/ml) for twelve hours. Error bars indicate s.d.
Figure 11 GET / HETD-mediated delivery of PTD protein variants, (a) Schematic of the proteins created to test the enhancing effect of P21 on other PTDs for protein delivery to cells. 8R is RRRRRRRR (SEQ ID NO: 19), TAT is HIV- 1 TAT protein RKKRRQRRR (SEQ ID NO: 20), 8K is KKKKKKKK (SEQ ID NO : 56), 8RQ is RQRQRQRQ (SEQ ID NO: 57) (b) Fusion of P21 and any PTD to mR significantly improves transduction. Flow cytometry analyses of NIH3t3 and HUES7 cells incubated with the protein variants (20μg/ml) for twelve hours. Error bars indicate s.d.
Figure 12 GET / HETDs can achieve higher intracellular levels of cargo delivery than transgenic systems, (a) Fluorometry of soluble extracts generated from NIH3t3 mR (transgenic NIH3t3 cells transduced with SIN mR) compared with those from NIH3t3 cells transduced for 6 hours with different doses of mR-8R or P21 -mR-8R (0, 10, 20, 50, 100 or 200μg/ml in serum-free media) (b) Flow
cytometry of NIH3t3 mR (transgenic NIH3t3 cells transduced with SIN mR) compared with those from NIH3t3 cells transduced for 6 hours with different doses of mR-8R or P21 -mR-8R (0, 10, 20, 50, 100 or 20(^g/ml in serum-free media). Fluorescence is normalised to untreated NIH3t3 cells. Error bars indicate s.d.
Figure 13 HERD-mediated Cre Recombinase nuclear activity is promoted by vesicle escape but repressed by inhibitors of macropinocytosis or cholesterol depletion. NIH3t3 : LSL-eGFP cells were pre-incubated in serum-free media (with or without drugs), transduced with Cre proteins (mR-Cre : 100μg/ml or P21 -mR- 8R: 10μg/ml) for 1 hour in serum-free media (with or without drugs), washed and cultured for 12 hours in full growth media (with or without drugs) and a further 36 hours in full growth media before analyses, (a) Methyl- -cyclodextrin (used to deplete cholesterol) inhibits Cre transduction and recombination. (Methyl-β- cyclodextrin doses were 0, 1 2 and 5 mM) . (b) Nystatin (a drug which sequesters cholesterol) inhibits Cre transduction and recombination. (Nystatin doses were 0, 10, 20 and 50μg/ml). (c) Amiloride (a specific inhibitor of Na+/H+ exchanged required for macropinocytosis) inhibits Cre transduction and recombination. (Amiloride doses were 0, 1 , 5 or l OmM). (d) Cytochalasin D (an F-actin elongation inhibitor) inhibits Cre transduction and recombination. (Cytochalasin D doses were 0, 1 , 5 or 10μΜ) . (e) Chloroquine promotes the release of Cre from endosomal vesicles and increases recombination (Chloroquine doses were 0, 10 and Ι ΟΟμΜ). (f) Picogram per millilitre amounts is required to induce recombination with enhanced vesicle escape. The dose of transduced P21 -mR- Cre-8R was varied in ten-fold dilutions (0- 100μg/ml) with 1 hour incubation in the presence of Chloroquine. All data is presented as % of the maximal recombination. Error bars indicate s.d.
Figure 14 GET / HETD-mediated transduction increases general cellular macropinocytosis. Flow cytometry of cells incubated in 70kDa FITC-Dextran and transduced with recombinant proteins. NIH3t3 cells were pre-incubated in serum- free media for 1 hour and transduced with mR, P21 -mR, mR-8R or P21 -mR-8R (20μg/ml in serum-free media) containing 70kDa FITC-Dextran (neutral) for 1 hour. Error bars indicate s.d.
Figure 15 GET of non-protein Cargoes, (a) GET of biotinylated cargoes using monomeric streptavidin (mSA2) . (i) Schematic of the mSA2 proteins engineered to bind to and transduce biotinylated cargoes. P21 -8R was used as a non- interacting control, mSA2 as a non-transducing control, and P21 -mSA2-8R as the test protein, (ii) Schematic of the antibody (Ab) complexes of a biotinylated primary ( ) antibody (Goat anti-rabbit; GtaRb) bound to an FITC-conjugated secondary (2°) antibody (Rabbit anti-mouse; Rb aMu) used to test activity, (iii) GET-delivery of Ab complexes were visible by fluorescence microscopy (scale bar, 50μιη). With co-incubation of P21 -mSA2-8R ( l C^g/ml, bottom image), Ab complexes were efficiency delivered to cells (iv) Flow cytometry demonstrating that 172° Ab complexes ( ^g/ml) are taken into NIH3t3 cells poorly by direct incubation or when co-incubated with mSA2 only, (b) GET of nucleic acids by employing LK15 peptide , (i) Schematic of the LK15 proteins engineered to bind to and transduce nucleic acids, (ii) Transfection of human mesenchymal stem cells (iHMSCs) using GET-LK 15. Initially we assessed binding capacity of LK15 peptides for plasmid (p)DNA (SIN GFP, to express GFP on transfection), modified synthetic messenger RNA (modRNA) (Miltenyi Biotech; to express GFP on transfection) and small-inhibitory (si)RNAs (labelled with FAM fluorophore to detect delivery) . After optimising ratios we transfected iHMSCs with P21 -LK15 - 8R and pDNA ( l (^g), modRNA ( l (^g) or siRNA ( ^g) and visualised transfection by fluorescence microscopy (scale bar, Ι ΟΟμιη) . (iii) Quantification of GET-LK15 transfection of iHMSCs by flow cytometry (% transfection efficiency or relative fluorescence for siRNA) compared to lipofectamine (LIPO)2000 as a commercial standard. Error bars indicate s.d. (c) GET of Magnetic Nanoparticles. (i) Schematic of the P21 -8R peptide synthesised and test magnetic nanoparticles (MNPs). We tested 250nm Nanomag-D dextran shell/iron oxide core MNPs and conjugated P21 -8R peptide to surface COOH groups, (ii) MNPs are taken into NIH3t3 cells most efficiently in serum-free media (SFM; left panel) . Light microscopy images of Prussian blue iron stained NIH3t3 cells treated with MNPs (5C^g/ml) for twelve hours in standard media conditions ( 10% FCS) or SFM. Conjugation of P21 -8R to MNPs significantly increases cellular uptake in both 10% FCS and SFM conditions (circular image is of entire well, scale bar, Ι ΟΟμιη).
Figure 16 Ligand auto-labelling of intracellular and extracellular membrane- anchored HALO proteins, (a) Schematic of the HALO (intracellular) and LAMP2b-HALO (extracellular membrane-anchored) transgenic SIN lentivirus constructs. In LAMP2b-HALO the expressed protein is localised to the cell membrane by the signal peptide (SIG) which is cleaved and presented on the extracellular side of the cell membrane (b) NIH3t3 cells transgenic for intracellular HALO protein (NIH3t3 -HALO) are only efficiently labelled by cell permeant ligands (HALOTAG Oregon Green). NIH3t3 cells transgenic for membrane-anchored extracellular HALO protein (NIH3t3-LAMP2b) is efficiently labelled by both cell permeant and cell impermeant ligands (HALOTAG
Alexafluor488). Data shows flow cytometry of the NIH3t3 cell-lines incubated in ligand ( Ι μΜ) for 15mins, followed by 3 media washes and a 15mins incubation to remove unbound ligand. Error bars indicate s.d. This provides an assay to assess intra- verses extracellular localisation of HALO proteins.
Figure 17 Ligand labelling of GET-HALO proteins demonstrates rapid cell binding and transduction, (a) Schematic of HALO proteins created (as described for mRFP in fig 1) . (b) P21 -HALO-8R and P21 -HALO efficiently bind NIH3t3 cells but do not significantly internalise with a 1 hour incubation, (c) Bound P21 - HALO-8R efficiently transduces into NIH3t3 cells with further incubation ( lh-
5h). Bound P21 -HALO does not as efficiently enter cells and remains bound to cell membrane with further incubation. Data shows flow cytometry analyses of NIH3t3 cells treated with proteins (20μg/ml) for 1 hour followed direct ligand labelling ( lh) or further incubation of 5 hours ( lh-5h). Error bars indicate s.d.
Figure 18 pH-sensitivity of GET-mNectarine (mNect) proteins demonstrates rapid cell binding and transduction, (a) Schematic of HALO proteins created (as described for mRFP in fig 1). (b-c) GET-mNect or GET-mR proteins (20μg/ml) were transduced into NIH3t3 cells for lh (to demonstrate membrane binding activity), lh followed by a further 5h incubation without protein ( lh-5h) (to demonstrate transduction activity) or 6h (to demonstrate sustained delivery) . Flow cytometry was used to compare intensities of mNect and mR GET-proteins. Fluorescence signal from transducing mNect proteins (unlike mR versions) is rapidly lost after internalisation new to endosomal acidification and protein unfolding. Error bars indicate s.d. (d-f) GET-mNect proteins (20μg/ml) were
transduced into NIH3t3 cells for the same regimes but washed in DMEM at pH7.5 or pH5.5 before cytometry. Membrane localised mNect protein fluorescence is extinguished by pH5.5 but is retained at pH7.5 indicating at lh incubations leave P21 -mNect-8R external to cells, bound to membranes and not protected from pH- mediated unfolding. lh-5h incubations demonstrate that P21 -mNect-8R localisation is shifted and protected from pH-mediated unfolding demonstrating internalisation of the protein and protection by the cell membrane. Error bars indicate s.d. Figure 19 GET protein must be delivered intracellularly to allow successful re- transduction (a) Scheme of testing the effect of re-transduction of GET proteins in NIH3t3 cells. Cells were pre-incubated in fresh media for 1 hour and transduced with P21 -mR-8R (2C^g/ml) for 1 hour. Cells were then either analysed for fluorescence or re-transduced with P21 -mR-8R (2C^g/ml) for a further 1 hour. This re-transduction was either immediate (Oh) or with a 1 -6 hour incubation between re-transduction before fluorescence analyses by flow cytometry. Immediate re-transduction is inhibited whereas > 1 hour incubation between transductions allows the most efficient re-transduction of GET-protein. Error bars indicate s.d. * p<0.05.
Figure 20 GET is biocompatible in multiple clinically relevant cell types. Cell lines were transduced with P21 -mR-8R at 20 or 200μg/ml over 24 hours and assessed by trypan blue for cell viability (cell lines were those described in Fig. 1 including rat aortic smooth muscle cells (rSMC) and neonatal cardiomyocytes (rCMs)). Viability remained high in all cell types for both concentrations tested.
Error bars indicate s.d.
Figure 21 A: Prussian blue staining of Nanomag particles incubated with 3t3 cells for 24 hours, B : Iron assay results for the amount of iron per cell after the 24 hour incubation.
Figure 22 Graph showing NIH3T3, CGR-8 and HUES7 cells treated with mRFP conjugated peptides (20ug/ml) for 12h. Flow cytometry analysis was used to quantify fluorescence (relative fluorescence wnits (RFU)) of cells. Error bars indicate s.d, n=3.
Figure 23 Graph showing the increase in transduction of mRFP into cells by modified CPPs (HS-GAG binding domain mRFP 8R) over an unmodified CPP (mRFP 8R) . NIH3T3, CGR-8 and HUES7 cells were treated with mRFP conjugated peptides (20ug/ml) for 12h. Error bars indicate s.d, n=3.
Figure 24 Efficient delivery of mRFP to cells via modified peptides shown to promote GET. Fluorescence microscopy images of NIH3T3, CGR8 and HUES-7 cells treated with P21 mRFP 8R, FGF2B mRFP 8R, FGF7B mRFP 8R and PDGF mRFP 8R peptides (2C^g/ml) for twelve hours. Scale bar, Ι ΟΟμιη.
Figure 25 Optimization of (+/-) charge ratio of P21 LK15 8R to pSIN GFP using YO-PRO- 1 assay. Graph shows a decrease in % of fluorescence as P21 LK15 8R binds pSIN GFP. Error bars indicate s.d., n=3.
Figure 26 Examples of flow cytometry dot plots showing GFP expression of NIH3T3 cells following transfection with pSIN GFP for 6h. Following transfection, cells were fixed at a 48h time-point. Flow cytometry analysis was used to quantify % of GFP positive cells.
Figure 27 Transfection optimization of pSIN GFP into NIH3T3 cells by P21 LK15 8R peptide. Cells were treated with the optimum (+/-) charge ratio of P21 LK15 8R to pSIN GFP of 2: 1 , respectively. Optimization was carried out at varying transfection times (3, 6 and 24h) in (A) 10% serum transfection media (B) serum free transfection media. Following transfection, cells were fixed at a 48h time-point. Flow cytometry analysis was used to quantify % of GFP positive cells. Error bars indicate s.d., n=3.
Figure 28 Graph showing the optimization of the transfection of pSIN GFP into NIH3T3 cells by Lipofectamine2000, in serum free conditions. Flow cytometry analysis was used to quantify % of GFP positive cells. Error bars indicate s.d., n=3.
Figure 29 Transient immortalisation of human MSCs. A) The transient immortalisation process demonstrated to expand hMSCs through a proliferative
intermediate (Trans-ihMSCs) driven by GET or lipid-transfection delivery of RNA5. B) Proof-of-principle that the delivery promotes hMSC growth post-TERT E6/7 or SV40T RNA transfection. C) ihMSCs6 (immortalised by lentivirus expressing TERT & E6/7) remain karyotypically stable and euploid.
Figure 30 Optimisation of RNA transfection and cytotoxicity in hMSCs. A)
The transient transfection of hMSCs is efficient but rapidly lost without serial transfection (bar = l Oum). B) Flow cytometry showing a 3x serial transfections. 2x serial transfection is best to maintain expression and retain cell viability). Arrows show 'Yes' and 'No' for transfected and untransfected, respectively. C)
Transfection remains high after 2 transfections (2x). D) Viability is rapidly lost beyond 2x serial transfections.
Figure 31 Transfection 'resets' cellular senescence and triggers cell cycle in aged human MSCs. A) SA- galactosidase senescence assay shows P 10 cells are mainly senescent, whereas Lentiviral-transduced ihMSCs are not senescent. Transfection of TE6/7 or SV40T RNA using the invention partially 'resets' the senescence of P 10 hMSCs. (arrows show non-senescent cells. Bar = 20um) B) Quantification of senescence 'resetting' by the invention. C) Transfection partially triggers cells to enter cell-cycle (as a function of G2/M cell cycle analyses using PI).
Example 1 There is an unmet clinical need for high numbers of patient-specific cells for cell therapies. The solution is the use of transient immortalisation to expand the small cell population to numbers feasible for cell therapies.
Transgenic systems (like those used in genetic immortalisation for ihMSCs; Fig 2B) have been used for basic research and one example exists in cell therapies (CTX trial of immortalized neural cells for stroke treatment by ReNeuron, UK)7. Stable genetic modification has been used by several studies1. However these cells are not clinically relevant. Transient immortalisation of clinically valuable cells to generate extensive cell numbers (without losing the primary cell phenotype) will be a step change in what is possible using hMSCs in cell therapies. There are many examples of other cell
therapies were large numbers of patient-matched (autologous) cells are required but there is presently no approach to produce them.
Many systems simply rely on conventional culture (Fig 2A), in which slow growing cells are pushed to proliferate by media conditions with progressive slowing of growth and eventual senescence. Most therapies cannot feasibly use patient-derived cells. Therefore most approaches employ heterologous donor cells which require patient immunosuppression and a reduction in efficacy and clinical outcome. Even if the desired numbers of patient-specific cells can be produced then they have been exhaustively manipulated over several weeks/months meaning that spontaneous transformation could result leading to considerable safety concerns2.
Immortalised hMSCs (ihMSCs) have been created by transgenically expressing human telomerase (hTERT) and human papilloma virus E6/7 (HPV E6/7) genes3. These cells grow rapidly, do not senesce and retain multipotent differentiation into bone, fat and connective tissue (Fig 1). Importantly these should not form tumours and have normal karyotype1. These ihMSCs represent an unlimited source of material for transplant, but will not be clinically adopted due to their permanent genetic modification with hTERT/HPV oncogenes. With transient activity of these factors achieved without delivery of DNA, these cells would have a transformative impact on hMSC therapeutic use (Fig 2).
A peptide-mediated delivery system for RNA (Fig 3 & 4) can transiently deliver the activity of any gene4. The delivery mechanism for this technology is termed Glycosaminoglycan-binding Enhanced Transduction (GET) and is described and demonstrated in international patent application No. PCT/GB2014/053764, the content of which is incorporated by reference herein.
GET is used to deliver hTERT and HPV E6/7 activity without genetic modification to hMSCs. This yields proliferative, karyotypically normal cells (trans-ihMSCs) which can be expanded. Upon GET removal, cells return to their original phenotype but with vastly amplified numbers (Fig 2C). This technology can therefore be directly applied to clinical research allowing transformative patient-specific cell therapy approaches that would not presently be achievable .
Example 2
GET intracellular delivery system
Protein transduction domains (PTDs) are powerful non-genetic tools that allow intracellular delivery of conjugated cargoes to modify cell behaviour. Their use in biomedicine has been hampered by inefficient delivery to nuclear and cytoplasmic targets. This deficiency is overcome by a fusion protein that couples a membrane docking peptide to heparan sulfate glycosaminoglycans (GAGs) with a PTD (termed GAG-binding Enhanced Transduction (GET)).
This GET (GAG-binding Enhanced Transduction) system can deliver enzymes (Cre, neomycin phosphotransferase), transcription factors (NANOG, MYOD), antibodies, native proteins (Cytochrome-C), magnetic nanoparticles (MNPs) and nucleic acids (plasmid (p)DNA, modified (mod)RNA and siRNA) at efficiencies of up to two- orders of magnitude higher than previously reported in cell types considered hard to transduce, such as mouse embryonic stem cells (mESCs), human ESCs (hESCs), induced pluripotent stem cells (hiPSCs) and human mesenchymal stem cells (hMSCs).
Delivery of RNAs (Fig 3 & 4) using GET temporarily produces a proliferative phenotype in clinically-relevant cells which are hard and slow to expand to sufficient numbers for human cell therapies.
Immortalised hMSCs retain differentiation capacity, are non-tumorigenic and proliferate
Immortalised hMSCs (ihMSCs) were created by over-expressing oncogenes from lentiviruses in primary cells (TERT and HPV E6/7 or SV40T) (Fig 1A). These are robustly proliferating cell lines which also retain the differentiation of the primary hMSCs (Fig IB). The technological advantages afforded by the GET system (which is non-toxic, can be used in serum-containing systems and does not affect cell proliferation) is used to immortalise primary hMSCs by delivering RNAs for the TERT, E6/7 or SV40T genes.
Modified Synthetic RNA production to regulate gene expression stoichiometrically
A major technological improvement to the approach of RNA transfection was detailed in a recent study4. RNA can be synthetically made using modified nucleotides and cap analogues which express well in human cells, are not cytotoxic and do not generate a cellular immune response (Fig 3). RNA is not stability inherited unlike integrated DNA and is more efficient at producing a translated protein product as it is translated in the cytosol rather than needing transcription in nuclei like delivered DNAs.
An important benefit of using RNA delivery verses DNA is that RNA does not integrate into the host cell genome and that it is rapidly turned-over meaning that protein-expression from it is transient. RNA can be delivered daily to create a situation of constant protein expression and simply ceasing the delivery results in no further protein-expression. Therefore the level and duration of the expressed protein' s activity can tightly and stoichiometrically controlled. GET of immortalisation RNAs to transiently proliferate hMSCs:
Creation of Tran-ihMSCs
In this example the efficient, non-toxic and serum-resistant GET transfection system was used to express immortalisation factors in primary hMSCs to promote their proliferation. This is temporary and once GET delivery is stopped, proliferation will return to normal levels but have yielded a significantly larger population of cells that could be used for therapies.
If this approach is indeed to be clinically useful then we must prove a number of attributes that cells have post-processing. They should return to normal primary cell behaviour and essentially be identical to the starting cell-type. They should not form tumours, they must still have the same differentiation capacity, they should not contain any proportion of genetically unstable or mutated cells. It is important that the process is an immortalisation which is reversed, and is not a transformative process. Given that ihMSCs genetically-expressing TERT E6/7 are not transformed, are euploid and do not form tumours in mice1 this approach will yield similar attributes in the resulting cells. References
Okamoto, T., Aoyama, T., Nakayama, T., Nakamata, T., Hosaka, T., Nishijo, K., Nakamura, T., Kiyono, T. & Toguchida, J. (2002). Clonal heterogeneity in differentiation potential of immortalised human mesenchymal stem cells. Biochem. Biophys. Res. Com. 295:354-361
Jin, H.J., Bae, Y.K., Kim, M., Kwon, S-J., Jeon, H.B., Choi, S.J., Kim, S.W., Yang, Y.S. Oh, W. & Chang, J. W. (2013). Comparative Analysis of Human Mesenchymal Stem Cells from Bone Marrow, Adipose Tissue, and Umbilical Cord Blood as sources of Cell Therapy. IJMS. 14: 17986-18001.
Saeed, A., Francini, N., White, L., Dixon, J. E., Gould, T., Rashidi, H.„ Cheikh Al Ghanami, R., Hruschka, V., Redl, H., Saunders, B. R., Alexander, A. & Shakesheff, K. M. (2014). A Thermoresponsive and Magnetic Colloid for 3D Cell Expansion and Reconfiguration. Advanced Materials. 27(4):662-8
Warren, L., Manos, P. D., Ahfeldt, T., Loh, Y-H., Li, H., Lau, F., Ebina, W., Mandal, P. K., Smith, Z. D., Meissner, A., Daley, G. Q., Brack, A. S., Collins, J. J., Cowan, C, Schlaeger, T. M. & Rossi D. J. (2010). Highly efficient reprogramming to pluripotency and directed differentiation of human cells with synthetic mRNA. Cell Stem Cell. 7(5):618-630.
Dixon, J.E., Dick, E., Shakesheff, K.M. & Denning, C. (2011). Directed differentiation of human embryonic stem cells to interrogate the cardiac gene regulatory network. Mol. Therapy. 19(9): 1695-703
Dixon, J.E., Shah, D.A., Rogers, C, Hall, S., Weston, N., McNally, D., Denning, C. & Shakesheff, K.M. (2014). Combined hydrogels that switch human pluripotent stem cells from self-renewal to differentiation. PNAS. 111(15):5580-5
CTX Neural Stem Cell Clinical trial. ReNeuron. http://www.reneuron.com/clinical- trials.
Example of the GET system
Results
Isolation of P21, a HBD that enhances PTD function through HS-GAG interaction
Several short peptides were screened which have been reported to interact with molecules known to be present on mESC, HESC or HiPSC membranes including integrins, CD markers and GAGs. Peptides were fused N-terminally to mRFP l , expressed, affinity purified and incubated with the three cell-types. Screening of 12 variants yielded one which clearly increased localisation of mRFP l -fluorescence (mR) to cells and their membranes, termed P21 (KRKKKGKGLGKKRDPCLRKYK (SEQ ID NO: 1)) (Fig 7). Interestingly this peptide also demonstrated transduction activity as evidenced by punctate intracellular fluorescence indicative of endosomal localisation (Fig 7b, c). P21 was derived from HB-EGF, which belongs to the EGF family of cytokines. HB-EGF shows a strong affinity to heparin and binds to the same receptor as EGF and TGF-a { Sakuma, 1997 #76} . The interaction of HB-EGF with cell surface HS-GAG is essential for its optimal binding to EGFR and for promoting its growth/migratory activity toward vascular smooth muscle cells {Higashiyama, 1993 #90} . Mutagenesis and protease digestion of recombinant HB-EGF, coupled with analyses using synthetic peptides and heparin, revealed the P21 sequence in the amino-terminal region of the soluble HB-EGF is responsible for its binding to heparin so is considered a typical HBD {Thompson, 1994 #77} . In addition, P21 also interacts with cell surface HS-GAG but not the EGFR which is mediated by other sequences in HB-EGF. Therefore, a short 21 -residue peptide, P21 , was isolated, which enhances the association of a fluorescent reporter to both mouse and human pluripotent stem cells. P21 -mediated binding of cell membranes was tested to determine if it could enhance PTD-mediated transduction of mR by combining both moieties in one molecule (Fig 7a). P21 -mR-8R was cloned, expressed and purified, and its activity compared to P21 - only (termed P21 -mR) or 8R-only (mR-8R) proteins (Fig. 7a). Data demonstrated that the inclusion of both P21 - and 8R- moieties synergized in the same protein to significantly enhance the fluorescence of all cell-lines tested. (Fig. 7b). Importantly mouse and human pluripotent stem cells (CGR-8, HUES7 and IPS2) and cardiomyocytes (HL 1) only transduced efficiently with the inclusion of P21 -tag, and both tags synergized to produce the high-levels of transduction similar to that seen in other cell lines (Fig. 7c) . These motifs were also placed in tandem at N- and C- terminal of mRFP (P21 or 8R first; P21 -8R-mR, 8R-P21 -mR or mR-P21 -8R, mR-8R-
P21 ) or switched their termini (i .e . 8R-mR-P21 ) with all variants demonstrating similar synergy and cell transducing behaviour (Fig 10) as seen for P21 -mR-8R. Furthermore 8R was swapped for alternative well characterised PTDs (TAT, 8K and 8RQ ; { El-Andaloussi, 2005 #36 } ) and showed that these also synergized with P2 1 (Fig 1 1 ) .
By incubating cells with protein for different timings and including a post-culture period it could be efficiently distinguished between fluorescence signal produced at the cell surface with that internalised (Fig . 7d) . Cells demonstrated membrane localisation of fluorescence with short incubation times ( 1 hour), termed lh. With this short incubation and a subsequent culture period ( 1 hour with a 5 hour post-culture), termed l h-5h we observed near exclusive intracellular fluorescence indicating transduction. Using longer incubation times (6 hours), termed 6h, cells exhibited strong punctate peri-nuclear fluorescence indicative of endosomal-mediated transduction. This synergistic delivery mechanism is described as GAG-binding enhanced transduction (GET) or otherwise Heparan-sulfate enhanced transduction domain (HETD)-mediated delivery.
GET requires the presence of trypsin-sensitive and detergent-soluble cell membrane molecules
To evaluate the mechanism of GET interaction and uptake by cells, a series of experiments were performed which were previously used to assess PTD . To assess which cell membrane components are required for both initial cell association and transduction by HETDs it was determined whether similar transduction would be obtained by enzymatic depletion of cell membrane before transduction. Cells were pre-treated with proteolytic enzyme trypsin and tested cell transduction using the l h-5h regime protocol. Enzymatic removal of cell-surface proteins potently inhibited GET / HETD-mediated transduction (~8.4-fold; /X0.05) (Fig 7e) . In contrast, non-enzymatic release of cells from the culture plastic using ionic cell dissociation solution (CDS) did not alter HETD-mediated uptake .
Next it was tested if depletion of detergent-soluble cell-membrane molecules would also have a similar effect on transduction. Cells were pre-incubated in 0. 1 % (v/v) Triton X- 100 and using the l h-5h protocol a decrease (~2.2-fold; p<0.05) was observed in GET (Fig 7f) without a decrease in viability. Therefore, it was
demonstrated that both protein and detergent soluble moieties on the cell membrane affect the efficacy of protein transduction through P21 - and PTD- synergy in GET / HETD-transduction. GET generates higher intracellular protein levels than Lentiviral transgenesis
Several studies have concluded that PTD-mediated transduction is sufficiently refined to allow the transport of biologically active cargos for clinical studies. These now include trials of cancer therapies {Gump, 2007 #39} , siRNAs {Meade, 2007 #37} and in vivo imaging technologies {Bullok, 2006 #79} . As well as the benefits of avoiding genomic modification, if PTD-mediated transduction is to be preferential to gene- therapy approaches it must achieve the delivery of high-levels of molecule, be amenable to control of protein levels over short time-frames and also allow cell-type specific delivery. The levels achieved in cells by PTD- or GET / HETD-delivery were compared to those achieved by efficient lentiviral transduction {Dick, 201 1 # 10} and exogenous expression of mRFP l (with stable EF l a-promoter driven) (Fig 12). To achieve this soluble protein was extracted from transduced cells and measured amounts by fluorometry (Fig 12a), or flow cytometry was used (Fig 12b). Using 6 hour incubations, mR-8R levels were several times lower (~3-fold; ><0.05) than that achieved by viral transgenesis even at the highest tested doses (200μg/ml). However P21 -mR-8R levels under the same conditions were ~ 16-fold higher ( ?<0.001) than transgenic cells. Importantly of the amount of P21 -mR-8R protein incubated a significant proportion was recovered as soluble intracellular protein (~46±3.5 μg/200μg used; ~23± 1.7% recovery). It is important to note that under these conditions transduced cells appear red/purple in colour under normal light, demonstrating the efficient enrichment of large quantities of HETD-tagged / GET proteins in cells.
The rate at which these proteins were concentrated in cells was investigated by measuring the depletion of fluorescence in media over the incubation period. Proteins were diluted (20μg/ml) and incubated with cells for 12 hours in serum-free conditions. 8R-tagged proteins were depleted by - 12% in NIH3t3 - and -3.5% in HUES7- incubations. This precisely mirrors flow cytometric data with 8R-proteins poorly transduced into HUES7 cells but at moderate levels in NIH3t3 cells (Fig 7). P21 - tagged proteins were significantly depleted in both cell types (-37% and -25% in NIH3t3 and HUES7 cells, respectively; ><0.05) with HETD-proteins depleted from
media to the highest levels and maj ority of protein removed (-72 and -66% in NIH3t3 and HUES7 cells, respectively; p<0.0 \ ) .
The time required to deplete half of the fluorescence (TV2) was determined, with P21 - mPv-8R requiring only -9.4 hours, in comparison to mR-8R which required -62 hours and untagged protein never achieving half-depletion even after 7 days . These data are corroborative with the cytometric data proving a rapid and efficient enrichment of exogenous GET-protein/HETD-protein into cells. Therefore, it was demonstrated that within a relatively short incubation period (6 hours) that a significant protein concentration can be achieved within cells. In less than a day, the maj ority of extracellular protein has been effectively internalised using GET delivery. This system will be amenable to precise regulation of protein stoichiometry, while avoiding the stochastic transgene expression variation and silencing of integrating vectors used in gene-therapy approaches .
GET enhances Cre-mediated genome modification
It was determined that HETDs bind rapidly to cell membranes through HS-GAGs and transduce efficiently into cells, but it was yet to be confirmed if the mode of uptake was through macropinocytosis as for PTDs . Also, what proportion of this protein escaped endosomes and may be considered successfully delivered was not assessed. Previous studies have the avoided issues associated with direct measurement of fluorescent-tagged proteins (such as being unable to distinguish membrane, vesicle or functional cytosolic/nuclear protein) by assaying for the successful nuclear activity of Cre recombinase {Gump, 2010 #2 } . This system was used to measure Cre-mediated recombination of a /oxP-STOP-/oxP (LSL) enhanced green fluorescent protein (eGFP) reporter gene in live NIH3t3 mouse fibroblast cells (NIH3t3 : LSL-eGFP cells) as an indicator of cellular uptake (Fig 9a) . This system is rigorous as activation of green fluorescence requires exogenous Cre protein to enter the cell, undergo nuclear- translocation and excise the LSL fragment of the transgene . This must occur in live cells and be non-toxic for the subsequent expression of eGFP . However, this process requires only one functional Cre recombinase molecule to be delivered to activate eGFP so does not allow the determination of the precise amount of cargo delivered. To overcome this issue Cre proteins were delivered at limiting dilutions for a short exposure time ( 1 hour) and the minimum dose required to activate green fluorescence after 48 hours (Fig 9c) was determined.
Transduction of NIH3t3 : LSL-eGFP cells with SIN Cre lentiviruses to overexpress Cre transgenically led to near complete (92±6%; ><0.001) activation of eGFP- expression in all cells confirming the utility of this system (Fig 9b). The benefits of the fluorescence system and delivered fluorescent-versions of Cre-recombinase protein were retained by purifying proteins with mRFPl cloned to the N-terminal of Cre cDNA. Treatment of NIH3t3 : LSL-eGFP cells with mR-Cre (mRFP fused to Cre) resulted in recombination and eGFP activation (22. 1±6.7%; ><0.05) at the highest doses (50C^g/ml) (Fig 9d). eGFP activation was inhibited at 4°C and negatively affected by serum concentration-dependently. mR-Cre-8R demonstrated that the 8R PTD enhanced functional delivery of Cre (~22-fold; /J><0.01).
The GET-protein / HETD-protein, P21 -mR-Cre-8R, required as little as one minute incubation with cells at a low dose ( ^g/ml) to elicit recombination (4.3±2.5 %; ><0.05) confirming that binding and internalization is an efficient and rapid process. For a moderate dose ( l C^g/ml) GET/ HETD-transduction achieved a functional delivery ~ 15-fold (/?<0.01) above PTD only levels and completely recombined all NIH3t3 : LSL-eGFP cells (Fig 9d,e). Importantly this activity was ~340-fold better than mR-Cre (/?<0.001). Heparinase III, free-heparin and serum-free experiments were repeated using the Cre recombination system. It was confirmed that heparinase III pre- treatment reduced recombination to basal-levels and that media serum plays a role in replenishing cell membrane GAGs depleted by heparinase . Overall these data correlate well with the fluorescence delivery conclusions and show synergy between P21 - and PTD- moieties to achieve significant increases in functional transduction of protein cargo.
GET protein enters cells by lipid raft macropinocytosis
Previously it has been shown that PTD-mediated internalization is via macropinocytosis rather than other endocytotic pathways {Wadia, 2004 #25 } . It was next determined whether the cellular uptake of GET-proteins / HETD-proteins occurs through a specific endocytotic pathway employing the Cre assay system. Removal of cholesterol from the cell plasma membrane disrupts several lipid raft-mediated endocytotic pathways, including caveolae and macropinocytosis {Anderson, 1998 #29; Nichols, 2001 #30; Liu, 2002 #28 } . NIH3t3 : LSL-eGFP cells treated with methyl-β- cyclodextrin and nystatin were used to deplete or sequester cholesterol, respectively,
then transduced HETD-tagged proteins. Both methyl- -cyclodextrin (Fig 13a) and nystatin (Fig 13b) disruption of lipid rafts resulted in a dose-dependent inhibition of functional delivery. These data demonstrates that GET / HETD-mediated transduction specifically requires lipid raft-mediated endocytosis.
Macropinocytosis is a rapid, lipid raft-dependent and receptor-independent form of endocytosis which requires actin membrane protrusions that envelope into vesicles termed macropinosomes {Nichols, 2001 #30; Liu, 2002 #28; Conner, 2003 #22} . To confirm macropinocytosis was indeed the endocytotic mechanism of HETD-mediated transduction cells were pre-treated with macropinocytosis-inhibiting compounds (Fig. l la,b). Amiloride is a specific inhibitor of the Na+/H+ exchange required for macropinocytosis {West, 1989 #3 1 } . Cytochalasin D is an inhibitor of F-actin elongation which is required for macropinosome-linked membrane protrusions { Sampath, 1991 #32} . Amiloride and Cytochalasin D did not disrupt cell binding of HETD-proteins but resulted in a dose-dependent reduction of functional transduction into cells (Fig 13c and 13d, respectively). These data confirm that P21 enhances the macropinocytotic pathway used by PTD to internalize cargo molecules.
GET-delivery promotes general macropinocytosis
The effects of GET-binding / HETD-binding on the induction of macropinocytosis was investigated. PTD-mediated transduction has previously been shown to promote the uptake of other proteins by an increase in the overall level of macropinocytosis {Wadia, 2004 #25 } . Cells were incubated with a fluorescent fluid-phase macropinocytotic maker, FITC-labeled 70kDa neutral dextran, in combination with GET / HETD protein, P21 -mR-8R (Fig. 14). Other studies {Oliver, 1984 #24; Araki, 1996 #23 ; Wadia, 2004 #25 } have demonstrated that neutral dextrans are taken up by amiloride-sensitive macropinocytosis. P21 -mR-8R induced a significant dose dependant increase in fluid-phase dextran uptake over steady-state control levels. PTD-tagged versus GET / HETD-tagged activity to stimulate this macropinocytosis was compared. P21 -mR-8R enhanced FITC-dextran uptake ~2.5-fold (p<0.05) over the stimulation achieved by the same concentration of mR-8R demonstrating that engagement with HS-GAG through P21 and its subsequent effect on PTD-mediated transduction stimulates macropinocytotic uptake .
Significant amounts of GET-delivered protein is trapped in Endosomes which can be efficiently released with Chloroquine
The maj ority of PTD-delivered molecules remain trapped in macropinosomes even after further incubation indicating that release from these vesicles is inefficient. If fine-tuned and graded amounts of delivery are to be controlled then it would be beneficial if the maj ority of internalized protein could be considered as functional . Cells were treated with chloroquine, an ion-transporting ATPase inhibitor that disrupts endosomes by preventing their acidification { Seglen, 1979 #33 } (Fig . 13e) . Similar doses have been demonstrated to significantly improve the functional delivery of PTD-delivered proteins {Wadia, 2004 #25 } . Sub-cytotoxic doses of Chloroquine ( Ι ΟΟμΜ) resulted in a marked increase (95.3±4.8 -fold; p<0.00 \ ) in functional HETD- tagged / GET protein delivery at a sub-threshold dose (0. ^g/ml) indicating that this is point in the pathway is still a maj or issue to resolve for GET/HETD medicinal application. Nevertheless the GET-delivery / HETD-delivery system was so efficient that with chloroquine treatment we achieved significant and measureable levels of recombination (4.8±2.9%; p<0.05) with short ( 1 hour) incubations of > 10pg/ml (Fig 13f) . Combination of GET / HETD-delivery efficiency with endosomal-escape technologies may therefore allow precise and temporally controlled amounts of cargo function in cells .
GET-mediated internalisation is efficient after cell membrane association
Even for incubations using low amounts of GET-protein functional quantities of protein activity were observed within cells. However, to categorically and stringently prove that most GET protein was indeed efficiently internalising a series of analyses was conducted using reporters that are responsive to their cellular or extracellular localisation. HALO (HaloTag) was used, which is a self-labelling protein derived from DhaA 29. HALO rapidly forms a covalent attachment to synthetic chloroalkane-based ligands; with cell permeant and impermeant ligands available . Intra- versus extracellular labelling of HALO was confirmed using transgenic over-expression of untagged HALO (for intracellular) and LAMP2b-HALO which is presented on the external cell membrane (for extracellular) and labeling with cell permeant (HALOTAG Oregon Green) or impermeant (HALOTAG Alexafluor488) ligands (Fig 16) . GET-HALO proteins were constructed and recombinantly expressed (Fig 17a) and delivered them to cells testing the the internalisation by sensitivity to labelling with the cell impermeant ligand. One hour incubation demonstrated that GET-proteins remained
mainly extracellularly localised and attached to the cell membrane (Fig 17b) . However, with further incubation ( lh exposure with 5h further incubation; lh-5h) GET-protein (P21 -HALO-8R) is effectively internalised (remaining cell permeant ligand-sensitive but impermeant ligand-insensitive) (Fig 17c) . These experiments were repeated using the mNectarine (mNect) variant of RFP which is pH-sensitive and loses almost all fluorescence in environments <pH6 0 (Fig 18). In agreement with HALO transduction, mNect remained mostly membrane localised after 1 h and its fluorescence sensitive to acidic pH media incubation (pH5.5) (Fig 18 d). After further incubation post-delivery ( lh-5h) GET-mNect fluorescence was no longer sensitive to extracellular pH (Fig 18e); however interestingly the absolute fluorescence levels were significantly decreased when compared to GET-mR, presumably due to the internal pH change the protein is experiencing during endosomal acidification \ These data demonstrates that GET protein membranes association is rapid and transduction is efficient post-cell binding. It was hypothesised that membrane clearance of GET- protein could be a rate-limiting step in the delivery process and this was tested by undertaking multiple transductions ( lh) of GET-mR varying the time between transductions (Fig 19a). Indeed re-transduction directly after the initial transduction decreases the effectiveness of the second transduction however as little as 1 h between new transductions is required to obtain a maximal efficiency of re-transduction (Fig 19b).
Experimental Procedures
Expression and Purification of Recombinant Proteins
cDNA was obtained for mRFPl (mR) as a kind gift from Prof. R. Y. Tsien (University of California, USA) { Campbell, 2002 # 12} . 8R, TAT, 8K, 8RQ, P21, Cre, NANOG, MYOD and NEO cDNAs were synthesized de novo (Eurofins MWG Operon). cDNAs were cloned into the pGEX6-P l expression vector (Novagen) to create in-frame fusions and expressed proteins in BL21 (DE21) pLysS Escherichia coli (Novagen). Exponentially growing LB cultures (OD60o = 0.4) shaken at 220rpm at 37°C were induced using 1 mM IPTG for 24 hours at 25 °C. Bacterial pellets were lysed and sonicated (7 amplitudes, 1 minute, 5 times) in IX STE extraction buffer (50 mM Tris, pH 7.5, 150 mM NaCl, 1 mM EDTA containing ImM DTT, 0.2 mg/ml lysozyme, and IX protease inhibitor cocktail) . Insoluble protein was retrieved using the Rapid GST inclusion body solubilisation and renaturation kit (AKR- 1 10; Cell Biolabs, Inc., San Diego, CA). Recombinant proteins were purified by affinity chromatography using
Glutathione-Sepharose resin (GE Healthcare). GST-tags were removed and eluted from resin by PreScission™ Protease cleavage (GE healthcare) in IX cleavage buffer (50 mM Tris-HCI pH 7.0, 150 mM NaCl, 1 mM EDTA and 1 mM DTT) . Protein concentration was determined using a BCA-based protein assay (BioRad) with absorbance measured at 595nm using recombinant mR protein as a standard. Integrity and full-length protein expression was confirmed by SDS-PAGE. The fluorescence of recombinant proteins (excitation: 584 nm; emission: 607 nm) was determined with all preparations < 10% intensity difference between samples (fluorescence^g). Standards and samples were analysed using the TECAN infinite 200PRO multimode reader. Aliquots were stored at -80°C.
Cell Culture
NIH3T3 mouse fibroblast cells, HEK293T human embryonic kidney cells, C2C 12 mouse myoblast cells, iHMSC immortalised human mesenchymal stem cells (created as described {Okamoto, 2002 #8 } ) and MEF murine embryonic fibroblasts (harvested as described {Anderson, 2007 #9}) were maintained in DMEM with 10% (v/v) fetal calf serum (FCS; Sigma) media supplemented with 2mM L-glutamine, l OOunits/ml penicillin and 100μg/ml streptomycin). CGR-8 mouse embryonic stem cells (mESCs) and EXT1-/- mESCs (a kind gift from Dr. D. E. Wells, University of Houston, USA; {Lin, 2000 #78 }) were maintained in DMEM, 20% (v/v) FCS, l OOOunits/ml leukaemia inhibitory factor (LIF), non-essential amino acids, Ι ΟΟμΜ β-mecaptoethanol (Sigma) 2mM L-glutamine, l OOunits/ml penicillin and 100μg/ml streptomycin). HL 1 mouse cardiomyocyte cells were maintained as described {Claycomb, 1998 #7} . HUES7 human embryonic and IPS2 induced pluripotent stem cells were cultured as previously described {Dick, 201 1 # 10} . HUES7fib human fibroblasts derived from HUES7 cells were generated and cultured as previously described {Dick, 201 1 # 10} . All cells were cultured at 37°C under 5% C02.
Flow Cytometry and Microscopy
For flow cytometry, cells were trypsinized (unless otherwise stated), fixed in 4% (w/v) PFA, resuspended in PBS (pH7.5) and analysed on a MoFlo™DP (DAKO) Flow Cytometer using a 488nm green laser. (50,000 cells; gated on live cells by forward/side scatter). Median fluorescence was used for statistical analyses with background from unlabelled/transduced cells subtracted and values taken as ratios to the experimental control. Data shown are three experiments of triplicate samples. For
microscopy, cultures were rinsed twice with PBS and imaged with inverted fluorescence microscope (Nikon Eclipse TS 100) .
Fluorescence Delivery Assay
For testing multiple cell lines we plated 2x 105 cells/well (in 12-well plates) onto the surface relevant to the tested cell line, attached cells for 2 hours and transduced with recombinant proteins in cell-type specific growth media. After transduction cells were washed with PBS, trypsinized and fixed in 4% PFA for flow cytometry. For membrane localization, intracellular localisation or both we plated cells as above, but cultures pre-incubated in serum-free media for 1 hour before transduction. Membrane localization to assess cell interaction was achieved by a short transduction of 1 hour in serum-free media. Intracellular localization to assess transduction efficiency was achieved by a short transduction of 1 hour followed by 5 hour incubation in serum- free media only. Cell association (membrane and intracellular levels) were assessed by transducing cells for 6 hours in serum-free medium. For flow cytometry cells were trypsinized, washed and fixed in 4% PFA and for microscopy cells were imaged live after washing in PBS. For trypsin depletion of cell-surface proteins, cells were treated with trypsin/EDTA (Invitrogen) or EDTA-based cell dissociation solution (CDS) (Sigma) for 15 minutes at 37 °C, followed by washes with PBS and IX soybean trypsin inhibitor ( 10 mg/ml in PBS; Sigma) . Cells were then treated with proteins for 1 hour at 37 °C in serum-free medium. For detergent depletion of cell membranes, cells were treated with PBS (pH7.5) containing 0. 1 % (v/v) Triton-X l OO (Txl OO) for 10 minutes at 37 °C, followed by washes with PBS. Cells were then treated with proteins for 1 hour at 37 °C in serum-free medium. For GAG-treatment cells were pre- treated with GAGs in DMEM without serum before transduction and were included in the transduction media. This included heparin and chondroitin sulphate A, B and C
Total delivered Protein Analyses
5 x 106 NIH3t3 cells were plated (in T25 flasks), pre-incubated cells in serum-free DMEM for 1 hour, and transduced them with mR-8R or P21 -mR-8R (0-20(^g/ml; 1 ml volume) in serum-free DMEM for 6 hours. NIH3t3 cells transduced with SIN-mR lentiviruses were used as a control for the levels achieved by transgenic systems {Dixon, 201 1 # 15 ; Dick, 201 1 # 10} . Cells were harvested by trypsinization, fixed in 4% PFA for flow cytometry or washed several times in cold PBS with soluble
protein extracted in cold HKM buffer (20mM HEPES, pH 7.5, 5mM KC1, 0.5 mM MgCl2 and 0.5 mM DTT with IX complete EDTA-free protease inhibitor cocktail) for fluorometry {Medina, 2000 # 14} . Extracts were sonicated, centrifuged and NaCl added to yield a final concentration of l OOmM prior to analyses. Fluorometry was used to compare soluble extracts with purified mRFP protein diluted in HKM buffer with l OOmM NaCl as standards. Flow cytometry was used to assess total delivered protein in intact cells.
Media depletion Assessment
2 x 106 NIH3t3 cells or HUES7 HESCs were plated (in 6-well plates), pre-incubated cells in serum-free DMEM for 1 hour, and transduced with recombinant proteins (20μg/ml; 1 ml volume) in serum-free DMEM for 12 hours. Media was harvested and fluorometry was used to compare the remaining fluorescence in media verses that before cell-incubation. Fluorescence of media pre-incubation was assigned as 100% fluorescence units and background of serum-free media subtracted.
Heparin-binding assay, Heparinase treatment and depletion of P21-binding molecules from Serum
For Heparin binding activity we incubated 1ml of recombinant proteins (20μg/ml) in DMEM with 50μ1 of PBS-washed Heparin-sepharose beads (Sigma) for 1 hour at 37°C shaking at l OOrpm. Media pre- and post-incubation was compared by fluorometry. For Heparinase treatment, we plated NIH3t3 cells at 2 x 105/well (in 12-well plates) and were pre-incubated in serum-free media for 1 hour with Heparinase III (0- 1 U/ml) or Heparin (0-50μg/ml). Cells were then washed and transduced with mR or P21 -mR-8R (20μg/ml in serum-free media or media with different FCS concentrations) containing Heparinase III or Heparin for 12 hours. FCS was depleted of P21 -binding material by affinity chromatography. This was achieved by incubating 50 ml FCS with 2 ml Glutathione-Sepharose resin (GE Healthcare) pre-absorbed with GST-P21 protein expressed in Escherichia coli.
Macropinocytosis Assessment
To measure the effects of protein transduction on general macropinocytosis, cells were incubated with 100μg/ml FITC-70kDa neutral dextran (Sigma), along with different recombinant proteins (0- 10μg/ml) for 1 hour at 4°C or 37°C. Cells were trypsinized and washed in PBS before analyses by flow cytometry.
Cre Recombination Assay
To measure Cre Recombinase activity the NIH3t3 : LSL-eGFP cell line was created using the pZ/EG plasmid transfection and G-418 selection {Novak, 2000 #6} . To confirm Cre activity efficiently led to recombination and eGFP activation cells were transduced with SIN-Cre lentiviruses (as described in Dixon et al. 201 1) and >95% of cells were confirmed eGFP-positive 48 hours post-transduction. 2 xl O5 cells/well were plated (in 12-well plates), pre-incubated them in DMEM without serum for 1 hour and treated with Cre proteins (0-500 μg/ml) in DMEM without serum. After the Cre incubation cells were trypsinized, replated into complete media and incubated for 2 days. Cells were pre-treated with drugs for the stated time-period in DMEM without serum, were included in Cre-transduction medium and were added after replating. Pre- treatments included: heparin (0-50 μg/ml), chondroitin sulphate A, B and C (0-50 μ /πιΙ), chloroquine (0- Ι ΟΟμΜ), cytochalasin-D (0- 10 μΜ), amiloride (0-5 mM), methyl- -cyclodextrin (0-5mM), and nystatin (0-50μg/ml). After incubations cell were trypsinized, washed, fixed in 4% PFA and % recombined cells was determined by flow cytometry. For mR-Cre-8R and P21 -mR-Cre-8R comparisons concentrations of 100μg/ml and 10μg/ml were used, respectively and data was expressed as % maximum recombination (i.e. the % relative to the maximum recombination achieved at the stared dose of Cre) .
Antibody, Nucleic acid and Nanoparticle delivery
Biotinylated-Goat anti-Rabbit and FITC-Rabbit anti-mouse antibodies (Sigma), pSIN- GFP (Dixon et al. 2014), modified nucleotide RNA (modRNA) for GFP (Miltenyi Biotech) and FAM-labelled siRNA against GAPDH (Sigma), and nanomag-D (250nm) (MircoMod) were complexed with GET-proteins or -peptides and added to cells. For antibodies complexes were allowed to form in growth media for 20mins before cell addition. For nucleic acids a 2: 1 peptide :nucleic acid charge ratio was used for complexation. GET- or LIPO2000 (lipofectamine 2000; Invitrogen) transfection used 10μg or 1 μg nucleic acid per transfection of 100,000 hMSCs in 12 well plates. GET- peptide substituted LIPO2000 following the exact manufacturer's instructions. For MNPs, a final concentration of 25 μΜ peptide was used in an EDAC/NHS reaction using 2mg MNPs according to manufacturer's instructions. Prussian blue was carried out using potassium ferrocyanide (2.5% w/v) in 2.5% w/v HC1.
Statistical Analysis
Statistical comparisons were carried out using the GraphPad Prism software package. Comparisons were made using Tukey-Kramer analysis of variance (ANOVA). Results were considered significant if p<0.05.
Gump JM & Dowdy SF (2007) TAT transduction: the molecular mechanism and therapeutic prospects. Trends in molecular medicine 13(10):443-448.
El-Andaloussi S, Holm T, & Langel U (2005) Cell-penetrating peptides: Mechanisms and applications. Curr Pharm Design 11(28):3597-3611.
Goun EA, Pillow TH, Jones LR, Rothbard JB, & Wender PA (2006) Molecular transporters: Synthesis of oligoguanidinium transporters and their application to drug delivery and real-time imaging. Chembiochem 7(10):1497-1515.
Meade BR & Dowdy SF (2007) Exogenous siRNA delivery using peptide transduction domains/cell penetrating peptides. Adv Drug Deliver Rev 59(2- 3):134-140.
Fischer R, Fotin-Mleczek M, Hufnagel H, & Brock R (2005) Break on through to the other side - Biophysics and cell biology shed light on cell-penetrating peptides. Chembiochem 6(12):2126-2142.
Nakase I, Takeuchi T, Tanaka G, & Futaki S (2008) Methodological and cellular aspects that govern the internalization mechanisms of arginine-rich cell- penetrating peptides. Adv Drug Deliver Rev 60(4-5):598-607.
Heitz F, Morris MC, & Divita G (2009) Twenty years of cell-penetrating peptides: from molecular mechanisms to therapeutics. Brit J Pharmacol 157(2):195-206.
Gump JM, June RK, & Dowdy SF (2010) Revised Role of Glycosaminoglycans in TAT Protein Transduction Domain-mediated Cellular Transduction. J Biol Chem 285(2):1500-1507.
Norbury CC, Hewlett LJ, Prescott AR, Shastri N, & Watts C (1995) Class I MHC presentation of exogenous soluble antigen via macropinocytosis in bone marrow macrophages. Immunity 3(6):783-791.
Meier O, et al. (2002) Adenovirus triggers macropinocytosis and endosomal leakage together with its clathrin-mediated uptake. J Cell Biol 158(6):1119- 1131.
Conner SD & Schmid SL (2003) Regulated portals of entry into the cell. Nature 422(6927):37-44.
Wadia JS, Stan RV, & Dowdy SF (2004) Transducible TAT-HA fusogenic peptide enhances escape of TAT-fusion proteins after lipid raft macropinocytosis. Nat Med 10(3):310-315.
Skehel JJ, Cross K, Steinhauer D, & Wiley DC (2001) Influenza fusion peptides. Biochem Soc T 29:623-626.
Han X, Bushweller JH, Cafiso DS, & Tamm LK (2001) Membrane structure and fusion-triggering conformational change of the fusion domain from influenza hemagglutinin. Nat Struct Biol 8(8):715-720.
Sakuma T, Higashiyama S, Hosoe S, Hayashi S, & Taniguchi N (1997) CD9 antigen interacts with heparin-binding EGF-like growth factor through its heparin-binding domain. Journal of biochemistry 122(2):474-480.
Higashiyama S, Abraham JA, & Klagsbrun M (1993) Heparin-Binding Egf-Like Growth-Factor Stimulation of Smooth-Muscle Cell-Migration - Dependence on Interactions with Cell-Surface Heparan-Sulfate. J Cell Biol 122(4):933-940. Thompson SA, et al. (1994) Characterization of Sequences within Heparin- Binding Egf-Like Growth-Factor That Mediate Interaction with Heparin. J Biol Chem 269(4):2541-2549.
Kaplan IM, Wadia JS, & Dowdy SF (2005) Cationic TAT peptide transduction domain enters cells by macropinocytosis (vol 102, pg 247, 2005). J Control Release 107(3):571-572.
Lawrence R, Lu H, Rosenberg RD, Esko JD, & Zhang LJ (2008) Disaccharide structure code for the easy representation of constituent oligosaccharides from glycosaminoglycans. Nat Methods 5(4):291-292.
Lin X, et al. (2000) Disruption of gastrulation and heparan sulfate biosynthesis in EXTl-deficient mice. Dev Biol 224(2):299-311.
Dick E, Matsa E, Young LE, Darling D, & Denning C (2011) Faster generation of hiPSCs by coupling high-titer lentivirus and column-based positive selection. Nat Protoc 6(6):701-714.
22. Anderson GW (1998) The caveolae membrane system. Annu Rev Biochem 67:199-225.
23. Nichols BJ & Lippincott-Schwartz J (2001) Endocytosis without clathrin coats.
Trends Cell Biol 11(10):406-412.
24. Liu NQ, et al. (2002) Human immunodeficiency virus type 1 enters brain microvascular endothelia by macropinocytosis dependent on lipid rafts and the mitogen-activated protein kinase signaling pathway. J Virol 76(13):6689- 6700.
25. West MA, Bretscher MS, & Watts C (1989) Distinct Endocytotic Pathways in Epidermal Growth Factor-Stimulated Human Carcinoma A431 Cells. J Cell Biol
109(6):2731-2739.
26. Sampath P & Pollard TD (1991) Effects of Cytochalasin, Phalloidin, and Ph on the Elongation of Actin-Filaments. Biochemistry-Us 30(7):1973-1980.
27. Oliver JM, Berlin RD, & Davis BH (1984) Use of Horseradish-Peroxidase and Fluorescent Dextrans to Study Fluid Pinocytosis in Leukocytes. Method
Enzymol 108:336-347.
28. Araki N, Johnson MT, & Swanson JA (1996) A role for phosphoinositide 3- kinase in the completion of macropinocytosis and phagocytosis by macrophages. J Cell Biol 135(5):1249-1260.
29. Seglen PO, Grinde B, & Solheim AE (1979) Inhibition of the Lysosomal Pathway of Protein-Degradation in Isolated Rat Hepatocytes by Ammonia, Methylamine, Chloroquine and Leupeptin. Eur J Biochem 95(2):215-225.
30. Eustice DC & Wilhelm JM (1984) Mechanisms of Action of Aminoglycoside Antibiotics in Eukaryotic Protein-Synthesis. Antimicrob Agents Ch 26(l):53-60. 31. Yu JY, Chau KF, Vodyanik MA, Jiang JL, & Jiang Y (2011) Efficient Feeder-Free Episomal Reprogramming with Small Molecules. Plos One 6(3).
32. Warren L, et al. (2010) Highly Efficient Reprogramming to Pluripotency and Directed Differentiation of Human Cells with Synthetic Modified mRNA. Cell Stem Cell 7(5):618-630.
33. Kim D, et al. (2009) Generation of human induced pluripotent stem cells by direct delivery of reprogramming proteins. Cell Stem Cell 4(6):472-476.
34. Zhou HY, et al. (2009) Generation of Induced Pluripotent Stem Cells Using Recombinant Proteins (vol 4, pg 381, 2009). Cell Stem Cell 4(6):581-581.
Takahashi K, et al. (2007) Induction of pluripotent stem cells from adult human fibroblasts by defined factors. Cell 131(5):861-872.
Dixon JE, et al. (2010) Axolotl Nanog activity in mouse embryonic stem cells demonstrates that ground state pluripotency is conserved from urodele amphibians to mammals. Development 137(18):2973-2980.
Chambers I, et al. (2003) Functional expression cloning of Nanog, a pluripotency sustaining factor in embryonic stem cells. Cell 113(5):643-655.
Robinton DA & Daley GQ (2012) The promise of induced pluripotent stem cells in research and therapy. Nature 481(7381):295-305.
Do Kwon Y, et al. (2005) Cellular manipulation of human embryonic stem cells by TAT-PDX1 protein transduction. Mol Ther 12(l):28-32.
Hidema S, Tonomura Y, Date S, & Nishimori K (2012) Effects of protein transduction with intact myogenic transcription factors tagged with HIV-1 Tat- PTD (T-PTD) on myogenic differentiation of mouse primary cells. J Biosci Bioeng 113(1):5-11.
Liang QL, Mo ZY, Li XF, Wang XX, & Li RM (2013) Pdxl protein induces human embryonic stem cells into the pancreatic endocrine lineage. Cell Biol Int 37(1):2-10.
Bichsel C, et al. (2013) Direct Reprogramming of Fibroblasts to Myocytes via Bacterial Injection of MyoD Protein. Cell Reprogram 15(2):117-125.
Chan EM, et al. (2009) Live cell imaging distinguishes bona fide human iPS cells from partially reprogrammed cells. Nat Biotechnol 27(11):1033-U1100. Smith KP, Luong MX, & Stein GS (2009) Pluripotency: Toward a Gold Standard for Human ES and iPS Cells. J Cell Physiol 220(l):21-29.
Burridge PW, et al. (2011) A Universal System for Highly Efficient Cardiac Differentiation of Human Induced Pluripotent Stem Cells That Eliminates Interline Variability. Plos One 6(4).
Campbell RE, et al. (2002) A monomeric red fluorescent protein. Proceedings of the National Academy of Sciences of the United States of America 99(12):7877-7882.
Okamoto T, et al. (2002) Clonal heterogeneity in differentiation potential of immortalized human mesenchymal stem cells. Biochem Bioph Res Co 295(2):354-361.
48. Anderson D, et al. (2007) Transgenic enrich ment of cardiomyocytes from human embryonic stem cel ls. Mol Ther 15( ll) : 2027-2036.
49. Claycom b WC, et al. ( 1998) H L-1 cells: A cardiac m uscle cell l ine that contracts and retains phenotypic characteristics of the adu lt cardiomyocyte. Proceedings of the National Academy of Sciences of the United States of
America 95(6) :2979-2984.
50. Dixon J E, Dick E, ajamohan D, Sha kesheff KM, & Denn ing C (2011) Directed differentiation of human em bryonic stem cells to interrogate the cardiac gene regulatory network. Mol Ther 19(9) : 1695-1703.
51. Medina D, Moskowitz N, Khan S, Christopher S, & Germ ino J (2000) Rapid purification of protein com plexes from mam ma lian cells. Nucleic Acids Res 28( 12).
52. Novak A, Guo CY, Ya ng WY, Nagy A, & Lobe CG (2000) Z/EG, a dou ble reporter mouse line that expresses enhanced green fluorescent protein upon Cre- mediated excision. Genesis 28(3-4) : 147-155.
53. Bayoussef Z, Dixon J E, Stolnik S, & Sha kesheff KM (2012) Aggregation promotes cell viabil ity, prol iferation, and differentiation in an in vitro model of injection cel l therapy. J Tissue Eng Regen M 6( 10) :e61-e73. Improving the Efficiency of Iron Oxide Nanoparticle Uptake Using Cell
Penetrating Peptides
Background
Superparamagnetic Iron Oxide nanoparticles (SPIONS) are small highly magnetised particles consisting of an iron oxide core and surface coating. SPIONS have been clinically approved for use in MRI contrast agents1, and are currently being researched for use in targeted drug delivery2, hyperthermia treatment and cell labelling3. SPIONS have been approved for uses in MRI contrast agents and commercially available products include Lumiren, Resivist and Feridex.1
Applications of SPIONS require an adequate concentration being internalised into cells and without the required targeting of nanoparticles it can lead to an inefficient outcome . The efficiency of cell internalisation can depend on the size, coating and additional ligands to name a few4. Literature shows that without the attachment of
internalisation agents researchers are achieving a range of 15-30 pg of iron per cell5'6. The functional groups on nanoparticle coatings can be exploited to target increase cell internalisation by attaching monoclonal antibodies, cell penetrating peptides and small molecules as internalisation agents.7
A currently researched cell penetrating peptide is Arg-Gly-Asp (RGD) . RGD was designed to target the ανβ3 intergrin8. The intergrin can be found predominantly on cancer cells, so can also be used as a targeting peptide. Research found that the RGD peptide increased nanoparticle uptake by 50%.9
The following study focuses on a cell penetrating peptide of the invention herein, in particular P218R. The peptide has two domains, P21 binds to the heparan sulphate (HS) on the cell membrane and the 8R aids in the transduction. The aim of the study was to identify the efficiency of the P218R and to investigate its mechanism.
Materials and Methods
Nanoparticle labelling
A 3 1 mM EDAC with 0. 1 M NHS dissolved in 0.5M MES buffer was added to Nanomag-D (250 nm) particles in a 1 :5 ratio respectively and mixed for 1 hour. The particles are then washed in a 0. 1M MES buffer and 0.2 μg/μl of the required labelling agent dissolved in the same buffer was added to give a 1 : 1 ratio of labelling solution and nanoparticles, an aliquot of the labelling solution was kept for testing labelling efficiency. The solution is then continuously mixed at room temperature for 3 hours. Once the particles are labelled a 25 mM glycine solution is added to the particles then further incubated for 30 minutes. An aliquot of the labelling solution is kept for comparison with the earlier aliquot and the particles washed in 0. 1 % BSA in PBS . Particles are finally diluted in 0. 1 % BSA in PBS to give a lmg/ml solution. Both aliquots of labelling solution and some of the labelled nanoparticles were assessed for fluorescence.
Cell Culture
NIH 3t3 fibroblast cells were cultured in Dulbecco's modified Eagle 's media (DMEM; Gibeco), supplemented with 10% (v/v) Fetal Calf Serum (FCS, Sigma), 2mM L- glutamine and (PS) at 37oC and 5% C02. The cells were then cultured until confluent.
Cell Labelling
Confluent cells were split into 12 well plates at 200,000 cells/well and incubated for 24 hours at 37oC. After 24 hours 50 μg of Nanomag-D iron oxide nanoparticles (250 nm) and either 0, 0.01 , 0.05, 0.1 , 0.5, 2, 1 , 5 and 10 μΜ of cell penetrating peptide were added to the cells with either 10% FCS DMEM or serum free DMEM media and left for 24 hours for iron nanoparticles to be internalised. After incubation cells were washed in PBS to remove excess nanoparticles then harvested for qualitative Prussian blue staining, quantitative colorimetric iron assay or fluorescence activated flow cytometry.
Prussian Blue Staining
Cells were labelled then fixed in 4% (w/v) PFA for 15-20 minutes at 4oC. A staining solution of 2.5% potassium ferrocyanide in 2.5% HCL was added to cells and incubated for an hour at room temperature. If nanoparticles were present a blue stain appeared which is proportional to the concentration of iron.
Quantitative Colorimetric Iron Assay Cells were labelled, trypsinised and pelleted then all media removed. 40μ1 of 37% HCL was added to the cells and heated at 70°C until dissolved, then neutralised with 50μ1 of NaOH. Those samples containing a high concentration of iron were diluted 1 : 10 then 40 μΐ of Quantichrom working reagent was added and the instructions in the Quantichrom iron assay followed.
Flow Cytometry
Cells were labelled with 50 μg of Nanomag-D particles, 1 μΜ P218R and either 0, 0. 1 , 1 and 5 μg/ml of FitC-BSA. Cells were then fixed cells and run through a Coulter Altra flow cytometer to assess the green fluorescence. Findings were then statistically analysed by Wesal software.
Results
Nanoparticle and Cell labelling
Nanomag-D (250 nm) particles were successfully labelled with mR, P21mR, 8RmR and P21mR8R.
Quantitative Assessment of Nanoparticle Uptake
Optimisation of Protein Concentration
As shown in figure 21 , Prussian blue staining proves that the P218R is the most effective peptide for particle uptake compared to P21 and 8R alone . The iron assay results showed that when cells are incubated for 24 hours with Ι μΜ of P218R and 5C^g of Nanomag-D particles 100% of the particles become associated with the cells and 63 pg/cell. Therefore it was concluded that only 1 μΜ of P218R is needed for 100% uptake of particles.
Discussion
The results show that the addition of a small amount of P218R leads to 100% uptake of iron oxide nanoparticles. Microscopy and the trypsinisation of the cells indicate that the particles are being internalised. Experiments were also conducted using mesenchymal stem cells showing a 90% association of particles. The mechanism behind the uptake is dependent on the symbiotic action of the two domains of the peptide, The hypothesis is that the P21 can bind to both the HS on the cell membrane and the dextran in the coating of the nanoparticles, the peptide either has multiple binding points by which both nanoparticle and cell can both be attached to the same P21. Therefore the pre bound protein to the particle can also bind to the membrane keeping the particle in close proximity to the cell. The 8R can then aid in the transduction of the nanoparticle by endocytosis. Or the other mechanism could involve the peptide pre binding to the nanoparticle then when in close proximity to a cell membrane the HS has a higher binding efficiency so the P21 then binds to the cell. This may then lead to the particle being internalised. The advantages of using the P218R peptide is its efficiency in serum media which is more relatable to the in vivo environment and that the system does not require the use of the functional group on the nanoparticles surface coating. The free functional group means that targeting molecules or drugs can be covalently attached to the particle.
Conclusion
The peptide P218R has been found to cause 100% cell association of nanoparticles. This has been found to be due to a dextran binding mechanism which can be utilised for many applications for example targeting of nanoparticles for specific tissues by attaching antibodies, or drug delivery.
References
1. Singh, A & Sahoo, S, (2013), Magnetic Nanoparticles: a novel platform for theranostics, Drug Disc Today,
2. Arruebo, M et al, (2007) Magnetic Nanoparticles for drug delivery, Nanotoday, 3, 22
3. Wang, Z and Cuschieri A, (2013) Tumor cell labelling by magnetic nanoparticles with determination of intracellular iron content and spatial distribution of the intracellular iron, Int. J. Mol. Sci, 14, 91 1 1
4. Sun, C, Lee, J and Zhang, M, (2008), Magnetic Nanoparticles in MR Imaging and drug delivery, Adv Drug Deli Rev, 60, 1253
5. Schlorf, T et al, (201 1), Biological properties of iron oxide nanoparticles for cellular and molecular magnetic resonance imaging, Int. J. Mol. Sci. 12, 12
6. Markides, H et al, (2013) Whole body tracking of superparamagnetic iron oxide nanoparticle labelled cells - a rheumatoid arthritis mouse model, Stem cell Res & ther, 4, 126
7. Peng et al, (2008), targeted magnetic iron oxide nanoparticles for tumour imaging and therapy, Int. J. of Nanomed. 3, 3 1 1
8. Zhang, C et al, (2007), Specific Targeting of Tumor Angiogenesis by RGD- Conjugated Ultrasmall Superparamagnetic Iron Oxide Particles Using a Clinical 1.5-T Magnetic Resonance Scanner, Can. Res. 67, 1555
9. Ji, S et al, (2012), RGD-conjugated albumin nanoparticles as a novel delivery vehicle in pancreatic cancer therapy, Cancer Biology & Therapy 13 :4, 206.
Modified CPPs for Efficient Cell Type Specific Delivery of Therapeutic Molecules via GET (Glycosaminoglycan (GAG)-binding Enhanced Transduction) Introduction
The first aim of this study was to investigate whether the GET-mediated synergistic increase in delivery of mRFP into cells with P21 8R could be observed when P21 was replaced by growth factor derived HS-GAG binding domains. The second aim of this study was to show cell type specific delivery in a heterogeneous population of cells by targeting a specific cell surface HS-epitope . Merry et al have demonstrated the utility of a HS-epitope binding antibody in targeting a subpopulation of cells during mesodermal differentiation [ 13] . The variable region of this antibody was conjugated to 8R to show an example of cell type specific delivery. The third aim of this study
was to demonstrate the GET-mediated delivery of therapeutic biomolecules. The transfection of reporter gene (pSIN GFP) was optimized with P21 LK15 8R peptide and compared to a 'gold standard' commercial lipid based transfection reagent Lipofectamine2000. Cell Type Specific Delivery via GET Experimental Procedures Preparation of Peptides
Peptides, mRFP, mRFP 8R, P21 mRFP 8R, FGF 1A mRFP, FGF 1A mRFP 8R, FGF2A mRFP, FGF2A mRFP 8R, FGF4A mRFP, FGF4A mRFP 8R, FGF7A mRFP, FGF7A mRFP 8R, FGF 1B mRFP, FGF 1B mRFP 8R, FGF2B mRFP, FGF2B mRFP 8R, FGF4B mRFP, FGF4B mRFP 8R, FGF7B mRFP, FGF7B mRFP 8R, FGF 1 C mRFP, FGF 1 C mRFP 8R, FGF2C mRFP, FGF2C mRFP 8R, FGF4C mRFP, FGF4C mRFP 8R, FGF7C mRFP, FGF7C mRFP 8R, ATIII mRFP, ATIII mRFP 8R, PDGF mRFP, PDGF mRFP 8R, VEGF mRFP, VEGF mRFP 8R, HS4C3 mRFP and HS4C3 mRFP 8R, were cloned as cDNAs into pGEX6-PI vector (Novagen), expressed in BL21 (DE21) pLysS Escherichia coli (Novagen) and purified as previously described [ 12] . Integrity and full length peptide expression was confirmed by SDS-PAGE. Fluorescence of the recombinant peptides was confirmed using the TECAN infinite 200PRO multimode reader, the difference in fluorescence intensity measurements between samples was < 10%.
Peptide Assay
Bradford assay was used to quantify protein concentration [ 14] . Absorbance was measured at 595nm using recombinant mRFP protein as a standard [ 12] . Samples were analysed using the TECAN infinite 200PRO multimode reader. Cell Culture of NIH3T3, CGR-8 and HUES7 Cells
NIH3T3 , CGR-8 and HUES7 cells were grown and maintained as previously described [ 12] . NIH3T3 mouse fibroblast cells were maintained in Z)ulbecco's modified Eagle' s medium (DMEM) with 10% (v/v) fetal calf .serum (FCS) supplemented with 2mM L- glutamine and 100 ug/ml streptomyocin. CGR-8 mouse embryonic stem cells were maintained in DMEM with 20% (v/v) FCS supplemented with l OOOunits/ml /eukaemia
inhibitory /actor (LIF), Ι ΟΟμΜ β-mecaptoethanol, 2mM L-glutamine and l OOug/ml streptomyocin. HUES7 human embryonic stem cells were cultured on gelatin coated tissue culture flask. The cells were maintained in DMEM with 20% (v/v) FCS supplemented with l OOOunits/ml LIF, Ι ΟΟμΜ β-mecaptoethanol, 2mM L-glutamine and l OOug/ml streptomyocin. All cells were incubated at 37°C under humidified 5 % C02 conditions.
Peptide Delivery to Cells
Cells were seeded at 2 x 105cells/well in 12-well plates and incubated for 2h in lmL of relevant growth media (GM) at 37°C in a 5% C02 humidified incubator. The peptide was diluted to 20ug/ml in 500ul of GM. Each well of cells was aspirated, washed with phosphate buffered valine (PBS) and replaced with 500ul of peptide solution. The cells were incubated with the peptide at 37°C in a 5% C02 humidified atmosphere for 20h. Following incubation, each well of cells was washed with PBS, trypsinized and fixed with 3.7% /2ara/ormaldehyde (PFA) in preparation for flow cytometry. Each experiment was done in duplicate and repeated 3 times, n=3.
Maintenance and Differentiation of Bry-GFP ES Cells, Generation of EBs
Bry-GFP murine embryonic stem cell line was maintained and differentiated as previously described [ 13] . Bry-GFP cells were maintained on feeders in DMEM-ES (DMEM with 15% FCS supplemented with 1.5x l 05 M monortiioglycerol (MTG), l Ong/ml LIF and 2mM L-glutamine) .
Bry-GFP cells were differentiated as EBs. Prior to differentiation the cells were passaged twice, first onto a gelatin coated flask in DMEM-ES and second into a flask in /scove 's modified Z ulbecco's medium (IMDM)-ES (IMDM with 15% FCS supplemented with 1.5xl 04 M monoihioglycerol (MTG), l Ong/ml LIF and 2mM L- glutamine) . Cells were then differentiated as EBs for 2.8 days in IMDM with 15% FCS supplemented with 4xl 04 M MTG, 300ug/ml transfe rrin, 25ug/ml ascorbic acid and 2mM L-glutamine in Petri-grade dishes. 3h before dissociation, EBs were treated with 50ug/ml of HS4C3 mRFP or HS4C3 mRFP 8R. Following differentiation EBs were separated into single cells by l Omin incubation and agitation in cell dissociation buffer and fixed in PFA.
Flow Cytometry Analysis
Cells were analysed on a MoFlo™ DP (DAKO) Flow Cytometer using a 488nm green laser and/or 633nm red laser. (40,000 cells; gated on live cells by forward/side scatter). Median fluorescence was used for statistical analyses. Results and Discussion
CPPs Modified to Include GET
In this study the HS-GAG binding domains of fibroblast growth factor (FGF)- l , FGF- 2, FGF-4, FGF-7, platelet derived growth factor (PDGF) and antithrombin-III (ATIII) were coupled to 8R. These growth factors play important biological roles in embryonic development and angiogenesis. They have also been shown to interact with cell surface HS-GAGs, similarly to P21. NIH 3T3 murine fibroblasts, CGR8 murine embryonic stem cells and HUES-7 human embryonic stem cells were treated with these modified CPPs to investigate whether any of the peptides demonstrated a GET- mediated increase in delivery of mRFP (Figure 22). It was also important to explore whether any of the modified peptides would preferentially target HS epitopes that were more abundantly expressed in any of the different cell types.
A panel of four modified CPPs that showed GET-mediated enhanced transduction into cells have been identified. P21 8R, FGF2B 8R, FGF7B 8R and PDGF 8R have demonstrated 30- 100 fold increase in transduction of mRFP into cells over using an 8R alone (Figure 23 and 24). P21 8R, FGF7B 8R and PDGF 8R showed preferential transduction into HUES-7 embryonic stem cells. This demonstrates preferential transduction of CPPs into a cell-type that is considered difficult to transduce in to. FGF2B 8R showed pluripotency specific transduction into CGR8 and HUES7 embryonic stem cells. The diverse delivery profiles of the modified CPPs into the three cell types suggests the HS-GAG binding domains of different growth factors target and bind different cell surface HS-epitopes. Targeting HS-epitopes that are expressed more abundantly by specific cell types can be utilized for the selection of CPPs that are more suitable for their application.
GET Mediated Delivery of Plasmid DNA
Experimental Procedures Preparation of Peptides
P21 -LK15-8R peptide was synthesised using solid phase t-Boc chemistry (Novabiochem (Beeston, Nottinghamshire, UK)) . Cell culture
NIH3T3 mouse fibroblast cells were maintained in DMEM with 10% (v/v) fetal calf serum (FCS) media supplemented with 2mM L-glutamine and l OOug/ml streptomyocin. The cells were incubated at 37°C under humidified 5% C02 conditions.
Preparation of Plasmid DNA
DNA (pSIN GFP) was amplified in E. coli. The DNA was extracted and purified using a QIAGEN Plasmid Maxi kit (Qiagen). DNA was precipitated in 100% ethanol and rehydrated in dH20. Plasmid purity was confirmed using the nanodrop.
Peptide-DNA Complexation Assay
l Oug DNA was diluted in 60ul 4-(2-^ydroxy£thyl)- l -/2iperazine£thanesulfonic acid (HEPES)-buffered saline ( l OmM HEPES, 150mM podium chloride (NaCl) solution, pH 7.4). ImM YO-PRO- 1 stock solution was diluted to O. lmM in dimethyl .sulfoxide (DMSO). 2.7ul of the diluted YO-PRO- 1 solution was made up to 60ul in HEPES- buffered saline and added dropwise to the diluted DNA. The DNA/YO-PRO- 1 solution was mixed, wrapped in foil and incubated for 5h at room temperature. After 5h, the DNA/YO-PRO- 1 solution was made up to 1ml in HEPES-buffered saline and l OOul aliquots were pipetted into eppindorf tubes per treatment condition. Peptide amounts corresponding to the desired (+/-) charge ratios were added to each eppindorf (Appendix 1). Peptide/DNA/YO-PRO- 1 solutions were mixed and incubated at room temperature for l Omin. Fluorescence measurements were then analysed using the TECAN infinite 200PRO multimode reader. Similarly, a no DNA control was made by diluting 2.7ul of the diluted YO-PRO- 1 solution in 120ul HEPES-buffered saline and following the procedure above.
Design and Optimization of Transfection Experiment
Cells were seeded at 80,000 cells per well on 12-well plates and incubated overnight in lmL of 10% GM at 37°C in a 5 % C02 humidified incubator. For each well of cells to be transfected, DNA was diluted in l OOul Opti-MEM® and mixed. The peptide was
added directly to the diluted DNA at the optimal (+/-) charge ratio. The solution was then mixed and incubated for 25min at room temperature. The cells were aspirated, washed with PBS and replaced with 400ul Opti-MEM®. Each well of cells was treated with l OOul of Peptide/DNA complex and incubated 37°C in a 5% C02 humidified atmosphere . Appendix 2 shows the different treatment conditions used for each well. Following incubation, the cells were washed with PBS and replaced with 1ml GM. After 48h, each well of cells was washed with PBS, trypsinized and fixed with 3.7% PFA. Experiments were repeated 3 times. Lipofectamine2000 transfection optimization was carried out as described in the manufacturers guide (Invitrogen). Cells were seeded at 80,000 cells per well on 12- well plates and incubated overnight in lmL of GM at 37°C in a 5% C02 humidified incubator. For each well of cells to be transfected, DNA was diluted in l OOul Opti- MEM® and mixed. 1.5ul of Lipofectamine2000 was added directly to the diluted DNA. The mixture was then mixed and incubated for 25mins at room temperature. The cells were aspirated, washed with PBS and replaced with 400ul Opti-MEM®. Each well of cells was treated with l OOul of Lipofectamine2000/DNA complex and incubated 37°C in a 5% C02 humidified atmosphere. After 6h, the cells was washed with PBS, trypsinized and fixed with 3.7% PFA. This was repeated with varying volumes of Lipofectamine2000 (3ul and 4.5ul) to find the optimal ratio of Lipofectamine2000 to DNA. Experiments were repeated 3 times.
Flow Cytometry Analysis
Cells were analysed on a MoFlo™ DP (DAKO) Flow Cytometer using a 633nm red laser. (40,000 cells; gated on live cells by forward/side scatter). Median fluorescence was used for statistical analyses.
Results and Discussion
Peptide to DNA Binding
YO-PRO- 1 assay can be used to investigate the DNA condensation ability of a DNA binding peptide. YO-PRO- 1 is a cyanine dye that binds DNA to form a fluorescent DNA/dye complex. Different (+/-) charge ratios of peptide can be added to the fluorescent DNA/dye complex. As the peptide out competes the dye by binding the DNA a reduction in fluorescence intensity is observed. In this study, LK15 was fused
to P21 8R transduction protein to improve the DNA binding ability of the modified cell penetrating peptide. Fusion of LK15 peptide to TAT has been shown to significantly improve transfection of pDNA into HT29 and HT 1080 cultured cells [ 19] . Enhanced transduction efficiency of Tat-LK15 over Tat is thought to be due to the improved condensation ability of the peptide and DNA, and better transduction of the DNA across the cell membrane [20] .
A graph of (+/-) charge ratio was plotted against % fluorescence to investigate the optimum ratio of P21 LK15 8R to pSIN GFP (Figure 25). Results showed that the optimal (+/-) charge ratio of P21 LK15 8R to pSIN GFP was 2: 1 , respectively. This ratio was used in the transfection experiments.
Transfection of pDNA Reporter Gene via P21 LK15 8R
The phospholipid bilayer of the cell membrane acts as an impenetrable barrier to nucleic acids and thus pDNA will be conjugated to a modified CPP to facilitate its transport into the cell [2] . In this study the GET-mediated transfection of the reporter gene pSIN GFP into NIH 3T3 murine fibroblast cells was optimized in terms of transfection time (3, 6 or 24h), transfection media (with or without serum) and amount of DNA ( 1 , 4 or l Oug) . The reporter gene pSIN GFP was transfected into cells using P21 LK15 8R where P21 targets and binds cell surface HS-GAGs, LK15 complexes pSIN GFP and 8R transduces pSIN GFP across the cell membrane . The transfection efficiency of pSIN GFP with P21 LK15 8R was compared to the transfection efficiency of commercially used lipid-based transfection reagent lipofectamine2000. Cells were fixed at 48h following transfection to allow time for the transient expression of GFP to be captured and transfection efficiencies were quantified by flow cytometry (Figure 26).
Gene carrier systems must be serum resistant for efficacious in-vivo applications, however most gene carries, including lipofectamine2000, have demonstrated steep decreases in transfection efficiency in serum containing media [21] . This is believed to be because serum molecules competitively bind the gene carrier, therefore decreasing free gene carriers available to bind the DNA [22] . The transfection efficiency of P21 LK15 8R was characterised in serum and serum free transfection media. The optimal transfection conditions were when cells were transfected with l Oug DNA for 24h in serum conditions where transfection efficiency reached 17.9 ±
4.8%. (Figure 27). This is 3 fold lower than the optimized transfection efficiency observed for lipofectamine2000 in serum free conditions (54.7 ± 10.3%, Appendix 3) however, the serum-resistance of P21 LK15 8R transfection is advantageous for any sort of clinical/ in-vivo delivery of therapeutic biomolecules. In addition, it is well documented that endosomal escape strategies greatly increase the efficiencies of CPP- mediated transfections.
Conclusions
A panel of CPPs that have been modified to include growth factor derived cell surface HS-GAG binding domains have shown 30- 100 fold increase in transduction into cells, compared to unmodified CPPs. The hypothesis is that the GET-mediated delivery of these peptides is due to the dual functionality of the peptide in i) increasing interaction with the cell membrane via the HS-GAG binding domain, and ii) transducing protein across cell membrane via 8R. The modified CPPs showed preferential delivery profiles of mRFP into different cell types, this is due the HS- GAG binding domains targeting specific HS-epitopes that are more abundantly expressed in different cell types. Future work is to modify CPPs to include specific antibody-derived HS-epitope binding domains. HS-epitope binding libraries of antibodies can be utilized for the cell type specific delivery of therapeutic molecules via GET.
To demonstrate the utility of these peptides for the delivery of therapeutic molecules P21 LK15 8R was used to deliver the reporter gene pSIN GFP into cells. Results showed GET-mediated transfection efficiencies of up to 17.9 ± 4.8% in serum conditions, without any endosomal escape strategy. CPPs modified to include HS- GAG binding domains show great promise as alternatives to using viral and lipid based delivery vehicles for the in-vivo delivery of therapeutic biomolecules.
References
[ 1] Bechara C, Sagan S . Cell-penetrating peptides: 20 years later, where do we stand? Febs Letters 2013 ;587: 1693-702.
[2] Tanaka K, Kanazawa T, Ogawa T, Suda Y, Takashima Y, Fukuda T, et al. A Novel, Bio-Reducible Gene Vector Containing Arginine and Histidine Enhances Gene
Transfection and Expression of Plasmid DNA. Chemical & Pharmaceutical Bulletin 201 1 ;59:202-7.
[3] Mitchell DJ, Kim DT, Steinman L, Fathman CG, Rothbard JB . Polyarginine enters cells more efficiently than other polycationic homopolymers. Journal of Peptide Research 2000;56: 3 18-25.
[4] Nakase I, Niwa M, Takeuchi T, Sonomura K, Kawabata N, Koike Y, et al. Cellular uptake of arginine-rich peptides: Roles for macropinocytosis and actin rearrangement. Molecular Therapy 2004; 10: 101 1 -22.
[5] Ma DX, Shi NQ, Qi XR. Distinct transduction modes of arginine-rich cell- penetrating peptides for cargo delivery into tumor cells. International Journal of Pharmaceutics 201 1 ;419:200-8.
[6] El-Sayed A, Futaki S, Harashima H. Delivery of Macromolecules Using Arginine- Rich Cell-Penetrating Peptides: Ways to Overcome Endosomal Entrapment. Aaps Journal 2009; 1 1 : 13-22.
[7] Shiraishi T, Nielsen PE. Enhanced delivery of cell-penetrating peptide-peptide nucleic acid conjugates by endosomal disruption. Nature Protocols 2006; 1 :633 -6.
[8] Matsubara Y, Chiba T, Kashimada K, Morio T, Takada S, Mizutani S, et al. Transcription activator-like effector nuclease-mediated transduction of exogenous gene into IL2RG locus. Scientific Reports 2014;4.
[9] Parelkar SS, Letteri R, Chan-Seng D, Zolochevska O, Ellis J, Figueiredo M, et al. Polymer-Peptide Delivery Platforms: Effect of Oligopeptide Orientation on Polymer- Based DNA Delivery. Biomacromolecules 2014; 15 : 1328-36.
[ 10] Yang HY, Vonk LA, Licht R, van Boxtel AMG, Bekkers JEJ, Kragten AHM, et al. Cell type and transfection reagent-dependent effects on viability, cell content, cell cycle and inflammation of RNAi in human primary mesenchymal cells. European Journal of Pharmaceutical Sciences 2014;53 : 35 -44.
[ 1 1] Ma Y, Gong C, Ma YL, Fan FK, Luo MJ, Yang F, et al. Direct cytosolic delivery of cargoes in vivo by a chimera consisting of D- and L-arginine residues. Journal of Controlled Release 2012; 162:286-94.
[ 12] James E. Dixon GM, Nina Lane, Chris Denning and Kevin M. Shakesheff Highly Efficient Delivery of Functional Proteins by the Synergistic Effect of GAG Binding Motifs and Cell-Penetrating Peptides. Unpublished 2014.
[ 13] Baldwin RJ, ten Dam GB, van Kuppevelt TH, Lacaud G, Gallagher JT, Kouskoff V, et al. A Developmentally Regulated Heparan Sulfate Epitope Defines a
Subpopulation with Increased Blood Potential During Mesodermal Differentiation. Stem Cells 2008;26: 3 108- 18.
[ 14] Bradford MM. RAPID AND SENSITIVE METHOD FOR QUANTITATION OF MICROGRAM QUANTITIES OF PROTEIN UTILIZING PRINCIPLE OF PROTEIN- DYE BINDING. Analytical Biochemistry 1976;72:248-54.
[ 15] Schamhart DHJ, Kurth KH. Role of proteoglycans in cell adhesion of prostate cancer cells: From review to experiment. Urological Research 1997;25 : S89-S96.
[ 16] Delehedde M, Deudon E, Boilly B, Hondermarck H. Proteoglycans in breast cancer. Pathologie Biologie 1997;45 : 305- 1 1.
[ 17] Shao C, Shi XF, Phillips JJ, Zaia J. Mass Spectral Profiling of Glycosaminoglycans from Histological Tissue Surfaces. Analytical Chemistry 2013 ;85 : 10984-91.
[ 18] Thompson KE, Bashor CJ, Lim WA, Keating AE. SYNZIP Protein Interaction Toolbox: in Vitro and in Vivo Specifications of Heterospecific Coiled-Coil Interaction Domains. Acs Synthetic Biology 2012; 1 : 1 18-29.
[ 19] Saleh AF, Aojula H, Arthanari Y, Offerman S, Alkotaji M, Pluen A. Improved Tat-mediated plasmid DNA transfer by fusion to LK15 peptide . Journal of Controlled Release 2010; 143 :233 -42.
[20] Dufourcq J, Neri W, Henry-Toulme N. Molecular assembling of DNA with amphipathic peptides. Febs Letters 1998;421 : 7- 1 1 .
[21] Zhang X, Hu HM, Liu TB, Yang YY, Peng YF, Cai QQ, et al. Multi-armed poly(L-glutamic acid)-graft-polypropyleneinime as effective and serum resistant gene delivery vectors. International Journal of Pharmaceutics 2014;465 :444-54.
[22] Wu HM, Pan SR, Chen MW, Wu Y, Wang C, Wen YT, et al. A serum-resistant polyamidoamine-based polypeptide dendrimer for gene transfection. Biomaterials 201 1 ;32: 1619-34.
Example 3 There is an unmet clinical need for high numbers of patient-specific cells for cell therapies. In this example RNAs have been delivered (Figures 29-3 1 ) that temporarily produce a proliferative phenotype in clinically-relevant cells which are hard and slow to expand to sufficient numbers for human cell therapies.
Modified Synthetic RNA production to regulate gene expression stoichiometrically
RNA was synthetically made using modified nucleotides and cap analogues which express well in human cells, are not cytotoxic and do not generate a cellular immune response, specifically in primary cells using the interferon B 18R inhibitor (Fig 29) . Clearly RNA is not stability inherited unlike integrated DNA and is more efficient at producing a translated protein product as it is translated in the cytosol rather than needing transcription in nuclei like delivered DNAs. RNA expression was demonstrated to be short lived (to background levels by 72h) meaning that RNA can be serially delivered (daily to every 3 days) to create a situation of constant protein expression and simply ceasing the delivery results in no further protein-expression (Fig. 29). Therefore, it has been proven that the level and duration of the expressed protein's activity can tightly and stoichiometrically controlled in the target cell type.
Transient immortalisation of clinically valuable cells to generate extensive cell numbers (without losing the primary cell phenotype) is a step change in what is possible using hMSCs in cell therapies. We found that aged cells (by over passaging them; Fig 3 1. P4- 10) benefited the most from this technology. It is well known that stem cell derived from the elderly or diabetic patients are the most difficult to expand.
Transformative benefits of the invention are:
1) A rapid expansion of cells in one-to-several weeks rather than months from small starting populations. We have demonstrated a doubling of proliferation after a single dose of delivered RNA
2) Non-genetically modified cells will be produced. No modification to the genome has been detected.
3) This is a technology to facilitate autologous cell therapies.
4) No spontaneous transformation has been seen using this technology in hMSC cultures.
5) There is application to other therapeutic cell types (Pancreatic islets, hepatocytes, retinal pigment, neurons) . Example Sequences
Example HS-GAG binding sequences
P21 amino acid sequence
(SEQ ID NO.1)
KRKKKGKGLGKKRDPCLRKYK
P21 nucleotide sequence (with a methionine/ ATG):
(SEQ ID NO: 2)
aagcgcaagaagaagggcaaaggcctgggcaagaagcgcgatccgtgcctgcgcaagtataag PDGF (194-211) amino acid sequence:
(SEQ ID NO.3)
GRPRE SGKKRKRKRLKPT
PDGF (194-211) nucleotide sequence:
(SEQ ID NO: 4)
ggccgcccgcgcgaaagcggcaaaaaacgcaaacgcaaacgcctgaaaccgacc
FGF7B amino acid sequence:
(SEQ ID NO.5).
TYA SAKWTHNGGEMFVALNQ
FGF7B nucleotide sequence:
(SEQ ID NO: 6)
acctatgcgagcgcgaaatggacccataacggcggcgaaatgtttgtggcgctgaaccag FGF2 HBD B(247-262) amino acid sequence:
(SEQ ID NO.7).
TYRSRKYTSWYVALKR
FGF2 HBD B(247-262) nucleotide sequence:
(SEQ ID NO: 8)
acctatcgcagccgcaaatataccagctggtatgtggcgctgaaacgc
Nucleotides encoding 8R protein transduction domain sequence:
(SEQ ID NO: 9)
CGA AGA CGC AGG AGA CGT CGA AGG
Example delivery molecule nucleotide sequence (P21-cargo-8R):
(SEQ ID NO: 10)
aagcgcaagaagaagggcaaaggcctgggcaagaagcgcgatccgtgcctgcgcaagtataagNcgaagacgcagga gacgtcgaagg
N=cargo nucleic acid sequence of various length (i.e. the number of nucleotide residues may vary), or another molecular entity.
Two versions of each of the nanobody variants of the ScFv antibodies were made; one with identical sequence to the ScFv vHH domain (Frame domain 1 -CDRl -Frame domain 2-CDR2-Frame domain 3-CDR3-IgA Hinge domain/Frame domain 4) and one in which the CDR1, 2 and 3 domains were grafted into a generic vHH domain sequence. Both versions have comparable activity and the grafting version was created to prove that simply grafting the CDR domains onto a generic antibody also works.
Below are the sequences of the HS4C3, and A04B08 ScFv vHH and grafted vHH:
HS4C3 ScFv vHH
(SEQ ID NO: 1 1)
EVQLVESGGGLVQPRGSLRLSCAASGFTVSSNEMSWIRQAPGKGLEWVSSISGG STYYADSRKGRFTISRDNSKNTLYLQMNNLRAEGTAAYYCGRRLKDPSTPPTPS PSTPPTPSPS
CDR1 GFTVSSNE
CDR2 ISGGST
CDR3 GRRLKD
HS4C3 ScFv vHH nucleotide sequence
(SEQ ID NO: 12)
gaagtgcagctggtggaaagcggcggcggcctggtgcagccgcgcggcagcctgcgcctgagctgcgcggcgagcgg ctttaccgtgagcagcaacgaaatgagctggattcgccaggcgccgggcaaaggcctggaatgggtgagcagcattagcg gcggcagcacctattatgcggatagccgcaaaggccgctttaccattagccgcgataacagcaaaaacaccctgtatctgca gatgaacaacctgcgcgcggaaggcaccgcggcgtattattgcggccgccgcctgaaagatccgagcaccccgccgacc ccgagcccgagcaccccgccgaccccgagcccgagc
HS4C3 grafted vHH
(SEQ ID NO : 13)
QVQLVESGGGSVQAGGSLRLSCTASGFTVSSNELGWFRQAPGQERWAVAAISG GSTYYADSVKGRFTISRDNAKNTVTLQMNNLKPEDTAIYYCGRRLKDWGQGTQ VTVSSPSTPPTPSPSTPPTPSPS
CDR1 GFTVSSNE
CDR2 ISGGST
CDR3 GRRLKD
HS4C3 grafted vHH nucleotide
(SEQ ID NO: 14)
caggtgcagctggtggaaagcggcggcggcagcgtgcaggcgggcggcagcctgcgcctgagctgcaccgcgagcgg ctttaccgtgagcagcaacgaactgggctggtttcgccaggcgccgggccaggaacgctgggcggtggcggcgattagc ggcggcagcacctattatgcggatagcgtgaaaggccgctttaccattagccgcgataacgcgaaaaacaccgtgaccctg cagatgaacaacctgaaaccggaagataccgcgatttattattgcggccgccgcctgaaagattggggccagggcaccca ggtgaccgtgagcagcccgagcaccccgccgaccccgagcccgagcaccccgccgaccccgagcccgagc
AO4B08 ScFv vHH
(SEQ ID NO: 15)
EDQLVESGGGLVQPGGSLRPSCAASGFAFSSYALHWVRRAPGKGLEWVSAIGT
GGDTYYADSVMGRFTISRDNAKKSLYLHMNSLIAEDMAVYYCSLRMNGWRAH
O_PSTPPTPSPSTPPTPSPS CDR1 GFAFSSYA
CDR2 IGTGGDT
CDR3 SLRMNGWRAHQ
AO4B08 ScFv vHH nucleotide sequence
(SEQ ID NO: 16)
gaagatcagctggtggaaagcggcggcggcctggtgcagccgggcggcagcctgcgcccgagctgcgcggcgagcgg ctttgcgtttagcagctatgcgctgcattgggtgcgccgcgcgccgggcaaaggcctggaatgggtgagcgcgattggcac cggcggcgatacctattatgcggatagcgtgatgggccgctttaccattagccgcgataacgcgaaaaaaagcctgtatctg catatgaacagcctgattgcggaagatatggcggtgtattattgcagcctgcgcatgaacggctggcgcgcgcatcagccg agcaccccgccgaccccgagcccgagcaccccgccgaccccgagcccgagc
AO4B08 grafted vHH
(SEQ ID NO: 17)
QVQLVESGGGSVQAGGSLRLSCTASGFAFSSYALGWFRQAPGQERWAVAAIGT GGDTYYADSVKGRFTISRDNAKNTVTLQMNNLKPEDTAIYYCSLRMNGWRAH
0_WGQGTQVTVSSPSTPPTPSPSTPPTPSPS
CDR1 GFAFSSYA
CDR2 IGTGGDT
CDR3 SLRMNGWRAHQ
AO4B08 grafted vHH nucleotide sequence
(SEQ ID NO: 18)
caggtgcagctggtggaaagcggcggcggcagcgtgcaggcgggcggcagcctgcgcctgagctgcaccgcgagcgg ctttgcgtttagcagctatgcgctgggctggtttcgccaggcgccgggccaggaacgctgggcggtggcggcgattggca ccggcggcgatacctattatgcggatagcgtgaaaggccgctttaccattagccgcgataacgcgaaaaacaccgtgaccc tgcagatgaacaacctgaaaccggaagataccgcgatttattattgcagcctgcgcatgaacggctggcgcgcgcatcagt ggggccagggcacccaggtgaccgtgagcagcccgagcaccccgccgaccccgagcccgagcaccccgccgacccc gagcccgagc
Claims
1. A method of producing a population of cells comprising:
-transiently transforming a cell with nucleic acid arranged to promote cell expansion,
wherein the nucleic acid is linked to a delivery vehicle for cell attachment and internalization, wherein the delivery vehicle comprises:
- a glycosaminoglycan (GAG) binding element, which is capable of binding to GAG on the surface of the cell; and
- a protein transduction domain.
2. A method of transient modification of a cell comprising:
-exposing the cell to a transformation complex comprising a nucleic acid linked to a delivery vehicle for cell attachment and internalization, wherein the delivery vehicle comprises:
- a glycosaminoglycan (GAG) binding element, which is capable of binding to GAG on the surface of the cell; and
- a protein transduction domain.
3. The method according to claim 1 or claim 2, wherein the cell comprises a mesenchymal stem cell (MSC).
4. The method according to any preceding claim, wherein the resulting expanded population of cells retain multipotent differentiation into bone, fat and connective tissue.
5. The method according to claim 1 or claim 2, wherein the cell comprises a pancreatic islet cell, a hepatocyte, a retinal pigment cell, or a neuron.
6. The method according to any preceding claim, wherein the nucleic acid comprises RNA.
7. The method according to claim 6, wherein the RNA is modified for translation and stability.
8. The method according to any preceding claim, wherein the nucleic acid is arranged to promote cell expansion by encoding genes capable of temporally immortalizing cells
9. The method according to any preceding claim, wherein the nucleic acid encodes any one of the genes selected from SV40T, TERT, HPV E6/7, BMI 1 , Cyclins, Survivin (BIRC5), p53, and Ras; or combinations thereof.
10. The method according to any preceding claim, wherein the GAG binding element is a heparan sulphate glycosaminoglycan (HS-GAG) binding element, which is capable of binding to HS-GAG on the surface of the cell.
1 1. The method according to any preceding claim, wherein the protein transduction domain is hydrophilic or amphiphilic.
12. The method according to any preceding claim, wherein the protein transduction domain comprises a majority of arginine and/or lysine amino acid residues.
13. A method of treatment or prevention of a disease, or treatment for tissue damage or a bone defect comprising:
- providing a cell;
- transiently transforming the cell with nucleic acid for causing expansion of the cell in accordance with the method of any preceding claim;
-expanding the cell to form an expanded population of cells;
-administering the expanded population of cells to the patient.
14. The method according to claim 13, wherein the expanded population of cells is administered to the patient by implantation of a scaffold populated with the expanded population of cells; or administered by injection; or administered topically for skin regeneration treatments.
15. A method of manufacturing an implant for treatment of tissue damage or a bone defect in a patient comprising:
- providing a cell;
- transiently transforming the cell with nucleic acid for causing expansion of the cell in accordance with the method of any of claims 1 to 12;
- expanding the cell to form an expanded population of cells;
- populating the expanded population of cells into the implant.
16. A method of manufacturing a scaffold-forming composition comprising cells for treatment of tissue damage or a bone defect in a patient comprising:
- providing a cell;
- transiently transforming the cell with nucleic acid for causing expansion of the cell in accordance with the method of any of claims 1 to 12;
- expanding the cell to form an expanded population of cells;
-mixing the expanded population of cells with a scaffold-forming composition.
17. A method of manufacturing a suspension of autologous cells for treatment of a patient in need thereof comprising:
- providing a cell;
- transiently transforming the cell with nucleic acid for causing expansion of the cell in accordance with the method of the invention;
- expanding the cell to form an expanded population of cells which are autologous to the patient.
18. The method according to any of claims 13 to 17, wherein the cell is from the patient to be treated.
19. A population of cells produced by the method of any preceding claim.
20. Use of delivery vehicle for transiently transforming a mesenchymal stem cell with nucleic acid, wherein the delivery vehicle comprises:
- a glycosaminoglycan (GAG) binding element, which is capable of binding to GAG on the surface of the cell; and
- a protein transduction domain; and
wherein the delivery vehicle is linked to, or complexed with, the nucleic acid.
21. The use of claim 20, wherein the transient transformation and/or expansion of the cell is in vitro.
22. A method of stably genetically modifying a cell comprising:
- transiently modifying the cell according to the method of any of claims 1 to 12, such that the cell is in an expansion phase to form a population of cells;
- stably transforming the cells during the expansion phase with nucleic acid arranged to stably modify the chromosomal DNA of the cell.
23. Use of the method according to any of claims 1 to 12 to transiently transform a cell for achieving a cell expansion phase in order to genetically modify the cell by transformation with nucleic acid.
24. A method of manufacturing a wound dressing comprising cells for treatment of tissue damage in a patient comprising:
- providing a cell;
- transiently transforming the cell with nucleic acid for causing expansion of the cell in accordance with the method of any of claims 1 to 12;
- expanding the cell to form an expanded population of cells;
-mixing the expanded population of cells with a wound dressing material.
25. An agent for transiently transforming a population of cells, the agent comprising:
- nucleic acid arranged to promote cell expansion,
wherein the nucleic acid is linked to a delivery vehicle for cell attachment and internalization, wherein the delivery vehicle comprises:
- a glycosaminoglycan (GAG) binding element, which is capable of binding to GAG on the surface of the cell; and
- a protein transduction domain.
26. Use of the method of any of claims 1 to 12 or the use of the agent of claim 25 for providing a population of cells suitable for seeding onto a scaffold implant or wound dressing.
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| GBGB1511158.6A GB201511158D0 (en) | 2015-06-24 | 2015-06-24 | Cell modification and application in therapy |
| GB1511158.6 | 2015-06-24 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2016207637A1 true WO2016207637A1 (en) | 2016-12-29 |
Family
ID=53784476
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/GB2016/051881 Ceased WO2016207637A1 (en) | 2015-06-24 | 2016-06-23 | Cell modification and application in therapy |
Country Status (2)
| Country | Link |
|---|---|
| GB (1) | GB201511158D0 (en) |
| WO (1) | WO2016207637A1 (en) |
Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2007095152A2 (en) * | 2006-02-10 | 2007-08-23 | The Regents Of The University Of California | TRANSDUCIBLE DELIVERY OF sIRNA BY dsRNA BINDING DOMAIN FUSIONS TO PTD/CPPS |
| WO2015092417A1 (en) * | 2013-12-18 | 2015-06-25 | The University Of Nottingham | Transduction |
-
2015
- 2015-06-24 GB GBGB1511158.6A patent/GB201511158D0/en not_active Ceased
-
2016
- 2016-06-23 WO PCT/GB2016/051881 patent/WO2016207637A1/en not_active Ceased
Patent Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2007095152A2 (en) * | 2006-02-10 | 2007-08-23 | The Regents Of The University Of California | TRANSDUCIBLE DELIVERY OF sIRNA BY dsRNA BINDING DOMAIN FUSIONS TO PTD/CPPS |
| WO2015092417A1 (en) * | 2013-12-18 | 2015-06-25 | The University Of Nottingham | Transduction |
Non-Patent Citations (105)
| Title |
|---|
| ANDERSON D ET AL.: "Transgenic enrichment of cardiomyocytes from human embryonic stem cells", MOL THER, vol. 15, no. 11, 2007, pages 2027 - 2036 |
| ANDERSON RGW: "The caveolae membrane system", ANNU REV BIOCHEM, vol. 67, 1998, pages 199 - 225, XP001095052, DOI: doi:10.1146/annurev.biochem.67.1.199 |
| ARAKI N; JOHNSON MT; SWANSON JA: "A role for phosphoinositide 3-kinase in the completion of macropinocytosis and phagocytosis by macrophages", J CELL BIOL, vol. 135, no. 5, 1996, pages 1249 - 1260, XP001057115, DOI: doi:10.1083/jcb.135.5.1249 |
| ARRUEBO, M ET AL.: "Magnetic Nanoparticles for drug delivery", NANOTODAY, vol. 3, 2007, pages 22 |
| BALDWIN RJ; TEN DAM GB; VAN KUPPEVELT TH; LACAUD G; GALLAGHER JT; KOUSKOFF V ET AL.: "A Developmentally Regulated Heparan Sulfate Epitope Defines a Subpopulation with Increased Blood Potential During Mesodermal Differentiation", STEM CELLS, vol. 26, 2008, pages 3108 - 18 |
| BAYOUSSEF Z; DIXON JE; STOLNIK S; SHAKESHEFF KM: "Aggregation promotes cell viability, proliferation, and differentiation in an in vitro model of injection cell therapy", J TISSUE ENG REGEN M, vol. 6, no. 10, 2012, pages E61 - E73 |
| BECHARA C; SAGAN S.: "Cell-penetrating peptides: 20 years later, where do we stand?", FEBS LETTERS, vol. 587, 2013, pages 1693 - 702, XP028562950, DOI: doi:10.1016/j.febslet.2013.04.031 |
| BICHSEL C ET AL.: "Direct Reprogramming of Fibroblasts to Myocytes via Bacterial Injection of MyoD Protein", CELL REPROGRAM, vol. 15, no. 2, 2013, pages 117 - 125 |
| BRADFORD MM.: "RAPID AND SENSITIVE METHOD FOR QUANTITATION OF MICROGRAM QUANTITIES OF PROTEIN UTILIZING PRINCIPLE OF PROTEIN-DYE BINDING", ANALYTICAL BIOCHEMISTRY, vol. 72, 1976, pages 248 - 54, XP025650297, DOI: doi:10.1016/0003-2697(76)90527-3 |
| BURRIDGE PW ET AL.: "A Universal System for Highly Efficient Cardiac Differentiation of Human Induced Pluripotent Stem Cells That Eliminates Interline Variability", PLOS ONE, vol. 6, no. 4, 2011, XP009167975, DOI: doi:10.1371/journal.pone.0018293 |
| CAMPBELL RE ET AL.: "A monomeric red fluorescent protein", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF THE UNITED STATES OF AMERICA, vol. 99, no. 12, 2002, pages 7877 - 7882, XP002967837, DOI: doi:10.1073/pnas.082243699 |
| CELL STEM CELL, vol. 4, no. 6, pages 581 - 581 |
| CHAMBERS I ET AL.: "Functional expression cloning of Nanog, a pluripotency sustaining factor in embryonic stem cells", CELL, vol. 113, no. 5, 2003, pages 643 - 655, XP002290473, DOI: doi:10.1016/S0092-8674(03)00392-1 |
| CHAN EM ET AL.: "Live cell imaging distinguishes bona fide human iPS cells from partially reprogrammed cells", NAT BIOTECHNOL, vol. 27, no. 11, 2009, pages 1033 - U1100, XP002621305, DOI: doi:10.1038/NBT.1580 |
| CHEN CHIEN-JUNG ET AL: "In Vitro Characterization and in Vivo Application of a Dual Functional Peptide", 2013 SEVENTH INTERNATIONAL CONFERENCE ON COMPLEX, INTELLIGENT, AND SOFTWARE INTENSIVE SYSTEMS, IEEE, 3 July 2013 (2013-07-03), pages 576 - 581, XP032485643, DOI: 10.1109/CISIS.2013.104 * |
| CLAYCOMB WC ET AL.: "HL-1 cells: A cardiac muscle cell line that contracts and retains phenotypic characteristics of the adult cardiomyocyte", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF THE UNITED STATES OF AMERICA, vol. 95, no. 6, 1998, pages 2979 - 2984, XP002198161, DOI: doi:10.1073/pnas.95.6.2979 |
| CONNER SD; SCHMID SL: "Regulated portals of entry into the cell", NATURE, vol. 422, no. 6927, 2003, pages 37 - 44 |
| DELEHEDDE M; DEUDON E; BOILLY B; HONDERMARCK H.: "Proteoglycans in breast cancer", PATHOLOGIE BIOLOGIE, vol. 45, 1997, pages 305 - 11 |
| DICK E; MATSA E; YOUNG LE; DARLING D; DENNING C: "Faster generation of hiPSCs by coupling high-titer lentivirus and column-based positive selection", NAT PROTOC, vol. 6, no. 6, 2011, pages 701 - 714, XP055339902, DOI: doi:10.1038/nprot.2011.320 |
| DIXON JE ET AL.: "Axolotl Nanog activity in mouse embryonic stem cells demonstrates that ground state pluripotency is conserved from urodele amphibians to mammals", DEVELOPMENT, vol. 137, no. 18, 2010, pages 2973 - 2980 |
| DIXON JE; DICK E; RAJAMOHAN D; SHAKESHEFF KM; DENNING C: "Directed differentiation of human embryonic stem cells to interrogate the cardiac gene regulatory network", MOL THER, vol. 19, no. 9, 2011, pages 1695 - 1703, XP055176812, DOI: doi:10.1038/mt.2011.125 |
| DIXON, J.E.; DICK, E.; SHAKESHEFF, K.M.; DENNING, C.: "Directed differentiation of human embryonic stem cells to interrogate the cardiac gene regulatory network", MOL. THERAPY., vol. 19, no. 9, 2011, pages 1695 - 703, XP055176812, DOI: doi:10.1038/mt.2011.125 |
| DIXON, J.E.; SHAH, D.A.; ROGERS, C.; HALL, S.; WESTON, N.; MCNALLY, D.; DENNING, C.; SHAKESHEFF, K.M.: "Combined hydrogels that switch human pluripotent stem cells from self-renewal to differentiation", PNAS, vol. 111, no. 15, 2014, pages 5580 - 5, XP055177031, DOI: doi:10.1073/pnas.1319685111 |
| DO KWON Y ET AL.: "Cellular manipulation of human embryonic stem cells by TAT-PDX1 protein transduction", MOL THER, vol. 12, no. 1, 2005, pages 28 - 32, XP004974945, DOI: doi:10.1016/j.ymthe.2005.03.010 |
| DUFOURCQ J; NERI W; HENRY-TOULME N: "Molecular assembling of DNA with amphipathic peptides", FEBS LETTERS, vol. 421, 1998, pages 7 - 11, XP004261682, DOI: doi:10.1016/S0014-5793(97)01522-6 |
| EL-ANDALOUSSI S; HOLM T; LANGEL U: "Cell-penetrating peptides: Mechanisms and applications", CURR PHARM DESIGN, vol. 11, no. 28, 2005, pages 3597 - 3611, XP008081641, DOI: doi:10.2174/138161205774580796 |
| EL-SAYED A; FUTAKI S; HARASHIMA H: "Delivery of Macromolecules Using Arginine-Rich Cell-Penetrating Peptides: Ways to Overcome Endosomal Entrapment", AAPS JOURNAL, vol. 11, 2009, pages 13 - 22, XP035718989, DOI: doi:10.1208/s12248-008-9071-2 |
| ELTAHER HODA M ET AL: "Highly efficient intracellular transduction in three-dimensional gradients for programming cell fate", ACTA BIOMATERIALIA, ELSEVIER, AMSTERDAM, NL, vol. 41, 3 June 2016 (2016-06-03), pages 181 - 192, XP029666133, ISSN: 1742-7061, DOI: 10.1016/J.ACTBIO.2016.06.004 * |
| EUSTICE DC; WILHELM JM: "Mechanisms of Action of Aminoglycoside Antibiotics in Eukaryotic Protein-Synthesis", ANTIMICROB AGENTS CH, vol. 26, no. 1, 1984, pages 53 - 60 |
| FISCHER R; FOTIN-MLECZEK M; HUFNAGEL H; BROCK R: "Break on through to the other side - Biophysics and cell biology shed light on cell-penetrating peptides", CHEMBIOCHEM, vol. 6, no. 12, 2005, pages 2126 - 2142 |
| FREED ET AL.: "Biodegradable polymer scaffolds for tissue engineering", NATURE BIOTECHNOLOGY, vol. 12, 1994, pages 689 - 693 |
| GOUN EA; PILLOW TH; JONES LR; ROTHBARD JB; WENDER PA: "Molecular transporters: Synthesis of oligoguanidinium transporters and their application to drug delivery and real-time imaging", CHEMBIOCHEM, vol. 7, no. 10, 2006, pages 1497 - 1515, XP055079926, DOI: doi:10.1002/cbic.200600171 |
| GREGORY A. BIRD ET AL: "Expansion of Human and Murine Hematopoietic Stem and Progenitor Cells Ex Vivo without Genetic Modification Using MYC and Bcl-2 Fusion Proteins", PLOS ONE, vol. 9, no. 8, 29 August 2014 (2014-08-29), pages e105525, XP055284106, DOI: 10.1371/journal.pone.0105525 * |
| GUMP JM; DOWDY SF: "TAT transduction: the molecular mechanism and therapeutic prospects", TRENDS IN MOLECULAR MEDICINE, vol. 13, no. 10, 2007, pages 443 - 448, XP022299872, DOI: doi:10.1016/j.molmed.2007.08.002 |
| GUMP JM; JUNE RK; DOWDY SF: "Revised Role of Glycosaminoglycans in TAT Protein Transduction Domain-mediated Cellular Transduction", J BIOL CHEM, vol. 285, no. 2, 2010, pages 1500 - 1507 |
| HAN X; BUSHWELLER JH; CAFISO DS; TAMM LK: "Membrane structure and fusion-triggering conformational change of the fusion domain from influenza hemagglutinin", NAT STRUCT BIOL, vol. 8, no. 8, 2001, pages 715 - 720 |
| HEITZ F; MORRIS MC; DIVITA G: "Twenty years of cell-penetrating peptides: from molecular mechanisms to therapeutics", BRIT J PHARMACOL, vol. 157, no. 2, 2009, pages 195 - 206 |
| HEITZ FREDERIC ET AL: "Twenty years of cell-penetrating peptides: from molecular mechanisms to therapeutics", BRITISH JOURNAL OF PHARMACOLOGY,, vol. 157, no. 2, 1 January 2009 (2009-01-01), pages 195 - 206, XP002566600, ISSN: 0007-1188, [retrieved on 20090320], DOI: 10.1111/J.1476-5381.2008.00057.X * |
| HIDEMA S; TONOMURA Y; DATE S; NISHIMORI K: "Effects of protein transduction with intact myogenic transcription factors tagged with HIV-1 Tat-PTD (T-PTD) on myogenic differentiation of mouse primary cells", J BIOSCI BIOENG, vol. 113, no. 1, 2012, pages 5 - 11, XP028123207, DOI: doi:10.1016/j.jbiosc.2011.08.025 |
| HIGASHIYAMA S; ABRAHAM JA; KLAGSBRUN M: "Heparin-Binding Egf-Like Growth-Factor Stimulation of Smooth-Muscle Cell-Migration - Dependence on Interactions with Cell-Surface Heparan-Sulfate", J CELL BIOL, vol. 122, no. 4, 1993, pages 933 - 940, XP002317108, DOI: doi:10.1083/jcb.122.4.933 |
| HODA M ELTAHER ET AL: "Intracellular transduction of proteins in three dimensional gradients", EUROPEAN CELLS AND MATERIALS, 1 January 2014 (2014-01-01), pages 84, XP055177029, Retrieved from the Internet <URL:http://www.researchgate.net/profile/Hoda_Eltaher/publication/271511473_Intracellular_transduction_of_proteins_in_three_dimensional_gradients/links/54ca11490cf2002b93ca9f86.pdf> [retrieved on 20150317] * |
| J CONTROL RELEASE, vol. 107, no. 3, pages 571 - 572 |
| J. R. AGUILA ET AL: "SALL4 is a robust stimulator for the expansion of hematopoietic stem cells", BLOOD, vol. 118, no. 3, 20 May 2011 (2011-05-20), pages 576 - 585, XP055092565, ISSN: 0006-4971, DOI: 10.1182/blood-2011-01-333641 * |
| JAMES E DIXON ET AL: "Get: glycosaminoglycan (gag)-binding enhanced transduction of functional proteins", EUROPEAN CELLS AND MATERIALS, 1 January 2014 (2014-01-01), pages 63, XP055177030, Retrieved from the Internet <URL:http://www.ecmjournal.org/journal/supplements/vol028supp04/pdf/Vol028Supp04a063.pdf> [retrieved on 20150317] * |
| JAMES E. DIXON ET AL: "Highly efficient delivery of functional cargoes by the synergistic effect of GAG binding motifs and cell-penetrating peptides", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES, vol. 113, no. 3, 5 January 2016 (2016-01-05), US, pages E291 - E299, XP055290762, ISSN: 0027-8424, DOI: 10.1073/pnas.1518634113 * |
| JAMES E; DIXON GM; NINA LANE; CHRIS DENNING; KEVIN M., SHAKESHEFF HIGHLY EFFICIENT DELIVERY OF FUNCTIONAL PROTEINS BY THE SYNERGISTIC EFFECT OF GAG BINDING MOTIFS AND CELL-PENETRATING PEPTIDES, 2014 |
| JENNISKENS ET AL., THE JOURNAL OF NEUROSCIENCE, vol. 20, no. 11, 2000, pages 4099 - 4111 |
| JI, S ET AL.: "RGD-conjugated albumin nanoparticles as a novel delivery vehicle in pancreatic cancer therapy", CANCER BIOLOGY & THERAPY, vol. 13, no. 4, 2012, pages 206 |
| JIN, H.J.; BAE, Y.K.; KIM, M.; KWON, S-J.; JEON, H.B.; CHOI, S.J.; KIM, S.W.; YANG, Y.S.; OH, W.; CHANG, J. W.: "Comparative Analysis of Human Mesenchymal Stem Cells from Bone Marrow, Adipose Tissue, and Umbilical Cord Blood as sources of Cell Therapy", IJMS, vol. 14, 2013, pages 17986 - 18001, XP055202899, DOI: doi:10.3390/ijms140917986 |
| KAPLAN IM; WADIA JS; DOWDY SF, CATIONIC TAT PEPTIDE TRANSDUCTION DOMAIN ENTERS CELLS BY MACROPINOCYTOSIS, vol. 102, 2005, pages 247 |
| KIM D ET AL.: "Generation of human induced pluripotent stem cells by direct delivery of reprogramming proteins", CELL STEM CELL, vol. 4, no. 6, 2009, pages 472 - 476, XP002564507, DOI: doi:10.1016/j.stem.2009.05.005 |
| LAWRENCE R; LU H; ROSENBERG RD; ESKO JD; ZHANG LJ: "Disaccharide structure code for the easy representation of constituent oligosaccharides from glycosaminoglycans", NAT METHODS, vol. 5, no. 4, 2008, pages 291 - 292 |
| LIANG QL; MO ZY; LI XF; WANG XX; LI RM: "Pdx1 protein induces human embryonic stem cells into the pancreatic endocrine lineage", CELL BIOL INT, vol. 37, no. 1, 2013, pages 2 - 10 |
| LIN X ET AL.: "Disruption of gastrulation and heparan sulfate biosynthesis in EXT1-deficient mice", DEV BIOL, vol. 224, no. 2, 2000, pages 299 - 311 |
| LINDBERG ET AL., INTERNATIONAL JOURNAL OF PHARMACEUTICS, vol. 441, 2013, pages 242 - 247 |
| LIU NQ ET AL.: "Human immunodeficiency virus type 1 enters brain microvascular endothelia by macropinocytosis dependent on lipid rafts and the mitogen-activated protein kinase signaling pathway", J VIROL, vol. 76, no. 13, 2002, pages 6689 - 6700 |
| MA DX; SHI NQ; QI XR: "Distinct transduction modes of arginine-rich cell-penetrating peptides for cargo delivery into tumor cells", INTERNATIONAL JOURNAL OF PHARMACEUTICS, vol. 419, 2011, pages 200 - 8, XP028306630, DOI: doi:10.1016/j.ijpharm.2011.08.001 |
| MA Y; GONG C; MA YL; FAN FK; LUO MJ; YANG F ET AL.: "Direct cytosolic delivery of cargoes in vivo by a chimera consisting of D- and L-arginine residues", JOURNAL OF CONTROLLED RELEASE, vol. 162, 2012, pages 286 - 94 |
| MARKIDES, H ET AL.: "Whole body tracking of superparamagnetic iron oxide nanoparticle labelled cells - a rheumatoid arthritis mouse model", STEM CELL RES & THER, vol. 4, 2013, pages 126, XP021167434, DOI: doi:10.1186/scrt337 |
| MATSUBARA Y; CHIBA T; KASHIMADA K; MORIO T; TAKADA S; MIZUTANI S ET AL.: "Transcription activator-like effector nuclease-mediated transduction of exogenous gene into IL2RG locus", SCIENTIFIC REPORTS, 2014, pages 4 |
| MEADE BR; DOWDY SF: "Exogenous siRNA delivery using peptide transduction domains/cell penetrating peptides", ADV DRUG DELIVER REV, vol. 59, no. 2-3, 2007, pages 134 - 140 |
| MEDINA D; MOSKOWITZ N; KHAN S; CHRISTOPHER S; GERMINO J: "Rapid purification of protein complexes from mammalian cells", NUCLEIC ACIDS RES, vol. 28, no. 12, 2000 |
| MEIER O ET AL.: "Adenovirus triggers macropinocytosis and endosomal leakage together with its clathrin-mediated uptake", J CELL BIOL, vol. 158, no. 6, 2002, pages 1119 - 1131, XP002526955, DOI: doi:10.1083/JCB.200112067 |
| MITCHELL DJ; KIM DT; STEINMAN L; FATHMAN CG; ROTHBARD JB: "Polyarginine enters cells more efficiently than other polycationic homopolymers", JOURNAL OF PEPTIDE RESEARCH, vol. 56, 2000, pages 318 - 25 |
| NAKASE I; NIWA M; TAKEUCHI T; SONOMURA K; KAWABATA N; KOIKE Y ET AL.: "Cellular uptake of arginine-rich peptides: Roles for macropinocytosis and actin rearrangement", MOLECULAR THERAPY, vol. 10, 2004, pages 1011 - 22, XP004651492, DOI: doi:10.1016/j.ymthe.2004.08.010 |
| NAKASE I; TAKEUCHI T; TANAKA G; FUTAKI S: "Methodological and cellular aspects that govern the internalization mechanisms of arginine-rich cell-penetrating peptides", ADV DRUG DELIVER REV, vol. 60, no. 4-5, 2008, pages 598 - 607, XP022476849, DOI: doi:10.1016/j.addr.2007.10.006 |
| NICHOLS BJ; LIPPINCOTT-SCHWARTZ J: "Endocytosis without clathrin coats", TRENDS CELL BIOL, vol. 11, no. 10, 2001, pages 406 - 412 |
| NORBURY CC; HEWLETT LJ; PRESCOTT AR; SHASTRI N; WATTS C: "Class I MHC presentation of exogenous soluble antigen via macropinocytosis in bone marrow macrophages", IMMUNITY, vol. 3, no. 6, 1995, pages 783 - 791, XP000674246, DOI: doi:10.1016/1074-7613(95)90067-5 |
| NOVAK A; GUO CY; YANG WY; NAGY A; LOBE CG: "Z/EG, a double reporter mouse line that expresses enhanced green fluorescent protein upon Cre-mediated excision", GENESIS, vol. 28, no. 3-4, 2000, pages 147 - 155, XP055011683, DOI: doi:10.1002/1526-968X(200011/12)28:3/4<147::AID-GENE90>3.0.CO;2-G |
| OKAMOTO T ET AL.: "Clonal heterogeneity in differentiation potential of immortalized human mesenchymal stem cells", BIOCHEM BIOPH RES CO, vol. 295, no. 2, 2002, pages 354 - 361, XP002963413, DOI: doi:10.1016/S0006-291X(02)00661-7 |
| OKAMOTO, T.; AOYAMA, T.; NAKAYAMA, T.; NAKAMATA, T.; HOSAKA, T.; NISHIJO, K.; NAKAMURA, T.; KIYONO, T.; TOGUCHIDA, J.: "Clonal heterogeneity in differentiation potential of immortalised human mesenchymal stem cells", BIOCHEM. BIOPHYS. RES. COM., vol. 295, 2002, pages 354 - 361, XP002963413, DOI: doi:10.1016/S0006-291X(02)00661-7 |
| OLIVER JM; BERLIN RD; DAVIS BH: "Use of Horseradish-Peroxidase and Fluorescent Dextrans to Study Fluid Pinocytosis in Leukocytes", METHOD ENZYMOL, vol. 108, 1984, pages 336 - 347 |
| PARELKAR SS; LETTERI R; CHAN-SENG D; ZOLOCHEVSKA O; ELLIS J; FIGUEIREDO M ET AL.: "Polymer-Peptide Delivery Platforms: Effect of Oligopeptide Orientation on Polymer-Based DNA Delivery", BIOMACROMOLECULES, vol. 15, 2014, pages 1328 - 36 |
| PENG ET AL.: "targeted magnetic iron oxide nanoparticles for tumour imaging and therapy", INT. J. OFNANOMED., vol. 3, 2008, pages 311 |
| ROBINTON DA; DALEY GQ: "The promise of induced pluripotent stem cells in research and therapy", NATURE, vol. 481, no. 7381, 2012, pages 295 - 305, XP055050160, DOI: doi:10.1038/nature10761 |
| SAEED, A.; FRANCINI, N.; WHITE, L.; DIXON, J. E.; GOULD, T.; RASHIDI, H.; CHEIKH AL GHANAMI, R.; HRUSCHKA, V.; REDL, H.; SAUNDERS,: "A Thermoresponsive and Magnetic Colloid for 3D Cell Expansion and Reconfiguration", ADVANCED MATERIALS, vol. 27, no. 4, 2014, pages 662 - 8 |
| SAKUMA T; HIGASHIYAMA S; HOSOE S; HAYASHI S; TANIGUCHI N: "CD9 antigen interacts with heparin-binding EGF-like growth factor through its heparin-binding domain", JOURNAL OF BIOCHEMISTRY, vol. 122, no. 2, 1997, pages 474 - 480, XP002969209 |
| SALEH AF; AOJULA H; ARTHANARI Y; OFFERMAN S; ALKOTAJI M; PLUEN A: "Improved Tat-mediated plasmid DNA transfer by fusion to LK15 peptide", JOURNAL OF CONTROLLED RELEASE, vol. 143, 2010, pages 233 - 42 |
| SAMPATH P; POLLARD TD: "Effects of Cytochalasin, Phalloidin, and Ph on the Elongation of Actin-Filaments", BIOCHEMISTRY-US, vol. 30, no. 7, 1991, pages 1973 - 1980 |
| SCHAMHART DHJ; KURTH KH: "Role of proteoglycans in cell adhesion of prostate cancer cells: From review to experiment", UROLOGICAL RESEARCH, vol. 25, 1997, pages S89 - S96 |
| SCHLORF, T ET AL.: "Biological properties of iron oxide nanoparticles for cellular and molecular magnetic resonance imaging", INT. J. MOL. SCI., vol. 12, 2011, pages 12 |
| SEGLEN PO; GRINDE B; SOLHEIM AE: "Inhibition of the Lysosomal Pathway of Protein-Degradation in Isolated Rat Hepatocytes by Ammonia, Methylamine, Chloroquine and Leupeptin", EURJ BIOCHEM, vol. 95, no. 2, 1979, pages 215 - 225 |
| SHAO C; SHI XF; PHILLIPS JJ; ZAIA J.: "Mass Spectral Profiling of Glycosaminoglycans from Histological Tissue Surfaces", ANALYTICAL CHEMISTRY, vol. 85, 2013, pages 10984 - 91 |
| SHIRAISHI T; NIELSEN PE: "Enhanced delivery of cell-penetrating peptide-peptide nucleic acid conjugates by endosomal disruption", NATURE PROTOCOLS, vol. 1, 2006, pages 633 - 6 |
| SINGH, A; SAHOO, S: "Magnetic Nanoparticles: a novel platform for theranostics", DRUG DISC TODAY, 2013 |
| SKEHEL JJ; CROSS K; STEINHAUER D; WILEY DC: "Influenza fusion peptides", BIOCHEM SOC T, vol. 29, 2001, pages 623 - 626 |
| SMITH KP; LUONG MX; STEIN GS: "Pluripotency: Toward a Gold Standard for Human ES and iPS Cells", J CELL PHYSIOL, vol. 220, no. 1, 2009, pages 21 - 29 |
| SMITS ET AL., METHODS IN ENZYMOLOGY, vol. 416, 2006, pages 61 - 87 |
| SUN, C; LEE, J; ZHANG, M: "Magnetic Nanoparticles in MR Imaging and drug delivery", ADV DRUG DELI REV, vol. 60, 2008, pages 1253 |
| TAKAHASHI K ET AL.: "Induction of pluripotent stem cells from adult human fibroblasts by defined factors", CELL, vol. 131, no. 5, 2007, pages 861 - 872, XP002555952, DOI: doi:10.1016/j.cell.2007.11.019 |
| TANAKA K; KANAZAWA T; OGAWA T; SUDA Y; TAKASHIMA Y; FUKUDA T ET AL.: "A Novel, Bio-Reducible Gene Vector Containing Arginine and Histidine Enhances Gene Transfection and Expression of Plasmid DNA", CHEMICAL & PHARMACEUTICAL BULLETIN, vol. 59, 2011, pages 202 - 7 |
| THOMPSON KE; BASHOR CJ; LIM WA; KEATING AE: "SYNZIP Protein Interaction Toolbox: in Vitro and in Vivo Specifications of Heterospecific Coiled-Coil Interaction Domains", ACS SYNTHETIC BIOLOGY, vol. 1, 2012, pages 118 - 29, XP055285294, DOI: doi:10.1021/sb200015u |
| THOMPSON SA ET AL.: "Characterization of Sequences within Heparin-Binding Egf-Like Growth-Factor That Mediate Interaction with Heparin", J BIOL CHEM, vol. 269, no. 4, 1994, pages 2541 - 2549, XP000578210 |
| WADIA JS; STAN RV; DOWDY SF: "Transducible TAT-HA fusogenic peptide enhances escape of TAT-fusion proteins after lipid raft macropinocytosis", NAT MED, vol. 10, no. 3, 2004, pages 310 - 315, XP002477563, DOI: doi:10.1038/nm996 |
| WANG, Z; CUSCHIERI A: "Tumor cell labelling by magnetic nanoparticles with determination of intracellular iron content and spatial distribution of the intracellular iron", INT. J. MOL. SCI, vol. 14, 2013, pages 9111 |
| WARREN L ET AL.: "Highly Efficient Reprogramming to Pluripotency and Directed Differentiation of Human Cells with Synthetic Modified mRNA", CELL STEM CELL, vol. 7, no. 5, 2010, pages 618 - 630, XP002693059, DOI: doi:10.1016/J.STEM.2010.08.012 |
| WARREN, L.; MANOS, P. D.; AHFELDT, T.; LOH, Y-H.; LI, H.; LAU, F.; EBINA, W.; MANDAL, P. K.; SMITH, Z. D.; MEISSNER, A.: "Highly efficient reprogramming to pluripotency and directed differentiation of human cells with synthetic mRNA", CELL STEM CELL., vol. 7, no. 5, 2010, pages 618 - 630, XP002693059, DOI: doi:10.1016/J.STEM.2010.08.012 |
| WEST MA; BRETSCHER MS; WATTS C: "Distinct Endocytotic Pathways in Epidermal Growth Factor-Stimulated Human Carcinoma A431 Cells", J CELL BIOL, vol. 109, no. 6, 1989, pages 2731 - 2739 |
| WIJNHOVEN ET AL., GLYCOCONJ J, vol. 25, 2008, pages 177 - 185 |
| WU HM; PAN SR; CHEN MW; WU Y; WANG C; WEN YT ET AL.: "A serum-resistant polyamidoamine-based polypeptide dendrimer for gene transfection", BIOMATERIALS, vol. 32, 2011, pages 1619 - 34, XP027568280 |
| YANG HY; VONK LA; LICHT R; VAN BOXTEL AMG; BEKKERS JEJ; KRAGTEN AHM ET AL.: "Cell type and transfection reagent-dependent effects on viability, cell content, cell cycle and inflammation of RNAi in human primary mesenchymal cells", EUROPEAN JOURNAL OF PHARMACEUTICAL SCIENCES, vol. 53, 2014, pages 35 - 44, XP028828423, DOI: doi:10.1016/j.ejps.2013.12.006 |
| YU JY; CHAU KF; VODYANIK MA; JIANG JL; JIANG Y: "Efficient Feeder-Free Episomal Reprogramming with Small Molecules", PLOS ONE, vol. 6, no. 3, 2011, XP055015366, DOI: doi:10.1371/journal.pone.0017557 |
| ZHANG X; HU HM; LIU TB; YANG YY; PENG YF; CAI QQ ET AL.: "Multi-armed poly(L-glutamic acid)-graft-polypropyleneinime as effective and serum resistant gene delivery vectors", INTERNATIONAL JOURNAL OF PHARMACEUTICS, vol. 465, 2014, pages 444 - 54, XP028837218, DOI: doi:10.1016/j.ijpharm.2014.02.041 |
| ZHANG, C ET AL.: "Specific Targeting of Tumor Angiogenesis by RGD-Conjugated Ultrasmall Superparamagnetic Iron Oxide Particles Using a Clinical 1.5-T Magnetic Resonance Scanner", CAN. RES., vol. 67, 2007, pages 1555, XP002483668, DOI: doi:10.1158/0008-5472.CAN-06-1668 |
| ZHOU HY ET AL., GENERATION OF INDUCED PLURIPOTENT STEM CELLS USING RECOMBINANT PROTEINS, vol. 4, 2009, pages 381 |
Also Published As
| Publication number | Publication date |
|---|---|
| GB201511158D0 (en) | 2015-08-05 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US11672870B2 (en) | Transduction | |
| US12286632B2 (en) | Rationally-designed synthetic peptide shuttle agents for delivering polypeptide cargos from an extracellular space to the cytosol and/or nucleus of a target eukaryotic cell, uses thereof, methods and kits relating to same | |
| Kerkis et al. | Crotamine is a novel cell‐penetrating protein from the venom of rattlesnake Crotalus durissus terrificus | |
| US8273867B2 (en) | Transducible delivery of siRNA by dsRNA binding domain fusions to PTD/CPPS | |
| Mie et al. | Intracellular delivery of antibodies using TAT fusion protein A | |
| US11702462B2 (en) | Gene transfer systems for stem cell engineering | |
| EP2470664A2 (en) | A NOVEL PROTEIN DELIVERY SYSTEM TO GENERATE INDUCED PLURIPOTENT STEM (iPS) CELLS OR TISSUE-SPECIFIC CELLS | |
| JP2018507865A (en) | Targeted transplantation of mitochondria into hepatocytes | |
| EP3313983B1 (en) | Controlled cell delivery vehicle and treatment of tumours | |
| Qu et al. | Peptide-based vector of VEGF plasmid for efficient gene delivery in vitro and vessel formation in vivo | |
| Manceur et al. | Flow cytometric screening of cell-penetrating peptides for their uptake into embryonic and adult stem cells | |
| Berthoin et al. | Targeted release of transcription factors for cell reprogramming by a natural micro-syringe | |
| WO2016207637A1 (en) | Cell modification and application in therapy | |
| KR20150025524A (en) | Cell permeable Fusion protein for Facilitating Reprogramming inducing and Use Thereof | |
| WO2014164684A1 (en) | Protein delivery systems | |
| HK40118619A (en) | Rationally-designed synthetic peptide shuttle agents for delivering polypeptide cargos to a target eukaryotic cell, uses, methods and kits thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 16735674 Country of ref document: EP Kind code of ref document: A1 |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 16735674 Country of ref document: EP Kind code of ref document: A1 |


