WO2016198521A1 - Fviii fusion proteins - Google Patents
Fviii fusion proteins Download PDFInfo
- Publication number
- WO2016198521A1 WO2016198521A1 PCT/EP2016/063155 EP2016063155W WO2016198521A1 WO 2016198521 A1 WO2016198521 A1 WO 2016198521A1 EP 2016063155 W EP2016063155 W EP 2016063155W WO 2016198521 A1 WO2016198521 A1 WO 2016198521A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- fviii
- seq
- domain
- fusion protein
- amino acid
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/96—Stabilising an enzyme by forming an adduct or a composition; Forming enzyme conjugates
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/745—Blood coagulation or fibrinolysis factors
- C07K14/755—Factors VIII, e.g. factor VIII C (AHF), factor VIII Ag (VWF)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
Definitions
- the present invention relates to treatment and/or prophylaxis of haemophilia using FVIII fusion proteins.
- Haemophilia A is an inherited bleeding disorder: formation of the blood clot in the patients occurs normally but the clot is unstable due to a lack of secondary thrombin formation.
- the disease is treated by intravenous injection of coagulation factor VIII (FVIII) isolated from blood or produced recombinantly.
- FVIII coagulation factor VIII
- the circulatory in vivo half life of endogenous FVIII is 12-14 hours and prophylactic treatment with FVIII is thus to be performed several times a week in order to obtain a virtually symptom-free life for the patients.
- Miao et al. (Blood, 103: 3412-3419 (2004)) discloses FVIII molecules with B domains of intermediate length (54-269 amino acids). These molecules are reported to be produced in higher yields than FVIII with shorter B domains.
- One of the FVIII compounds described by Miao et al. has a 226 amino acid B domain (amino acid 741-966) connected to the FVIII LC sequence via a dipeptide QR linker ("226aa/N6"). This compound does not comprise the processing protease recognition site, and therefore 226aa/N6 does not become processed at the B domain-light chain junction.
- WO2013160005 discloses that FVIII molecules with a B domain having a length of 100-400 amino acids have an improved bioavailability in connection with subcutaneous FVIII administration.
- the present invention relates to FVIII fusion proteins, comprising a FVIII molecule with a B domain (a full length or a truncated B domain), wherein said FVIII molecule is fused to (at least one) FVIII B domain fusion partner, wherein said FVIII B domain fusion partner(-s) is derived from the FVIII B domain and comprises 100-908 amino acids.
- FVIII fusion proteins comprising a FVIII molecule with a B domain (a full length or a truncated B domain), wherein said FVIII molecule is fused to (at least one) FVIII B domain fusion partner, wherein said FVIII B domain fusion partner(-s) is derived from the FVIII B domain and comprises 100-908 amino acids.
- the present invention furthermore relates to compositions suitable for treatment of blood clotting diseases.
- the inventors of the present invention have made the surprising observation that
- FVIII proteins can be fused with at least one additional (truncated) B domain in order to obtain a therapeutic molecule with advantageous properties.
- treatment refers to the medical therapy of any human or other vertebrate subject in need thereof. Said subject is expected to have undergone physical examination by a medical practitioner, or a veterinary medical practitioner, who has given a tentative or definitive diagnosis which would indicate that the use of said specific treatment is beneficial to treating a disease in said human or other vertebrate.
- the timing and purpose of said treatment may vary from one individual to another, according to the subject's health.
- said treatment may be prophylactic, palliative, symptomatic and/or curative.
- Compounds and pharmaceutical compositions according to the invention may be administered parenterally, such as e.g. intravenously or extravascularly (such as e.g. intradermally, intramuscularly, subcutaneously, etc). Compounds and pharmaceutical compositions according to the invention may be administered
- Factor VIII is a large, complex glycoprotein that is primarily produced by endothelial cells including liver sinusoidal endothelial cells (LSECs) and possibly also hepatocytes.
- Human FVIII codes for 2351 amino acids, including a signal peptide, and contains several distinct domains as defined by homology. There are three A- domains, a unique B-domain, and two C-domains. The domain order can be listed as NH2- A1-A2-B-A3-C1-C2-COOH.
- A2-a2-B chain is termed the heavy chain (HC) while the a3-A3-C1-C2 is termed the light chain (LC).
- the chains are connected by bivalent metal ion-bindings.
- Table 1 FVIII domains and regions. The numbering of domains, regions and single amino acid residues in the Factor VIII molecule follow the numbering of full length Factor VIII (also if the B-domain is truncated or if a fusion partner (herein a FVIII B domain fusion partner) is added to the molecule).
- the nucleotide sequence encoding full length Factor VIII encodes a B domain of 908 amino acid residues.
- the B-domain in full-length FVIII is processed, resulting in a mixture of heavy chain with different length of B-domains attached (Jankowski MA et al. Haemophilia 2007; 13: 30-37).
- rFVIII with truncated truncated B domains may comprise B domains being significantly shorter than 908 amino acids - one example of a truncated B domain is the 21 amino acid B domain linker according to SEQ ID NO 2.
- FVIII variants comprise an a3 region spanning amino acids 1655-1689 and 1658-1689 (Lind P et al. Eur J Biochem 1995; 232: 19-27). Such FVIII proteins, as well as other naturally occurring FVIII variants, are also part of the present invention.
- Endogenous FVIII molecules circulate in vivo as a pool of molecules with B domains of various sizes, the shortest having C-terminal at position 740, i.e. at the C-terminal of A2- a2, and thus contains no B domain.
- FVIII molecules with B-domains of different length all maintain procoagulant activity.
- FVIII Upon activation with thrombin, FVIII is cleaved C-terminal of A1-a1 at position 372, C-terminal of A2-a2 at position 740, and between a3 and A3 at position 1689, the latter cleavage releasing the a3 region with concomitant loss of affinity for VWF.
- the activated FVIII molecule is termed FVIIIa.
- the activation allows interaction of FVIIIa with phospholipid surfaces like activated platelets and activated factor IX (FIXa), i.e. the tenase complex is formed, allowing efficient activation of factor X (FX) resulting in thrombin generation and ultimately formation of a fibrin-stabilized haemostatic clot.
- FIXa activated factor IX
- FX factor X
- Wildtype(wt)/native FVIII is the human FVIII molecule derived from the full length sequence as shown in SEQ ID NO: 1 (amino acid 1-2332).
- FVIII includes natural allelic variants of FVIII that may exist and occur from one individual to another. It follows that FVIII fusion proteins according to the present invention are recombinantly produced proteins (rFVIII), using well known methods of production and purification. The degree and location of glycosylation, tyrosine sulfation and other post-translation modifications of FVIII occurring in the cell may therefore vary, depending on the chosen host cell and its growth conditions.
- compositions according to the present invention may comprise FVIII fusion proteins according to the present invention.
- FVIII fusion proteins herein are capable of functioning in the coagulation cascade in a manner that - on a molar basis - is functionally similar, or equivalent, to wt/endogenous FVIII, inducing the formation of FXa via interaction with FIXa on an activated platelet and supporting the formation of a blood clot.
- FVIII(a) activity can be assessed in vitro using techniques well known in the art. Clot analyses, FX activation assays (often termed chromogenic assays), thrombin generation assays and whole blood thrombo- elastography are examples of such in vitro techniques.
- FVIII molecules according to the present invention have FVIII activity that is at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, 100% or even more than 100% of that of native human FVIII.
- Native human FVIII is herein understood to be either plasma derived purified FVIII or recombinant FVIII corresponding to SEQ ID NO 1 , or a B domain truncated version thereof.
- Endogenous full length FVIII is synthesized as a single-chain precursor molecule. Prior to secretion, the precursor is cleaved into the heavy chain and the light chain.
- Recombinant FVIII can be produced by means of two different strategies. Either the heavy chain with or without the B-domain and the light chain are synthesized individually as two different polypeptide chains (two-chain strategy) or the B domain-truncated FVIII is synthesized as a single precursor polypeptide chain (single-chain strategy) that is cleaved into the heavy and light chains in the same way as the full-length FVIII precursor.
- a B domain-truncated FVIII (precursor) fusion polypeptide according to the invention produced by the single-chain strategy, the heavy and light chain moieties are often separated by a linker.
- the sequence of the B domain linker is preferably derived from the FVIII B-domain.
- the C-terminal part of the linker contains a furin recognition site resulting in intracellular processing into a heavy and a light chain.
- amino acid 1644-1648 constitutes this recognition site.
- the thrombin cleavage site leading to removal of the linker during activation of B domain-truncated FVIII is located in the a2 region C-terminal to the A2 domain.
- SEQ ID NO: 1 wt human FVIII (Ser750 residue shown in bold and underline) ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTLFVEFT DHLFNIAKPRPPWMGLLGPTIQAEVYDTWITLKNMASHPVSLHAVGVSYWKASEGAEYDD QTSQREKEDDKVFPGGSHTYVWQVLKENGPMASDPLCLTYSYLSHVDLVKDLNSGLIGALL VCREGSLAKEKTQTLHKFILLFAVFDEGKSWHSETKNSLMQDRDAASARAWPKMHTVNGY VNRSLPGLIGCHRKSVYWHVIGMGTTPEVHSIFLEGHTFLVRNHRQASLEISPITFLTAQTLL MDLGQFLLFCHISSHQHDGMEAYVKVDSCPEEPQLRMKNNEEAEDYDDDLTDSEMDVVRF DDDNSPSFIQIRSVAKKHPKTWVHYIAAEEEDWDYAPLV
- the B domain in FVIII spans amino acids 741-1648 of SEQ ID NO: 1.
- the B domain undergoes endo-proteolysis at several different sites, generating large heterogeneity in circulating plasma FVIII molecules as explained above and in Jankowski et al, Haemophilia 2007; 13: 30-37 and D'Amici et al, Electrophoresis 2010; 31 : 2730-2739 .
- the B- domain plays a role in intracellular expression of FVIII, the exact extracellular function of the heavily glycosylated B domain, if any, is unknown. What is known is that the B domain is dispensable for FVIII activity in the coagulation cascade.
- the FVIII fusion protein is produced by an expression vector encoding a FVIII molecule comprising a 21 amino acid residue linker (B domain linker) sequence with the following sequence: SEQ ID NO 2: SFSQNSRHPSQNPPVLKRHQR.
- An O-glycan is attached to the underlined S in SEQ ID NO 2 - this residue corresponds to position S750 in SEQ ID N01.
- the FVIII fusion protein herein comprises a linker sequence with the following sequence: SEQ ID NO: 3: SFSQNSRHPSQNPPVLKRHQ.
- the FVIII fusion protein herein comprises a linker sequence with the following sequence: SEQ ID NO: 4: FSQNSRHPSQNPPVLKRHQR.
- FVIII fusion protein herein are B domain/truncated FVIII variants comprising an O-glycan attached to the Ser 750 residue shown in SEQ ID NO 1.
- FVIII fusion proteins herein may be FVIII molecules comprising the full B domain, or it may be comprise a FVIII molecule with a truncated B domain.
- FVIII molecules according to the invention comprise 908, 4-908, 10-908, 15-908, 4-900, 5-900, 10-900, 15-900, 20-900, 25-900, 50-900, 100-900, 200-900, 300-900, 400-900, 500-900, 600-900, 700-900, 10-700, 15-700, 20-700, 25-700, 50-700, 100-700, 200-700, 300-700, 400-700, 500-700, 600-700, 10-500, 15-500, 20-500, 25-500, 50-500, 100-500, 200-500, 300-500, 400-500, 10-400, 15- 400, 20-400, 25-400, 50-400, 100-400, 200-400, 300-400, 10-300, 15-300, 20-300, 25-300, 50-300, 100-300, 200-
- the inventors of the present invention have made the surprising observation that fusion of a FVIII molecule with a FVIII B domain fusion partner, as defined herein, results in a FVIII fusion protein with a surprisingly long in vivo circulatory half life (T1 ⁇ 2).
- the FVIII part of this fusion protein may be a B domain truncated FVIII molecule comprising a B domain linker with an amino acid sequence selected from SEQ ID No 2, 3, or 4.
- the FVIII B domain fusion partner has a size from 100-908, 100-900, 100-800, 100-700, 100-600, 100-500, 100- 400 amino acids, preferably 150-650, more preferably 150-600, more preferably 150-550, more preferably 150-500, more preferably 150-450, more preferably 150-400, more preferably 150-350, more preferably 200-700, more preferably 200-600, more preferably 200-500, more preferably 200-400, more preferably 200-300, and most preferably about 200 to 250 amino acids.
- Such FVIII fusion proteins may or may not comprise the Ser750 residue according to SEQ ID NO 1. A simple and safe way of obtaining therapeutic FVIII molecules with advantageous properties is thus provided with the present invention.
- the FVIII B domain fusion partner according to the present invention is derived from the FVIII B domain.
- the only modification compared to the wt FVIII B domain is that the FVIII B domain fusion partner may be truncated, i.e. a region has been removed/deleted relative to the wt FVIII B domain.
- two, three or more truncations were made in the FVIII B domain fusion partner - relative to the wt FVIII B domain.
- minor amino acid modifications (1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14, or 15 point mutations in the form of amino acid alterations, -additions and/or -deletions) may be present in the FVIII B domain fusion partner - relative to the corresponding positions in the wt FVIII B domain.
- the FVIII fusion proteins according to the present invention are thus structurally similar to the native FVIII molecule in that the fusion partner is derived from the FVIII B domain rather than being derived from a heterologous molecule.
- FVIII fusion proteins according to the present invention can thus be said to be a homologous type of FVIII fusion protein with a desirable safety profile compared to heterologous FVIII fusion molecules.
- Safety in use of therapeutic FVIII molecules is particularly important in order to reduce the risk of developing patient FVIII inhibitors (FVIII neutralizing antibodies).
- the FVIII B domain fusion partner/B domain fusion partner according to the present invention can be regarded as an "additional FVIII B domain" having a size of 100-908 amino acids as described above.
- the FVIII fusion proteins according to the invention may even comprise more than one FVIII B domain fusion partners, such as e.g. two, three, or even four FVIII B domain fusion partners fused head-to-tail and/or fused to or within different domains of the FVIII molecule.
- FVIII molecules according to the present invention may thus comprise a FVIII molecule fused to two, three, or four identical or different FVIII B domain fusion partners.
- the inventors have herein made the surprising discovery that the FVIII in vivo circulatory half life can be increased by fusing a FVIII derived B domain fusion partner to a FVIII molecule. This effect may be caused by an ability of this additional FVIII B domain(-s) to interfere with various FVIII clearance receptors.
- An explanation of the apparent ability of FVIII B domain fusion partners to interfere with FVIII clearance may be that the FVIII B domain tends to fold in a less structured and compact way compared to other proteins - thus mimicking the effect of large bulky groups frequently attached to therapeutic proteins to prolong the half life thereof, such as e.g. polymeric groups (e.g.
- FVIII B domain fusion partners may have a relatively low tendency to form secondary and/or tertiary protein structures such as e.g. alpha helix, beta sheets and folded domains. Secondary structures can be measured by e.g. circular dichroism (CD). Another feature of the FVIII B domain is a tendency to be heavily
- glycosylated with N-glycans but likely also several O-glycans - this structure may provide the B domain with a large hydrodynamic volume in a similar manner as e.g. PEG polymers, polysaccharide polymers, etc.
- FVIII B domain fusion partners according to the present invention may furthermore have the advantage of being relatively homogenous in structure - in the production cell line as well as in in vivo circulation.
- An example thereof is the 226 amino acid B domain fusion partner corresponding to SEQ ID NO 11 - this FVIII B domain fusion partner tends to avoid endo-proteolytical processing. The tendency to undergo this processing can be analysed and quantified using established techniques such as e.g. HPLC, SDS-PAGE, etc.
- SEQ ID no. 8 (FVIII amino acid 741-903):
- SEQ ID no. 10 (FVIII amino acid 741 -954): SFSQNSRHPSTRQKQFNATTIPENDIEKTDPWFAHRTPMPKIQNVSSSDLLMLLRQ SPTPHGLSLSDLQEAKYETFSDDPSPGAIDSNNSLSEMTHFRPQLHHSGDMVFTPESGLQL RLNEKLGTTAATELKKLDFKVSSTSNNLISTIPSDNLAAGTDNTSSLGPPSMPVHYDSQLDTT LFGKKSSPLTESGGPLSLSEENNDSKLLESGLMN
- SEQ ID no. 28 (FVIII amino acid 741 -1461):
- Fusion proteins are proteins created through the in-frame joining of two or more DNA sequences which originally encoded FVIII and the FVIII B domain fusion partner. Translation of the fusion protein DNA sequence will result in a single protein sequence which may have functional properties derived from each of the original proteins or peptides.
- DNA sequences encoding fusion proteins may be created by standard molecular biology methods such as overlapping PCR or DNA ligation - the FVIII B domain fusion partner according to the present invention can be inserted at any position and in any domain or region as long as FVIII activity is preserved.
- the resulting fusion protein DNA sequence may be inserted into an appropriate expression vector that supports the heterologous fusion protein expression in a standard host organism.
- Fusion proteins may furthermore contain a linker or spacer peptide sequence that separates the protein or peptide parts which define the fusion protein.
- the linker or spacer peptide sequence may facilitate the correct folding of the individual protein or peptide parts and may make it more likely for the individual protein or peptide parts to retain their individual functional properties.
- Linker or spacer peptide sequences may be inserted into fusion protein DNA sequences during the in frame assembly of the individual DNA fragments that make up the complete fusion protein DNA sequence i.e. during overlapping PCR or DNA ligation.
- linker sequences according to the invention comprising repetitive GS residues include e.g.: (GS) n , (GGGS) n , (GGGGS) n , (GGGS) n (GGG), etc.
- the linker can thus be very short, e.g. 1 , 2, 3, 4, 5, 6, 7, or 8 amino acids or somewhat longer, e.g. 5-10, 5-15, 5-20, 5- 30, 5-50, 10-15, 10-20, 10-30, 10-40, 10-50, 15-20, 15-30, 15-40, 15-50 amino acids.
- compositions and formulations comprising one or more FVIII fusion proteins of the invention, formulated together with one or more
- one object of the invention is to provide a pharmaceutical formulation comprising a protein according to the invention present in a concentration from 0.25 mg/ml to 250 mg/ml, and wherein said formulation has a pH from 2.0 to 10.0.
- the formulation may further comprise one or more of a buffer system, a preservative, a tonicity agent, a chelating agent, a stabilizer, or a surfactant, as well as various combinations thereof.
- a buffer system a preservative, a tonicity agent, a chelating agent, a stabilizer, or a surfactant, as well as various combinations thereof.
- preservatives, isotonic agents, chelating agents, stabilizers and surfactants in pharmaceutical compositions is well-known to the skilled person. Reference may be made to Remington: The Science and Practice of Pharmacy, 19th edition, 1995.
- the pharmaceutical formulation is an aqueous formulation.
- aqueous formulation is typically a solution or a suspension, but may also include colloids, dispersions, emulsions, and multi-phase materials.
- aqueous formulation is defined as a formulation comprising at least 50% w/w water.
- aqueous solution is defined as a solution comprising at least 50 % w/w water
- aqueous suspension is defined as a suspension comprising at least 50 %w/w water.
- the pharmaceutical formulation is a freeze-dried
- the pharmaceutical formulation comprises an aqueous solution.
- compositions according to the present invention are preferably suitable for intravenous (IV) and/or extravascular administration (e.g. subcutaneous (sc) or intradermal administration) in prophylactic/therapeutic treatment of haemophilia.
- IV intravenous
- extravascular administration e.g. subcutaneous (sc) or intradermal administration
- Haemophilia Haemophilia/hemophilia/blood clotting diseases is a group of hereditary genetic disorders that impair the body's ability to control blood clotting or coagulation ("bleeding disorders"), which is used to stop bleeding when a blood vessel is broken.
- Haemophilia A clotting factor VIII deficiency
- Haemophilia A clotting factor VIII deficiency
- Embodiment 1 A FVIII fusion protein, comprising a FVIII molecule with a B domain (a full length or a truncated B domain), wherein said FVIII molecule is fused to a FVIII B domain fusion partner, wherein said FVIII B domain fusion partner is derived from the FVIII B domain and comprises 100-908 amino acids.
- Embodiment 2 A FVIII fusion protein according to the invention, wherein said FVIII molecule is a B domain truncated molecule with a B domain comprising 0-908, 4-908 or 15- 25 amino acids.
- the FVIII B domain may be selected from the list consisting of SEQ ID no 2, 3, and 4.
- Embodiment 3 A FVIII fusion protein according to the invention, wherein the FVIII B domain fusion partner is a truncated FVIII B domain.
- Embodiment 4 A FVIII fusion protein according to the invention, wherein said FVIII molecule is a B domain truncated FVIII molecule comprising a B domain amino acid sequence selected from the group consisting of SEQ ID NO 2, SEQ ID NO 3, and SEQ ID NO 4.
- Embodiment 5 A FVIII fusion protein according to the invention, wherein said FVIII B domain fusion partner is fused to the C-terminal end of the FVIII B domain.
- Embodiment 6 A FVIII fusion protein according to the invention, wherein said FVIII B domain fusion partner is fused to the N-terminal end of the FVIII light chain.
- Embodiment 7 A FVIII fusion protein according to the invention, wherein the FVIII B domain fusion partner is fused to the C-terminal end of the FVIII light chain.
- the FVIII B domain fusion partner can also be inserted into one or more domains within the heavy chain and/or the light chain as long as the resulting fusion protein maintains FVIII activity.
- Embodiment 8 A FVIII fusion protein according to the invention, wherein said FVIII
- B domain fusion partner comprises the amino acid sequence selected from the list consisting of: SEQ ID No 5, SEQ ID No 6, SEQ ID No 7, SEQ ID No 8, SEQ ID No 9, SEQ ID No 10, SEQ ID No 11 , SEQ ID No 12, SEQ ID No 13, SEQ ID No 14, SEQ ID No 15, SEQ ID No 16, SEQ ID No 17, SEQ ID No 18, SEQ ID No 19, SEQ ID No 20, SEQ ID No 21 , SEQ ID No 22, SEQ ID No 23, SEQ ID No 24, SEQ ID No 25, SEQ ID No 26, SEQ ID No 27, SEQ ID No 28, SEQ ID No 29, SEQ ID No 30, SEQ ID No 31 , SEQ ID No 32, SEQ ID No 33, and SEQ ID No 34.
- Embodiment 9 A FVIII fusion protein according to the invention, wherein said FVIII B domain fusion partner has a low degree of secondary and tertiary structures. Secondary and tertiary structure can be measured by e.g. Circular Dichroism (CD). Based on e.g. a CD wavelength spectrum from 190-260 nm, wherein the fingerprint of the FVIII B domain fusion partner resembles that of a disordered polypeptide having a signal minimum of 204 nm.
- the FVIII B domain fusion partner is homogenous in structure in in vivo circulation upon administration to the patient in need thereof.
- An example of a protein according to the invention having a homogenous structure is a FVIII protein fused to the FVIII B domain fusion partner according to SEQ ID NO 11.
- Embodiment 10 A pharmaceutical composition comprising a FVIII fusion protein according to the invention.
- Embodiment 11 A method for making a FVIII fusion protein according to the invention, wherein said method comprises the step of incubating a host cell under appropriate conditions, wherein said host cell comprises an expression vector that encodes a FVIII fusion protein according to the invention.
- Embodiment 12 A nucleotide molecule encoding a FVIII fusion protein according to the invention.
- Embodiment 13 An expression vector comprising a nucleotide molecule according to the invention.
- Embodiment 14 A host cell comprising an expression vector according to the invention.
- Embodiment 15 A FVIII fusion protein according to the invention, or a
- Embodiment 16 A FVIII fusion protein according to the invention, or a
- composition according to the invention for treatment of haemophilia by subcutaneous administration.
- Embodiment 17 A FVIII fusion protein according to the invention, or a
- Embodiment 18 A FVIII fusion protein according to the invention, wherein said protein comprises the amino acid sequence selected from the list consisting of: SEQ ID NO 35, SEQ ID NO 36, and SEQ ID NO 37.
- FSQNSRHPSQNPPVLKRHQR - SEQ ID NO 2 amino acids 1649-2332 of full-length wild-type human FVIII.
- the sequence of the 21 amino acid linker is derived from the FVIII B domain and consists of amino acids 741-750 and 1638-1648 of full length wild-type human FVIII.
- the F8-500-C2-linked-GS BDD FVIII molecule is identical to F8-500 except that a glycin-serine (GS) dipeptide has been added to the C-terminus of the FVIII light chain.
- GS glycin-serine
- DNA encoding fusion partners can be introduced at the C-terminus of the FVIII molecule encoded by plasmid #1742 by insertion of DNA encoding the fusion partner in Bam HI and Not I digested plasmid #1742.
- plasmid #2149 consists of pTT5 with insert encoding F8-500- C2-linked-G-FVIII(741-966) (SEQ ID no 35).
- This FVIII molecule consists of the F8-500 protein described above with a G residue followed by FVIII residue 741-966 fused to the C terminus of the FVIII light chain.
- the Bam Hi/Not I fragment from plasmid #2149 was transferred to plasmid #1679.
- the latter plasmid consists of pTT5 with insert encoding the F8-500-C2-linked- (GGGS)6 BDD FVIII molecule.
- the F8-500-C2-linked-(GGGS)6 BDD FVIII molecule is identical to F8-500 except that a (GGGS)6 peptide has been added to the C-terminus of the FVIII light chain.
- the six nucleotides immediately upstream to the stop signal constitute a Bam HI restriction site.
- the #1742 plasmid contains a Not I restriction site.
- DNA encoding fusion partners can be introduced at the C-terminus of the FVIII molecule encoded by plasmid #1679 by insertion of DNA encoding the fusion partner in Bam HI and Not I digested plasmid #1679. Insertion of the Bam Hi/Not I fragment from plasmid #2149 into plasmid #1679 resulted in plasmid #2185 consisting of pTT5 with insert encoding encoding F8-500-C2-linked-(GGGS)5-GGG-FVIII(741-966) (SEQ ID no 36).
- This FVIII molecule consists of the F8-500 protein described above with a
- Transient expression of FVIII with a B domain sequence fused to the light chain C- terminus HKB11 cells at a density of 0.9 - 1.1 x 10 6 were transfected with a complex of plasmid (0.7 mg/l or 1.0 mg/l) and the transfection agent, 293Fectin (Invitrogen) (1.0 ml/l or 1.4 ml/l).
- the transfection complex was prepared by diluting the plasmid and the transfection separately, mixing the two solutions, and incubating the mixture at room temperature for 20 minutes.
- the complex mixture was added to the cell suspension and the suspension was incubated in shaker incubator for 4 or 5 days at 36.5 °C or 37 °C and at 5 % or 8 % C0 2 .
- Cell culture supernatants were analysed by chromogenic FVIII assay as described in Example 3 and/or filtered through a 0,22 ⁇ membrane filter and utilized for purification of FVIII variant as described in Example 4.
- the FVIII activity (FVI 11 :C) of the rFVIII compound was evaluated in a chromogenic FVIII assay using Coatest SP reagents (Chromogenix) as follows: rFVIII samples and a FVIII standard (Coagulation reference, Technoclone) were diluted in Coatest assay buffer (50 mM Tris, 150 mM NaCI, 1 % BSA, pH 7.3, with preservative). Fifty ⁇ of samples, standards, and buffer negative control were added to 96-well microtiter plates (Spectraplates MB, Perkin Elmer). All samples were tested diluted 1 :100, 1 :400, 1 :1600, and 1 :6400.
- the factor IXa/factor X reagent, the phospholipid reagent and CaCI 2 from the Coatest SP kit were mixed 5:1 :3 (vol:vol:vol) and 75 ⁇ of this added to the wells. After 15 min incubation at room temperature, 50 ⁇ of the factor Xa substrate S-2765/thrombin inhibitor 1-2581 mix was added and the reactions were incubated 5 min at room temperature before 25 ⁇ 1 M citric acid, pH 3, was added. The absorbance at 405 nm was measured on an Envision microtiter plate reader (Perkin Elmer) with absorbance at 620 nm used as reference wavelength.
- the value for the negative control was subtracted from all samples and a calibration curve prepared by linear regression of the absorbance values plotted vs. FVIII concentration.
- the specific activity was calculated by dividing the activity in each supernatant with the FVIII antigen concentration determined by ELISA.
- the ELISA was a sandwich ELISA using polyclonal sheep anti-FVIII antibody for catching and the same but HRP-conjugated antibody for detection (Matched-Pair Antibody Set for ELISA of human Factor VIII antigen, Affinity Biologicals, cat. no. F8C-EIA). Purified FVIII "F8-500" was used as calibrator. Results shown in Table 2 demonstrate that FVIII activity of the fusion protein according to the invention is maintained. Table 2. Specific activities of FVIII molecules in supernatant from transiently transfected HKB11
- FVIII molecules Purification of FVIII molecules Purification of F8-500 from the supernatant of transiently transfected HKB11 cells was carried out by a three step purification method using: Affinity chromatography on a VlllSelect column (GE Health Care) followed by affinity chromatography on an F25 column (Novo Nordisk A S) and an anionic exchange chromatography column, Poros 50 HQ (GE Health Care).
- a volume of 1700 ml cell culture media as pumped onto a VlllSelect column (2.6 x 3.5 cm, Vol 7 ml) at 3 ml/min.
- the eluted F8-500 protein ended up in a pool volume of 10 ml.
- Buffer B is identical to buffer A except for the NaCI which is 1 M in buffer B.
- the eluted F8-500 protein ended up in a pool of 1 ml.
- the FVIII activity (FVI 11 :C) of the rFVIII compound was evaluated in a chromogenic FVIII assay using Coatest SP reagents (Chromogenix) as follows: rFVIII samples and a FVIII standard (e.g. purified wild-type rFVIII calibrated against the 7th international FVIII standard from NIBSC) were diluted in Coatest assay buffer (50 mM Tris, 150 mM NaCI, 1 % BSA, pH 7.3, with preservative). Fifty ⁇ of samples, standards, and buffer negative control were added to 96-well microtiter plates (Nunc) in duplicates.
- the factor IXa/factor X reagent, the phospholipid reagent and CaCI 2 from the Coatest SP kit were mixed 5:1 :3 (vohvohvol) and 75 ⁇ of this added to the wells. After 15 min incubation at room temperature 50 ⁇ of the factor Xa substrate S-2765/thrombin inhibitor 1-2581 mix was added and the reactions incubated 10 min at room temperature before 25 ⁇ 1 M citric acid, pH 3, was added. The absorbance at 415 nm was measured on a Spectramax microtiter plate reader (Molecular Devices) with absorbance at 620 nm used as reference wavelength.
- the value for the negative control was subtracted from all samples and a calibration curve prepared by curve fitting of the absorbance values plotted vs. FVIII concentration.
- the specific activity was calculated by dividing the activity of the samples with the protein concentration determined by HPLC.
- the concentration of the sample was determined by integrating the area under the peak in the chromatogram corresponding to the light chain and compare with the area of the same peak in a parallel analysis of a wild-type rFVIII, where the concentration was determined by amino acid analyses.
- the results shown in Table 3 demonstrate the FVIII with a B domain sequence fused to the light chain C-terminus has FVIII activity.
- FVI 11 :C of the rFVIII compounds was further evaluated in a one-stage FVIII clot assay as follows: rFVIII samples and a FVIII standard (e.g. purified wild-type rFVIII calibrated against the 7th international FVIII standard from NIBSC) were diluted in HBS/BSA buffer (20 mM hepes, 150 mM NaCI, pH 7.4 with 1 % BSA) to approximately 10 U/ml followed by 10-fold dilution in FVIII-deficient plasma containing VWF (Dade Behring). The samples were subsequently diluted in HBS/BSA buffer.
- a FVIII standard e.g. purified wild-type rFVIII calibrated against the 7th international FVIII standard from NIBSC
- the APTT clot time was measured on an ACL300R or an ACL5000 instrument (Instrumentation Laboratory) using the single factor program.
- FVIII-deficient plasma with VWF Dade Behring
- SynthASil HemosILTM, Instrumentation Laboratory
- the diluted sample or standard is mixed with FVIII-deficient plasma, aPTT reagents at 37°C. Calcium chloride is added and time until clot formation is determined by turbidity.
- the FVIILC in the sample is calculated based on a standard curve of the clot formation times of the dilutions of the FVIII standard. The results are shown in table 3.
- F8-500-C2-linked-(GGGS)5-GGG-FVIII(741-966) and F8-500 both produced from transiently transfected HKB11 cells were evaluated in FVIII deficient mice (FVIII KO mice) and in VWF deficient mice (VWF KO mice).
- FVIII deficient mice FVIII exon 16 knock out mice with mixed C57BI/6 and SV129 background, bred at Taconic M&B, (B6.129S4-F8tm1 Kaz/J) and VWF-deficient mice (VWF exon 4 + 5 KO mice with C57BI/6 background ((B6.129S2-VWFtm1 Wgr/J) bred at Charles River, Germany) were included in the study.
- the VWF deficient mice had app. 13% of normal FVIII chromogenic activity, while the FVIII-KO mice had no detectable FVIII chromogenic activity.
- mice A mixture of male and female mice (approximately1 :1 ) with an approximate weight of 25 grams and age range of 15-28 weeks were used.
- Blood was taken using non- coated capillary glass tubes from the orbital plexus at regular time points in the interval of 0.08-3 or 0.08-7 h post-administration, for compound F8-500-C2-linked-(GGGS)6-FVIII(741- 966) and F8-500 respectively, in VWF deficient mice and at 5, 24, 30 or 5, 24, 48 h post administration for compound F8-500 and F8-500-C2-linked-(GGGS)6-FVIII(741-966), respectively, in FVIII deficient mice.
- Three blood samples were taken from each mouse, and 2 to 63 samples were obtained at each time point. Blood was immediately stabilized with sodium citrate and diluted in four volumes FVIII Coatest SP buffer before 5 min centrifugation at 4000g.
- Plasma obtained from diluted blood was frozen on dry ice and kept at -80°C prior to analysis in the FVIII chromogenic activity assay (plasma from FVIII deficient mice) and in a FVIII antigen based LOCI assay (plasma from VWF KO mice).
- the FVIII chromogenic activity assay was analysed using CoatestSP FVIII kit, Chromogenix (#82408663). Calibration was done using purified FVIII (N8-SRM standard, batch 307.7008.09.2, Novo Nordisk) diluted appropriately in Coatest buffer to produce the following calibrator points 0, 0.25, 0.5, 1.0, 2.0, 3.0, 4.0 and 5.0 mU/ml. Minimal required dilution of plasma samples was 1 :80. All samples were analysed in duplicates in four different dilutions (1 :80, 1 :240, 1 :720 and 1 :2160) and the result was reported as mean of dilutions within the calibration range plus %CV of these results.
- Control plasma N (ORKE 41 , Siemens Health care diagnostics product GmbH) diluted appropriately extra high, high, medium and low level.
- the assay was carried out by mixing 50 ⁇ calibrator or sample with 75 ⁇ FIX mixture (FIXa/X, phospholipid and CaCI 2 reagent from the kit mixed 5+1 +3). After 15 min incubation time, 50 ⁇ Xa substrate (S-2765) was added and the enzymatic reactions were stopped after 10-15 min by addition of 25 ul stop buffer. All samples, calibrators and QC-samples were analysed in duplicates. Absorbance was read at 405 nm with 620 nm as reference using Tecan Infinite reader M200, and Magellan 6.6 for data transformation.
- the lower limit of quantification (LLOQ) in the plasma was 34 mU/ml.
- the calibration curve was fitted using 4 Parametric logistic (4PL Marquardt) in Magellan and sample results were obtained by interpolation from the calibration curve. Interpolation and estimation of %CV of duplicates was done by Magellan. %CV of double replicates should be ⁇ 10, %CV of double samples in different dilutions should be ⁇ 25.
- the FVIII antigen based LOCI assay was a homogenous bead based assay.
- LOCI reagents included two latex bead reagents and a biotinylated anti-rFVIII light chain antibody (hF8- 4F11 , Novo Nordisk).
- One of the bead reagents was a generic reagent (D-beads) and was coated with streptavidin and contains a photosensitive dye.
- the second bead reagent (A- beads) was coated with another anti-FVIII light chain antibody (hF8-4F45, Novo Nordisk).
- Table 4 and 5 list the FVIII activity levels at the specified time points for the two compounds dosed to VWF and FVIII deficient mice.
- Table 6 and 7 list the estimated pharmacokinetic parameters. In both of the mice strains F8-500-C2-linked-(GGGS)5-GGG-FVIII(741-966) has a slower elimination, i.e. a longer t 1 ⁇ 2 as compared to F8-500.
- each line represent data from one individual mouse
- each line represent data from one individual mouse
- Table 7 Estimated t 1 ⁇ 2 and 95% CI on the estimated t 1 ⁇ 2 after i.v. administration to FVIII deficient mice (based on chromogenic activity data)
- the mammalian expression vector pGB445 with insert encoding the FVIII molecule F8-500- LCN-FVIII(741-966) was generated as described in the following.
- the construction of pGB445 was carried out by combining DNA sequences from pJSV331 and pGB368.
- pJSV331 consists of pQMCF-5 with insert encoding F8-500.
- pGB368 consists of pTT5 with insert encoding amino acid 741-966 of human FVIII.
- a PCR product containing the entire nucleotide sequence of pJSV331 was generated from pJSV331 using Phusion U DNA polymerase (Thermo Fisher Scientific), the forward primer
- AGATCACUCGTACTACTCTTCAGTCTGA (SEQ ID no 38), and the reverse primer
- FVIII (741-966) was generated from pGB368 using Phusion U DNA polymerase, the forward primer ACGGAGCUTTAGCCAGAACAGCAGAC (SEQ ID no 40), and the reverse primer AGTGATCUCGGAGGACACGTTCTTGCC (SEQ ID no 41 ).
- the two overlapping PCR products were joined at both ends with the Uracil-Specific Excision Reagent enzyme (New England Biolabs) giving rise to the pGB445 plasmid consisting of pQMCF-5 with insert encoding F8-500-LCN-FVIII(741-966).
- This molecule consists of the F8-500 FVIII molecule described in Example 1 fused to amino acid 741-966 of FVIII at the N-terminus of the FVIII light chain (SEQ ID no 37).
- Portions of 1 X 10 7 CHOEBNALT85 cells in 700 ml 1 :1 CD CHO and SFM II medium were electroporated with 10 mg pGB445 in a Gene Pulser Cuvette (BioRad) using a GenePulser Xcell (Biorad). Subsequently, the cells were transferred to 125 ml Erlenmeyer flasks with 30 ml of the above growth medium and incubated in a shaker incubator at 36.5 °C and 8 % C0 2 . Five days after transfection, the culture volumes were increased 20 % by addition of CHO CD Efficient Feed B (Thermo Fisher Scientific), and the incubation temperature was reduced to 30 °C.
- Table 8 FVIII activity in FVIII-KO mice (FVIII chromogenic activity in Ill/ml). FVIII FVIII activity in samples from mice 1 (lll/mL)
- Table 9 Estimated pharmacokinetic parameters including 95% CI (based on FVIII chromogenic activity data)
- the resulting protein was expressed and purified essentially as previously described using anti- HPC4 affinity chromatography.
- FVIII(741-966)-HPC4 was prepared at a concentration of 5 ⁇ in the following buffer, 20 mM HEPES, 100 mM NaCI, 5mM EDTA, 0.005% Tween80, pH 7.5. Also, a denatured sample was prepared similarly but with the addition of 6 M guanadinium hydrochloride. 200 ⁇ of sample was loaded to a quartz cuvette with a 1 cm path length and measured on a SpectraMax M2e platereader (Molecular Devices Ltd, UK) with the following settings: excitation wavelength of 280nm, emission wavelengths of 300-450 nm with steps of 1 nm, sensitivity of 6 and a temperature of 21 °C.
- Circular dichroism The secondary structure fingerprint was measured with Far-UV circular dichroism (CD).
- FVIII(741-966)-HPC4 was prepared to 13.8 mg/ml protein in 20 mM HEPES, 100 mM NaCI, 5mM EDTA, 0.005% Tween80, pH 7.5 and loaded to a rectangular quartz CD cuvette with a 0.01 mm light path. With a Chirascan CD spectrophotometer (Applied
- 1 mm quartz cuvettes were used due to improper heating of 0.01 mm cuvettes. Due to high noise from the buffer in a 1 mm cuvette, the buffer was diluted four times and the protein concentration was diluted 100 times. This way, acceptable signal to noise was acquired from 200-260 nm. The sample was measured at 25, 50, 70 and 90°C using the settings described above. No visual aggregation was observed upon melting.
- Trp fluorescence is a sensitive reporter of tertiary structure as the wavelength corresponding to the highest intensity (A max ) shifts when the polarity of its near-environment changes. Trp residues located in a folded environment (i.e. hydrophobic) have a A max of -334 nm. When Trp is solvent-exposed (i.e. in a hydrophilic environment), the A max red-shifts to -355 nm. For FVIII(741-966)-HPC4 a A max of 355 nm is found suggesting that this residue is in a hydrophilic environment.
- Trp residues are often engaged in hydrophobic interactions, this data suggest that the two Trp residues are located in disordered regions of the polypeptide.
- evaluation of the Far-UV CD spectrum of FVIII(741-966)-HPC4 as a function of temperature indicates that there is a thermal unfolding transition occurring at higher temperatures. A dichroic point is identified when overlaying Far-UV CD spectra obtained at 25, 50, 70 and 90°C suggesting that it is a two-state thermal unfolding transition.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Genetics & Genomics (AREA)
- Zoology (AREA)
- General Health & Medical Sciences (AREA)
- Molecular Biology (AREA)
- Medicinal Chemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biochemistry (AREA)
- Wood Science & Technology (AREA)
- Engineering & Computer Science (AREA)
- Microbiology (AREA)
- General Engineering & Computer Science (AREA)
- Biomedical Technology (AREA)
- Biotechnology (AREA)
- Hematology (AREA)
- Toxicology (AREA)
- Gastroenterology & Hepatology (AREA)
- Biophysics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Peptides Or Proteins (AREA)
Abstract
The present invention relates to FVIII fusion molecules and compositions suitable for treatment of blood clotting diseases.
Description
FVIII FUSION PROTEINS
TECHNICAL FIELD
The present invention relates to treatment and/or prophylaxis of haemophilia using FVIII fusion proteins. BACKGROUND
Haemophilia A is an inherited bleeding disorder: formation of the blood clot in the patients occurs normally but the clot is unstable due to a lack of secondary thrombin formation. The disease is treated by intravenous injection of coagulation factor VIII (FVIII) isolated from blood or produced recombinantly. Current haemophilia treatment
recommendations are moving from traditional on-demand treatment towards prophylaxis.
The circulatory in vivo half life of endogenous FVIII is 12-14 hours and prophylactic treatment with FVIII is thus to be performed several times a week in order to obtain a virtually symptom-free life for the patients.
Recombinant FVIII variants with a prolonged circulatory half life (e.g. heterologous FVIIhFc fusions) are becoming available for the haemophilia patients but such compounds still need to be administered several times a week. Another frequently used strategy for prolonging FVIII circulatory half life is conjugation of FVIII, employing chemical or enzymatic methods. There is thus a need in the art for improved safe and convenient Haemophilia A therapies offering compounds with prolonged circulatory half life.
Miao et al. (Blood, 103: 3412-3419 (2004)) discloses FVIII molecules with B domains of intermediate length (54-269 amino acids). These molecules are reported to be produced in higher yields than FVIII with shorter B domains. One of the FVIII compounds described by Miao et al. has a 226 amino acid B domain (amino acid 741-966) connected to the FVIII LC sequence via a dipeptide QR linker ("226aa/N6"). This compound does not comprise the processing protease recognition site, and therefore 226aa/N6 does not become processed at the B domain-light chain junction.
WO2013160005 discloses that FVIII molecules with a B domain having a length of 100-400 amino acids have an improved bioavailability in connection with subcutaneous FVIII administration.
SUMMARY
The present invention relates to FVIII fusion proteins, comprising a FVIII molecule with a B domain (a full length or a truncated B domain), wherein said FVIII molecule is fused to (at least one) FVIII B domain fusion partner, wherein said FVIII B domain fusion partner(-s) is derived from the FVIII B domain and comprises 100-908 amino acids. Such therapeutic proteins are associated with various advantages.
The present invention furthermore relates to compositions suitable for treatment of blood clotting diseases.
DESCRIPTION
The inventors of the present invention have made the surprising observation that
FVIII proteins can be fused with at least one additional (truncated) B domain in order to obtain a therapeutic molecule with advantageous properties.
Definitions
The term "treatment", as used herein, refers to the medical therapy of any human or other vertebrate subject in need thereof. Said subject is expected to have undergone physical examination by a medical practitioner, or a veterinary medical practitioner, who has given a tentative or definitive diagnosis which would indicate that the use of said specific treatment is beneficial to treating a disease in said human or other vertebrate. The timing and purpose of said treatment may vary from one individual to another, according to the subject's health. Thus, said treatment may be prophylactic, palliative, symptomatic and/or curative.
Mode of administration: Compounds and pharmaceutical compositions according to the invention may be administered parenterally, such as e.g. intravenously or extravascularly (such as e.g. intradermally, intramuscularly, subcutaneously, etc). Compounds and pharmaceutical compositions according to the invention may be administered
prophylactically and/or therapeutically and/or on demand.
Factor VIII: Factor VIII (FVIII) is a large, complex glycoprotein that is primarily produced by endothelial cells including liver sinusoidal endothelial cells (LSECs) and possibly also hepatocytes. Human FVIII codes for 2351 amino acids, including a signal peptide, and contains several distinct domains as defined by homology. There are three A- domains, a unique B-domain, and two C-domains. The domain order can be listed as NH2-
A1-A2-B-A3-C1-C2-COOH. Small acidic regions C-terminal of the A1 (the a1 region) and A2 (the a2 region) and N-terminal of the A3 domain (the a3 region) play important roles in FVIII interaction with other coagulation proteins, including thrombin and von Willebrand factor (VWF).
During cellular processing furin cleaves prior to the a3 region. The resulting A1-a1-
A2-a2-B chain is termed the heavy chain (HC) while the a3-A3-C1-C2 is termed the light chain (LC). The chains are connected by bivalent metal ion-bindings.
Table 1 : FVIII domains and regions. The numbering of domains, regions and single amino acid residues in the Factor VIII molecule follow the numbering of full length Factor VIII (also if the B-domain is truncated or if a fusion partner (herein a FVIII B domain fusion partner) is added to the molecule).
*) The numbering of domains, regions and single amino acid residues is in accordance with uniprot:P00451. Other FVIII alleles exist as well in human populations.
**) The nucleotide sequence encoding full length Factor VIII encodes a B domain of 908 amino acid residues. During protein synthesis, the B-domain in full-length FVIII is processed, resulting in a mixture of heavy chain with different length of B-domains attached (Jankowski MA et al. Haemophilia 2007; 13: 30-37). rFVIII with truncated truncated B domains may comprise B domains being significantly shorter than 908 amino acids - one example of a truncated B domain is the 21 amino acid B domain linker according to SEQ ID NO 2.
***) Some naturally occurring FVIII variants comprise an a3 region spanning amino acids 1655-1689 and 1658-1689 (Lind P et al. Eur J Biochem 1995; 232: 19-27). Such FVIII proteins, as well as other naturally occurring FVIII variants, are also part of the present invention.
Endogenous FVIII molecules circulate in vivo as a pool of molecules with B domains of various sizes, the shortest having C-terminal at position 740, i.e. at the C-terminal of A2- a2, and thus contains no B domain. FVIII molecules with B-domains of different length all maintain procoagulant activity. Upon activation with thrombin, FVIII is cleaved C-terminal of A1-a1 at position 372, C-terminal of A2-a2 at position 740, and between a3 and A3 at position 1689, the latter cleavage releasing the a3 region with concomitant loss of affinity for VWF. The activated FVIII molecule is termed FVIIIa. The activation allows interaction of FVIIIa with phospholipid surfaces like activated platelets and activated factor IX (FIXa), i.e. the tenase complex is formed, allowing efficient activation of factor X (FX) resulting in thrombin generation and ultimately formation of a fibrin-stabilized haemostatic clot.
"Wildtype(wt)/native FVIII" is the human FVIII molecule derived from the full length sequence as shown in SEQ ID NO: 1 (amino acid 1-2332). "FVIII" includes natural allelic variants of FVIII that may exist and occur from one individual to another. It follows that FVIII fusion proteins according to the present invention are recombinantly produced proteins (rFVIII), using well known methods of production and purification. The degree and location of glycosylation, tyrosine sulfation and other post-translation modifications of FVIII occurring in the cell may therefore vary, depending on the chosen host cell and its growth conditions.
Pharmaceutical compositions according to the present invention may comprise FVIII fusion proteins according to the present invention.
Following activation, FVIII fusion proteins herein are capable of functioning in the coagulation cascade in a manner that - on a molar basis - is functionally similar, or equivalent, to wt/endogenous FVIII, inducing the formation of FXa via interaction with FIXa on an activated platelet and supporting the formation of a blood clot. FVIII(a) activity can be assessed in vitro using techniques well known in the art. Clot analyses, FX activation assays (often termed chromogenic assays), thrombin generation assays and whole blood thrombo- elastography are examples of such in vitro techniques. FVIII molecules according to the present invention have FVIII activity that is at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, 100% or even more than 100% of that of native human FVIII. "Native human FVIII" is herein understood to be either plasma derived purified
FVIII or recombinant FVIII corresponding to SEQ ID NO 1 , or a B domain truncated version thereof.
Endogenous full length FVIII is synthesized as a single-chain precursor molecule. Prior to secretion, the precursor is cleaved into the heavy chain and the light chain.
Recombinant FVIII can be produced by means of two different strategies. Either the heavy chain with or without the B-domain and the light chain are synthesized individually as two different polypeptide chains (two-chain strategy) or the B domain-truncated FVIII is synthesized as a single precursor polypeptide chain (single-chain strategy) that is cleaved into the heavy and light chains in the same way as the full-length FVIII precursor. In a B domain-truncated FVIII (precursor) fusion polypeptide according to the invention, produced by the single-chain strategy, the heavy and light chain moieties are often separated by a linker. To minimize the risk of introducing immunogenic epitopes, the sequence of the B domain linker is preferably derived from the FVIII B-domain. The C-terminal part of the linker contains a furin recognition site resulting in intracellular processing into a heavy and a light chain. In the B domain of full length FVIII, amino acid 1644-1648 constitutes this recognition site. The thrombin cleavage site leading to removal of the linker during activation of B domain-truncated FVIII is located in the a2 region C-terminal to the A2 domain. Thus, the size and amino acid sequence of the linker is unlikely to influence its removal from the remaining FVIII molecule by thrombin activation. Deletion/truncation of the B domain is often considered to be an advantage for recombinant production of FVIII. Nevertheless, parts of the B domain can be included in the B domain linker without reducing the productivity.
SEQ ID NO: 1 : wt human FVIII (Ser750 residue shown in bold and underline) ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTLFVEFT DHLFNIAKPRPPWMGLLGPTIQAEVYDTWITLKNMASHPVSLHAVGVSYWKASEGAEYDD QTSQREKEDDKVFPGGSHTYVWQVLKENGPMASDPLCLTYSYLSHVDLVKDLNSGLIGALL VCREGSLAKEKTQTLHKFILLFAVFDEGKSWHSETKNSLMQDRDAASARAWPKMHTVNGY VNRSLPGLIGCHRKSVYWHVIGMGTTPEVHSIFLEGHTFLVRNHRQASLEISPITFLTAQTLL MDLGQFLLFCHISSHQHDGMEAYVKVDSCPEEPQLRMKNNEEAEDYDDDLTDSEMDVVRF DDDNSPSFIQIRSVAKKHPKTWVHYIAAEEEDWDYAPLVLAPDDRSYKSQYLNNGPQRIGR KYKKVRFMAYTDETFKTREAIQHESGILGPLLYGEVGDTLLIIFKNQASRPYNIYPHGITDVRP LYSRRLPKGVKHLKDFPILPGEIFKYKWTVTVEDGPTKSDPRCLTRYYSSFVNMERDLASGLI GPLLICYKESVDQRGNQIMSDKRNVILFSVFDENRSWYLTENIQRFLPNPAGVQLEDPEFQA SNIMHSINGYVFDSLQLSVCLHEVAYWYILSIGAQTDFLSVFFSGYTFKHKMVYEDTLTLFPF SGETVFMSMENPGLWILGCHNSDFRNRGMTALLKVSSCDKNTGDYYEDSYEDISAYLLSKN
NAIEPRSFSQNSRHPSTRQKQFNATTIPENDIEKTDPWFAHRTPMPKIQNVSSSDLLMLLRQ SPTPHGLSLSDLQEAKYETFSDDPSPGAIDSNNSLSEMTHFRPQLHHSGDMVFTPESGLQL RLNEKLGTTAATELKKLDFKVSSTSNNLISTIPSDNLAAGTDNTSSLGPPSMPVHYDSQLDTT LFGKKSSPLTESGGPLSLSEENNDSKLLESGLMNSQESSWGKNVSSTESGRLFKGKRAHG PALLTKDNALFKVSISLLKTNKTSNNSATNRKTHIDGPSLLIENSPSVWQNILESDTEFKKVTP LIHDRMLMDKNATALRLNHMSNKTTSSKNMEMVQQKKEGPIPPDAQNPDMSFFKMLFLPES ARWIQRTHGKNSLNSGQGPSPKQLVSLGPEKSVEGQNFLSEKNKVWGKGEFTKDVGLKE MVFPSSRNLFLTNLDNLHENNTHNQEKKIQEEIEKKETLIQENWLPQIHTVTGTKNFMKNLF LLSTRQNVEGSYDGAYAPVLQDFRSLNDSTNRTKKHTAHFSKKGEEENLEGLGNQTKQIVE KYACTTRISPNTSQQNFVTQRSKRALKQFRLPLEETELEKRIIVDDTSTQWSKNMKHLTPSTL TQIDYNEKEKGAITQSPLSDCLTRSHSIPQANRSPLPIAKVSSFPSIRPIYLTRVLFQDNSSHL PAASYRKKDSGVQESSHFLQGAKKNNLSLAILTLEMTGDQREVGSLGTSATNSVTYKKVEN TVLPKPDLPKTSGKVELLPKVHIYQKDLFPTETSNGSPGHLDLVEGSLLQGTEGAIKWNEAN RPGKVPFLRVATESSAKTPSKLLDPLAWDNHYGTQIPKEEWKSQEKSPEKTAFKKKDTILSL NACESNHAIAAINEGQNKPEIEVTWAKQGRTERLCSQNPPVLKRHQREITRTTLQSDQEEID YDDTISVEMKKEDFDIYDEDENQSPRSFQKKTRHYFIAAVERLWDYGMSSSPHVLRNRAQS GSVPQFKKVVFQEFTDGSFTQPLYRGELNEHLGLLGPYIRAEVEDNIMVTFRNQASRPYSFY SSLISYEEDQRQGAEPRKNFVKPNETKTYFWKVQHHMAPTKDEFDCKAWAYFSDVDLEKD VHSGLIGPLLVCHTNTLNPAHGRQVTVQEFALFFTIFDETKSWYFTENMERNCRAPCNIQME DPTFKENYRFHAINGYIMDTLPGLVMAQDQRIRWYLLSMGSNENIHSIHFSGHVFTVRKKEE YKMALYNLYPGVFETVEMLPSKAGIWRVECLIGEHLHAGMSTLFLVYSNKCQTPLGMASGHI RDFQITASGQYGQWAPKLARLHYSGSINAWSTKEPFSWIKVDLLAPMIIHGIKTQGARQKFS SLYISQFIIMYSLDGKKWQTYRGNSTGTLMVFFGNVDSSGIKHNIFNPPIIARYIRLHPTHYSIR STLRMELMGCDLNSCSMPLGMESKAISDAQITASSYFTNMFATWSPSKARLHLQGRSNAW RPQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLTSMYVKEFLISSSQDGHQWTLFFQNGK VKVFQGNQDSFTPWNSLDPPLLTRYLRIHPQSWVHQIALRMEVLGCEAQDLY
The B domain in FVIII spans amino acids 741-1648 of SEQ ID NO: 1. The B domain undergoes endo-proteolysis at several different sites, generating large heterogeneity in circulating plasma FVIII molecules as explained above and in Jankowski et al, Haemophilia 2007; 13: 30-37 and D'Amici et al, Electrophoresis 2010; 31 : 2730-2739 . While the B- domain plays a role in intracellular expression of FVIII, the exact extracellular function of the heavily glycosylated B domain, if any, is unknown. What is known is that the B domain is dispensable for FVIII activity in the coagulation cascade. Recombinant FVIII is thus frequently produced in the form of B domain-/truncated variants. In one embodiment, the
FVIII fusion protein is produced by an expression vector encoding a FVIII molecule comprising a 21 amino acid residue linker (B domain linker) sequence with the following sequence: SEQ ID NO 2: SFSQNSRHPSQNPPVLKRHQR. An O-glycan is attached to the underlined S in SEQ ID NO 2 - this residue corresponds to position S750 in SEQ ID N01. In another embodiment, the FVIII fusion protein herein comprises a linker sequence with the following sequence: SEQ ID NO: 3: SFSQNSRHPSQNPPVLKRHQ. In another embodiment, the FVIII fusion protein herein comprises a linker sequence with the following sequence: SEQ ID NO: 4: FSQNSRHPSQNPPVLKRHQR. In another embodiment, FVIII fusion protein herein are B domain/truncated FVIII variants comprising an O-glycan attached to the Ser 750 residue shown in SEQ ID NO 1.
FVIII fusion proteins herein may be FVIII molecules comprising the full B domain, or it may be comprise a FVIII molecule with a truncated B domain. FVIII molecules according to the invention comprise 908, 4-908, 10-908, 15-908, 4-900, 5-900, 10-900, 15-900, 20-900, 25-900, 50-900, 100-900, 200-900, 300-900, 400-900, 500-900, 600-900, 700-900, 10-700, 15-700, 20-700, 25-700, 50-700, 100-700, 200-700, 300-700, 400-700, 500-700, 600-700, 10-500, 15-500, 20-500, 25-500, 50-500, 100-500, 200-500, 300-500, 400-500, 10-400, 15- 400, 20-400, 25-400, 50-400, 100-400, 200-400, 300-400, 10-300, 15-300, 20-300, 25-300, 50-300, 100-300, 200-300, 10-250, 15-250, 20-250, 25-250, 50-250, 100-250, 200-250, 10- 200, 15-200, 20-200, 25-200, 50-200, 100-200, 10-100, 15-100, 20-100, 25-100, 50-100, 10- 50, 15-50, 20-50, 10-25, 10-20, 10-15, 15-25, 15-20, 20-21 , 20-25, or 20-30 amino acids. As explained herein, such FVIII molecules are fused to a fusion partner derived from the FVIII B domain - a FVIII B domain fusion partner.
The inventors of the present invention have made the surprising observation that fusion of a FVIII molecule with a FVIII B domain fusion partner, as defined herein, results in a FVIII fusion protein with a surprisingly long in vivo circulatory half life (T½). The FVIII part of this fusion protein may be a B domain truncated FVIII molecule comprising a B domain linker with an amino acid sequence selected from SEQ ID No 2, 3, or 4. The FVIII B domain fusion partner has a size from 100-908, 100-900, 100-800, 100-700, 100-600, 100-500, 100- 400 amino acids, preferably 150-650, more preferably 150-600, more preferably 150-550, more preferably 150-500, more preferably 150-450, more preferably 150-400, more preferably 150-350, more preferably 200-700, more preferably 200-600, more preferably 200-500, more preferably 200-400, more preferably 200-300, and most preferably about 200 to 250 amino acids. Such FVIII fusion proteins may or may not comprise the Ser750 residue according to SEQ ID NO 1. A simple and safe way of obtaining therapeutic FVIII molecules with advantageous properties is thus provided with the present invention.
FVIII B domain fusion partner: The FVIII B domain fusion partner according to the present invention is derived from the FVIII B domain. Preferably, the only modification compared to the wt FVIII B domain is that the FVIII B domain fusion partner may be truncated, i.e. a region has been removed/deleted relative to the wt FVIII B domain. In other embodiments, two, three or more truncations were made in the FVIII B domain fusion partner - relative to the wt FVIII B domain. In some embodiments, minor amino acid modifications (1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14, or 15 point mutations in the form of amino acid alterations, -additions and/or -deletions) may be present in the FVIII B domain fusion partner - relative to the corresponding positions in the wt FVIII B domain. The FVIII fusion proteins according to the present invention are thus structurally similar to the native FVIII molecule in that the fusion partner is derived from the FVIII B domain rather than being derived from a heterologous molecule. FVIII fusion proteins according to the present invention can thus be said to be a homologous type of FVIII fusion protein with a desirable safety profile compared to heterologous FVIII fusion molecules. Safety in use of therapeutic FVIII molecules is particularly important in order to reduce the risk of developing patient FVIII inhibitors (FVIII neutralizing antibodies).
The FVIII B domain fusion partner/B domain fusion partner according to the present invention can be regarded as an "additional FVIII B domain" having a size of 100-908 amino acids as described above. In some embodiments, the FVIII fusion proteins according to the invention may even comprise more than one FVIII B domain fusion partners, such as e.g. two, three, or even four FVIII B domain fusion partners fused head-to-tail and/or fused to or within different domains of the FVIII molecule. FVIII molecules according to the present invention may thus comprise a FVIII molecule fused to two, three, or four identical or different FVIII B domain fusion partners.
The inventors have herein made the surprising discovery that the FVIII in vivo circulatory half life can be increased by fusing a FVIII derived B domain fusion partner to a FVIII molecule. This effect may be caused by an ability of this additional FVIII B domain(-s) to interfere with various FVIII clearance receptors. An explanation of the apparent ability of FVIII B domain fusion partners to interfere with FVIII clearance may be that the FVIII B domain tends to fold in a less structured and compact way compared to other proteins - thus mimicking the effect of large bulky groups frequently attached to therapeutic proteins to prolong the half life thereof, such as e.g. polymeric groups (e.g. poly ethylen glycol, poly sialic acid, dextran, starch, heparosan, etc.), XTEN™ polypeptides, etc. It thus follows that FVIII B domain fusion partners according to the present invention may have a relatively low
tendency to form secondary and/or tertiary protein structures such as e.g. alpha helix, beta sheets and folded domains. Secondary structures can be measured by e.g. circular dichroism (CD). Another feature of the FVIII B domain is a tendency to be heavily
glycosylated with N-glycans but likely also several O-glycans - this structure may provide the B domain with a large hydrodynamic volume in a similar manner as e.g. PEG polymers, polysaccharide polymers, etc.
Some FVIII B domain fusion partners according to the present invention may furthermore have the advantage of being relatively homogenous in structure - in the production cell line as well as in in vivo circulation. An example thereof is the 226 amino acid B domain fusion partner corresponding to SEQ ID NO 11 - this FVIII B domain fusion partner tends to avoid endo-proteolytical processing. The tendency to undergo this processing can be analysed and quantified using established techniques such as e.g. HPLC, SDS-PAGE, etc.
SEQ ID no. 5 (FVIII amino acid 741-769):
SFSQNSRHPSTRQKQFNATTIPENDIEKT
SEQ ID no. 6 (FVIII amino acid 741-794):
SFSQNSRHPSTRQKQFNATTIPENDIEKTDPWFAHRTPMPKIQNVSSSDLLMLL SEQ ID no. 7 (FVIII amino acid 741-857):
SFSQNSRHPSTRQKQFNATTIPENDIEKTDPWFAHRTPMPKIQNVSSSDLLMLLRQ SPTPHGLSLSDLQEAKYETFSDDPSPGAIDSNNSLSEMTHFRPQLHHSGDMVFTPESGLQL
SEQ ID no. 8 (FVIII amino acid 741-903):
SFSQNSRHPSTRQKQFNATTIPENDIEKTDPWFAHRTPMPKIQNVSSSDLLMLLRQ SPTPHGLSLSDLQEAKYETFSDDPSPGAIDSNNSLSEMTHFRPQLHHSGDMVFTPESGLQL RLNEKLGTTAATELKKLDFKVSSTSNNLISTIPSDNLAAGTDNTSS
SEQ ID no. 9 (FVIII amino acid 741-914):
SFSQNSRHPSTRQKQFNATTIPENDIEKTDPWFAHRTPMPKIQNVSSSDLLMLLRQ SPTPHGLSLSDLQEAKYETFSDDPSPGAIDSNNSLSEMTHFRPQLHHSGDMVFTPESGLQL RLNEKLGTTAATELKKLDFKVSSTSNNLISTIPSDNLAAGTDNTSSLGPPSMPVHYD
SEQ ID no. 10 (FVIII amino acid 741 -954):
SFSQNSRHPSTRQKQFNATTIPENDIEKTDPWFAHRTPMPKIQNVSSSDLLMLLRQ SPTPHGLSLSDLQEAKYETFSDDPSPGAIDSNNSLSEMTHFRPQLHHSGDMVFTPESGLQL RLNEKLGTTAATELKKLDFKVSSTSNNLISTIPSDNLAAGTDNTSSLGPPSMPVHYDSQLDTT LFGKKSSPLTESGGPLSLSEENNDSKLLESGLMN
SEQ ID no. 11 (FVIII amino acid 741-966) "226" amino acid B domain:
SFSQNSRHPSTRQKQFNATTIPENDIEKTDPWFAHRTPMPKIQNVSSSDLLMLLRQ SPTPHGLSLSDLQEAKYETFSDDPSPGAIDSNNSLSEMTHFRPQLHHSGDMVFTPESGLQL RLNEKLGTTAATELKKLDFKVSSTSNNLISTIPSDNLAAGTDNTSSLGPPSMPVHYDSQLDTT LFGKKSSPLTESGGPLSLSEENNDSKLLESGLMNSQESSWGKNVSS
SEQ ID no. 12 (FVIII amino acid 741 -968):
SFSQNSRHPSTRQKQFNATTIPENDIEKTDPWFAHRTPMPKIQNVSSSDLLMLLRQ SPTPHGLSLSDLQEAKYETFSDDPSPGAIDSNNSLSEMTHFRPQLHHSGDMVFTPESGLQL RLNEKLGTTAATELKKLDFKVSSTSNNLISTIPSDNLAAGTDNTSSLGPPSMPVHYDSQLDTT LFGKKSSPLTESGGPLSLSEENNDSKLLESGLMNSQESSWGKNVSSTE
SEQ ID no. 13 (FVIII amino acid 741 -1003):
SFSQNSRHPSTRQKQFNATTIPENDIEKTDPWFAHRTPMPKIQNVSSSDLLMLLRQ SPTPHGLSLSDLQEAKYETFSDDPSPGAIDSNNSLSEMTHFRPQLHHSGDMVFTPESGLQL RLNEKLGTTAATELKKLDFKVSSTSNNLISTIPSDNLAAGTDNTSSLGPPSMPVHYDSQLDTT LFGKKSSPLTESGGPLSLSEENNDSKLLESGLMNSQESSWGKNVSSTESGRLFKGKRAHG PALLTKDNALFKVSISLLKTNKT SEQ ID no. 14 (FVIII amino acid 741 -1009):
SFSQNSRHPSTRQKQFNATTIPENDIEKTDPWFAHRTPMPKIQNVSSSDLLMLLRQ SPTPHGLSLSDLQEAKYETFSDDPSPGAIDSNNSLSEMTHFRPQLHHSGDMVFTPESGLQL RLNEKLGTTAATELKKLDFKVSSTSNNLISTIPSDNLAAGTDNTSSLGPPSMPVHYDSQLDTT LFGKKSSPLTESGGPLSLSEENNDSKLLESGLMNSQESSWGKNVSSTESGRLFKGKRAHG PALLTKDNALFKVSISLLKTNKTSNNSAT
SEQ ID no. 15 (FVIII amino acid 741 -1018):
SFSQNSRHPSTRQKQFNATTIPENDIEKTDPWFAHRTPMPKIQNVSSSDLLMLLRQ SPTPHGLSLSDLQEAKYETFSDDPSPGAIDSNNSLSEMTHFRPQLHHSGDMVFTPESGLQL RLNEKLGTTAATELKKLDFKVSSTSNNLISTIPSDNLAAGTDNTSSLGPPSMPVHYDSQLDTT
LFGKKSSPLTESGGPLSLSEENNDSKLLESGLMNSQESSWGKNVSSTESGRLFKGKRAHG PALLTKDNALFKVSISLLKTNKTSNNSATNRKTHIDGP
SEQ ID no. 16 (FVIII amino acid 741 -1020):
SFSQNSRHPSTRQKQFNATTIPENDIEKTDPWFAHRTPMPKIQNVSSSDLLMLLRQ SPTPHGLSLSDLQEAKYETFSDDPSPGAIDSNNSLSEMTHFRPQLHHSGDMVFTPESGLQL RLNEKLGTTAATELKKLDFKVSSTSNNLISTIPSDNLAAGTDNTSSLGPPSMPVHYDSQLDTT LFGKKSSPLTESGGPLSLSEENNDSKLLESGLMNSQESSWGKNVSSTESGRLFKGKRAHG PALLTKDNALFKVSISLLKTNKTSNNSATNRKTHIDGPSL
SEQ ID no. 17 (FVIII amino acid 741 -1070):
SFSQNSRHPSTRQKQFNATTIPENDIEKTDPWFAHRTPMPKIQNVSSSDLLMLLRQ SPTPHGLSLSDLQEAKYETFSDDPSPGAIDSNNSLSEMTHFRPQLHHSGDMVFTPESGLQL RLNEKLGTTAATELKKLDFKVSSTSNNLISTIPSDNLAAGTDNTSSLGPPSMPVHYDSQLDTT LFGKKSSPLTESGGPLSLSEENNDSKLLESGLMNSQESSWGKNVSSTESGRLFKGKRAHG PALLTKDNALFKVSISLLKTNKTSNNSATNRKTHIDGPSLLIENSPSVWQNILESDTEFKKVTP LI H D RM LM D KN ATALRLN H MSN KTTS
SEQ ID no. 18 (FVIII amino acid 741 -1079):
SFSQNSRHPSTRQKQFNATTIPENDIEKTDPWFAHRTPMPKIQNVSSSDLLMLLRQ SPTPHGLSLSDLQEAKYETFSDDPSPGAIDSNNSLSEMTHFRPQLHHSGDMVFTPESGLQL RLNEKLGTTAATELKKLDFKVSSTSNNLISTIPSDNLAAGTDNTSSLGPPSMPVHYDSQLDTT LFGKKSSPLTESGGPLSLSEENNDSKLLESGLMNSQESSWGKNVSSTESGRLFKGKRAHG PALLTKDNALFKVSISLLKTNKTSNNSATNRKTHIDGPSLLIENSPSVWQNILESDTEFKKVTP LIHDRMLMDKNATALRLNHMSNKTTSSKNMEMVQQ
SEQ ID no. 19 (FVIII amino acid 741 -1206):
SFSQNSRHPSTRQKQFNATTIPENDIEKTDPWFAHRTPMPKIQNVSSSDLLMLLRQ SPTPHGLSLSDLQEAKYETFSDDPSPGAIDSNNSLSEMTHFRPQLHHSGDMVFTPESGLQL RLNEKLGTTAATELKKLDFKVSSTSNNLISTIPSDNLAAGTDNTSSLGPPSMPVHYDSQLDTT LFGKKSSPLTESGGPLSLSEENNDSKLLESGLMNSQESSWGKNVSSTESGRLFKGKRAHG PALLTKDNALFKVSISLLKTNKTSNNSATNRKTHIDGPSLLIENSPSVWQNILESDTEFKKVTP LIHDRMLMDKNATALRLNHMSNKTTSSKNMEMVQQKKEGPIPPDAQNPDMSFFKMLFLPES ARWIQRTHGKNSLNSGQGPSPKQLVSLGPEKSVEGQNFLSEKNKVWGKGEFTKDVGLKE MVFPSSRNLFLTNLDNLHENNTHNQEKKIQEEIEKKETLIQ
SEQ ID no. 20 (FVIII amino acid 741 -1230):
SFSQNSRHPSTRQKQFNATTIPENDIEKTDPWFAHRTPMPKIQNVSSSDLLMLLRQ SPTPHGLSLSDLQEAKYETFSDDPSPGAIDSNNSLSEMTHFRPQLHHSGDMVFTPESGLQL RLNEKLGTTAATELKKLDFKVSSTSNNLISTIPSDNLAAGTDNTSSLGPPSMPVHYDSQLDTT LFGKKSSPLTESGGPLSLSEENNDSKLLESGLMNSQESSWGKNVSSTESGRLFKGKRAHG PALLTKDNALFKVSISLLKTNKTSNNSATNRKTHIDGPSLLIENSPSVWQNILESDTEFKKVTP LIHDRMLMDKNATALRLNHMSNKTTSSKNMEMVQQKKEGPIPPDAQNPDMSFFKMLFLPES ARWIQRTHGKNSLNSGQGPSPKQLVSLGPEKSVEGQNFLSEKNKVWGKGEFTKDVGLKE MVFPSSRNLFLTNLDNLHENNTHNQEKKIQEEIEKKETLIQENWLPQIHTVTGTKNFMKNLF LL
SEQ ID no. 21 (FVIII amino acid 741 -1261):
SFSQNSRHPSTRQKQFNATTIPENDIEKTDPWFAHRTPMPKIQNVSSSDLLMLLRQ SPTPHGLSLSDLQEAKYETFSDDPSPGAIDSNNSLSEMTHFRPQLHHSGDMVFTPESGLQL RLNEKLGTTAATELKKLDFKVSSTSNNLISTIPSDNLAAGTDNTSSLGPPSMPVHYDSQLDTT LFGKKSSPLTESGGPLSLSEENNDSKLLESGLMNSQESSWGKNVSSTESGRLFKGKRAHG PALLTKDNALFKVSISLLKTNKTSNNSATNRKTHIDGPSLLIENSPSVWQNILESDTEFKKVTP LIHDRMLMDKNATALRLNHMSNKTTSSKNMEMVQQKKEGPIPPDAQNPDMSFFKMLFLPES ARWIQRTHGKNSLNSGQGPSPKQLVSLGPEKSVEGQNFLSEKNKVWGKGEFTKDVGLKE MVFPSSRNLFLTNLDNLHENNTHNQEKKIQEEIEKKETLIQENWLPQIHTVTGTKNFMKNLF LLSTRQNVEGSYDGAYAPVLQDFRSLNDSTNRT
SEQ ID no. 22 (FVIII amino acid 741 -1301):
SFSQNSRHPSTRQKQFNATTIPENDIEKTDPWFAHRTPMPKIQNVSSSDLLMLLRQ SPTPHGLSLSDLQEAKYETFSDDPSPGAIDSNNSLSEMTHFRPQLHHSGDMVFTPESGLQL RLNEKLGTTAATELKKLDFKVSSTSNNLISTIPSDNLAAGTDNTSSLGPPSMPVHYDSQLDTT LFGKKSSPLTESGGPLSLSEENNDSKLLESGLMNSQESSWGKNVSSTESGRLFKGKRAHG PALLTKDNALFKVSISLLKTNKTSNNSATNRKTHIDGPSLLIENSPSVWQNILESDTEFKKVTP LIHDRMLMDKNATALRLNHMSNKTTSSKNMEMVQQKKEGPIPPDAQNPDMSFFKMLFLPES ARWIQRTHGKNSLNSGQGPSPKQLVSLGPEKSVEGQNFLSEKNKVWGKGEFTKDVGLKE MVFPSSRNLFLTNLDNLHENNTHNQEKKIQEEIEKKETLIQENWLPQIHTVTGTKNFMKNLF LLSTRQNVEGSYDGAYAPVLQDFRSLNDSTNRTKKHTAHFSKKGEEENLEGLGNQTKQIVE KYACTTRISPNT
SEQ ID no. 23 (FVIII amino acid 741 -1309):
SFSQNSRHPSTRQKQFNATTIPENDIEKTDPWFAHRTPMPKIQNVSSSDLLMLLRQ SPTPHGLSLSDLQEAKYETFSDDPSPGAIDSNNSLSEMTHFRPQLHHSGDMVFTPESGLQL RLNEKLGTTAATELKKLDFKVSSTSNNLISTIPSDNLAAGTDNTSSLGPPSMPVHYDSQLDTT LFGKKSSPLTESGGPLSLSEENNDSKLLESGLMNSQESSWGKNVSSTESGRLFKGKRAHG PALLTKDNALFKVSISLLKTNKTSNNSATNRKTHIDGPSLLIENSPSVWQNILESDTEFKKVTP LIHDRMLMDKNATALRLNHMSNKTTSSKNMEMVQQKKEGPIPPDAQNPDMSFFKMLFLPES ARWIQRTHGKNSLNSGQGPSPKQLVSLGPEKSVEGQNFLSEKNKVWGKGEFTKDVGLKE MVFPSSRNLFLTNLDNLHENNTHNQEKKIQEEIEKKETLIQENWLPQIHTVTGTKNFMKNLF LLSTRQNVEGSYDGAYAPVLQDFRSLNDSTNRTKKHTAHFSKKGEEENLEGLGNQTKQIVE KYACTTRISPNTSQQNFVTQ
SEQ ID no. 24 (FVIII amino acid 741 -1386):
SFSQNSRHPSTRQKQFNATTIPENDIEKTDPWFAHRTPMPKIQNVSSSDLLMLLRQ SPTPHGLSLSDLQEAKYETFSDDPSPGAIDSNNSLSEMTHFRPQLHHSGDMVFTPESGLQL RLNEKLGTTAATELKKLDFKVSSTSNNLISTIPSDNLAAGTDNTSSLGPPSMPVHYDSQLDTT LFGKKSSPLTESGGPLSLSEENNDSKLLESGLMNSQESSWGKNVSSTESGRLFKGKRAHG PALLTKDNALFKVSISLLKTNKTSNNSATNRKTHIDGPSLLIENSPSVWQNILESDTEFKKVTP LIHDRMLMDKNATALRLNHMSNKTTSSKNMEMVQQKKEGPIPPDAQNPDMSFFKMLFLPES ARWIQRTHGKNSLNSGQGPSPKQLVSLGPEKSVEGQNFLSEKNKVWGKGEFTKDVGLKE MVFPSSRNLFLTNLDNLHENNTHNQEKKIQEEIEKKETLIQENWLPQIHTVTGTKNFMKNLF LLSTRQNVEGSYDGAYAPVLQDFRSLNDSTNRTKKHTAHFSKKGEEENLEGLGNQTKQIVE KYACTTRISPNTSQQNFVTQRSKRALKQFRLPLEETELEKRIIVDDTSTQWSKNMKHLTPSTL TQIDYNEKEKGAITQSPLSDCLTRSHSIPQANRS
SEQ ID no. 25 (FVIII amino acid 741 -1395):
SFSQNSRHPSTRQKQFNATTIPENDIEKTDPWFAHRTPMPKIQNVSSSDLLMLLRQ SPTPHGLSLSDLQEAKYETFSDDPSPGAIDSNNSLSEMTHFRPQLHHSGDMVFTPESGLQL RLNEKLGTTAATELKKLDFKVSSTSNNLISTIPSDNLAAGTDNTSSLGPPSMPVHYDSQLDTT LFGKKSSPLTESGGPLSLSEENNDSKLLESGLMNSQESSWGKNVSSTESGRLFKGKRAHG PALLTKDNALFKVSISLLKTNKTSNNSATNRKTHIDGPSLLIENSPSVWQNILESDTEFKKVTP LIHDRMLMDKNATALRLNHMSNKTTSSKNMEMVQQKKEGPIPPDAQNPDMSFFKMLFLPES ARWIQRTHGKNSLNSGQGPSPKQLVSLGPEKSVEGQNFLSEKNKVWGKGEFTKDVGLKE MVFPSSRNLFLTNLDNLHENNTHNQEKKIQEEIEKKETLIQENWLPQIHTVTGTKNFMKNLF LLSTRQNVEGSYDGAYAPVLQDFRSLNDSTNRTKKHTAHFSKKGEEENLEGLGNQTKQIVE
KYACTTRISPNTSQQNFVTQRSKRALKQFRLPLEETELEKRIIVDDTSTQWSKNMKHLTPSTL TQIDYNEKEKGAITQSPLSDCLTRSHSIPQANRSPLPIAKVSS
SEQ ID no. 26 (FVIII amino acid 741 -1444):
SFSQNSRHPSTRQKQFNATTIPENDIEKTDPWFAHRTPMPKIQNVSSSDLLMLLRQ SPTPHGLSLSDLQEAKYETFSDDPSPGAIDSNNSLSEMTHFRPQLHHSGDMVFTPESGLQL RLNEKLGTTAATELKKLDFKVSSTSNNLISTIPSDNLAAGTDNTSSLGPPSMPVHYDSQLDTT LFGKKSSPLTESGGPLSLSEENNDSKLLESGLMNSQESSWGKNVSSTESGRLFKGKRAHG PALLTKDNALFKVSISLLKTNKTSNNSATNRKTHIDGPSLLIENSPSVWQNILESDTEFKKVTP LIHDRMLMDKNATALRLNHMSNKTTSSKNMEMVQQKKEGPIPPDAQNPDMSFFKMLFLPES ARWIQRTHGKNSLNSGQGPSPKQLVSLGPEKSVEGQNFLSEKNKVWGKGEFTKDVGLKE MVFPSSRNLFLTNLDNLHENNTHNQEKKIQEEIEKKETLIQENWLPQIHTVTGTKNFMKNLF LLSTRQNVEGSYDGAYAPVLQDFRSLNDSTNRTKKHTAHFSKKGEEENLEGLGNQTKQIVE KYACTTRISPNTSQQNFVTQRSKRALKQFRLPLEETELEKRIIVDDTSTQWSKNMKHLTPSTL TQIDYNEKEKGAITQSPLSDCLTRSHSIPQANRSPLPIAKVSSFPSIRPIYLTRVLFQDNSSHL PAASYRKKDSGVQESSHFLQGAKKNNLS
SEQ ID no. 27 (FVIII amino acid 741 -1440):
SFSQNSRHPSTRQKQFNATTIPENDIEKTDPWFAHRTPMPKIQNVSSSDLLMLLRQ SPTPHGLSLSDLQEAKYETFSDDPSPGAIDSNNSLSEMTHFRPQLHHSGDMVFTPESGLQL RLNEKLGTTAATELKKLDFKVSSTSNNLISTIPSDNLAAGTDNTSSLGPPSMPVHYDSQLDTT LFGKKSSPLTESGGPLSLSEENNDSKLLESGLMNSQESSWGKNVSSTESGRLFKGKRAHG PALLTKDNALFKVSISLLKTNKTSNNSATNRKTHIDGPSLLIENSPSVWQNILESDTEFKKVTP LIHDRMLMDKNATALRLNHMSNKTTSSKNMEMVQQKKEGPIPPDAQNPDMSFFKMLFLPES ARWIQRTHGKNSLNSGQGPSPKQLVSLGPEKSVEGQNFLSEKNKVWGKGEFTKDVGLKE MVFPSSRNLFLTNLDNLHENNTHNQEKKIQEEIEKKETLIQENWLPQIHTVTGTKNFMKNLF LLSTRQNVEGSYDGAYAPVLQDFRSLNDSTNRTKKHTAHFSKKGEEENLEGLGNQTKQIVE KYACTTRISPNTSQQNFVTQRSKRALKQFRLPLEETELEKRIIVDDTSTQWSKNMKHLTPSTL TQIDYNEKEKGAITQSPLSDCLTRSHSIPQANRSPLPIAKVSSFPSIRPIYLTRVLFQDNSSHL PAASYRKKDSGVQESSHFLQGAKK
SEQ ID no. 28 (FVIII amino acid 741 -1461):
SFSQNSRHPSTRQKQFNATTIPENDIEKTDPWFAHRTPMPKIQNVSSSDLLMLLRQ SPTPHGLSLSDLQEAKYETFSDDPSPGAIDSNNSLSEMTHFRPQLHHSGDMVFTPESGLQL
RLNEKLGTTAATELKKLDFKVSSTSNNLISTIPSDNLAAGTDNTSSLGPPSMPVHYDSQLDTT LFGKKSSPLTESGGPLSLSEENNDSKLLESGLMNSQESSWGKNVSSTESGRLFKGKRAHG PALLTKDNALFKVSISLLKTNKTSNNSATNRKTHIDGPSLLIENSPSVWQNILESDTEFKKVTP LIHDRMLMDKNATALRLNHMSNKTTSSKNMEMVQQKKEGPIPPDAQNPDMSFFKMLFLPES ARWIQRTHGKNSLNSGQGPSPKQLVSLGPEKSVEGQNFLSEKNKVWGKGEFTKDVGLKE MVFPSSRNLFLTNLDNLHENNTHNQEKKIQEEIEKKETLIQENWLPQIHTVTGTKNFMKNLF LLSTRQNVEGSYDGAYAPVLQDFRSLNDSTNRTKKHTAHFSKKGEEENLEGLGNQTKQIVE KYACTTRISPNTSQQNFVTQRSKRALKQFRLPLEETELEKRIIVDDTSTQWSKNMKHLTPSTL TQIDYNEKEKGAITQSPLSDCLTRSHSIPQANRSPLPIAKVSSFPSIRPIYLTRVLFQDNSSHL PAASYRKKDSGVQESSHFLQGAKKNNLSLAILTLEMTGDQREVGS
SEQ ID no. 29 (FVIII amino acid 741 -1514):
SFSQNSRHPSTRQKQFNATTIPENDIEKTDPWFAHRTPMPKIQNVSSSDLLMLLRQ SPTPHGLSLSDLQEAKYETFSDDPSPGAIDSNNSLSEMTHFRPQLHHSGDMVFTPESGLQL RLNEKLGTTAATELKKLDFKVSSTSNNLISTIPSDNLAAGTDNTSSLGPPSMPVHYDSQLDTT LFGKKSSPLTESGGPLSLSEENNDSKLLESGLMNSQESSWGKNVSSTESGRLFKGKRAHG PALLTKDNALFKVSISLLKTNKTSNNSATNRKTHIDGPSLLIENSPSVWQNILESDTEFKKVTP LIHDRMLMDKNATALRLNHMSNKTTSSKNMEMVQQKKEGPIPPDAQNPDMSFFKMLFLPES ARWIQRTHGKNSLNSGQGPSPKQLVSLGPEKSVEGQNFLSEKNKVWGKGEFTKDVGLKE MVFPSSRNLFLTNLDNLHENNTHNQEKKIQEEIEKKETLIQENWLPQIHTVTGTKNFMKNLF LLSTRQNVEGSYDGAYAPVLQDFRSLNDSTNRTKKHTAHFSKKGEEENLEGLGNQTKQIVE KYACTTRISPNTSQQNFVTQRSKRALKQFRLPLEETELEKRIIVDDTSTQWSKNMKHLTPSTL TQIDYNEKEKGAITQSPLSDCLTRSHSIPQANRSPLPIAKVSSFPSIRPIYLTRVLFQDNSSHL PAASYRKKDSGVQESSHFLQGAKKNNLSLAILTLEMTGDQREVGSLGTSATNSVTYKKVEN TVLPKPDLPKTSGKVELLPKVHIYQKDLFPTETSNGS
SEQ ID no. 30 (FVIII amino acid 741 -1524):
SFSQNSRHPSTRQKQFNATTIPENDIEKTDPWFAHRTPMPKIQNVSSSDLLMLLRQ SPTPHGLSLSDLQEAKYETFSDDPSPGAIDSNNSLSEMTHFRPQLHHSGDMVFTPESGLQL RLNEKLGTTAATELKKLDFKVSSTSNNLISTIPSDNLAAGTDNTSSLGPPSMPVHYDSQLDTT LFGKKSSPLTESGGPLSLSEENNDSKLLESGLMNSQESSWGKNVSSTESGRLFKGKRAHG PALLTKDNALFKVSISLLKTNKTSNNSATNRKTHIDGPSLLIENSPSVWQNILESDTEFKKVTP LIHDRMLMDKNATALRLNHMSNKTTSSKNMEMVQQKKEGPIPPDAQNPDMSFFKMLFLPES ARWIQRTHGKNSLNSGQGPSPKQLVSLGPEKSVEGQNFLSEKNKVWGKGEFTKDVGLKE MVFPSSRNLFLTNLDNLHENNTHNQEKKIQEEIEKKETLIQENWLPQIHTVTGTKNFMKNLF
LLSTRQNVEGSYDGAYAPVLQDFRSLNDSTNRTKKHTAHFSKKGEEENLEGLGNQTKQIVE KYACTTRISPNTSQQNFVTQRSKRALKQFRLPLEETELEKRIIVDDTSTQWSKNMKHLTPSTL TQIDYNEKEKGAITQSPLSDCLTRSHSIPQANRSPLPIAKVSSFPSIRPIYLTRVLFQDNSSHL PAASYRKKDSGVQESSHFLQGAKKNNLSLAILTLEMTGDQREVGSLGTSATNSVTYKKVEN TVLPKPDLPKTSGKVELLPKVHIYQKDLFPTETSNGSPGHLDLVEGS
SEQ ID no. 31 (FVIII amino acid 741 -1554):
FSQNSRHPSTRQKQFNATTIPENDIEKTDPWFAHRTPMPKIQNVSSSDLLMLLRQS PTPHGLSLSDLQEAKYETFSDDPSPGAIDSNNSLSEMTHFRPQLHHSGDMVFTPESGLQLR LNEKLGTTAATELKKLDFKVSSTSNNLISTIPSDNLAAGTDNTSSLGPPSMPVHYDSQLDTTL FGKKSSPLTESGGPLSLSEENNDSKLLESGLMNSQESSWGKNVSSTESGRLFKGKRAHGP ALLTKDNALFKVSISLLKTNKTSNNSATNRKTHIDGPSLLIENSPSVWQNILESDTEFKKVTPLI HDRMLMDKNATALRLNHMSNKTTSSKNMEMVQQKKEGPIPPDAQNPDMSFFKMLFLPESA RWIQRTHGKNSLNSGQGPSPKQLVSLGPEKSVEGQNFLSEKNKWVGKGEFTKDVGLKEM VFPSSRNLFLTNLDNLHENNTHNQEKKIQEEIEKKETLIQENWLPQIHTVTGTKNFMKNLFLL STRQNVEGSYDGAYAPVLQDFRSLNDSTNRTKKHTAHFSKKGEEENLEGLGNQTKQIVEKY ACTTRISPNTSQQNFVTQRSKRALKQFRLPLEETELEKRIIVDDTSTQWSKNMKHLTPSTLT QIDYNEKEKGAITQSPLSDCLTRSHSIPQANRSPLPIAKVSSFPSIRPIYLTRVLFQDNSSHLP AASYRKKDSGVQESSHFLQGAKKNNLSLAILTLEMTGDQREVGSLGTSATNSVTYKKVENT VLPKPDLPKTSGKVELLPKVHIYQKDLFPTETSNGSPGHLDLVEGSLLQGTEGAIKWNEANR PGKVPFLRVATESS
SEQ ID no. 32 (FVIII amino acid 741 -1595):
SFSQNSRHPSTRQKQFNATTIPENDIEKTDPWFAHRTPMPKIQNVSSSDLLMLLRQ SPTPHGLSLSDLQEAKYETFSDDPSPGAIDSNNSLSEMTHFRPQLHHSGDMVFTPESGLQL RLNEKLGTTAATELKKLDFKVSSTSNNLISTIPSDNLAAGTDNTSSLGPPSMPVHYDSQLDTT LFGKKSSPLTESGGPLSLSEENNDSKLLESGLMNSQESSWGKNVSSTESGRLFKGKRAHG PALLTKDNALFKVSISLLKTNKTSNNSATNRKTHIDGPSLLIENSPSVWQNILESDTEFKKVTP LIHDRMLMDKNATALRLNHMSNKTTSSKNMEMVQQKKEGPIPPDAQNPDMSFFKMLFLPES ARWIQRTHGKNSLNSGQGPSPKQLVSLGPEKSVEGQNFLSEKNKVWGKGEFTKDVGLKE MVFPSSRNLFLTNLDNLHENNTHNQEKKIQEEIEKKETLIQENWLPQIHTVTGTKNFMKNLF LLSTRQNVEGSYDGAYAPVLQDFRSLNDSTNRTKKHTAHFSKKGEEENLEGLGNQTKQIVE KYACTTRISPNTSQQNFVTQRSKRALKQFRLPLEETELEKRIIVDDTSTQWSKNMKHLTPSTL TQIDYNEKEKGAITQSPLSDCLTRSHSIPQANRSPLPIAKVSSFPSIRPIYLTRVLFQDNSSHL PAASYRKKDSGVQESSHFLQGAKKNNLSLAILTLEMTGDQREVGSLGTSATNSVTYKKVEN
TVLPKPDLPKTSGKVELLPKVHIYQKDLFPTETSNGSPGHLDLVEGSLLQGTEGAIKWNEAN RPGKVPFLRVATESSAKTPSKLLDPLAWDNHYGTQIPKEEWKSQEKSPEKTAFKKK
SEQ ID no. 33 (FVIII amino acid 741 -1643):
SFSQNSRHPSTRQKQFNATTIPENDIEKTDPWFAHRTPMPKIQNVSSSDLLMLLRQ SPTPHGLSLSDLQEAKYETFSDDPSPGAIDSNNSLSEMTHFRPQLHHSGDMVFTPESGLQL RLNEKLGTTAATELKKLDFKVSSTSNNLISTIPSDNLAAGTDNTSSLGPPSMPVHYDSQLDTT LFGKKSSPLTESGGPLSLSEENNDSKLLESGLMNSQESSWGKNVSSTESGRLFKGKRAHG PALLTKDNALFKVSISLLKTNKTSNNSATNRKTHIDGPSLLIENSPSVWQNILESDTEFKKVTP LIHDRMLMDKNATALRLNHMSNKTTSSKNMEMVQQKKEGPIPPDAQNPDMSFFKMLFLPES ARWIQRTHGKNSLNSGQGPSPKQLVSLGPEKSVEGQNFLSEKNKVWGKGEFTKDVGLKE MVFPSSRNLFLTNLDNLHENNTHNQEKKIQEEIEKKETLIQENWLPQIHTVTGTKNFMKNLF LLSTRQNVEGSYDGAYAPVLQDFRSLNDSTNRTKKHTAHFSKKGEEENLEGLGNQTKQIVE KYACTTRISPNTSQQNFVTQRSKRALKQFRLPLEETELEKRIIVDDTSTQWSKNMKHLTPSTL TQIDYNEKEKGAITQSPLSDCLTRSHSIPQANRSPLPIAKVSSFPSIRPIYLTRVLFQDNSSHL PAASYRKKDSGVQESSHFLQGAKKNNLSLAILTLEMTGDQREVGSLGTSATNSVTYKKVEN TVLPKPDLPKTSGKVELLPKVHIYQKDLFPTETSNGSPGHLDLVEGSLLQGTEGAIKWNEAN RPGKVPFLRVATESSAKTPSKLLDPLAWDNHYGTQIPKEEWKSQEKSPEKTAFKKKDTILSL NACESNHAIAAINEGQNKPEIEVTWAKQGRTERLCSQNPPVL
SEQ ID no. 34 (FVIII amino acid 741 -1648):
SFSQNSRHPSTRQKQFNATTIPENDIEKTDPWFAHRTPMPKIQNVSSSDLLMLLRQ SPTPHGLSLSDLQEAKYETFSDDPSPGAIDSNNSLSEMTHFRPQLHHSGDMVFTPESGLQL RLNEKLGTTAATELKKLDFKVSSTSNNLISTIPSDNLAAGTDNTSSLGPPSMPVHYDSQLDTT LFGKKSSPLTESGGPLSLSEENNDSKLLESGLMNSQESSWGKNVSSTESGRLFKGKRAHG PALLTKDNALFKVSISLLKTNKTSNNSATNRKTHIDGPSLLIENSPSVWQNILESDTEFKKVTP LIHDRMLMDKNATALRLNHMSNKTTSSKNMEMVQQKKEGPIPPDAQNPDMSFFKMLFLPES ARWIQRTHGKNSLNSGQGPSPKQLVSLGPEKSVEGQNFLSEKNKVWGKGEFTKDVGLKE MVFPSSRNLFLTNLDNLHENNTHNQEKKIQEEIEKKETLIQENWLPQIHTVTGTKNFMKNLF LLSTRQNVEGSYDGAYAPVLQDFRSLNDSTNRTKKHTAHFSKKGEEENLEGLGNQTKQIVE KYACTTRISPNTSQQNFVTQRSKRALKQFRLPLEETELEKRIIVDDTSTQWSKNMKHLTPSTL TQIDYNEKEKGAITQSPLSDCLTRSHSIPQANRSPLPIAKVSSFPSIRPIYLTRVLFQDNSSHL PAASYRKKDSGVQESSHFLQGAKKNNLSLAILTLEMTGDQREVGSLGTSATNSVTYKKVEN TVLPKPDLPKTSGKVELLPKVHIYQKDLFPTETSNGSPGHLDLVEGSLLQGTEGAIKWNEAN
RPGKVPFLRVATESSAKTPSKLLDPLAWDNHYGTQIPKEEWKSQEKSPEKTAFKKKDTILSL NACESNHAIAAINEGQNKPEIEVTWAKQGRTERLCSQNPPVLKRHQR
Fusion proteins: Fusion proteins according to the present invention are proteins created through the in-frame joining of two or more DNA sequences which originally encoded FVIII and the FVIII B domain fusion partner. Translation of the fusion protein DNA sequence will result in a single protein sequence which may have functional properties derived from each of the original proteins or peptides. DNA sequences encoding fusion proteins may be created by standard molecular biology methods such as overlapping PCR or DNA ligation - the FVIII B domain fusion partner according to the present invention can be inserted at any position and in any domain or region as long as FVIII activity is preserved. The resulting fusion protein DNA sequence may be inserted into an appropriate expression vector that supports the heterologous fusion protein expression in a standard host organism.
Fusion proteins may furthermore contain a linker or spacer peptide sequence that separates the protein or peptide parts which define the fusion protein. The linker or spacer peptide sequence may facilitate the correct folding of the individual protein or peptide parts and may make it more likely for the individual protein or peptide parts to retain their individual functional properties. Linker or spacer peptide sequences may be inserted into fusion protein DNA sequences during the in frame assembly of the individual DNA fragments that make up the complete fusion protein DNA sequence i.e. during overlapping PCR or DNA ligation. Examples of linker sequences according to the invention comprising repetitive GS residues include e.g.: (GS)n, (GGGS)n, (GGGGS)n, (GGGS)n(GGG), etc. The linker can thus be very short, e.g. 1 , 2, 3, 4, 5, 6, 7, or 8 amino acids or somewhat longer, e.g. 5-10, 5-15, 5-20, 5- 30, 5-50, 10-15, 10-20, 10-30, 10-40, 10-50, 15-20, 15-30, 15-40, 15-50 amino acids.
Pharmaceutical compositions:
The present invention provides compositions and formulations comprising one or more FVIII fusion proteins of the invention, formulated together with one or more
pharmaceutically acceptable carrier(-s).
Accordingly, one object of the invention is to provide a pharmaceutical formulation comprising a protein according to the invention present in a concentration from 0.25 mg/ml to 250 mg/ml, and wherein said formulation has a pH from 2.0 to 10.0. The formulation may further comprise one or more of a buffer system, a preservative, a tonicity agent, a chelating agent, a stabilizer, or a surfactant, as well as various combinations thereof. The use of
preservatives, isotonic agents, chelating agents, stabilizers and surfactants in pharmaceutical compositions is well-known to the skilled person. Reference may be made to Remington: The Science and Practice of Pharmacy, 19th edition, 1995.
In one embodiment, the pharmaceutical formulation is an aqueous formulation. Such a formulation is typically a solution or a suspension, but may also include colloids, dispersions, emulsions, and multi-phase materials. The term "aqueous formulation" is defined as a formulation comprising at least 50% w/w water. Likewise, the term "aqueous solution" is defined as a solution comprising at least 50 % w/w water, and the term "aqueous suspension" is defined as a suspension comprising at least 50 %w/w water.
In another embodiment, the pharmaceutical formulation is a freeze-dried
formulation, to which the physician or the patient adds solvents and/or diluents prior to use. In a further aspect, the pharmaceutical formulation comprises an aqueous solution.
Pharmaceutical compositions according to the present invention are preferably suitable for intravenous (IV) and/or extravascular administration (e.g. subcutaneous (sc) or intradermal administration) in prophylactic/therapeutic treatment of haemophilia.
"Haemophilia": Haemophilia/hemophilia/blood clotting diseases is a group of hereditary genetic disorders that impair the body's ability to control blood clotting or coagulation ("bleeding disorders"), which is used to stop bleeding when a blood vessel is broken. Haemophilia A (clotting factor VIII deficiency) is the most common form of the disorder, present in about 1 in 5,000-10,000 male births.
List of embodiments: It is understood that all aspects and embodiments of the invention can be combined and that they are not to be understood in any limiting way.
Embodiment 1 : A FVIII fusion protein, comprising a FVIII molecule with a B domain (a full length or a truncated B domain), wherein said FVIII molecule is fused to a FVIII B domain fusion partner, wherein said FVIII B domain fusion partner is derived from the FVIII B domain and comprises 100-908 amino acids.
Embodiment 2: A FVIII fusion protein according to the invention, wherein said FVIII molecule is a B domain truncated molecule with a B domain comprising 0-908, 4-908 or 15- 25 amino acids. The FVIII B domain may be selected from the list consisting of SEQ ID no 2, 3, and 4.
Embodiment 3: A FVIII fusion protein according to the invention, wherein the FVIII B domain fusion partner is a truncated FVIII B domain.
Embodiment 4: A FVIII fusion protein according to the invention, wherein said FVIII molecule is a B domain truncated FVIII molecule comprising a B domain amino acid sequence selected from the group consisting of SEQ ID NO 2, SEQ ID NO 3, and SEQ ID NO 4.
Embodiment 5: A FVIII fusion protein according to the invention, wherein said FVIII B domain fusion partner is fused to the C-terminal end of the FVIII B domain.
Embodiment 6: A FVIII fusion protein according to the invention, wherein said FVIII B domain fusion partner is fused to the N-terminal end of the FVIII light chain.
Embodiment 7: A FVIII fusion protein according to the invention, wherein the FVIII B domain fusion partner is fused to the C-terminal end of the FVIII light chain. The FVIII B domain fusion partner can also be inserted into one or more domains within the heavy chain and/or the light chain as long as the resulting fusion protein maintains FVIII activity.
Embodiment 8: A FVIII fusion protein according to the invention, wherein said FVIII
B domain fusion partner comprises the amino acid sequence selected from the list consisting of: SEQ ID No 5, SEQ ID No 6, SEQ ID No 7, SEQ ID No 8, SEQ ID No 9, SEQ ID No 10, SEQ ID No 11 , SEQ ID No 12, SEQ ID No 13, SEQ ID No 14, SEQ ID No 15, SEQ ID No 16, SEQ ID No 17, SEQ ID No 18, SEQ ID No 19, SEQ ID No 20, SEQ ID No 21 , SEQ ID No 22, SEQ ID No 23, SEQ ID No 24, SEQ ID No 25, SEQ ID No 26, SEQ ID No 27, SEQ ID No 28, SEQ ID No 29, SEQ ID No 30, SEQ ID No 31 , SEQ ID No 32, SEQ ID No 33, and SEQ ID No 34.
Embodiment 9: A FVIII fusion protein according to the invention, wherein said FVIII B domain fusion partner has a low degree of secondary and tertiary structures. Secondary and tertiary structure can be measured by e.g. Circular Dichroism (CD). Based on e.g. a CD wavelength spectrum from 190-260 nm, wherein the fingerprint of the FVIII B domain fusion partner resembles that of a disordered polypeptide having a signal minimum of 204 nm. Preferably, the FVIII B domain fusion partner is homogenous in structure in in vivo circulation upon administration to the patient in need thereof. An example of a protein according to the invention having a homogenous structure is a FVIII protein fused to the FVIII B domain fusion partner according to SEQ ID NO 11.
Embodiment 10: A pharmaceutical composition comprising a FVIII fusion protein according to the invention.
Embodiment 11 : A method for making a FVIII fusion protein according to the invention, wherein said method comprises the step of incubating a host cell under
appropriate conditions, wherein said host cell comprises an expression vector that encodes a FVIII fusion protein according to the invention.
Embodiment 12: A nucleotide molecule encoding a FVIII fusion protein according to the invention.
Embodiment 13: An expression vector comprising a nucleotide molecule according to the invention.
Embodiment 14: A host cell comprising an expression vector according to the invention.
Embodiment 15: A FVIII fusion protein according to the invention, or a
pharmaceutical formulation according to the invention, for use as a medicament for treatment of haemophilia.
Embodiment 16: A FVIII fusion protein according to the invention, or a
pharmaceutical composition according to the invention, for treatment of haemophilia by subcutaneous administration.
Embodiment 17: A FVIII fusion protein according to the invention, or a
pharmaceutical formulation according to the invention, for treatment of haemophilia by intravenous administration.
Embodiment 18: A FVIII fusion protein according to the invention, wherein said protein comprises the amino acid sequence selected from the list consisting of: SEQ ID NO 35, SEQ ID NO 36, and SEQ ID NO 37.
EXAMPLES
While certain features of the invention have been illustrated and described herein, many modifications, substitutions, changes, and equivalents will now occur to those of ordinary skill in the art. It is, therefore, to be understood that the appended claims are intended to cover all such modifications and changes as fall within the true spirit of the invention.
EXAMPLE 1
Expression constructs encoding FVIII with a B domain sequence fused to the light chain C-terminus For generation of plasmids encoding FVIII with a B domain sequence fused to the light chain C-terminus, we utilized a plasmid named #1742 consisting of the mammalian expression vector pTT5 (Durocher et al., Nucleic Acids Research, Vol 30, No 2 edition 9 (2002)) with an insert encoding the "F8-500-C2-linked-GS BDD FVIII" molecule. Starting at the N-terminus, the F8-500 protein is synthesized from an expression vector encoding a B domain truncated FVIII molecule comprising a heavy chain a 21 amino acid B domain linker
(SFSQNSRHPSQNPPVLKRHQR - SEQ ID NO 2), and the FVIII light chain (amino acids 1649-2332 of full-length wild-type human FVIII). The sequence of the 21 amino acid linker is derived from the FVIII B domain and consists of amino acids 741-750 and 1638-1648 of full length wild-type human FVIII. The F8-500-C2-linked-GS BDD FVIII molecule is identical to F8-500 except that a glycin-serine (GS) dipeptide has been added to the C-terminus of the FVIII light chain. This has been done by adding a Bam HI restriction site encoding the GS dipeptide immediately upstream to the stop signal in the F8-500 coding open reading frame. Immediately down-stream to the same stop signal, the #1742 plasmid contains a Not I restriction site. Thus, DNA encoding fusion partners can be introduced at the C-terminus of the FVIII molecule encoded by plasmid #1742 by insertion of DNA encoding the fusion partner in Bam HI and Not I digested plasmid #1742.
A PCR fragment of FVIII encoding DNA encoding FVIII amino acid 741-966 followed by a stop codon was amplified with an oligonucleotide forward primer containing a Bam HI restriction site and an oligonucleotide reverse primer containing a Not I site. Bam HI and Not I digested PCR fragment was ligated into Bam HI and Not I digested plasmid #1742 giving rise to plasmid #2149. Thus, plasmid #2149 consists of pTT5 with insert encoding F8-500- C2-linked-G-FVIII(741-966) (SEQ ID no 35). This FVIII molecule consists of the F8-500 protein described above with a G residue followed by FVIII residue 741-966 fused to the C terminus of the FVIII light chain.
Subsequently, the Bam Hi/Not I fragment from plasmid #2149 was transferred to plasmid #1679. The latter plasmid consists of pTT5 with insert encoding the F8-500-C2-linked- (GGGS)6 BDD FVIII molecule. The F8-500-C2-linked-(GGGS)6 BDD FVIII molecule is identical to F8-500 except that a (GGGS)6 peptide has been added to the C-terminus of the
FVIII light chain. The six nucleotides immediately upstream to the stop signal constitute a Bam HI restriction site. Immediately down-stream to the same stop signal, the #1742 plasmid contains a Not I restriction site. Thus, DNA encoding fusion partners can be introduced at the C-terminus of the FVIII molecule encoded by plasmid #1679 by insertion of DNA encoding the fusion partner in Bam HI and Not I digested plasmid #1679. Insertion of the Bam Hi/Not I fragment from plasmid #2149 into plasmid #1679 resulted in plasmid #2185 consisting of pTT5 with insert encoding encoding F8-500-C2-linked-(GGGS)5-GGG-FVIII(741-966) (SEQ ID no 36). This FVIII molecule consists of the F8-500 protein described above with a
(GGGS)5-GGG linker followed by FVIII residue 741-966 fused to the C terminus of the FVIII light chain.
SEQ ID no. 35 (F8-500-C2-linked-G-FVIII(741 -966)) - described in Example 1 :
ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSWYKKTLFVEFTDHLFNIA KPRPPWMGLLGPTIQAEVYDTVVITLKNMASHPVSLHAVGVSYWKASEGAEYDDQTSQRE KEDDKVFPGGSHTYVWQVLKENGPMASDPLCLTYSYLSHVDLVKDLNSGLIGALLVCREGS LAKEKTQTLHKFILLFAVFDEGKSWHSETKNSLMQDRDAASARAWPKMHTVNGYVNRSLP GLIGCHRKSVYWHVIGMGTTPEVHSIFLEGHTFLVRNHRQASLEISPITFLTAQTLLMDLGQF LLFCHISSHQHDGMEAYVKVDSCPEEPQLRMKNNEEAEDYDDDLTDSEMDVVRFDDDNSP SFIQIRSVAKKHPKTWVHYIAAEEEDWDYAPLVLAPDDRSYKSQYLNNGPQRIGRKYKKVRF MAYTDETFKTREAIQHESGILGPLLYGEVGDTLLIIFKNQASRPYNIYPHGITDVRPLYSRRLP KGVKHLKDFPILPGEIFKYKWTVTVEDGPTKSDPRCLTRYYSSFVNMERDLASGLIGPLLICY KESVDQRGNQIMSDKRNVILFSVFDENRSWYLTENIQRFLPNPAGVQLEDPEFQASNIMHSI NGYVFDSLQLSVCLHEVAYWYILSIGAQTDFLSVFFSGYTFKHKMVYEDTLTLFPFSGETVF MSMENPGLWILGCHNSDFRNRGMTALLKVSSCDKNTGDYYEDSYEDISAYLLSKNNAIEPR SFSQNSRHPSQNPPVLKRHQREITRTTLQSDQEEIDYDDTISVEMKKEDFDIYDEDENQSPR SFQKKTRHYFIAAVERLWDYGMSSSPHVLRNRAQSGSVPQFKKVVFQEFTDGSFTQPLYR GELNEHLGLLGPYIRAEVEDNIMVTFRNQASRPYSFYSSLISYEEDQRQGAEPRKNFVKPNE TKTYFWKVQHHMAPTKDEFDCKAWAYFSDVDLEKDVHSGLIGPLLVCHTNTLNPAHGRQV TVQEFALFFTIFDETKSWYFTENMERNCRAPCNIQMEDPTFKENYRFHAINGYIMDTLPGLV MAQDQRIRVVYLLSMGSNENIHSIHFSGHVFTVRKKEEYKMALYNLYPGVFETVEMLPSKAGI WRVECLIGEHLHAGMSTLFLVYSNKCQTPLGMASGHIRDFQITASGQYGQWAPKLARLHYS GSINAWSTKEPFSWIKVDLLAPMIIHGIKTQGARQKFSSLYISQFIIMYSLDGKKWQTYRGNS TGTLMVFFGNVDSSGIKHNIFNPPIIARYIRLHPTHYSIRSTLRMELMGCDLNSCSMPLGMES KAISDAQITASSYFTNMFATWSPSKARLHLQGRSNAWRPQVNNPKEWLQVDFQKTMKVTG VTTQGVKSLLTSMYVKEFLISSSQDGHQWTLFFQNGKVKVFQGNQDSFTPVVNSLDPPLLT
RYLRIHPQSWVHQIALRMEVLGCEAQDLYGSFSQNSRHPSTRQKQFNATTIPENDIEKTDP WFAHRTPMPKIQNVSSSDLLMLLRQSPTPHGLSLSDLQEAKYETFSDDPSPGAIDSNNSLSE MTHFRPQLHHSGDMVFTPESGLQLRLNEKLGTTAATELKKLDFKVSSTSNNLISTIPSDNLAA GTDNTSSLGPPSMPVHYDSQLDTTLFGKKSSPLTESGGPLSLSEENNDSKLLESGLMNSQE SSWGKNVSS
SEQ ID no. 36 (F8-500-C2-linked-(GGGS)5-GGG-FVIII(741 -966)) - described in Example 1 :
ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSWYKKTLFVEFTDHLFNIA KPRPPWMGLLGPTIQAEVYDTVVITLKNMASHPVSLHAVGVSYWKASEGAEYDDQTSQRE KEDDKVFPGGSHTYVWQVLKENGPMASDPLCLTYSYLSHVDLVKDLNSGLIGALLVCREGS LAKEKTQTLHKFILLFAVFDEGKSWHSETKNSLMQDRDAASARAWPKMHTVNGYVNRSLP GLIGCHRKSVYWHVIGMGTTPEVHSIFLEGHTFLVRNHRQASLEISPITFLTAQTLLMDLGQF LLFCHISSHQHDGMEAYVKVDSCPEEPQLRMKNNEEAEDYDDDLTDSEMDVVRFDDDNSP SFIQIRSVAKKHPKTWVHYIAAEEEDWDYAPLVLAPDDRSYKSQYLNNGPQRIGRKYKKVRF MAYTDETFKTREAIQHESGILGPLLYGEVGDTLLIIFKNQASRPYNIYPHGITDVRPLYSRRLP KGVKHLKDFPILPGEIFKYKWTVTVEDGPTKSDPRCLTRYYSSFVNMERDLASGLIGPLLICY KESVDQRGNQIMSDKRNVILFSVFDENRSWYLTENIQRFLPNPAGVQLEDPEFQASNIMHSI NGYVFDSLQLSVCLHEVAYWYILSIGAQTDFLSVFFSGYTFKHKMVYEDTLTLFPFSGETVF MSMENPGLWILGCHNSDFRNRGMTALLKVSSCDKNTGDYYEDSYEDISAYLLSKNNAIEPR SFSQNSRHPSQNPPVLKRHQREITRTTLQSDQEEIDYDDTISVEMKKEDFDIYDEDENQSPR SFQKKTRHYFIAAVERLWDYGMSSSPHVLRNRAQSGSVPQFKKVVFQEFTDGSFTQPLYR GELNEHLGLLGPYIRAEVEDNIMVTFRNQASRPYSFYSSLISYEEDQRQGAEPRKNFVKPNE TKTYFWKVQHHMAPTKDEFDCKAWAYFSDVDLEKDVHSGLIGPLLVCHTNTLNPAHGRQV TVQEFALFFTIFDETKSWYFTENMERNCRAPCNIQMEDPTFKENYRFHAINGYIMDTLPGLV MAQDQRIRWYLLSMGSNENIHSIHFSGHVFTVRKKEEYKMALYNLYPGVFETVEMLPSKAGI WRVECLIGEHLHAGMSTLFLVYSNKCQTPLGMASGHIRDFQITASGQYGQWAPKLARLHYS GSINAWSTKEPFSWIKVDLLAPMIIHGIKTQGARQKFSSLYISQFIIMYSLDGKKWQTYRGNS TGTLMVFFGNVDSSGIKHNIFNPPIIARYIRLHPTHYSIRSTLRMELMGCDLNSCSMPLGMES KAISDAQITASSYFTNMFATWSPSKARLHLQGRSNAWRPQVNNPKEWLQVDFQKTMKVTG VTTQGVKSLLTSMYVKEFLISSSQDGHQWTLFFQNGKVKVFQGNQDSFTPVVNSLDPPLLT RYLRIHPQSWVHQIALRMEVLGCEAQDLYGGGSGGGSGGGSGGGSGGGSGGGSFSQNS RHPSTRQKQFNATTIPENDIEKTDPWFAHRTPMPKIQNVSSSDLLMLLRQSPTPHGLSLSDL QEAKYETFSDDPSPGAIDSNNSLSEMTHFRPQLHHSGDMVFTPESGLQLRLNEKLGTTAAT
ELKKLDFKVSSTSNNLISTIPSDNLAAGTDNTSSLGPPSMPVHYDSQLDTTLFGKKSSPLTES GGPLSLSEENNDSKLLESGLMNSQESSWGKNVSS
SEQ ID no. 37 (F8-500-LCN-FVIII-(741-966)) - described in Example 8:
ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSWYKKTLFVEFTDHLFNIA KPRPPWMGLLGPTIQAEVYDTVVITLKNMASHPVSLHAVGVSYWKASEGAEYDDQTSQRE KEDDKVFPGGSHTYVWQVLKENGPMASDPLCLTYSYLSHVDLVKDLNSGLIGALLVCREGS LAKEKTQTLHKFILLFAVFDEGKSWHSETKNSLMQDRDAASARAWPKMHTVNGYVNRSLP GLIGCHRKSVYWHVIGMGTTPEVHSIFLEGHTFLVRNHRQASLEISPITFLTAQTLLMDLGQF LLFCHISSHQHDGMEAYVKVDSCPEEPQLRMKNNEEAEDYDDDLTDSEMDVVRFDDDNSP SFIQIRSVAKKHPKTWVHYIAAEEEDWDYAPLVLAPDDRSYKSQYLNNGPQRIGRKYKKVRF MAYTDETFKTREAIQHESGILGPLLYGEVGDTLLIIFKNQASRPYNIYPHGITDVRPLYSRRLP KGVKHLKDFPILPGEIFKYKWTVTVEDGPTKSDPRCLTRYYSSFVNMERDLASGLIGPLLICY KESVDQRGNQIMSDKRNVILFSVFDENRSWYLTENIQRFLPNPAGVQLEDPEFQASNIMHSI NGYVFDSLQLSVCLHEVAYWYILSIGAQTDFLSVFFSGYTFKHKMVYEDTLTLFPFSGETVF MSMENPGLWILGCHNSDFRNRGMTALLKVSSCDKNTGDYYEDSYEDISAYLLSKNNAIEPR SFSQNSRHPSQNPPVLKRHQRSFSQNSRHPSTRQKQFNATTIPENDIEKTDPWFAHRTPM PKIQNVSSSDLLMLLRQSPTPHGLSLSDLQEAKYETFSDDPSPGAIDSNNSLSEMTHFRPQL HHSGDMVFTPESGLQLRLNEKLGTTAATELKKLDFKVSSTSNNLISTIPSDNLAAGTDNTSSL GPPSMPVHYDSQLDTTLFGKKSSPLTESGGPLSLSEENNDSKLLESGLMNSQESSWGKNV SSEITRTTLQSDQEEIDYDDTISVEMKKEDFDIYDEDENQSPRSFQKKTRHYFIAAVERLWDY GMSSSPHVLRNRAQSGSVPQFKKVVFQEFTDGSFTQPLYRGELNEHLGLLGPYIRAEVEDN IMVTFRNQASRPYSFYSSLISYEEDQRQGAEPRKNFVKPNETKTYFWKVQHHMAPTKDEFD CKAWAYFSDVDLEKDVHSGLIGPLLVCHTNTLNPAHGRQVTVQEFALFFTIFDETKSWYFTE NMERNCRAPCNIQMEDPTFKENYRFHAINGYIMDTLPGLVMAQDQRIRWYLLSMGSNENIH SIHFSGHVFTVRKKEEYKMALYNLYPGVFETVEMLPSKAGIWRVECLIGEHLHAGMSTLFLV YSNKCQTPLGMASGHIRDFQITASGQYGQWAPKLARLHYSGSINAWSTKEPFSWIKVDLLA PMIIHGIKTQGARQKFSSLYISQFIIMYSLDGKKWQTYRGNSTGTLMVFFGNVDSSGIKHNIF NPPIIARYIRLHPTHYSIRSTLRMELMGCDLNSCSMPLGMESKAISDAQITASSYFTNMFATW SPSKARLHLQGRSNAWRPQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLTSMYVKEFLIS SSQDGHQWTLFFQNGKVKVFQGNQDSFTPVVNSLDPPLLTRYLRIHPQSWVHQIALRMEVL GCEAQDLY
EXAMPLE 2
Transient expression of FVIII with a B domain sequence fused to the light chain C- terminus HKB11 cells at a density of 0.9 - 1.1 x 106 were transfected with a complex of plasmid (0.7 mg/l or 1.0 mg/l) and the transfection agent, 293Fectin (Invitrogen) (1.0 ml/l or 1.4 ml/l). The transfection complex was prepared by diluting the plasmid and the transfection separately, mixing the two solutions, and incubating the mixture at room temperature for 20 minutes. The complex mixture was added to the cell suspension and the suspension was incubated in shaker incubator for 4 or 5 days at 36.5 °C or 37 °C and at 5 % or 8 % C02. Cell culture supernatants were analysed by chromogenic FVIII assay as described in Example 3 and/or filtered through a 0,22 μηη membrane filter and utilized for purification of FVIII variant as described in Example 4. EXAMPLE 3
FVIII:C in cell culture supernatants measured by chromogenic assay
The FVIII activity (FVI 11 :C) of the rFVIII compound was evaluated in a chromogenic FVIII assay using Coatest SP reagents (Chromogenix) as follows: rFVIII samples and a FVIII standard (Coagulation reference, Technoclone) were diluted in Coatest assay buffer (50 mM Tris, 150 mM NaCI, 1 % BSA, pH 7.3, with preservative). Fifty μΙ of samples, standards, and buffer negative control were added to 96-well microtiter plates (Spectraplates MB, Perkin Elmer). All samples were tested diluted 1 :100, 1 :400, 1 :1600, and 1 :6400. The factor IXa/factor X reagent, the phospholipid reagent and CaCI2 from the Coatest SP kit were mixed 5:1 :3 (vol:vol:vol) and 75 μΙ of this added to the wells. After 15 min incubation at room temperature, 50 μΙ of the factor Xa substrate S-2765/thrombin inhibitor 1-2581 mix was added and the reactions were incubated 5 min at room temperature before 25 μΙ 1 M citric acid, pH 3, was added. The absorbance at 405 nm was measured on an Envision microtiter plate reader (Perkin Elmer) with absorbance at 620 nm used as reference wavelength. The value for the negative control was subtracted from all samples and a calibration curve prepared by linear regression of the absorbance values plotted vs. FVIII concentration. The specific activity was calculated by dividing the activity in each supernatant with the FVIII antigen concentration determined by ELISA. The ELISA was a sandwich ELISA using polyclonal sheep anti-FVIII antibody for catching and the same but HRP-conjugated antibody for detection (Matched-Pair Antibody Set for ELISA of human Factor VIII antigen, Affinity
Biologicals, cat. no. F8C-EIA). Purified FVIII "F8-500" was used as calibrator. Results shown in Table 2 demonstrate that FVIII activity of the fusion protein according to the invention is maintained. Table 2. Specific activities of FVIII molecules in supernatant from transiently transfected HKB11
*The specific activity could potentially be underestimated due to overestimation of the concentration of FVIII with a B domain fusion partner as additional epitopes in the B-domain fusion partner may be included in the measurement (polyclonal antibodies are used in the ELISA).
EXAMPLE 4
Purification of FVIII molecules Purification of F8-500 from the supernatant of transiently transfected HKB11 cells was carried out by a three step purification method using: Affinity chromatography on a VlllSelect column (GE Health Care) followed by affinity chromatography on an F25 column (Novo Nordisk A S) and an anionic exchange chromatography column, Poros 50 HQ (GE Health Care).
A volume of 1700 ml cell culture media as pumped onto a VlllSelect column (2.6 x 3.5 cm, Vol= 7 ml) at 3 ml/min. Prior to the application the column was equilibrated with a buffer consisting of: 20 mM imidazole, 10 mM CaCI2, 0.02% Tween 80, 250 mM NaCI, pH=7.3. The column was washed with a buffer consisting of: 20 mM imidazole, 10 mM CaCI2, 0.02% Tween 80, 1.5 M NaCI, pH=7.3. F8-500 was eluted with a buffer consisting of 20 mM imidazole, 10 mM CaCI2, 0.02% Tween 80, 1 M ammonium acetate, 6.5 M 1 ,2-propanediol, pH=7.3.
The eluted F8-500 protein ended up in a pool volume of 14 ml which was diluted with 140 ml buffer consisting of 20 mM imidazole, 10 mM CaCI2, 0.02% Tween 80, pH=7.3 and
thereafter pumped onto a F25 affinity column (2 x 2.5 cm, Vol= 5 ml). Prior to the application the column was equilibrated with a buffer consisting of 20 mM imidazole, 10 mM CaCI2, 0.02% Tween 80, 150 mM NaCI, 1 M glycerol, pH=7.3. The column was washed with a buffer consisting of 20 mM imidazole, 10 mM CaCI2, 0.02% Tween 80, 650 mM NaCI, pH=7.3. The bound FVIII protein was eluted with 20 mM imidazole, 10 mM CaCI2, 0.02% Tween 80, 2.5 M NaCI, 50% ethylenglycol, pH=7.3.
The eluted F8-500 protein ended up in a pool volume of 10 ml. This pool was diluted with 290 ml buffer consisting of 20 mM imidazole, 10 mM CaCI2, 0.02% Tween 80, pH=7.3 and pumped onto a Poros 50 HQ column (0.5 x 6 cm, Vol= 1.2 ml). Prior to the application the column was equilibrated with buffer A: consisting of 20 mM imidazole, 10 mM CaCI2, 0.02% Tween 80, 50 mM NaCI, 1 M glycerol pH=7.3. After application the column was eluted with a linear gradient from buffer A to buffer B over 5 column volumes. Buffer B is identical to buffer A except for the NaCI which is 1 M in buffer B. The eluted F8-500 protein ended up in a pool of 1 ml.
The overall yield using this 3 step purification procedure was close to 40%. The purity of the purified F8-500 protein was analysed by HPLC and SDS-gel electrophoresis essentially as previously described (Thim, L. et al. Haemophilia 16 (2010), 349-359.
Purification of F8-500-C2-linked-(GGGS)5-GGG-FVIII(741-966) from the supernatant of transiently transfected HKB11 cells was carried out by a two-step purification method using affinity chromatography on a VINSelect column (GE Health Care) followed by an anionic exchange chromatography column, Poros 50 HQ (GE Health Care). This purification method was identical to the method described above for purification of F8-500 with two exceptions: 1 ) The F25 affinity chromatography step is omitted and 2) in the anionic exchange
chromatographic step on the Poros 50 HQ column the elution from the column is carried out with a gradient over 10 column volumes instead of 5 column volumes. The overall yield using this 2 step purification procedure was close to 50%. The purity of the from the supernatant of transiently transfected HKB11 cells was analysed by HPLC and SDS-gel electrophoresis essentially as previously described (Thim, L. et al. Haemophilia 16 (2010), 349-359.
EXAMPLE 5
FVIII:C in purified samples measured by chromogenic assay
The FVIII activity (FVI 11 :C) of the rFVIII compound was evaluated in a chromogenic FVIII assay using Coatest SP reagents (Chromogenix) as follows: rFVIII samples and a FVIII standard (e.g. purified wild-type rFVIII calibrated against the 7th international FVIII standard from NIBSC) were diluted in Coatest assay buffer (50 mM Tris, 150 mM NaCI, 1 % BSA, pH 7.3, with preservative). Fifty μΙ of samples, standards, and buffer negative control were added to 96-well microtiter plates (Nunc) in duplicates. The factor IXa/factor X reagent, the phospholipid reagent and CaCI2 from the Coatest SP kit were mixed 5:1 :3 (vohvohvol) and 75 μΙ of this added to the wells. After 15 min incubation at room temperature 50 μΙ of the factor Xa substrate S-2765/thrombin inhibitor 1-2581 mix was added and the reactions incubated 10 min at room temperature before 25 μΙ 1 M citric acid, pH 3, was added. The absorbance at 415 nm was measured on a Spectramax microtiter plate reader (Molecular Devices) with absorbance at 620 nm used as reference wavelength. The value for the negative control was subtracted from all samples and a calibration curve prepared by curve fitting of the absorbance values plotted vs. FVIII concentration. The specific activity was calculated by dividing the activity of the samples with the protein concentration determined by HPLC. For HPLC, the concentration of the sample was determined by integrating the area under the peak in the chromatogram corresponding to the light chain and compare with the area of the same peak in a parallel analysis of a wild-type rFVIII, where the concentration was determined by amino acid analyses. The results shown in Table 3 demonstrate the FVIII with a B domain sequence fused to the light chain C-terminus has FVIII activity.
Table 3. Specific activities of purified FVIII molecules
FVIII:C in purified samples measured by one-stage clot assay
FVI 11 :C of the rFVIII compounds was further evaluated in a one-stage FVIII clot assay as follows: rFVIII samples and a FVIII standard (e.g. purified wild-type rFVIII calibrated against the 7th international FVIII standard from NIBSC) were diluted in HBS/BSA buffer (20 mM hepes, 150 mM NaCI, pH 7.4 with 1 % BSA) to approximately 10 U/ml followed by 10-fold dilution in FVIII-deficient plasma containing VWF (Dade Behring). The samples were subsequently diluted in HBS/BSA buffer. The APTT clot time was measured on an ACL300R or an ACL5000 instrument (Instrumentation Laboratory) using the single factor program. FVIII-deficient plasma with VWF (Dade Behring) was used as assay plasma and SynthASil, (HemosIL™, Instrumentation Laboratory) as aPTT reagent. In the clot instrument, the diluted sample or standard is mixed with FVIII-deficient plasma, aPTT reagents at 37°C. Calcium chloride is added and time until clot formation is determined by turbidity. The FVIILC in the sample is calculated based on a standard curve of the clot formation times of the dilutions of the FVIII standard. The results are shown in table 3.
EXAMPLE 7
Pharmacokinetic evaluation of FVIII with a B domain sequence fused to the light chain C-terminus
The pharmacokinetics of F8-500-C2-linked-(GGGS)5-GGG-FVIII(741-966) and F8-500 both produced from transiently transfected HKB11 cells were evaluated in FVIII deficient mice (FVIII KO mice) and in VWF deficient mice (VWF KO mice).
FVIII deficient mice (FVIII exon 16 knock out mice with mixed C57BI/6 and SV129 background, bred at Taconic M&B, (B6.129S4-F8tm1 Kaz/J) and VWF-deficient mice (VWF exon 4 + 5 KO mice with C57BI/6 background ((B6.129S2-VWFtm1 Wgr/J) bred at Charles River, Germany) were included in the study. The VWF deficient mice had app. 13% of normal FVIII chromogenic activity, while the FVIII-KO mice had no detectable FVIII chromogenic activity.
A mixture of male and female mice (approximately1 :1 ) with an approximate weight of 25 grams and age range of 15-28 weeks were used. The mice received a single i.v. dose of either of the two FVIII variants (280 lU/kg) in the tail vein (n=6). Blood was taken using non-
coated capillary glass tubes from the orbital plexus at regular time points in the interval of 0.08-3 or 0.08-7 h post-administration, for compound F8-500-C2-linked-(GGGS)6-FVIII(741- 966) and F8-500 respectively, in VWF deficient mice and at 5, 24, 30 or 5, 24, 48 h post administration for compound F8-500 and F8-500-C2-linked-(GGGS)6-FVIII(741-966), respectively, in FVIII deficient mice. Three blood samples were taken from each mouse, and 2 to 63 samples were obtained at each time point. Blood was immediately stabilized with sodium citrate and diluted in four volumes FVIII Coatest SP buffer before 5 min centrifugation at 4000g. Plasma obtained from diluted blood was frozen on dry ice and kept at -80°C prior to analysis in the FVIII chromogenic activity assay (plasma from FVIII deficient mice) and in a FVIII antigen based LOCI assay (plasma from VWF KO mice).
Briefly, the FVIII chromogenic activity assay was analysed using CoatestSP FVIII kit, Chromogenix (#82408663). Calibration was done using purified FVIII (N8-SRM standard, batch 307.7008.09.2, Novo Nordisk) diluted appropriately in Coatest buffer to produce the following calibrator points 0, 0.25, 0.5, 1.0, 2.0, 3.0, 4.0 and 5.0 mU/ml. Minimal required dilution of plasma samples was 1 :80. All samples were analysed in duplicates in four different dilutions (1 :80, 1 :240, 1 :720 and 1 :2160) and the result was reported as mean of dilutions within the calibration range plus %CV of these results. QC samples: Control plasma N (ORKE 41 , Siemens Health care diagnostics product GmbH) diluted appropriately extra high, high, medium and low level. In short the assay was carried out by mixing 50 μΙ calibrator or sample with 75 μΙ FIX mixture (FIXa/X, phospholipid and CaCI2 reagent from the kit mixed 5+1 +3). After 15 min incubation time, 50 μΙ Xa substrate (S-2765) was added and the enzymatic reactions were stopped after 10-15 min by addition of 25 ul stop buffer. All samples, calibrators and QC-samples were analysed in duplicates. Absorbance was read at 405 nm with 620 nm as reference using Tecan Infinite reader M200, and Magellan 6.6 for data transformation. The lower limit of quantification (LLOQ) in the plasma was 34 mU/ml. The calibration curve was fitted using 4 Parametric logistic (4PL Marquardt) in Magellan and sample results were obtained by interpolation from the calibration curve. Interpolation and estimation of %CV of duplicates was done by Magellan. %CV of double replicates should be <10, %CV of double samples in different dilutions should be <25.
The FVIII antigen based LOCI assay was a homogenous bead based assay. LOCI reagents included two latex bead reagents and a biotinylated anti-rFVIII light chain antibody (hF8- 4F11 , Novo Nordisk). One of the bead reagents was a generic reagent (D-beads) and was coated with streptavidin and contains a photosensitive dye. The second bead reagent (A-
beads) was coated with another anti-FVIII light chain antibody (hF8-4F45, Novo Nordisk). 5 μΙ diluted sample/calibrator/control was added to A-Screenplate-384 followed by 15 μ I mixture of biotin-hF8-4F11 , hF8-4F45-A-beads. Incubation at RT for 1 hour before 30 μΙ D- beads was added. Incubation for 30 minutes before reading. During the assay the three reactants combined with FVIII or FVIII analogues to form a bead-aggregate-immune complex. Illumination of the complex released singlet oxygen from the D-beads which channels into the A-beads and triggered chemiluminescence which was measured in the EnVision plate reader. The amount of light generated was proportional to the antigen concentration of FVIII. The LLOQ in plasma was 100 IU/L.
Pharmacokinetic analysis of mean plasma concentration versus time dataset for the VWF deficient mice was carried out by non-compartmental methods (NCA) using WinNonlin. For the FVIII deficient mice, the evaluation of the half-life was based on log-linear regression of the individual plasma concentrations versus time using SAS JMP.
Table 4 and 5 list the FVIII activity levels at the specified time points for the two compounds dosed to VWF and FVIII deficient mice. Table 6 and 7 list the estimated pharmacokinetic parameters. In both of the mice strains F8-500-C2-linked-(GGGS)5-GGG-FVIII(741-966) has a slower elimination, i.e. a longer t½ as compared to F8-500.
Table 4: FVIII activity in FVIII-KO mice (FVIII chromogenic activity in Ill/ml), na=not available
FVIII activity in samples from mice1
FVIII
(lll/mL)
Sampling time points 5 h 24 h 30 h 48 h
F8-500 2.31 0.22 0.12 na
1.93 0.13 0.04 na
1.84 0.13 0.06 na
2.53 0.2 0.11 na
2.86 0.37 0.22 na
2.82 0.38 0.22 na
F8-500-C2-linked- 2.72 0.63 na 0.14
(GGGS)5-GGG- 2.91 0.71 na 0.13
FVIII(741-966) SEQ ID 2.40 0.51 na 0.12
NO 36 2.89 0.75 na 0.23
2.27 0.36 na 0.04
2.86 0.40 na 0.07
1 ) each line represent data from one individual mouse
Table 5: FVIII activity in VWF deficient mice (antigen concentrations in IU/L). na= not available, < indicates FVIII activity below (LLOQ)
1 ) each line represent data from one individual mouse
Table 6: Estimated pharmacokinetic parameters after i.v. administration to VWF deficient mice (based on FVIII antigen data)
Table 7: Estimated t½ and 95% CI on the estimated t½ after i.v. administration to FVIII deficient mice (based on chromogenic activity data)
t½ 95% CI
(h) (h)
F8-500 5.6 5.1-6.2
F8-500-C2-linked-(GGGS)5-GGG-FVIII(741-966) SEQ ID NO 36 9.4 8.2-11
EXAMPLE 8
Expression construct encoding FVIII with a B domain sequence fused to the light chain N-terminus
The mammalian expression vector pGB445 with insert encoding the FVIII molecule F8-500- LCN-FVIII(741-966) was generated as described in the following. The construction of pGB445 was carried out by combining DNA sequences from pJSV331 and pGB368.
pJSV331 consists of pQMCF-5 with insert encoding F8-500. pGB368 consists of pTT5 with insert encoding amino acid 741-966 of human FVIII. A PCR product containing the entire nucleotide sequence of pJSV331 was generated from pJSV331 using Phusion U DNA polymerase (Thermo Fisher Scientific), the forward primer
AGATCACUCGTACTACTCTTCAGTCTGA (SEQ ID no 38), and the reverse primer
AGCTCCGUTGATGGCGTTTCAAGACC (SEQ ID no 39). In this PCR product, the pJSV331 sequence starts with the codon encoding amino acid 1649 at the N-terminus of the FVIII light chain and ends with the codon encoding amino acid 1648 at the C-terminus of the FVIII heavy chain. Likewise, a PCR product containing the nucleotide sequence encoding
FVIII (741-966) was generated from pGB368 using Phusion U DNA polymerase, the forward primer ACGGAGCUTTAGCCAGAACAGCAGAC (SEQ ID no 40), and the reverse primer AGTGATCUCGGAGGACACGTTCTTGCC (SEQ ID no 41 ). The two overlapping PCR products were joined at both ends with the Uracil-Specific Excision Reagent enzyme (New England Biolabs) giving rise to the pGB445 plasmid consisting of pQMCF-5 with insert encoding F8-500-LCN-FVIII(741-966). This molecule consists of the F8-500 FVIII molecule described in Example 1 fused to amino acid 741-966 of FVIII at the N-terminus of the FVIII light chain (SEQ ID no 37).
EXAMPLE 9
Generation of concentrated cell culture supernatants containing FVIII with a B domain sequence fused to the light chain N-terminus
Portions of 1 X 107 CHOEBNALT85 cells in 700 ml 1 :1 CD CHO and SFM II medium (Thermo Fisher Scientific) were electroporated with 10 mg pGB445 in a Gene Pulser Cuvette (BioRad) using a GenePulser Xcell (Biorad). Subsequently, the cells were transferred to 125 ml Erlenmeyer flasks with 30 ml of the above growth medium and incubated in a shaker
incubator at 36.5 °C and 8 % C02. Five days after transfection, the culture volumes were increased 20 % by addition of CHO CD Efficient Feed B (Thermo Fisher Scientific), and the incubation temperature was reduced to 30 °C. After 5 days of incubation at 30 °C, cell culture supernatants were collected and pooled. Proteins in the cell culture supernatant were concentrated by centrifugation of the supernatant in Ultra-15 Centrifugal Filter Devices with 50 K Nominal Molecular Weight Limit (Amicon) leading to approximately 10 fold reduction in the cell culture supernatant volume. The concentrated cell culture supernatants were frozen with 20 mM imidazol pH 7.0 (Sigma) and 0.2 % Tween 80 (Merck) and utilized for pharmacokinetic analysis of F8-500-LCN-FVIII(741-966) (Example 10). Cell culture supernatant was analysed by chromogenic FVIII assay as described in Example 3 and a specific activity of 5.8 mU/ng was calculated. The specific activity of F8-500-LCN-FVIII(741- 966) could potentially be underestimated due to overestimation of the concentration of FVIII with a B domain fusion partner as additional epitopes in the B-domain fusion partner may be included in the measurement (polyclonal antibodies are used in the ELISA).
EXAMPLE 10
Pharmacokinetic study of FVIII with a B domain sequence fused to the light chain N- terminus in concentrated cell culture supernatant
Pharmakokinetic study of the F8-500-LCN-FVIII-(741-966) FVIII molecule was carried out essentially as described in Example 7, except that the FVIII compound was administered as concentrated cell culture supernatant.
Blood was taken using non-coated capillary glass tubes from the orbital plexus at 0.08, 0.5, 1 , 3, 5, 18, 24, 30 and 48 h post-dose from FVIII deficient mice.
Pharmacokinetic analysis of plasma FVIII activity levels versus time dataset was modelled using the non-linear mixed effects approach (Phoenix NLME 1.3). Table 8 lists the FVIII activity levels at the specified time points for the compound dosed to FVIII deficient mice while table 9 lists the estimated pharmacokinetic parameters. From these data it is apparent that F8-500-LCN-FVIII-(741-966) has a terminal half-life that is 1.4 (statistically significant) longer compared to N8 (FVIII I).
Table 8: FVIII activity in FVIII-KO mice (FVIII chromogenic activity in Ill/ml).
FVIII FVIII activity in samples from mice1 (lll/mL)
Sampling time points (h) 0.08 1 2 4 6 18 24 30 48
F8-500-LCN-FVIII-(741- 2.31 2.60 1.74 1.20 1.15 0.57 0.36 0.11 0.07 966) 2.33 2.56 1.98 1.18 1.19 0.71 0.36 0.11 0.11
2.50 2.72 1.80 1.23 1.19 0.81 0.37 0.12 0.15
Table 9: Estimated pharmacokinetic parameters including 95% CI (based on FVIII chromogenic activity data)
*: Terminal half-life, based on a 2-compartment model
#: Half-life, based on a 1 -compartment model
EXAMPLE 11
Secondary and tertiary structure analysis of a B-domain fragment comprising 226 amino acid residues. The FVIII B domain fusion partner according to SEQ ID no. 11 was expressed with a C- terminal HPC4-tag (EDQVDPRLIDGK - SEQ ID NO 42).
The resulting protein was expressed and purified essentially as previously described using anti- HPC4 affinity chromatography.
Tryptophan fluorescence: FVIII(741-966)-HPC4 was prepared at a concentration of 5 μΜ in the following buffer, 20 mM HEPES, 100 mM NaCI, 5mM EDTA, 0.005% Tween80, pH 7.5. Also, a denatured sample was prepared similarly but with the addition of 6 M guanadinium hydrochloride. 200 μΙ of sample was loaded to a quartz cuvette with a 1 cm path length and measured on a SpectraMax M2e platereader (Molecular Devices Ltd, UK) with the following
settings: excitation wavelength of 280nm, emission wavelengths of 300-450 nm with steps of 1 nm, sensitivity of 6 and a temperature of 21 °C. Amaxwas determined by polynomial fitting in KaleidaGraph 4.5. Circular dichroism: The secondary structure fingerprint was measured with Far-UV circular dichroism (CD). FVIII(741-966)-HPC4 was prepared to 13.8 mg/ml protein in 20 mM HEPES, 100 mM NaCI, 5mM EDTA, 0.005% Tween80, pH 7.5 and loaded to a rectangular quartz CD cuvette with a 0.01 mm light path. With a Chirascan CD spectrophotometer (Applied
Photophysics, UK) wavelength spectra from 190-260 nm were measured with steps of 1 nm, a bandwidth of 1 nm at 25 °C. 3 consecutive scans was carried out and averaged the corresponding buffer scan was subtracted. For the full range (190-260nm) the noise was below 500V, i.e. data quality was good.
To evaluate whether a thermal unfolding transition could be observed, 1 mm quartz cuvettes were used due to improper heating of 0.01 mm cuvettes. Due to high noise from the buffer in a 1 mm cuvette, the buffer was diluted four times and the protein concentration was diluted 100 times. This way, acceptable signal to noise was acquired from 200-260 nm. The sample was measured at 25, 50, 70 and 90°C using the settings described above. No visual aggregation was observed upon melting.
Tryptophan (Trp) fluorescence is a sensitive reporter of tertiary structure as the wavelength corresponding to the highest intensity (Amax) shifts when the polarity of its near-environment changes. Trp residues located in a folded environment (i.e. hydrophobic) have a Amax of -334 nm. When Trp is solvent-exposed (i.e. in a hydrophilic environment), the Amax red-shifts to -355 nm. For FVIII(741-966)-HPC4 a Amax of 355 nm is found suggesting that this residue is in a hydrophilic environment. As Trp residues are often engaged in hydrophobic interactions, this data suggest that the two Trp residues are located in disordered regions of the polypeptide. Addition of chemical denaturant, 6 M GdmCI, which leads to complete unfolding and a subsequent maximum red-shift, also leads to a Amax of 355 nm, confirming that the Trp residues in FVIII(741-966)-HPC4 are fully solvent-exposed.
A secondary structure fingerprint of FVIII(741-966)-HPC4 was obtained with Far-UV circular dichroism (CD) spectroscopy. Based on wavelength spectrum from 190-260 nm, the fingerprint resembles that of a disordered polypeptide having a signal minimum of 204 nm. This minima does not correspond to standard minima of ohelical structure (Amin=218 nm) and β-sheet structure (Amin=208 nm and 222 nm) suggesting that the disordered conformation is
predominant. However, evaluation of the Far-UV CD spectrum of FVIII(741-966)-HPC4 as a function of temperature indicates that there is a thermal unfolding transition occurring at higher temperatures. A dichroic point is identified when overlaying Far-UV CD spectra obtained at 25, 50, 70 and 90°C suggesting that it is a two-state thermal unfolding transition.
In conclusion, Far-UV CD and Trp fluorescence analysis suggest that there is a substantial degree of disorder in FVIII(741-966)-HPC4. However, based on thermal unfolding followed with Far-UV CD, some persistent structure appear to be present in FVIII(741-966)-HPC4.
Claims
1. A FVIII fusion protein comprising a FVIII molecule with a B domain, wherein said FVIII molecule is fused to a FVIII B domain fusion partner, wherein said FVIII B domain fusion partner is derived from the FVIII B domain and comprises 100-908 amino acids.
2. A FVIII fusion protein according to claim 1 , wherein said FVIII molecule is a B domain truncated FVIII molecule with a B domain comprising 15-25 amino acids.
3. A FVIII fusion protein according to any one of the preceding claims, wherein the
FVIII B domain fusion partner is a truncated FVIII B domain.
4. A FVIII fusion protein according to any one of the preceding claims, wherein said FVIII molecule is a B domain truncated FVIII molecule comprising a B domain amino acid sequence selected from the group consisting of SEQ ID NO 2, SEQ ID NO 3, and SEQ ID NO 4.
5. A FVIII fusion protein according to any one of the preceding claims, wherein said FVIII B domain fusion partner is fused to the C-terminal end of the FVIII B domain.
6. A FVIII fusion protein according to any one of the preceding claims, wherein said FVIII B domain fusion partner is fused to the N-terminal end of the FVIII light chain.
7. A FVIII fusion protein according to any one of the preceding claims, wherein the FVIII B domain fusion partner is fused to the C-terminal end of the FVIII light chain.
8. A FVIII fusion protein according to any one of the preceding claims, wherein said FVIII B domain fusion partner comprises the amino acid sequence selected from the group consisting of: SEQ ID NO 5, SEQ ID NO 6, SEQ ID NO 7, SEQ ID NO 8, SEQ ID NO 9, SEQ ID NO 10, SEQ ID NO 11 , SEQ ID NO 12, SEQ ID NO 13, SEQ ID NO 14, SEQ ID NO 15, SEQ ID NO 16, SEQ ID NO 17, SEQ ID NO 18, SEQ ID NO 19, SEQ ID NO 20, SEQ ID NO 21 , SEQ ID NO 22, SEQ ID NO 23, SEQ ID NO 24, SEQ ID NO 25, SEQ ID NO 26, SEQ ID NO 27, SEQ ID NO 28, SEQ ID NO 29, SEQ ID NO 30, SEQ ID NO 31 , SEQ ID NO 32, SEQ ID NO 32, SEQ ID NO 33, and SEQ ID NO 34.
9. A FVIII fusion protein according to any one of the preceding claims, wherein said FVIII B domain fusion partner has a low degree of secondary and/or tertiary structures.
10. A FVIII fusion protein according to any one of the preceding claims, wherein said protein has a homogenous structure.
11. A pharmaceutical composition comprising a FVIII fusion protein according to any one of claims 1-10.
12. A FVIII fusion protein according to any one of claims 1-10, or a pharmaceutical formulation according to claim 11 , for use as a medicament for treatment of haemophilia.
13. A FVIII fusion protein according to any one of claims 1-10, or a pharmaceutical composition according to claim 11 , for treatment of haemophilia by subcutaneous administration.
14. A FVIII fusion protein according to any one of claims 1-10, or a pharmaceutical formulation according to claim 11 , for treatment of haemophilia by intravenous
administration.
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP15171338.5 | 2015-06-10 | ||
| EP15171338 | 2015-06-10 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2016198521A1 true WO2016198521A1 (en) | 2016-12-15 |
Family
ID=53365923
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2016/063155 Ceased WO2016198521A1 (en) | 2015-06-10 | 2016-06-09 | Fviii fusion proteins |
Country Status (1)
| Country | Link |
|---|---|
| WO (1) | WO2016198521A1 (en) |
Citations (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5595886A (en) * | 1986-01-27 | 1997-01-21 | Chiron Corporation | Protein complexes having Factor VIII:C activity and production thereof |
| US20060122376A1 (en) * | 1991-02-07 | 2006-06-08 | Chiron Corporation | Protein complexes having factor VIII:C activity and production thereof |
| WO2011101284A1 (en) * | 2010-02-16 | 2011-08-25 | Novo Nordisk A/S | Factor viii fusion protein |
| EP2626080A2 (en) * | 2008-02-27 | 2013-08-14 | Novo Nordisk A/S | Conjugated factor VIII molecules |
| WO2013122617A1 (en) * | 2012-02-15 | 2013-08-22 | Amunix Operating Inc. | Factor viii compositions and methods of making and using same |
| WO2013160005A1 (en) | 2012-04-24 | 2013-10-31 | Novo Nordisk A/S | Pharmaceutical composition suitable for treatment of haemophilia |
| WO2015023894A1 (en) * | 2013-08-14 | 2015-02-19 | Biogen Idec Ma Inc. | Recombinant factor viii proteins |
-
2016
- 2016-06-09 WO PCT/EP2016/063155 patent/WO2016198521A1/en not_active Ceased
Patent Citations (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5595886A (en) * | 1986-01-27 | 1997-01-21 | Chiron Corporation | Protein complexes having Factor VIII:C activity and production thereof |
| US20060122376A1 (en) * | 1991-02-07 | 2006-06-08 | Chiron Corporation | Protein complexes having factor VIII:C activity and production thereof |
| EP2626080A2 (en) * | 2008-02-27 | 2013-08-14 | Novo Nordisk A/S | Conjugated factor VIII molecules |
| WO2011101284A1 (en) * | 2010-02-16 | 2011-08-25 | Novo Nordisk A/S | Factor viii fusion protein |
| WO2013122617A1 (en) * | 2012-02-15 | 2013-08-22 | Amunix Operating Inc. | Factor viii compositions and methods of making and using same |
| WO2013160005A1 (en) | 2012-04-24 | 2013-10-31 | Novo Nordisk A/S | Pharmaceutical composition suitable for treatment of haemophilia |
| WO2015023894A1 (en) * | 2013-08-14 | 2015-02-19 | Biogen Idec Ma Inc. | Recombinant factor viii proteins |
Non-Patent Citations (6)
| Title |
|---|
| "Remington: The Science and Practice of Pharmacy", 1995 |
| D'AMICI ET AL., ELECTROPHORESIS, vol. 31, 2010, pages 2730 - 2739 |
| DUROCHER ET AL., NUCLEIC ACIDS RESEARCH, vol. 30, no. 2, 2002 |
| JANKOWSKI ET AL., HAEMOPHILIA, vol. 13, 2007, pages 30 - 37 |
| MIAO ET AL., BLOOD, vol. 103, 2004, pages 3412 - 3419 |
| THIM, L. ET AL., HAEMOPHILIA, vol. 16, 2010, pages 349 - 359 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| JP7418519B2 (en) | Factor IX fusion proteins and methods of producing and using them | |
| JP5832285B2 (en) | Factor VIII, von Willebrand factor or a complex thereof having an extended in vivo half-life | |
| AU2014257637B2 (en) | Complex | |
| EP2482841B1 (en) | Compositions and methods for enhancing coagulation factor viii function | |
| BR112015000267B1 (en) | CHIMERIC PROTEINS, AND PHARMACEUTICAL COMPOSITION | |
| BR112014017165B1 (en) | CHIMERIC PROTEIN COMPRISING A FACTOR VIII PROTEIN, PHARMACEUTICAL COMPOSITION, AND USES THEREOF | |
| DK2097096T3 (en) | MODIFIED COAGULATION FACTORS WITH EXTENDED IN VIVO HALF TIME | |
| AU2016210689A1 (en) | Factor viii compositions and methods of making and using same | |
| EP2536754A1 (en) | Factor viii fusion protein | |
| JP6676551B2 (en) | Modified von Willebrand factor | |
| CN108779165B (en) | Mutated von willebrand factor | |
| JP2022531664A (en) | Single-stranded factor VIII molecule | |
| WO2017050820A1 (en) | Fviii fusion proteins | |
| EP3785726A1 (en) | Factor viii protein with increased half-life | |
| US20210163575A1 (en) | Factor viii mutant expression vector with enhanced protein expression | |
| BR112019003302A2 (en) | highly glycosylated human blood coagulation factor fusion protein, and method of preparation and its use | |
| BR112019003302B1 (en) | HIGHLY GLYCOSYLATED HUMAN BLOOD COAGULATION FACTOR VIII FUSION PROTEIN, DNA MOLECULE, VECTOR, PHARMACEUTICAL COMPOSITION, AND METHOD OF PREPARATION AND ITS USE | |
| HK1151068B (en) | Factor viii, von willebrand factor or complexes thereof with prolonged in vivo half-life |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 16729535 Country of ref document: EP Kind code of ref document: A1 |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 16729535 Country of ref document: EP Kind code of ref document: A1 |





