WO2016203092A1 - Procedimiento para diseñar polipéptidos pseudoancestrales con características mejoradas - Google Patents
Procedimiento para diseñar polipéptidos pseudoancestrales con características mejoradas Download PDFInfo
- Publication number
- WO2016203092A1 WO2016203092A1 PCT/ES2016/070465 ES2016070465W WO2016203092A1 WO 2016203092 A1 WO2016203092 A1 WO 2016203092A1 ES 2016070465 W ES2016070465 W ES 2016070465W WO 2016203092 A1 WO2016203092 A1 WO 2016203092A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- sequence
- polypeptide
- sequences
- polypeptides
- ancestral
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/10—Processes for the isolation, preparation or purification of DNA or RNA
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/10—Processes for the isolation, preparation or purification of DNA or RNA
- C12N15/1034—Isolating an individual clone by screening libraries
- C12N15/1089—Design, preparation, screening or analysis of libraries using computer algorithms
-
- G—PHYSICS
- G16—INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR SPECIFIC APPLICATION FIELDS
- G16B—BIOINFORMATICS, i.e. INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR GENETIC OR PROTEIN-RELATED DATA PROCESSING IN COMPUTATIONAL MOLECULAR BIOLOGY
- G16B10/00—ICT specially adapted for evolutionary bioinformatics, e.g. phylogenetic tree construction or analysis
-
- G—PHYSICS
- G16—INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR SPECIFIC APPLICATION FIELDS
- G16Z—INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR SPECIFIC APPLICATION FIELDS, NOT OTHERWISE PROVIDED FOR
- G16Z99/00—Subject matter not provided for in other main groups of this subclass
Definitions
- the present invention is framed in the field of protein engineering.
- it is useful for obtaining modified polypeptides with improved characteristics (in terms of stability and function) with a view to their biotechnological applications, directly or as a starting point for rational design or laboratory-directed evolution. Since the vast majority of biomedical and industrial applications of proteins require variants with improved characteristics, the invention can find application in various sectors (detergents, textile industry, pharmaceutical industry, food industry, etc.).
- Stage 1 A certain number of sequences corresponding to a protein in different current organisms is obtained from a search in a sequence database.
- Stage 3 A simple evolutionary model is used to obtain reasonable approximations to the sequences in the internal nodes of the tree, that is, the ancestral sequences are reconstructed. • Stage 4. Finally, the usual molecular biology techniques are used to prepare in the laboratory the proteins encoded by the reconstructed ancestral sequences, which is commonly known in the field as "resuscitating" the ancestral proteins.
- Enzymes are polypeptides that have numerous biotechnological applications (textile industry, food industry, pharmaceutical industry, detergents, animal feed, paper processing, etc.) and biomedical (monoclonal antibodies, hormones, etc.).
- Proteins 82: 887-896 that the consensus method captures ancestral extreme properties (particularly enzymatic promiscuity and thermostability) in a very limited way, limiting or decreasing the interest of using such consensus variants before a possible industrial application when compared with the respective ancestral variants.
- a subject of the present invention is a method for obtaining sequences encoding pseudoancestral polypeptides, hereinafter "method of the invention” that does not use a phylogenetic analysis, where "pseudoancestral polypeptide” (from English “ancestral-like”) is understood to those polypeptides obtained by the process of the invention without the need to perform a phylogenetic analysis, and which generally capture ancestral extreme properties such as hyperstability and promiscuity of substrate.
- a second object of the invention is a polypeptide synthesis / production process comprising obtaining the polypeptide sequence by the first method of the invention, hereinafter "polypeptide production process of the invention” or “production method of the invention”.
- a third object of the invention relates to the pseudoancestral polypeptides obtained with the production process of the invention, which are not described in the state of the art and have improved ancestral properties that make them interesting for industrial application.
- a fourth object of the invention is a computer program comprising instructions for making a computer carry out the process of the invention.
- Another object of the invention is a computer-readable storage medium comprising program instructions capable of causing a computer to carry out the process of the invention.
- Another object of the invention relates to a transmissible signal comprising program instructions capable of causing a computer to carry out the process of the invention.
- Figure 1 Representation of the evolutionary / phylogenetic tree of the S 0 'sequence, corresponding to the ancestral protein from which the set of proteins with S 1 sequences has evolved ; S 2 , S N.
- the intermediate nodes correspond to proteins with sequences S, S ' 2 , ..., S' T.
- Figure 2. Representation of the star tree of the pseudoancestral or central sequence, S 0 , corresponding to the pseudoancestral polypeptide from which the set of polypeptides with S 1 sequences has evolved ; S 2 , S N.
- ancestral polypeptide sequence of that set will be understood as any polypeptide sequence from which all elements of said set have evolved.
- Polypeptide sequence pseudoancestral to those sequences obtained by the methodology described in this patent from current polypeptide sequences.
- Current polypeptide sequences means the polypeptide sequences used to calculate the pseudoancestral sequences. By way of example, sequences belonging to modern organisms that still exist in nature, or having been extinguished, their sequences are currently available.
- “Phylogenetic tree” ( Figure 1) means a tree-shaped diagram showing the evolutionary relationships between various species or other entities that are believed to have a common ancestry.
- “Star tree” ( Figure 2) means a tree-shaped diagram that has a single origin (called “central sequence ') to which the rest of the elements of the diagram are connected.
- central sequence ' a single origin to which the rest of the elements of the diagram are connected.
- this representation dispenses with all the intermediate sequences that would form the tree, that is, each current sequence will be directly connected to a hypothetical common pseudo-ancestor, thus avoiding the need for include the intermediate nodes in each path, which complicate the analysis.
- Sequence alignment shall be understood as the way to represent and compare two or more primary polypeptide sequences to highlight their areas of similarity, which could indicate functional or evolutionary relationships between the genes or polypeptides consulted.
- the aligned sequences are written with the letters (representing amino acids or nucleotides) in rows of a matrix in which, if necessary, spaces (in English, "gaps") are inserted so that the areas with the same or similar structure align.
- Global alignments which attempt to align each residue of each sequence, are most useful when the initial problem sequences are similar and approximately the same size (it does not mean that the global alignments cannot end in gaps).
- a general global alignment strategy is the Needleman-Wunsch algorithm based on dynamic programming.
- Local alignments are more useful for differentiated sequences in which it is suspected that there are very similar regions or motifs of similar sequences within a larger context.
- the Smith-Waterman algorithm is a general method of local alignment based on dynamic programming. With sufficiently similar sequences, there is no difference between global and local alignments.
- Hybrid methods known as “semiglobales” or “glocal” methods try to find the best possible alignment that includes the beginning and end of one or another sequence. It can be especially useful when the "upstream” part of a sequence overlaps the "downstream” part of the other. In this case, neither the global nor the local alignment is completely adequate: a global alignment will attempt to force the alignment to extend beyond the overlapping region, while the local alignment will not completely cover the overlapping region.
- the method of the invention is based on an alignment of the sequences of the polypeptides for which a pseudo-ancestral polypeptide is to be calculated.
- the process of the invention will use as a starting point a global sequence alignment.
- an alignment, preferably globally, of the current N polypeptide sequences is performed: S 1; S 2 , S N , using freely available bioinformatics tools, such as Clustal W [Thompson JD, Higgins DG, Gibson TJ (1994) CLUSTAL W: improving the sensitivity of progressive multiple sequence alignment through sequence weighting, position-specific gap penalties and weight matrix choice Nucleic Acids Research 22 (22): 4673-4680]. All sequences after alignment have the same length, L, which corresponds to the number of amino acids plus gaps or gaps generated in the alignment.
- amino acid found in position j of a sequence will be called A ⁇ , so an aligned sequence can be represented as
- the amino acid present in the position and the sequence S ⁇ will be identified as A ⁇ 7 .
- the amino acid present at position j of the pseudoancestral sequence, S 0 is identified as A 0y .
- the known ancestral protein calculation procedures need a complex edition of the initial alignment.
- the process of the invention avoids having to make modifications to the alignment.
- the first object of the invention is to obtain pseudoancestral polypeptides that have the extreme and biotechnological properties of ancestral polypeptides, such as substrate promiscuity and thermostability, but avoiding the derivation stage of the phylogenetic tree that includes the methods of reconstruction of ancestral sequences since said stage constitutes a very serious limitation to the biotechnological application of the reconstruction / resurrection of ancestral polypeptides.
- the method of the invention calculates the sequence of the pseudoancestral polypeptide, S 0 , or "center sequence, from a maximum likelihood estimate based on the following hypothesis:
- ⁇ ti ⁇ ⁇ Si
- t (5 w ) ⁇ is the set of the branch lengths that connect S 0 with each of the aligned sequences of departure;
- P Ai j ⁇ A 0j , ts is the probability of observing the amino acid present in position j of the sequence S ⁇ , fixed the amino acid present in that position in the central sequence, S 0 , and the length of the connecting branch S 0 with S ⁇ , t (S ⁇ ); and w (S 1 ), w (S 2 ), w (S N ) are a set of statistical weights for the current sequences that can be used to correct the fact that groups of similar sequences can distort the analysis.
- the procedure not only calculates the hypothetical pseudoancestral sequence for given starting sequences and branch lengths, but explores the space of the branch lengths and finds the optimum branch length (i.e., the one that maximizes the likelihood) for each sequence current given.
- the probabilities are calculated from amino acid substitution matrices and average frequencies thereof using a continuous time Markov chain, as described in the literature [Whelan, S., and N. Goldman. 2001. A general empirical model of protein evolution derived from multiple protein families using a maximum-likelihood approach. Mol. Biol. Evol. 18: 691-699; Huelsenbeck, Ronquist, Bayesian analysis of molecular evolution using MrBayes. In: Nielsen, R. (ed.), Statistical Methods in Molecular Evolution. Springer, New York, 2005].
- a continuous-time Markov model is used [Felsenstein J (1981) Evolutionary trees from DNA sequences: a maximum likelihood approach. Journal of Molecular Evolution 17: 368-376] with an amino acid substitution matrix that allows obtaining the probability of the modern amino acid at each position of each current sequence given the ancestral amino acid and the length of the branch that connects the current and the hypothetical ancestral sequence .
- the weights w (S 1 ), w (S 2 ), w (S N ) are calculated so that the weight of a sequence that is part of one of those groups contributes differently to the final sequence.
- the weights of all sequences are equal to 1.
- the optimal central sequence, S 0 is that which maximizes the likelihood defined in equation 1.
- a fourth object of the invention is a computer program comprising instructions for making a computer carry out the process of the invention.
- the invention encompasses computer programs that may be in the form of source code, object code or intermediate code between source code and object code, such as partially compiled form, or in any other form suitable for use in the implementation of the processes according to the invention.
- Computer programs also encompass cloud applications that implement the method of the invention.
- carrier medium can be any entity or device capable of carrying the program.
- the carrier means may be constituted by said cable or other device or medium.
- the carrier means could be an integrated circuit in which the program is included, the integrated circuit being adapted to execute, or to be used in the execution of, the corresponding processes.
- the programs could be incorporated into a storage medium, such as a ROM, a CD ROM or a semiconductor ROM, a USB memory, or a magnetic recording medium, for example, a floppy disk or a hard drive
- a storage medium such as a ROM, a CD ROM or a semiconductor ROM, a USB memory, or a magnetic recording medium, for example, a floppy disk or a hard drive
- the programs could be supported on a transmissible carrier signal.
- it could be an electrical or optical signal that could be transported through an electrical or optical cable, by radio or by any other means.
- another object of the invention is a storage medium readable by a computer comprising program instructions capable of causing a computer to carry out the process of the invention.
- a last object of the invention relates to a transmissible signal comprising program instructions capable of causing a computer to carry out the process of the invention.
- Another object of the invention is a process, hereinafter "method of production of the invention", of synthesis or production of a polypeptide, pseudoancestral polypeptide, from which a set of determined N polypeptides have evolved, which comprises the prior obtaining of the sequence of said pseudoancestral polypeptide by the method of the invention.
- the method for synthesizing a pseudoancestral polypeptide from which the foregoing would have evolved comprises the following steps:
- Another object of the invention relates to the pseudoancestral polypeptides obtained by the method of synthesis of the invention, hereinafter "polypeptides of the invention".
- polypeptides of the invention obtained by the method of synthesis of the invention.
- the pseudoancestral ⁇ -lactamases SecletOOO, SecletOOl, Seclet006 and Seclet012 are object of the invention. not described in the state of the art, and that have a high promiscuity of substrate and hyperstability:
- MAAEALEALAELERQSGGRLGVAVLDTASGRRIGYRADERFPMCS FKVMLAAAVLARVDQGKE QLDRRI YSKSDLVSYSPVTEKHVGNGMTVAELCAAAIQYSDNTAANLLLKQIGGPAAVTAFLR SIGDDT RLDRWEPELNTAAPGDPRDTT PAAMAATLRRLLLGDALSPASRAQLVEWMMGNKTG DNRIRAGLPAGWRVGDKTGTGDYGTTNDIAVIWPPNRAPIVLAVYFTQSQADAKARDDVIAAVA RIVVAAFLEHHHHHHHH
- polypeptides with an identity of at least 80%, 85%, 90%, 95%, 98% or 99% with any of sequences 1 to 4 and in which said Polypeptides possess similar activity and structural characteristics as ⁇ -lactamases, in particular, polypeptides with similar substrate promiscuity and hyperstability.
- a fourth object of the invention relates to polynucleotides (hereinafter “polynucleotides of the invention") encoding the polypeptides of the invention.
- polynucleotides of the invention encoding polypeptides with an identity of at least 80%, 85%, 90%, 95%, 98% or 99% with any of the sequences are subject to the invention 1 to 4 and in which the polypeptide encoded by said polynucleotides possesses similar activity and structural characteristics as ⁇ -lactamases, in particular, similar substrate promiscuity and hyperstability.
- said polypeptide has enzymatic activity.
- a fifth object of the invention relates to antibodies or fragments thereof that can bind polypeptides with any one of the aforementioned peptide sequences.
- the invention also relates to a recombinant vector, such as an expression vector, comprising a polynucleotide of the invention operably linked to a regulatory sequence, for example a promoter; a host cell that is transformed with a polynucleotide of the invention; and a method of producing a polypeptide with enzymatic activity, comprising maintaining a host cell transformed with a polynucleotide of the invention under conditions to provide peptide expression.
- a recombinant vector such as an expression vector, comprising a polynucleotide of the invention operably linked to a regulatory sequence, for example a promoter; a host cell that is transformed with a polynucleotide of the invention; and a method of producing a polypeptide with enzymatic activity, comprising maintaining a host cell transformed with a
- a particular embodiment of the invention has been carried out by implementing the method of the invention in a computer program compiled in QB64 (Quick Basic 64, a BASIC language compiler that is a C ++ transmitter).
- the program not only calculates the hypothetical ancestral sequence for given starting sequences and branch lengths, but explores the space of the branch lengths and finds the optimal branch length (that is, the one that maximizes the likelihood) for each sequence current given.
- pseudo-ancestral sequences have been calculated using different statistical weights (values between 0 and 1).
- the pseudo-ancestral variants SecletOOO (SEQ ID NO: 1), SecletOOl (SEQ ID NO: 2), Seclet006 (SEQ ID NO: 3), and Seclet012 (SEQ ID NO: 4) stand out.
- the corresponding proteins have been prepared in the laboratory, acquiring the expression plasmids in private companies encoding the corresponding gene sequences optimized for expression in Escherichia coli (TopGene Technologies).
- the enzymes were produced by a heterologous expression system and purified by one-step affinity chromatography thanks to the inclusion of a polyhistidine tail at the carboxyl end.
- Tm indicates the average denaturation temperature
Landscapes
- Life Sciences & Earth Sciences (AREA)
- Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Chemical & Material Sciences (AREA)
- Genetics & Genomics (AREA)
- Biotechnology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- General Engineering & Computer Science (AREA)
- Physics & Mathematics (AREA)
- Organic Chemistry (AREA)
- Biomedical Technology (AREA)
- Zoology (AREA)
- Wood Science & Technology (AREA)
- Biophysics (AREA)
- General Health & Medical Sciences (AREA)
- Bioinformatics & Computational Biology (AREA)
- Microbiology (AREA)
- Plant Pathology (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- Crystallography & Structural Chemistry (AREA)
- Animal Behavior & Ethology (AREA)
- Physiology (AREA)
- Evolutionary Biology (AREA)
- Medical Informatics (AREA)
- Spectroscopy & Molecular Physics (AREA)
- Theoretical Computer Science (AREA)
- Peptides Or Proteins (AREA)
- Analytical Chemistry (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
Abstract
Description
Claims
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| ESP201530877 | 2015-06-19 | ||
| ES201530877A ES2585054B1 (es) | 2015-06-19 | 2015-06-19 | Procedimiento para diseñar polipéptidos pseudoancestrales con características mejoradas |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2016203092A1 true WO2016203092A1 (es) | 2016-12-22 |
Family
ID=56994974
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/ES2016/070465 Ceased WO2016203092A1 (es) | 2015-06-19 | 2016-06-19 | Procedimiento para diseñar polipéptidos pseudoancestrales con características mejoradas |
Country Status (2)
| Country | Link |
|---|---|
| ES (1) | ES2585054B1 (es) |
| WO (1) | WO2016203092A1 (es) |
-
2015
- 2015-06-19 ES ES201530877A patent/ES2585054B1/es active Active
-
2016
- 2016-06-19 WO PCT/ES2016/070465 patent/WO2016203092A1/es not_active Ceased
Non-Patent Citations (7)
| Title |
|---|
| KLEINMAN, C.L. ET AL.: "A maximum likelihood Framework for protein design", BMC BIOINFORMATICS, vol. 7, no. 1, 2006, pages 326, XP021013840 * |
| MEIER, A ET AL.: "Automatic Prediction of Protein 3D Structures by Probabilistic Multi-template Homology Modeling.", PLOS COMPUT BIOL, vol. 11, no. 10, 23 October 2015 (2015-10-23), pages e1004343, XP055338073 * |
| MERKI, R. ET AL.: "Ancestral protein reconstruction: techniques and applications", BIOL. CHEM, IN LINE 07/08/2015, vol. 397, pages 1 - 21 * |
| RISSO, V.A. ET AL.: "Phenotypic comparisons Of consensus variants versus laboratory resurrections of Precambrian proteins", PROTEINS, vol. 82, no. 6, 2014, pages 887 - 896, XP055338068 * |
| SEMBA, Y. ET AL.: "Ancestral amino acid substitution improves the thermal stability of recombinant lignin peroxidase from white-rot fungi, Phanerochaete chrysosporium strain UAMH 3641", PROTEIN ENGINEERING, DESIGN &SELECTION, vol. 28, no. 7, 2015, pages 221 - 230, XP055338063 * |
| TOPFER, A. ET AL.: "Probabilistic Inference of Viral Quasispecies Subject to Recombination", JOURNAL OF COMPUTATIONAL BIOLOGY, vol. 20, no. 2, 2013, pages 113 - 123, XP055338069 * |
| WHELAN, S. ET AL.: "A General Empirical Model Of Protein Evolution Derived from Multiple Protein Families Using a Maximum-Likelihood Approach", MOL. BIOL. EVOL., vol. 18, no. 5, 2001, pages 691 - 699, XP002966700 * |
Also Published As
| Publication number | Publication date |
|---|---|
| ES2585054B1 (es) | 2017-07-11 |
| ES2585054A1 (es) | 2016-10-03 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| Tomaszewski et al. | New pathways of mutational change in SARS-CoV-2 proteomes involve regions of intrinsic disorder important for virus replication and release | |
| Frazao et al. | Ab initio determination of the crystal structure of cytochrome c6 and comparison with plastocyanin | |
| Lupas et al. | On the evolution of protein folds: are similar motifs in different protein folds the result of convergence, insertion, or relics of an ancient peptide world? | |
| Burroughs et al. | Anatomy of the E2 ligase fold: implications for enzymology and evolution of ubiquitin/Ub-like protein conjugation | |
| Taylor et al. | Filoviruses are ancient and integrated into mammalian genomes | |
| Davies et al. | Improved structures of full-length p97, an AAA ATPase: implications for mechanisms of nucleotide-dependent conformational change | |
| Zeke et al. | Systematic discovery of linear binding motifs targeting an ancient protein interaction surface on MAP kinases | |
| Carabias et al. | Retron-Eco1 assembles NAD+-hydrolyzing filaments that provide immunity against bacteriophages | |
| EP3089989B1 (en) | Cas9 crystals and methods of use thereof | |
| Shi et al. | The structure of L-aspartate ammonia-lyase from Escherichia coli | |
| Moser et al. | Structure of ADP-aluminium fluoride-stabilized protochlorophyllide oxidoreductase complex | |
| Persson et al. | Crystal structure analysis of a pentameric fungal and an icosahedral plant lumazine synthase reveals the structural basis for differences in assembly | |
| Tsai et al. | Insights into the mechanism and regulation of the CbbQO-type Rubisco activase, a MoxR AAA+ ATPase | |
| Burgess et al. | The structure of dynein-c by negative stain electron microscopy | |
| Squeglia et al. | Carbohydrate recognition by RpfB from Mycobacterium tuberculosis unveiled by crystallographic and molecular dynamics analyses | |
| Cissé et al. | Genomic insights into the host specific adaptation of the Pneumocystis genus | |
| Lynn et al. | Molecules illuminate morphology: phylogenomics confirms convergent evolution among ‘oligotrichous’ ciliates | |
| Gelin et al. | Screening and in situ synthesis using crystals of a NAD kinase lead to a potent antistaphylococcal compound | |
| Blanquart et al. | Resurrection of ancestral malate dehydrogenases reveals the evolutionary history of halobacterial proteins: deciphering gene trajectories and changes in biochemical properties | |
| Zielezinski et al. | Massive annotation of bacterial L-asparaginases reveals their puzzling distribution and frequent gene transfer events | |
| Mwinyi et al. | The phylogenetic position of Acoela as revealed by the complete mitochondrial genome of Symsagittifera roscoffensis | |
| Kopecky Jr et al. | Raman spectroscopy adds complementary detail to the high-resolution X-ray crystal structure of photosynthetic PsbP from Spinacia oleracea | |
| Nordquist et al. | Structural and functional characterization of the monomeric U-box domain from E4B | |
| Moreira et al. | Evolutionary history of TOPIIA topoisomerases in animals | |
| Kalra et al. | Structural, functional and phylogenetic analysis of sperm lysozyme-like proteins |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 16811077 Country of ref document: EP Kind code of ref document: A1 |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WPC | Withdrawal of priority claims after completion of the technical preparations for international publication |
Ref document number: P201530877 Country of ref document: ES Date of ref document: 20171215 Free format text: WITHDRAWN AFTER TECHNICAL PREPARATION FINISHED |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 16811077 Country of ref document: EP Kind code of ref document: A1 |