WO2016177846A1 - Combination of a cd30xcd16 antibody with a pd-1 antagonist for therapy - Google Patents

Combination of a cd30xcd16 antibody with a pd-1 antagonist for therapy Download PDF

Info

Publication number
WO2016177846A1
WO2016177846A1 PCT/EP2016/060113 EP2016060113W WO2016177846A1 WO 2016177846 A1 WO2016177846 A1 WO 2016177846A1 EP 2016060113 W EP2016060113 W EP 2016060113W WO 2016177846 A1 WO2016177846 A1 WO 2016177846A1
Authority
WO
WIPO (PCT)
Prior art keywords
antibody
combination
cells
cd16a
tumor
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2016/060113
Other languages
French (fr)
Inventor
Martin Treder
Uwe Reusch
Jens-Peter Marschner
Stefan Knackmuss
Narendiran RAJASEKARAN
Holbrook Kohrt
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Affimed GmbH
Original Assignee
Affimed GmbH
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from EP15166303.6A external-priority patent/EP3091031A1/en
Priority to JP2017557405A priority Critical patent/JP6609784B2/en
Priority to ES16723968T priority patent/ES2754557T3/en
Priority to CN201680026411.5A priority patent/CN107847587B/en
Priority to DK16723968.0T priority patent/DK3292153T3/en
Priority to HRP20191933TT priority patent/HRP20191933T1/en
Priority to RS20191372A priority patent/RS59489B1/en
Priority to RU2017137251A priority patent/RU2761352C2/en
Priority to BR112017023579A priority patent/BR112017023579A2/en
Priority to PL16723968T priority patent/PL3292153T3/en
Application filed by Affimed GmbH filed Critical Affimed GmbH
Priority to SI201630463T priority patent/SI3292153T1/en
Priority to SM20190598T priority patent/SMT201900598T1/en
Priority to EP16723968.0A priority patent/EP3292153B1/en
Priority to CA2983706A priority patent/CA2983706C/en
Priority to LT16723968T priority patent/LT3292153T/en
Priority to AU2016257334A priority patent/AU2016257334B2/en
Publication of WO2016177846A1 publication Critical patent/WO2016177846A1/en
Priority to US15/788,177 priority patent/US11167029B2/en
Anticipated expiration legal-status Critical
Priority to CY20191101115T priority patent/CY1122283T1/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2818Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/39558Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/3955Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/02Antineoplastic agents specific for leukemia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/04Immunostimulants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/283Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against Fc-receptors, e.g. CD16, CD32, CD64
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2878Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/3061Blood cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • A61K2039/507Comprising a combination of two or more separate antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/626Diabody or triabody
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value

Definitions

  • the invention relates to a combination of (i) a multifunctional antibody having specificity for
  • a PD-1 antagonist e.g. anti-PD-1 antibody
  • NK-cells mediate innate immunity and are constitutively activated, they are candidates for cancer immunotherapy.
  • a bispecific CD30/CD16A tandem diabody (TandAb ® ) binds NK-cells via CD16A and has a second binding domain for CD30, a cancer-specific target, e.g CD30 + Hodgkin Reed-Sternberg (HRS) lymphoma cells.
  • Such tandem diabody recruits and redirects the NK- cells to CD30 + tumor cells and binds both targets with high affinity, establishing a bridge whereby the NK-cells are activated and redirected to kill the tumor cells.
  • Immune checkpoint molecules are cell surface proteins, e.g. receptors that regulate costimulatory or coinhibitory pathways of the immune response.
  • immune checkpoint molecules are cytotoxic T-lymphocyte antigen-4 (CTLA-4), programmed death- 1 (PD-1), programmed death ligand-1 (PD-Ll) or programmed death ligand-2 (PD-L2), immune costimulatory molecules on NK-cell and costimulatory receptors of the TNF receptor family, for example CD137.
  • CTL-4 cytotoxic T-lymphocyte antigen-4
  • PD-1 programmed death- 1
  • PD-Ll programmed death ligand-1
  • PD-L2 programmed death ligand-2
  • PD-1 (PDCD1 or CD279) receptor mediates a coinhibitory pathway. Further PD-1 binds to
  • PD-Ll which induces a coinhibitory signaling upon receptor-ligand ligation.
  • PD-1 pathway is a checkpoint to limit T-cell mediated immune response (Keir ME et al., Annu. Rev. Immunol. 2008;26:677-704).
  • tumors can co-opt the PD-1 pathway to evade an immune response (Weber J, Semin Oncol. 2010;37:430-9; Ansell S et al., N. Engl J. Med. 2015;372:311-319).
  • PD-1 antagonists blocking the interaction between PD-1 and PD-Ll which is implicated in the down-modulation of T-cell responses have been studied in a variety of cancers and combinations of PD-1 blockade with CTLA-4 blockade for regulating adaptive immunity has been suggested (Dolan D and Gupta S, Cancer Control. 2014;21 :231 -237).
  • the anti-PD-1 antibody pembrolizumab has demonstrated initial clinical efficacy in single arm monotherapy trials in patients with Hodgkin lymphoma as determined by response rate. Ongoing clinical trials are being conducted in these tumor types as well as a number of other advanced solid tumor indications and hematologic malignancies.
  • anti-CD137 antibodies which bind to the costimulatory molecule CD 137 on NK cells have been used in combination with other monoclonal antibodies like rituximab or lenalidomide for enhancing NK-cell function (Miller J., Hematology 2013 :247-253).
  • a PD-1 antagonist in particular an anti-PD-1 antibody for use in a method of treating a tumor, in particular Hodgkin lymphoma (HL).
  • HL Hodgkin lymphoma
  • a combination of CD30/CD16A bispecific antibody and anti-PD-1 antibody significantly enhances the initial innate immune response by enhanced tumor infiltration of the innate immune cells, in particular NK-cells, macrophages and dendritic cells.
  • innate immune cells in particular NK-cells, macrophages and dendritic cells.
  • PDX patient derived xenograft
  • PBMC immune cells from blood
  • the single agent treatment showed a significant reduction in tumor growth for most molecules when compared to the control treatment group (irrelevant IgG)
  • the combination of bispecific CD30/CD16 multifunctional antibody and anti-PD-1 antibody showed enhanced anti-tumor efficacy.
  • IgG treatment it was observed that in animals treated with combinations of CD30/CD16 antibody and an anti-PD-1 antibody the NK cell population in the tumor increased.
  • bispecific CD30/CD16A tandem diabody monotherapy induced an infiltration of both NK cells and macrophages in the tumors.
  • CD30/CD16 antibody in combination with an anti-PD-1 enhanced the infiltration of both CD4+ and CD8+ T-cell in tumors.
  • T-cells and dendritic cells were significantly induced by the combination of CD30/CD16 antibody and anti-PD-1 compared to either monotherapy of CD30/CD16 antibody or anti-PD-1 ( Figure 8B).
  • Combination of CD30/CD16 antibody and anti-PD-1 advantageously induced an infiltration of dendritic cells into the tumor shortly after the administration (day 30 and day 40).
  • CD30/CD16 antibody and anti-PD-1 significantly increased the tumor infiltration of all immune subpopulations, such as T-cells, NK-cells, macrophages and dendritic cells, compared to monotherapies by CD30/CD16 antibody and anti-PD-1, respectively ( Figure 8B).
  • the combination of (i) a multifunctional antibody having specificity for CD30 and having specificity for CD 16, in particular CD16A and (ii) an anti-PD-1 antibody increases synergistically the killing of tumor cells which results in a significantly increased tumor regression.
  • the remarkable tumor regression is achieved by the coordinated, i.e. integrated, action of all immune subpopulations, such as CD4+ and CD8+ T-cells and NK-cells, macrophages and dendritic cells as well as the intra-tumoral increase of inflammatory cytokines, such as in particular IFN- ⁇ , through the combined activity of the NK-cell engaging multifunctional antibody and the agent modulating the immune checkpoint molecule.
  • the combination therapy provided herein demonstrates for the first time that the efficacy of inducing an innate immune response by a NK-cell engaging and tumor targeting antibody can be augmented by an anti-PD-1 antibody which is known for stimulating the adaptive immune response by blocking the PD-1 pathway.
  • the combination of the multifunctional antibody having specificity for CD30 and CD 16, in particular CD16A, and the PD-1 antagonist, in particular PD-1 antibody, is used for increasing the innate immune response as compared with that of the multifunctional antibody having specificity for CD30 and CD16A alone in a method of treating a tumor, in particular Hodgkin lymphoma (HL).
  • HL Hodgkin lymphoma
  • the innate immune response is increased by cell infiltration of innate cells, in particular macrophages, dendritic cells and NK-cells into the tumor.
  • the intratumoral infiltration of CD4+ and CD8+ T-cells is increased.
  • “Innate immune response” refers to the activation of one or more innate leukocytes of the innate immune system (or nonspecific immune system or in-born immunity system).
  • the activated leukocytes of the innate immune response comprise Natural killer (NK) cells, macrophages and dendritic cells.
  • NK Natural killer
  • the innate immune system is distinct from the adaptive immune system (or specific immune system) which includes lymphocytes like CD4+ or CD8+ T-cells.
  • “Combination” refers to a combination therapy, combined therapy or polytherapy that uses more than one medication for the treatment of a tumor, i.e. single disease.
  • “combination” is used for a combination therapy that embraces the steps of administering a multifunctional antibody having specificity for CD30 and CD16A, e.g. bispecific CD30/CD16A tandem diabody, and a PD-1 antagonist, e.g. anti-PD-1 antibody, for the treatment of a tumor, e.g. Hodgkin lymphoma.
  • a tumor e.g. Hodgkin lymphoma
  • the bispecific CD30/D16A tandem diabody and the anti-PD-1 antibody are given in combination.
  • “monotherapy” refers to a therapy which embraces the administration of a single medication alone, e.g. either bispecific CD30/CD16A tandem diabody or anti-PD-1 antibody.
  • the combination comprises a multifunctional antibody for use in a NK-cell based immunotherapy of a tumor.
  • multifunctional as used herein means that the antibody exhibits two or more different biological functions.
  • the different biological functions are different specificities for different antigens.
  • the multifunctional antibody is multispecific, e.g. bispecific, trispecific, etc. Such multispecific, e.g.
  • bispecific, binding proteins include, for example, bispecific monoclonal antibodies of the classes IgA, IgD, IgE, IgG or IgM, as well as antibody fragments or antibody derivatives including, for example, Fab, Fab', F(ab')2, Fv fragments, single-chain Fv, tandem single-chain Fv (scFv) 2 , dual affinity retargeting antibodies (DARTTM), diabody and tandem diabody (TandAb®), single-chain diabodies (scDb) and flexibodies.
  • antibody as used herein means monoclonal antibodies as well as antibody fragments and antibody derivatives comprising an antibody binding domain.
  • antibody formats can be generated from antibody fragments and antibody derivatives which have similar antibody binding specificity as a native antibody, but differ in validity and effector function due to the number of binding domains or lack of Fc-region.
  • Examples of antibody formats for bispecific antibodies are described in Spiess, C. et al., Mol Immunol. 2015 Oct;67(2 Pt A):95-106 and Kontermann, R.E., Brinkmann, U., Drug Discov. Today 2015 Jul;20(7):838-47.
  • the multifunctional antibody is a multispecific, e.g. bispecific tandem diabody (TandAb®).
  • a tandem diabody is constructed by linking the four variable domains of the heavy and light chains (VH and VL) from two or more different Fv binding domains in a single polypeptide. The domains are positioned such that corresponding VH and VL can pair when two molecules of the polypeptide align in a head-to-tail fashion. Short linkers between the domains (twelve or fewer amino acids) prevent intramolecular pairing of the Fv.
  • VH and VL variable domains of the heavy and light chains
  • Short linkers between the domains prevent intramolecular pairing of the Fv.
  • the multifunctional antibody e.g. bispecific CD30/CD16A tandem diabody
  • the agent being an immunomodulatory molecule i.e. anti-PD-1 antibody
  • CD30/CD16A and anti-PD-1 antibody can be sequentially administrated, typically over a certain period of time.
  • Administration of the multifunctional antibody and the anti-PD-1 can be effected by different ways, e.g. by intravenous, intraperitoneal, subcutaneous, intramuscular, topical or intradermal administration.
  • the route of administration depends on the kind of therapy and the kind of compound contained in the pharmaceutical composition.
  • the dosage regimen will be determined by the attending physician and other clinical factors. Dosages for any one patient depends on many factors, including the patient's size, body surface area, age, sex, the particular compound to be administered, time and route of administration, the kind of therapy, general health and other drugs being administered concurrently.
  • An “effective dose” refers to amounts of the active ingredient that are sufficient to affect the course and the severity of the disease, leading to the reduction or remission of such pathology.
  • An "effective dose" useful for treating a tumor may be determined using known methods. Hence, the invention encompasses a method of treatment, i.e.
  • combination therapy comprising the step of administering to a subject suffering from a CD30 + tumor, e.g. Hodgkin lymphoma, effective dosages of a combination of a multifunctional antibody and an anti-PD-1 (PD-1 antibody), wherein the multifunctional antibody has specificity for CD30 and CD16, e.g. is a CD30/CD 16A antibody.
  • a CD30 + tumor e.g. Hodgkin lymphoma
  • PD-1 antibody anti-PD-1
  • the multifunctional antibody has specificity for CD30 and CD16, e.g. is a CD30/CD 16A antibody.
  • the invention provides a combination of a multifunctional antibody having specificity for CD30 and CD16A, e.g. bispecific CD30/CD16A tandem diabody, and an anti-PD-1 antibody for use in a combination therapy for treating a tumor, e.g. Hodgkin lymphoma or anaplastic large-cell lymphoma (ALCL).
  • a multifunctional antibody having specificity for CD30 and CD16A, e.g. bispecific CD30/CD16A tandem diabody
  • an anti-PD-1 antibody for use in a combination therapy for treating a tumor, e.g. Hodgkin lymphoma or anaplastic large-cell lymphoma (ALCL).
  • the multifunctional antibody recruits NK-cells by binding exclusively to the CD 16 isoform CD16A.
  • anti-CD 16A binding domains and their generation are described in WO 2006/125668.
  • the anti-CD16A binding domain comprises CDRl, CDR2 and CDR3 of the heavy chain variable domain set forth in SEQ ID NO:4 and CDRl, CDR2 and CDR3 of the light chain variable domain set forth in SEQ ID NO:5.
  • the anti-CD 16A binding domain comprises the heavy chain variable domain set forth in SEQ ID NO:4 and the light chain variable domain set forth in SEQ ID NO:5.
  • CD30 antibody binding domains suitable for the multifunctional antibody according to the invention are disclosed in Arndt MA et al., Blood. 1999; 94:2562-8; Schlapschy M. et al., Protein Eng Des Sel. 2004; 12:847-60 and Reusch U. et al., MABS. 2014; 6(3):727-738.
  • the anti-CD30 binding domain is a modified anti-CD30 IgG HRS-3 (Reusch U. et al., 2014) and comprises CDRl, CDR2 and CDR3 of the heavy chain variable domain set forth in SEQ ID NO:2 and CDRl, CDR2 and CDR3 of the light chain variable domain set forth in SEQ ID NO:3.
  • the anti-CD30 has the Fv binding domains of a modified anti-CD30 IgG HRS- 3 (Reusch U. et al., 2014) and comprises the heavy chain variable domain set forth in SEQ ID NO:2 and the light chain variable domain set forth in SEQ ID NO:3.
  • the multifunctional antibody is a bispecific, tetravalent tandem diabody CD30/CD16A, which is a homodimer of two non-covalently associated polypeptide chains, wherein each of the tandem diabody polypeptide chains has the amino acid sequence set forth in SEQ ID NO: l .
  • Example 1 describes the CD30/CD16A tandem diabody which specifically recruits NK cells by binding exclusively to the isoform CD16A. Tandem diabodies have two binding sites for each antigen, but no Fc domains.
  • the CD30/CD16A tandem diabody of example 1 has a molecular weight of about 104 kDa and can be produced in bacteria or in mammalian cells, e.g. CHO.
  • CD30 specifically targets CD30 on Hodgkin lymphoma cells and recruits and activates NK-cells by binding to CD16A.
  • the construction and production of this tandem diabody is described in Reusch U. et al., MABS. 2014; 6(3):727-738 and the efficacy of this CD30/CD16A tandem diabody is reported in Rothe A. et al., Blood. 2015; 125(26):4024-4031.
  • the PD-1 antagonist is a PD-1 antibody or a PD-L1 antibody.
  • PD-1 antibodies anti-PD-1 or anti-PD-1 antibody
  • examples of PD-1 antibodies include nivolumab, pembrolizumab (MK3475, Keytruda) and an example of PD-L1 antibody (anti-PD-Ll or anti-PD-Ll antibody) is pidilizumab.
  • CD30/CD16 antibody e.g. bispecific, CD30/CD16A antibody, and anti-PD-1 antibody
  • CD30 + tumors such as, for example,
  • Hodgkin lymphoma or anaplastic large-cell lymphoma (ALCL).
  • the CD30/CD16 antibody e.g. CD30/CD16A, for example bispecific CD30/CD16A tandem diabody
  • anti-PD-1 antibody is administered, 10-72 h, e.g. 1 day, after the administration of the CD30/CD16 antibody, for example bispecific CD30/CD16A tandem diabody.
  • the combination i.e. combination therapy, comprises the administration of a further agent for modulating another immune checkpoint molecule, for example an antagonistic antibody blocking a coinhibitory pathway or an agonistic antibody inducing a costimulatory pathway through binding to the respective immune checkpoint molecule.
  • a further agent for modulating another immune checkpoint molecule for example an antagonistic antibody blocking a coinhibitory pathway or an agonistic antibody inducing a costimulatory pathway through binding to the respective immune checkpoint molecule.
  • a further agent for modulating another immune checkpoint molecule for example an antagonistic antibody blocking a coinhibitory pathway or an agonistic antibody inducing a costimulatory pathway through binding to the respective immune checkpoint molecule.
  • Such antibodies are also known as checkpoint inhibitors (CPI) or checkpoint agonists (CPA) and have been described and clinically tested.
  • Examples of another immune checkpoint molecules for the combination, i.e. combination therapy, are CTLA-4and CD137.
  • CTLA-4 induces a signal that inhibits T-cell response.
  • CTLA-4 antibodies for the combination are ipilimumab and tremelimumab.
  • CD137 (4-1BB) or TNF receptor superfamily 9 (TNFRSF9) is a costimulatory receptor that belongs to the TNF receptor superfamily, a member of tumor necrosis factor receptor superfamily which is involved in the regulation of the activation of immune cells.
  • the functional role of CD137 is enhancing cytotoxic T cell responses.
  • An example of a CD137 agonistic antibody which enhances the T cell response is urelumab.
  • the combination i.e. combination therapy, according to the invention further comprises an antibody selected from the group consisiting of anti-CTLA4 antibody and anti- CD 137 antibody.
  • both antibodies anti-PD-1 antibody and anti-CD 137 antibody are administered in combination with the bispecific CD30/CD16 antibody.
  • the combination i.e combination therapy, comprises the steps of administering a bispecific CD30/CD16A, an anti-PD-1 and an anti-CTLA4.
  • Figure 1 shows achromium releaseassay. Percent lysis was determined after cultures of pre-activated, purified NK-cells at variable effector:target cell (KARPAS-299) ratios with 5 l Cr- labeled lymphoma cells in media alone (no antibody), or with single
  • aCD137, aPDl, aCTLA4 or multiple antibodies (aCD137 and aPDl), wherein “a” is an abbreviation of "anti”.
  • Figure 2 shows a chromium release assay. Percent lysis was determined after cultures of
  • NK-cells pre-activated, purified NK-cells at variable effector:target cell (KARPAS-299) ratios with 5 l Cr- labeled lymphoma cells in media alone (no antibody), or with single (aCD137, aPDl, aCTLA4) or multiple antibodies (aCD137 and aPDl), CD30/CD16A tandem diabody was used at 1 pM concentrations, wherein "a” is an abbreviation of "anti”.
  • KARPAS-299 variable effector:target cell
  • Figure 3 shows results of an in vivo PDX model.
  • AFM13 designates a CD30/CD16A
  • FIG. 4 shows results of an in vivo PDX model.
  • AFM13 designates the CD30/CD16A
  • FIG. 6 shows results of four in vivo PDX models at day 30: (A) tumor sizes; . IgG designates an irrelevant control IgG antibody, AFM13 designates a CD30/CD16A tandem diabody, AFM22 designates an irrelevant control tandem diabody (EGFRvIII/CD16A), anti-PD-1 designates pembrolizumab; (B) Intratumoral lymphocyte populations
  • Figure 7 shows results of four in vivo PDX models at day 44: (A) tumor sizes; IgG designates an irrelevant control IgG antibody, AFM13 designates a CD30/CD16A tandem diabody, AFM22 designates an irrelevant control tandem diabody (EGFRvIII/CD16A), anti-PD-1 designates pembrolizumab; (B) Intratumoral lymphocyte populations
  • Figure 8 shows results of four in vivo PDX models at day 58: (A) tumor sizes; IgG designates an irrelevant control IgG antibody, AFM13 designates a CD30/CD16A tandem diabody, AFM22 designates an irrelevant control tandem diabody (EGFRvIII/CD16A), anti-PD-1 designates pembrolizumab; (B) Intratumoral lymphocyte populations
  • Figure 9 shows intratumoral cytokine profile of four in vivo PDX models at day 58
  • Figure 10 shows intratumoral human leukocyte profiles.
  • Rag2 - " IL2Ry nu mice were engrafted with tumor pieces from HL patients on day 0 and reconstituted with autologous patient-derived PBMC by i.p. injection on day 28.
  • Antibody treatment started on day 28 with i.p. injection of 5 mg/kg AFM13 or control tandem diabody AFM22 or IgG and injection of anti-PD-1 with one day delay once a week for a total of three cycles.
  • mice On day 30 (A, C) and day 58 (B, D) mice were sacrificed and tumor infiltrating CD3 " /CD56 + NK-C611S and CDl lb + /HLA-DR + /CD163 + macrophages (A, B) or CD3 + /CD8 + T-cells, CD37CD4 + T-cells and CDl lc7CD807CD86 + dendritic cells (C, D) were quantified.
  • CD137 co -stimulation and/or blocking PD-1 enhances NK-cell-mediated target cell lysis by bispecific CD30/CD 16A tandem diabody
  • Efficacy was assessed in vitro with human PBMCs, enriched NKs, and CD30 + target cells as well as cell line and patient-derived xenograft in vivo models with CD30/CD 16A tandem diabody, anti-CTLA-4, anti-PD-1 , or anti-CD137 antibodies.
  • NK-cell cytotoxicity was performed as follows: PBMCs were cultured for 24 hours together with anti-CD30 (10 ⁇ g/mL) and irradiated (5,000 rads) CD30 + lymphoma tumor cells at a ratio of 1 : 1. After 24 hours, NK-cells were isolated from these cultures by negative magnetic cell sorting using NK-cell isolation beads (Miltenyi Biotec) according to manufacturer's instructions. NK-cells were assessed for purity (>90% purity as defined by flow cytometry) prior to chromium release assay. Target cells were labeled with 150 iCi 51 Cr per lxl O 6 cells for 2 hours. Percent lysis was determined after 4 hour cultures of pre-activated, purified NK-cells at variable effector:target cell ratios with 51 Cr-labeled lymphoma cells in media alone, or with single or multiple antibodies.
  • Xenografted tumor pieces (8x8mm) derived from a surgical specimen of a newly diagnosed patient with CD30 + lymphoma (including Hodgkin Disease), in Rag2 _/ TL2R7 nu11 mice (n ⁇ 100) were observed for engraftment and up to 80 mice with engraftment of similar size (0.5 cm 2 ) randomized into up to 8 groups on day 28.
  • Autologous PBMCs were infused on day 28 (2x10 6 PBMCs/mouse) intra-peritoneally. Therapy begins on day 28 and is continued weekly for a total of three intraperitoneal injections, all dosed at 15mg/kg.
  • anti-CD30/CD16A AFM13; Reusch U.
  • NK-cell infiltration was determined as CD3 " and CD56 + ; T-cell infiltration was determined as CD25 + , and CD4 + , CD3 + and CD4 + , CD3 + and CD8 + ; NK-cell subsets are determined as CD56dim, CD56bright, CD 16 A, CD69; macrophages are determined as CDl lb, HL-DR and CD163; dendritic cells by CD1 lc, CD80 and CD86 ( Figures 6B, 7B and 8B).
  • the CD30/CD16A tandem diabody is the antibody AFM13 described in Reusch U. et al., MABS. 2014; 6(3):727-738.
  • the CD30/CD 16A tandem diabody comprises the anti-CD30 domain of hybridoma HRS-3 and its construction and expression in bacteria is disclosed in example 19 of WO 2006/125668. Results:
  • the enhanced antitumor activity of the CD30/CD16A tandem diabody in combination with immune -modulating antibodies was associated with higher numbers of tumor-infiltrating NK- and T- cells and augmented release of pro-inflammatory cytokines.
  • Treatment with control IgG or irrelevant CD16A-recruiting tandem diabodies did not induce an unspecific immune cell activation supporting strict target-dependent NK-cell activation by CD30/CD16A tandem diabody.
  • CD30/CD16A tandem diabody with immune -modulating anti-CTLA-4, anti- CD137, and anti-PD-1 antibodies not only enhanced the anti-tumor activity of NK-cells but also stimulated infiltration of T- cells and cytokine release in the tumors supporting cross-talk between innate and adaptive immunity.
  • CD30/CD16A tandem diabody In contrast to anti-PD-1 monotherapy, which only induced T-cell infiltration, monotherapy with CD30/CD16A tandem diabody was able to induce infiltration of NK- andT -cells in the tumors, however the combination of CD30/CD16A tandem diabody with anti-PD-1 further enhanced infiltration of both, NK- and T-cells.
  • CD30/CD16A tandem diabody resulted in stronger infiltration of macrophages than anti-PD-1, which was also increased by the combination of both agents (Figure 8B), therefore further supporting crosstalk between innate and adaptive immunity.
  • the data shows strong antitumor efficacy when CD30/CD16A tandem diabody is combined with anti-PD-1 checkpoint blockade in Hodgkin lymphoma PDX models, mediated by tumor-infiltrating lymphocytes (CD4+ and CD8+ T-cells, macrophages and dendritic cells).
  • CD4+ and CD8+ T-cells tumor-infiltrating lymphocytes
  • CD4+ and CD8+ T-cells tumor-infiltrating lymphocytes
  • macrophages tumor-infiltrating lymphocytes
  • dendritic cells tumor-infiltrating lymphocytes
  • the initial anti -tumor response induced by CD30/CD16A tandem diabody is driven by the recruitment and activation of innate immune cells such as NK-cells and macrophages,and their activation results in crosstalk between innate and adaptive immunity such as CD4 and CD8+ T-cells correlating with efficient tumor growth control.
  • innate immune cells such as NK-

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Epidemiology (AREA)
  • Cell Biology (AREA)
  • Oncology (AREA)
  • Hematology (AREA)
  • Biomedical Technology (AREA)
  • Endocrinology (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Peptides Or Proteins (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)

Abstract

Described is a combination therapy of (i) a multifunctional antibody having specificity for CD30 and CD16A and (ii) an anti-PD-1 antibody for the treatment of a tumor, in particular Hodgkin lymphoma.

Description

Combination of a CD30xCD16 antibody with a PD-1 antagonist for therapy The invention relates to a combination of (i) a multifunctional antibody having specificity for
CD30 on a tumor cell and having specificity for CD16, in particular CD16A, on a natural killer (NK)- cell and (ii) a PD-1 antagonist, e.g. anti-PD-1 antibody, for the treatment of a tumor, in particular Hodgkin lymphoma (HL).
Because, NK-cells mediate innate immunity and are constitutively activated, they are candidates for cancer immunotherapy. A bispecific CD30/CD16A tandem diabody (TandAb®) binds NK-cells via CD16A and has a second binding domain for CD30, a cancer-specific target, e.g CD30+ Hodgkin Reed-Sternberg (HRS) lymphoma cells. Such tandem diabody recruits and redirects the NK- cells to CD30+ tumor cells and binds both targets with high affinity, establishing a bridge whereby the NK-cells are activated and redirected to kill the tumor cells. Higher cytotoxic potency relative to native and Fc-enhanced antibodies has been reported for this bispecific CD30/CD16A tandem diabody (see Reusch U. et al., MABS. 2014; 6(3):727-738). The CD30/CD16A tandem diabody is well tolerated and active in Hodgkin lymphoma patients (see Rothe A. et al., Blood. 2015; 125(26):4024- 4031). Despite these promising results further improvements for this tumor-targeted NK-cell engaging immunotherapy are desired.
Immune checkpoint molecules are cell surface proteins, e.g. receptors that regulate costimulatory or coinhibitory pathways of the immune response. Examples of immune checkpoint molecules are cytotoxic T-lymphocyte antigen-4 (CTLA-4), programmed death- 1 (PD-1), programmed death ligand-1 (PD-Ll) or programmed death ligand-2 (PD-L2), immune costimulatory molecules on NK-cell and costimulatory receptors of the TNF receptor family, for example CD137.
PD-1 (PDCD1 or CD279) receptor mediates a coinhibitory pathway. Further PD-1 binds to
PD-Ll which induces a coinhibitory signaling upon receptor-ligand ligation. PD-1 pathway is a checkpoint to limit T-cell mediated immune response (Keir ME et al., Annu. Rev. Immunol. 2008;26:677-704). By expressing PD-1 ligands on the cell surface and engaging PD-1+ immune effector cells, tumors can co-opt the PD-1 pathway to evade an immune response (Weber J, Semin Oncol. 2010;37:430-9; Ansell S et al., N. Engl J. Med. 2015;372:311-319). PD-1 antagonists blocking the interaction between PD-1 and PD-Ll, which is implicated in the down-modulation of T-cell responses have been studied in a variety of cancers and combinations of PD-1 blockade with CTLA-4 blockade for regulating adaptive immunity has been suggested (Dolan D and Gupta S, Cancer Control. 2014;21 :231 -237). The anti-PD-1 antibody pembrolizumab has demonstrated initial clinical efficacy in single arm monotherapy trials in patients with Hodgkin lymphoma as determined by response rate. Ongoing clinical trials are being conducted in these tumor types as well as a number of other advanced solid tumor indications and hematologic malignancies.
Further, anti-CD137 antibodies which bind to the costimulatory molecule CD 137 on NK cells have been used in combination with other monoclonal antibodies like rituximab or lenalidomide for enhancing NK-cell function (Miller J., Hematology 2013 :247-253).
Provided herein is a combination of a multifunctional antibody having specificity for CD30 and CD16, in particular CD16A, and a PD-1 antagonist, in particular an anti-PD-1 antibody for use in a method of treating a tumor, in particular Hodgkin lymphoma (HL). This combination results in an enhanced tumor cell killing, because the combination of an NK-cell engaging and tumor targeting multifunctional antibody with the immune modulating agent has a synergistic anti-tumor effect through an integrated immune response involving NK-cells, T-cells, macrophages and dendritic cells. Hence, all immune subpopulations are activated and induced to infiltrate the tumors by the combination treatment. A combination of CD30/CD16A bispecific antibody and anti-PD-1 antibody significantly enhances the initial innate immune response by enhanced tumor infiltration of the innate immune cells, in particular NK-cells, macrophages and dendritic cells. In preclinical animal studies of Hodgkin lymphoma using autologous patient material, i.e. patient derived xenograft (PDX) and immune cells from blood (PBMC) from the same donor, the established tumor was treated with a bispecific CD30/CD16 antibody in combination with an agent modulating an anti-PDl antibody both alone and in combination. While the single agent treatment showed a significant reduction in tumor growth for most molecules when compared to the control treatment group (irrelevant IgG), the combination of bispecific CD30/CD16 multifunctional antibody and anti-PD-1 antibody showed enhanced anti-tumor efficacy. Compared to IgG treatment it was observed that in animals treated with combinations of CD30/CD16 antibody and an anti-PD-1 antibody the NK cell population in the tumor increased. As early as 2 days after treatment (day 30) bispecific CD30/CD16A tandem diabody monotherapy induced an infiltration of both NK cells and macrophages in the tumors. This effect was enhanced over time and both immune cell populations demonstrated strong bispecific CD30/CD16A tandem diabody-medicated infiltration of the tumors towards the end of the experiment (day 58). When bispecific CD30/CD16A tandem diabody was combined with the immuno-modulating antibody anti-PD-1 the effect on innate immunity was initially driven by bispecific CD30/CD16A tandem diabody alone, but the anti-PD-1 treatment did result in a more pronounced innate cell infiltration at the end of the experiment. In addition, while there was a small increase of T-cells in animals treated only with CD30/CD16 antibody, the cytotoxic T-cells detected in animals treated with CD30/CD16 antibody in combination with an agent modulating an immune checkpoint molecule increased.
While monotherapy with anti-PD-1 induces T-cell infiltration to a certain extent, CD30/CD16 antibody in combination with an anti-PD-1 enhanced the infiltration of both CD4+ and CD8+ T-cell in tumors. T-cells and dendritic cells were significantly induced by the combination of CD30/CD16 antibody and anti-PD-1 compared to either monotherapy of CD30/CD16 antibody or anti-PD-1 (Figure 8B). Combination of CD30/CD16 antibody and anti-PD-1 advantageously induced an infiltration of dendritic cells into the tumor shortly after the administration (day 30 and day 40). The combination of CD30/CD16 antibody and anti-PD-1 significantly increased the tumor infiltration of all immune subpopulations, such as T-cells, NK-cells, macrophages and dendritic cells, compared to monotherapies by CD30/CD16 antibody and anti-PD-1, respectively (Figure 8B).
Therefore, the combination of (i) a multifunctional antibody having specificity for CD30 and having specificity for CD 16, in particular CD16A and (ii) an anti-PD-1 antibody, increases synergistically the killing of tumor cells which results in a significantly increased tumor regression. The remarkable tumor regression is achieved by the coordinated, i.e. integrated, action of all immune subpopulations, such as CD4+ and CD8+ T-cells and NK-cells, macrophages and dendritic cells as well as the intra-tumoral increase of inflammatory cytokines, such as in particular IFN-γ, through the combined activity of the NK-cell engaging multifunctional antibody and the agent modulating the immune checkpoint molecule. The combination therapy provided herein demonstrates for the first time that the efficacy of inducing an innate immune response by a NK-cell engaging and tumor targeting antibody can be augmented by an anti-PD-1 antibody which is known for stimulating the adaptive immune response by blocking the PD-1 pathway.
The combination of the multifunctional antibody having specificity for CD30 and CD 16, in particular CD16A, and the PD-1 antagonist, in particular PD-1 antibody, is used for increasing the innate immune response as compared with that of the multifunctional antibody having specificity for CD30 and CD16A alone in a method of treating a tumor, in particular Hodgkin lymphoma (HL). In particular, the innate immune response is increased by cell infiltration of innate cells, in particular macrophages, dendritic cells and NK-cells into the tumor. Further, the intratumoral infiltration of CD4+ and CD8+ T-cells is increased.
"Innate immune response" refers to the activation of one or more innate leukocytes of the innate immune system (or nonspecific immune system or in-born immunity system). The activated leukocytes of the innate immune response comprise Natural killer (NK) cells, macrophages and dendritic cells. The innate immune system is distinct from the adaptive immune system (or specific immune system) which includes lymphocytes like CD4+ or CD8+ T-cells.
"Combination" refers to a combination therapy, combined therapy or polytherapy that uses more than one medication for the treatment of a tumor, i.e. single disease. In the present invention "combination" is used for a combination therapy that embraces the steps of administering a multifunctional antibody having specificity for CD30 and CD16A, e.g. bispecific CD30/CD16A tandem diabody, and a PD-1 antagonist, e.g. anti-PD-1 antibody, for the treatment of a tumor, e.g. Hodgkin lymphoma. Hence, the bispecific CD30/D16A tandem diabody and the anti-PD-1 antibody are given in combination. In contrast, "monotherapy" refers to a therapy which embraces the administration of a single medication alone, e.g. either bispecific CD30/CD16A tandem diabody or anti-PD-1 antibody.
The combination comprises a multifunctional antibody for use in a NK-cell based immunotherapy of a tumor. The term "multifunctional" as used herein means that the antibody exhibits two or more different biological functions. For example, the different biological functions are different specificities for different antigens. In certain instances, the multifunctional antibody is multispecific, e.g. bispecific, trispecific, etc. Such multispecific, e.g. bispecific, binding proteins include, for example, bispecific monoclonal antibodies of the classes IgA, IgD, IgE, IgG or IgM, as well as antibody fragments or antibody derivatives including, for example, Fab, Fab', F(ab')2, Fv fragments, single-chain Fv, tandem single-chain Fv (scFv)2, dual affinity retargeting antibodies (DART™), diabody and tandem diabody (TandAb®), single-chain diabodies (scDb) and flexibodies. The term "antibody" as used herein means monoclonal antibodies as well as antibody fragments and antibody derivatives comprising an antibody binding domain. Various antibody formats can be generated from antibody fragments and antibody derivatives which have similar antibody binding specificity as a native antibody, but differ in validity and effector function due to the number of binding domains or lack of Fc-region. Examples of antibody formats for bispecific antibodies are described in Spiess, C. et al., Mol Immunol. 2015 Oct;67(2 Pt A):95-106 and Kontermann, R.E., Brinkmann, U., Drug Discov. Today 2015 Jul;20(7):838-47.
In certain embodiments the multifunctional antibody is a multispecific, e.g. bispecific tandem diabody (TandAb®). A tandem diabody is constructed by linking the four variable domains of the heavy and light chains (VH and VL) from two or more different Fv binding domains in a single polypeptide. The domains are positioned such that corresponding VH and VL can pair when two molecules of the polypeptide align in a head-to-tail fashion. Short linkers between the domains (twelve or fewer amino acids) prevent intramolecular pairing of the Fv. The antibody format of a tandem diabody and its manufacture is described in Weichel et al., European Pharmaceutical Review 2015, vol. 20:27-32, Kipriyanov SM: Methods Mol. Biol. 2009;562: 177-93 or Kipriyanov SM: Methods Mol Biol 2003;207:323-33. In certain embodiments first the multifunctional antibody, e.g. bispecific CD30/CD16A tandem diabody, is administered and subsequently the agent being an immunomodulatory molecule, i.e. anti-PD-1 antibody, is administered. Hence, CD30/CD16A and anti-PD-1 antibody can be sequentially administrated, typically over a certain period of time. Administration of the multifunctional antibody and the anti-PD-1 can be effected by different ways, e.g. by intravenous, intraperitoneal, subcutaneous, intramuscular, topical or intradermal administration. In some embodiments, the route of administration depends on the kind of therapy and the kind of compound contained in the pharmaceutical composition. The dosage regimen will be determined by the attending physician and other clinical factors. Dosages for any one patient depends on many factors, including the patient's size, body surface area, age, sex, the particular compound to be administered, time and route of administration, the kind of therapy, general health and other drugs being administered concurrently. An "effective dose" refers to amounts of the active ingredient that are sufficient to affect the course and the severity of the disease, leading to the reduction or remission of such pathology. An "effective dose" useful for treating a tumor may be determined using known methods. Hence, the invention encompasses a method of treatment, i.e. combination therapy, comprising the step of administering to a subject suffering from a CD30+ tumor, e.g. Hodgkin lymphoma, effective dosages of a combination of a multifunctional antibody and an anti-PD-1 (PD-1 antibody), wherein the multifunctional antibody has specificity for CD30 and CD16, e.g. is a CD30/CD 16A antibody.
This immunotherapeutic approach of antibody-mediated recruitment of NK-cells to tumors using multifunctional antibodies can be used for the treatment of tumors, for example Hodgkin lymphoma. Therefore, the invention provides a combination of a multifunctional antibody having specificity for CD30 and CD16A, e.g. bispecific CD30/CD16A tandem diabody, and an anti-PD-1 antibody for use in a combination therapy for treating a tumor, e.g. Hodgkin lymphoma or anaplastic large-cell lymphoma (ALCL).
In certain embodiments the multifunctional antibody recruits NK-cells by binding exclusively to the CD 16 isoform CD16A. Examples of anti-CD 16A binding domains and their generation are described in WO 2006/125668. In certain embodiments the anti-CD16A binding domain comprises CDRl, CDR2 and CDR3 of the heavy chain variable domain set forth in SEQ ID NO:4 and CDRl, CDR2 and CDR3 of the light chain variable domain set forth in SEQ ID NO:5. In particular embodiments the anti-CD 16A binding domain comprises the heavy chain variable domain set forth in SEQ ID NO:4 and the light chain variable domain set forth in SEQ ID NO:5.
Examples of CD30 antibody binding domains suitable for the multifunctional antibody according to the invention are disclosed in Arndt MA et al., Blood. 1999; 94:2562-8; Schlapschy M. et al., Protein Eng Des Sel. 2004; 12:847-60 and Reusch U. et al., MABS. 2014; 6(3):727-738. In certain embodiments the anti-CD30 binding domain is a modified anti-CD30 IgG HRS-3 (Reusch U. et al., 2014) and comprises CDRl, CDR2 and CDR3 of the heavy chain variable domain set forth in SEQ ID NO:2 and CDRl, CDR2 and CDR3 of the light chain variable domain set forth in SEQ ID NO:3. In particular embodiments the anti-CD30 has the Fv binding domains of a modified anti-CD30 IgG HRS- 3 (Reusch U. et al., 2014) and comprises the heavy chain variable domain set forth in SEQ ID NO:2 and the light chain variable domain set forth in SEQ ID NO:3.
In a certain embodiment of the invention the multifunctional antibody is a bispecific, tetravalent tandem diabody CD30/CD16A, which is a homodimer of two non-covalently associated polypeptide chains, wherein each of the tandem diabody polypeptide chains has the amino acid sequence set forth in SEQ ID NO: l . Example 1 describes the CD30/CD16A tandem diabody which specifically recruits NK cells by binding exclusively to the isoform CD16A. Tandem diabodies have two binding sites for each antigen, but no Fc domains. The CD30/CD16A tandem diabody of example 1 has a molecular weight of about 104 kDa and can be produced in bacteria or in mammalian cells, e.g. CHO. It specifically targets CD30 on Hodgkin lymphoma cells and recruits and activates NK-cells by binding to CD16A. The construction and production of this tandem diabody is described in Reusch U. et al., MABS. 2014; 6(3):727-738 and the efficacy of this CD30/CD16A tandem diabody is reported in Rothe A. et al., Blood. 2015; 125(26):4024-4031.
In certain embodiments the PD-1 antagonist is a PD-1 antibody or a PD-L1 antibody. Examples of PD-1 antibodies (anti-PD-1 or anti-PD-1 antibody) include nivolumab, pembrolizumab (MK3475, Keytruda) and an example of PD-L1 antibody (anti-PD-Ll or anti-PD-Ll antibody) is pidilizumab.
The combination of a multifunctional CD30/CD16 antibody, e.g. bispecific, CD30/CD16A antibody, and anti-PD-1 antibody, can be used for treating CD30+ tumors, such as, for example,
Hodgkin lymphoma or anaplastic large-cell lymphoma (ALCL).
In certain embodiments first the CD30/CD16 antibody, e.g. CD30/CD16A, for example bispecific CD30/CD16A tandem diabody, is administered and subsequently anti-PD-1 antibody is administered. For example, anti-PD-1 antibody is administered, 10-72 h, e.g. 1 day, after the administration of the CD30/CD16 antibody, for example bispecific CD30/CD16A tandem diabody.
In certain embodiments the combination, i.e. combination therapy, comprises the administration of a further agent for modulating another immune checkpoint molecule, for example an antagonistic antibody blocking a coinhibitory pathway or an agonistic antibody inducing a costimulatory pathway through binding to the respective immune checkpoint molecule. Such antibodies are also known as checkpoint inhibitors (CPI) or checkpoint agonists (CPA) and have been described and clinically tested.
Examples of another immune checkpoint molecules for the combination, i.e. combination therapy, are CTLA-4and CD137.
CTLA-4 induces a signal that inhibits T-cell response. Examples of CTLA-4 antibodies for the combination are ipilimumab and tremelimumab.
CD137 (4-1BB) or TNF receptor superfamily 9 (TNFRSF9) is a costimulatory receptor that belongs to the TNF receptor superfamily, a member of tumor necrosis factor receptor superfamily which is involved in the regulation of the activation of immune cells. The functional role of CD137 is enhancing cytotoxic T cell responses. An example of a CD137 agonistic antibody which enhances the T cell response is urelumab.
In certain embodiments the combination, i.e. combination therapy, according to the invention further comprises an antibody selected from the group consisiting of anti-CTLA4 antibody and anti- CD 137 antibody.
In a particular embodiment, both antibodies anti-PD-1 antibody and anti-CD 137 antibody are administered in combination with the bispecific CD30/CD16 antibody. Hence, in this certain embodiment the combination, i.e combination therapy, comprises the steps of administering a bispecific CD30/CD16A, an anti-PD-1 and an anti-CTLA4. Brief description of the drawings:
Figure 1 shows achromium releaseassay. Percent lysis was determined after cultures of pre-activated, purified NK-cells at variable effector:target cell (KARPAS-299) ratios with 5 lCr- labeled lymphoma cells in media alone (no antibody), or with single
(aCD137, aPDl, aCTLA4) or multiple antibodies (aCD137 and aPDl), wherein "a" is an abbreviation of "anti".
Figure 2 shows a chromium release assay. Percent lysis was determined after cultures of
pre-activated, purified NK-cells at variable effector:target cell (KARPAS-299) ratios with 5 lCr- labeled lymphoma cells in media alone (no antibody), or with single (aCD137, aPDl, aCTLA4) or multiple antibodies (aCD137 and aPDl), CD30/CD16A tandem diabody was used at 1 pM concentrations, wherein "a" is an abbreviation of "anti".
Figure 3 shows results of an in vivo PDX model. AFM13 designates a CD30/CD16A
tandem diabody.
Figure 4 shows results of an in vivo PDX model. AFM13 designates the CD30/CD16A
tandem diabody.
Figure 5 In vivo PDX model: increased lymphocytes in CD30/CD16A tandem diabody
treated mice Figure 6 shows results of four in vivo PDX models at day 30: (A) tumor sizes; . IgG designates an irrelevant control IgG antibody, AFM13 designates a CD30/CD16A tandem diabody, AFM22 designates an irrelevant control tandem diabody (EGFRvIII/CD16A), anti-PD-1 designates pembrolizumab; (B) Intratumoral lymphocyte populations
Figure 7 shows results of four in vivo PDX models at day 44: (A) tumor sizes; IgG designates an irrelevant control IgG antibody, AFM13 designates a CD30/CD16A tandem diabody, AFM22 designates an irrelevant control tandem diabody (EGFRvIII/CD16A), anti-PD-1 designates pembrolizumab; (B) Intratumoral lymphocyte populations
Figure 8 shows results of four in vivo PDX models at day 58: (A) tumor sizes; IgG designates an irrelevant control IgG antibody, AFM13 designates a CD30/CD16A tandem diabody, AFM22 designates an irrelevant control tandem diabody (EGFRvIII/CD16A), anti-PD-1 designates pembrolizumab; (B) Intratumoral lymphocyte populations
Figure 9 shows intratumoral cytokine profile of four in vivo PDX models at day 58 Figure 10 shows intratumoral human leukocyte profiles. Rag2 - " IL2Rynu mice were engrafted with tumor pieces from HL patients on day 0 and reconstituted with autologous patient-derived PBMC by i.p. injection on day 28. Antibody treatment started on day 28 with i.p. injection of 5 mg/kg AFM13 or control tandem diabody AFM22 or IgG and injection of anti-PD-1 with one day delay once a week for a total of three cycles. On day 30 (A, C) and day 58 (B, D) mice were sacrificed and tumor infiltrating CD3" /CD56+NK-C611S and CDl lb+/HLA-DR+/CD163+macrophages (A, B) or CD3+/CD8+ T-cells, CD37CD4+ T-cells and CDl lc7CD807CD86+dendritic cells (C, D) were quantified.
Example: CD137 co -stimulation and/or blocking PD-1 enhances NK-cell-mediated target cell lysis by bispecific CD30/CD 16A tandem diabody
Methods:
Efficacy was assessed in vitro with human PBMCs, enriched NKs, and CD30+ target cells as well as cell line and patient-derived xenograft in vivo models with CD30/CD 16A tandem diabody, anti-CTLA-4, anti-PD-1 , or anti-CD137 antibodies.
To evaluate NK-cell cytotoxicity for CD30+ lymphoma cell lines, chromium release was performed as follows: PBMCs were cultured for 24 hours together with anti-CD30 (10 μg/mL) and irradiated (5,000 rads) CD30+ lymphoma tumor cells at a ratio of 1 : 1. After 24 hours, NK-cells were isolated from these cultures by negative magnetic cell sorting using NK-cell isolation beads (Miltenyi Biotec) according to manufacturer's instructions. NK-cells were assessed for purity (>90% purity as defined by flow cytometry) prior to chromium release assay. Target cells were labeled with 150 iCi 51Cr per lxl O6 cells for 2 hours. Percent lysis was determined after 4 hour cultures of pre-activated, purified NK-cells at variable effector:target cell ratios with 51Cr-labeled lymphoma cells in media alone, or with single or multiple antibodies.
Xenografted tumor pieces (8x8mm) derived from a surgical specimen of a newly diagnosed patient with CD30+ lymphoma (including Hodgkin Disease), in Rag2_/TL2R7nu11 mice (n~100) were observed for engraftment and up to 80 mice with engraftment of similar size (0.5 cm2) randomized into up to 8 groups on day 28. Autologous PBMCs were infused on day 28 (2x106 PBMCs/mouse) intra-peritoneally. Therapy begins on day 28 and is continued weekly for a total of three intraperitoneal injections, all dosed at 15mg/kg. With combination therapy, anti-CD30/CD16A (AFM13; Reusch U. et al., MABS. 2014; 6(3):727-738) was dosed on day 28 and anti-CTLA4 (Ipilimumab), anti-CD137 (Urelumab) or anti-PDl (Pembrolizumab) dosed on day 29. Tumor size was compared between groups at day 56. All mice are sacrificed for immunophenotyping once a group requires euthanasia due to growth to 700% of original tumor size (app 3.5cm2) on day 58.
Tumor infiltrating human lymphocytes, myeloid cells and intratumoral cytokines were evaluated on days 30, 44, and 58, i.e. 2, 16 and 30 days after treatment start. The following biomarkers were determined: NK-cell infiltration was determined as CD3" and CD56+; T-cell infiltration was determined as CD25+, and CD4+, CD3+ and CD4+, CD3+ and CD8+; NK-cell subsets are determined as CD56dim, CD56bright, CD 16 A, CD69; macrophages are determined as CDl lb, HL-DR and CD163; dendritic cells by CD1 lc, CD80 and CD86 (Figures 6B, 7B and 8B).
The CD30/CD16A tandem diabody is the antibody AFM13 described in Reusch U. et al., MABS. 2014; 6(3):727-738.The CD30/CD 16A tandem diabody comprises the anti-CD30 domain of hybridoma HRS-3 and its construction and expression in bacteria is disclosed in example 19 of WO 2006/125668. Results:
CD30/CD16A tandem diabody demonstrated higher potency and efficacy toward target and effector cells relative to other CD30+ antibody formats (EC5o = 15pM). These favorable properties resulted in superior cytotoxicity when CD30/CD16A tandem diabody was incubated with CD30+ tumor cells and enriched NK-cells (Figure 2). Single treatment with CD30/CD16A tandem diabody at suboptimal concentrations (1 pM) induced effector-to-target cell-dependent lysis of CD30+ lymphoma cells up to 40% using enriched NK-cells. Immune -modulating antibodies alone mediated substantially lower lysis (<25%) (Figure 1). However, the addition of anti-PD-1 or anti-CD137 to CD30/CD16A tandem diabody strongly enhanced specific lysis up to 70%, whereas the addition of anti-CTLA-4 to CD30/CD16A tandem diabody showed no beneficial effect. The most impressive increase of efficacy was observed when CD30/CD16A tandem diabody was applied together with a combination of anti- PD-1 and anti-CD137 (Figure 2). In vivo, synergy of CD30/CD16A tandem diabody and immune modulating antibody combination was observed with each immune modulating antibody tested and augmented with anti-PDl (regression in 9/10 tumors), anti-CTLA-4 (3/10), and anti-CD 137 mAb (3/10) and influenced by presence of regulatory T-cells, NK-cells, and Thl cytokines (Figures 3 and 4)·
Compared to IgG treatment it was observed that in animals treated with combinations of CD30/CD16A tandem diabody and anti-CTLA-4, anti-PD-1 and anti-CD 137 the NK-cell population in the tumor increased. In addition, while there was no increase of T-cells in animals treated only with CD30/CD16A tandem diabody or anti-CTLA-4, anti-PD-1 and anti-CD137 alone, the cytotoxic T- cells detected in animals treated with CD30/CD16A tandem diabody in combination with anti-CTLA- 4, anti-PD-1 and anti-CD 137 increased (Figure 5). The findings support that dual-antibody therapy augments the efficacy of CD30/CD16A tandem diabody and immune modulating antibodies achieving a remarkable tumor regression.
The enhanced antitumor activity of the CD30/CD16A tandem diabody in combination with immune -modulating antibodies was associated with higher numbers of tumor-infiltrating NK- and T- cells and augmented release of pro-inflammatory cytokines. Treatment with control IgG or irrelevant CD16A-recruiting tandem diabodies did not induce an unspecific immune cell activation supporting strict target-dependent NK-cell activation by CD30/CD16A tandem diabody. Combination of CD30/CD16A tandem diabody with immune -modulating anti-CTLA-4, anti- CD137, and anti-PD-1 antibodies not only enhanced the anti-tumor activity of NK-cells but also stimulated infiltration of T- cells and cytokine release in the tumors supporting cross-talk between innate and adaptive immunity.
In further experiments with the same PDX model of above and anti-PD-1 (pembrolizumab) tumor size, tumor infiltrating human lymphocytes, myeloid cells and intratumoral cytokines were evaluated on days 30, 44, and 58, i.e. 2, 16 and 30 days after treatment start. Monotherapy with CD30/CD16A tandem diabody was reproducibly more potent than monotherapy with anti-PD-1 and synergy was observed when both agents were combined. Analysis of the tumors on day 58 revealed a strong correlation between tumor growth inhibition (Figure 8A) and levels of tumor infiltrating NK- cells, T-cells, myeloid cells (Figure 8B) and intratumoral cytokines such as IFNy (Figure 9). In contrast to anti-PD-1 monotherapy, which only induced T-cell infiltration, monotherapy with CD30/CD16A tandem diabody was able to induce infiltration of NK- andT -cells in the tumors, however the combination of CD30/CD16A tandem diabody with anti-PD-1 further enhanced infiltration of both, NK- and T-cells. CD30/CD16A tandem diabody resulted in stronger infiltration of macrophages than anti-PD-1, which was also increased by the combination of both agents (Figure 8B), therefore further supporting crosstalk between innate and adaptive immunity. Furthermore, tumor analyses at the earlier time-points day 30 (Figure 6B) and day 44 (Figure7B) showed that the initial immune response is characterized by NK-cell infiltration and activation, as well as infiltration of macrophages, whilst the adaptive immune response by T-cells and activated dendritic cells was more pronounced on day 58 (Figure 8B). Combining CD30/CD16A tandem diabody and anti-PD-1 augments infiltration and activation of all immune subpopulations (Figure 8B). As early as 2 days after treatment (day 30) CD30/CD16A tandem diabody monotherapy induced an infiltration of both NK cells and macrophages in the tumors. This effect was enhanced over time and both immune cell populations demonstrated strong tandem diabody-mediated infiltration of the tumors towards the end of the experiment (day 58). When CD30/CD16A tandem diabody was combined with the immuno- modulating antibody anti-PD-1 the effect on innate immunity was initially driven by tandem diabody alone, but the anti-PD-1 treatment did result in a more pronounced innate cell infiltration at the end of the experiment (Figure 10).
In summary, the data shows strong antitumor efficacy when CD30/CD16A tandem diabody is combined with anti-PD-1 checkpoint blockade in Hodgkin lymphoma PDX models, mediated by tumor-infiltrating lymphocytes (CD4+ and CD8+ T-cells, macrophages and dendritic cells). Hence, the initial anti -tumor response induced by CD30/CD16A tandem diabody is driven by the recruitment and activation of innate immune cells such as NK-cells and macrophages,and their activation results in crosstalk between innate and adaptive immunity such as CD4 and CD8+ T-cells correlating with efficient tumor growth control. These observations also correlate with the release of intra-tumoral cytokines such as IFNy or TNFa.
SEQUENCE SUMMARY
SEQ
ID Sequence
NO:
Amino acid sequence of bispecific tandem diabody CD30/CD16A
1
QVQLVQSGAEVKKPGESLKVSCKASGYTFTSYYMHWVRQAPGQGLEWMGI IN PSGGSTSYAQKFQGRVTMTRDTS
TSTVYM ELSSLRSEDTAVYYCARGSAYYYDFADYWGQGTLVTVSSGGSGGSGGSDIVMTQSPKFMSTSVGDRVTVTC
KASQNVGTNVAWFQQKPGQSPKVLIYSASYRYSGVPDRFTGSGSGTDFTLTISNVQSEDLAEYFCQQYHTYPLTFGG
GTKLEINGGSGGSGGSQVQLQQSGAELARPGASVKMSCKASGYTFTTYTIHWVRQRPG HDLEWIGYIN PSSGYSDYN
QN FKGKTTLTADKSSNTAYMQLNSLTSEDSAVYYCARRADYG NYEYTWFAYWGQGTTVTVSSGGSGGSGGSSYVLT
QPSSVSVAPGQTATISCGGH N IGSKNVHWYQQRPGQSPVLVIYQDN KRPSG IPERFSGSNSGNTATLTISGTQAM DE
ADYYCQVWDNYSVLFGGGTKLTVL
Heavy chain variable domain amino acid sequence anti-CD30
2
QVQLQQSGAELARPGASVKMSCKASGYTFTTYTIHWVRQRPG H DLEWIGYIN PSSGYSDYNQN FKGKTTLTADKSSN TAY M QLN S LTSE DSA VYYCA RRADYGNY EYTW F AY WG QGTTVTVSS
Light chain variable domain amino acid sequence anti-CD30
3
DIVMTQSPKFMSTSVGDRVTVTCKASQNVGTNVAWFQQKPGQSPKVLIYSASYRYSGVPDRFTGSGSGTDFTLTISN VQSEDLAEYFCQQYHTYPLTFGGGTKLEIN
Heavy chain variable domain amino acid sequence anti-CD 16A
4
QVQLVQSGAEVKKPGESLKVSCKASGYTFTSYYMHWVRQAPGQGLEWMGI IN PSGGSTSYAQKFQGRVTMTRDTS TSTVY M ELSSLRSE DTAVY YCA RG SAYYY DFADYWGQGT LVTVSS
Light chain variable domain amino acids sequence anti-CD 16A
5
SYVLTQPSSVSVAPGQTATISCGGH N IGSKNVHWYQQRPGQSPVLVIYQDN KRPSGI PERFSGSNSGNTATLTISGTQ AM DEADYYCQVWDNYSVLFGGGTKLTVL

Claims

CLAIMS 1. A combination of (i) a multifunctional antibody having specificity for CD30 and CD16A and (ii) an anti-PD-1 antibody, for use in a method of treating a tumor.
2. The combination of claim 1, wherein the combination is used in a method for increasing the innate immune response as compared with that of the multifunctional antibody having specificity for CD30 and CD16A alone.
3. The combination of claim 2, wherein the increased innate immune response is an increased intratumoral cell infiltration of innate cells into the tumor.
4. The combination of claim 3, wherein intratumoral infiltration of macrophages, dendritic cells and NK-cells is increased.
5. The combination of claim 4, wherein further the intratumoral infiltration of CD4+ and CD8+ T-cells is increased.
6. The combination of any one of claims 1 to 5, wherein the tumor is a Hodgkin lymphoma.
7. The combination of any one of claims 1 to 6, wherein the multifunctional antibody comprises an anti-CD30 binding domain and said anti-CD30 binding domain comprises CDR1, CDR2 and CDR3 of the heavy chain variable domain set forth in SEQ ID NO:2 and CDR1, CDR2 and CDR3 of the light chain variable domain set forth in SEQ ID NO:3.
8. The combination of claim 7, wherein the multifunctional antibody comprises an anti-CD30 binding domain and said anti-CD30 binding domain comprises the heavy chain variable domain set forth in SEQ ID NO:2 and the light chain variable domain set forth in SEQ ID
NO:3
9. The combination of any one of claims 1 to 8, wherein the multifunctional antibody comprises an anti-CD 16A binding domain and said anti-CD 16A binding domain comprises CDR1, CDR2 and CDR3 of the heavy chain variable domain set forth in SEQ ID NO:4 and CDR1,
CDR2 and CDR3 of the light chain variable domain set forth in SEQ ID NO:5.
10. The combination of claim 9, wherein the multifunctional antibody comprises an anti-CD 16A binding domain and said anti-CD 16A binding domain comprises a heavy chain variable domain set forth in SEQ ID NO:4 and a light chain variable domain set forth in SEQ ID NO:5
11. The combination of any one of claims 1 to 10, wherein the multifunctional antibody is a bispecific CD30/CD16A tandem diabody.
12. The combination of claim 11, wherein the bispecific CD30/CD16A tandem diabody has an amino acid sequence as set forth in SEQ ID NO:l .
13. The combination of any one of claimsl -12, comprising a further agent modulating an immune checkpoint molecule selected from the group of antibodies consisting of anti-CD 137 antibody and anti-CTLA-4 antibody.
14. The combination of claim 13, comprising the multifunctional antibody having specificity for CD30 and CD16A, anti-CD137 antibody and anti-PD-1 antibody.
The combination of any one of claims 1 -14, wherein the multifunctional antibody administered prior to the anti-PD-1 antibody.
PCT/EP2016/060113 2015-05-04 2016-05-04 Combination of a cd30xcd16 antibody with a pd-1 antagonist for therapy Ceased WO2016177846A1 (en)

Priority Applications (17)

Application Number Priority Date Filing Date Title
AU2016257334A AU2016257334B2 (en) 2015-05-04 2016-05-04 Combination of a CD30xCD16 antibody with a PD-1 antagonist for therapy
SI201630463T SI3292153T1 (en) 2015-05-04 2016-05-04 Combination of a cd30xcd16a antibody with an anti-pd-1 antagonistic antibody for therapy
CN201680026411.5A CN107847587B (en) 2015-05-04 2016-05-04 Combination of a CD30 × CD16 antibody and a PD-1 antagonist
DK16723968.0T DK3292153T3 (en) 2015-05-04 2016-05-04 COMBINATION OF A CD30XCD16A ANTIBODY WITH ANTI-PD-1 ANTAGONISTIC ANTIBODY FOR TREATMENT
HRP20191933TT HRP20191933T1 (en) 2015-05-04 2016-05-04 Combination of a cd30xcd16a antibody with an anti-pd-1 antagonistic antibody for therapy
RS20191372A RS59489B1 (en) 2015-05-04 2016-05-04 Combination of a cd30xcd16a antibody with an anti-pd-1 antagonistic antibody for therapy
RU2017137251A RU2761352C2 (en) 2015-05-04 2016-05-04 Cd30xcd16 antibody combination for therapy with pd-1 antagonist
BR112017023579A BR112017023579A2 (en) 2015-05-04 2016-05-04 combining a cd30xcd16 antibody with a pd-1 antagonist for therapy
PL16723968T PL3292153T3 (en) 2015-05-04 2016-05-04 Combination of a cd30xcd16a antibody with an anti-pd-1 antagonistic antibody for therapy
JP2017557405A JP6609784B2 (en) 2015-05-04 2016-05-04 Combination of CD30xCD16 antibody and PD-1 antagonist for treatment
EP16723968.0A EP3292153B1 (en) 2015-05-04 2016-05-04 Combination of a cd30xcd16a antibody with an anti-pd-1 antagonistic antibody for therapy
ES16723968T ES2754557T3 (en) 2015-05-04 2016-05-04 Combination of a CD30XCD16A antibody with an anti-PD-1 antagonist antibody for therapy
SM20190598T SMT201900598T1 (en) 2015-05-04 2016-05-04 Combination of a cd30xcd16a antibody with an anti-pd-1 antagonistic antibody for therapy
CA2983706A CA2983706C (en) 2015-05-04 2016-05-04 Combination of a cd30xcd16 antibody with a pd-1 antagonist for therapy
LT16723968T LT3292153T (en) 2015-05-04 2016-05-04 CD30XCD16A ANTIBODY COMBINATION WITH ANTAGONIST ANTIBODY BEFORE PD-1 FOR TREATMENT
US15/788,177 US11167029B2 (en) 2015-05-04 2017-10-19 Combination of a CD30XCD16 antibody with a PD-1 antagonist for therapy
CY20191101115T CY1122283T1 (en) 2015-05-04 2019-10-25 COMBINATION OF A CD30XCD16A ANTIBODY WITH AN ANTI-PD-1 COMPETITIVE ANTIBODY FOR THERAPY

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
EP15166303.6 2015-05-04
EP15166303.6A EP3091031A1 (en) 2015-05-04 2015-05-04 Combination of a bispecific antibody with an immune modulating molecule for the treatment of a tumor
EP16152650.4 2016-01-25
EP16152650 2016-01-25

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US15/788,177 Continuation-In-Part US11167029B2 (en) 2015-05-04 2017-10-19 Combination of a CD30XCD16 antibody with a PD-1 antagonist for therapy

Publications (1)

Publication Number Publication Date
WO2016177846A1 true WO2016177846A1 (en) 2016-11-10

Family

ID=56026814

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2016/060113 Ceased WO2016177846A1 (en) 2015-05-04 2016-05-04 Combination of a cd30xcd16 antibody with a pd-1 antagonist for therapy

Country Status (20)

Country Link
US (1) US11167029B2 (en)
EP (1) EP3292153B1 (en)
JP (1) JP6609784B2 (en)
CN (1) CN107847587B (en)
AU (1) AU2016257334B2 (en)
BR (1) BR112017023579A2 (en)
CA (2) CA3219372A1 (en)
CY (1) CY1122283T1 (en)
DK (1) DK3292153T3 (en)
ES (1) ES2754557T3 (en)
HR (1) HRP20191933T1 (en)
HU (1) HUE045866T2 (en)
LT (1) LT3292153T (en)
PL (1) PL3292153T3 (en)
PT (1) PT3292153T (en)
RS (1) RS59489B1 (en)
RU (1) RU2761352C2 (en)
SI (1) SI3292153T1 (en)
SM (1) SMT201900598T1 (en)
WO (1) WO2016177846A1 (en)

Cited By (15)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2018158350A1 (en) 2017-02-28 2018-09-07 Affimed Gmbh Combination of an anti-cd16a antibody with a cytokine
WO2018158349A1 (en) * 2017-02-28 2018-09-07 Affimed Gmbh Tandem diabody for cd16a-directed nk-cell engagement
CN109706164A (en) * 2017-10-26 2019-05-03 深圳新诺微环生物科技有限公司 The bridging molecules and its application of minicircle dna expression connection people and monkey CD20 and effector cell's antigen
CN109706163A (en) * 2017-10-26 2019-05-03 深圳新诺微环生物科技有限公司 Bridging molecules and its application of minicircle dna expression connection people and animal target cells and effector cell
WO2019175368A1 (en) * 2018-03-14 2019-09-19 Affimed Gmbh Bispecific egfr/cd16 antigen-binding protein
WO2019198051A3 (en) * 2018-04-13 2019-11-14 Affimed Gmbh Nk cell engaging antibody fusion constructs
US20210169936A1 (en) * 2018-08-27 2021-06-10 Affimed Gmbh Cryopreserved NK cells preloaded with an antibody construct
WO2021130383A1 (en) * 2019-12-27 2021-07-01 Affimed Gmbh Method for the production of bispecific fcyriii x cd30 antibody construct
RU2774711C2 (en) * 2018-04-13 2022-06-22 Аффимед Гмбх Fused antibody structures for involvement of nk-cells
WO2023274183A1 (en) 2021-06-29 2023-01-05 江苏先声药业有限公司 Cd16 antibody and use thereof
WO2023057571A1 (en) 2021-10-08 2023-04-13 Genmab A/S Antibodies binding to cd30 and cd3
EP3983007A4 (en) * 2019-06-11 2023-11-15 Myeloid Therapeutics, Inc. Macrophage specific engager compositions and methods of use thereof
WO2024056097A1 (en) * 2022-09-16 2024-03-21 四川大学华西医院 Use of nkg2d-based cell adapter molecule in removal of aging cells
WO2024114676A1 (en) 2022-11-29 2024-06-06 江苏恒瑞医药股份有限公司 Cldn18.2/4-1bb binding protein and medical use thereof
WO2024208898A1 (en) 2023-04-05 2024-10-10 Genmab A/S Pharmaceutical compositions comprising antibodies binding to cd30 and cd3

Families Citing this family (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN109402168A (en) * 2018-10-30 2019-03-01 深圳新诺微环生物科技有限公司 Bridging molecules and its application of minicircle dna expression connection HER2 positive cell and effector cell
JP2024503933A (en) * 2021-01-27 2024-01-29 イノベント バイオロジクス(スーチョウ)カンパニー,リミティド Single domain antibodies against CD16A and their uses
CN118613271A (en) * 2021-11-04 2024-09-06 埃迪瓦生物治疗公司 Treating cancer with NK cells and multispecific agonists
WO2023080895A1 (en) * 2021-11-04 2023-05-11 Artiva Biotherapeutics, Inc. Treatment of cancer with nk cells and multispecific engagers
CN117442721B (en) * 2023-12-20 2024-03-15 苏州艾凯利元生物科技有限公司 A composition comprising NK cells and NK cell adaptor molecules
CN118791616A (en) * 2024-09-14 2024-10-18 苏州为度生物技术有限公司天津分公司 An anti-human CD16 engineered antibody and its application

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2006125668A2 (en) 2005-05-26 2006-11-30 Affimed Therapeutics Ag Anti-cd16 binding molecules

Family Cites Families (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA2611861C (en) * 2005-06-08 2017-11-28 The Brigham And Women's Hospital, Inc. Methods and compositions for the treatment of persistent infections
US9682143B2 (en) * 2012-08-14 2017-06-20 Ibc Pharmaceuticals, Inc. Combination therapy for inducing immune response to disease
EP3183269A2 (en) * 2014-08-22 2017-06-28 Bristol-Myers Squibb Company Treatment of cancer using a combination of an anti-pd-1 antibody and an anti-cd137 antibody

Patent Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2006125668A2 (en) 2005-05-26 2006-11-30 Affimed Therapeutics Ag Anti-cd16 binding molecules

Non-Patent Citations (17)

* Cited by examiner, † Cited by third party
Title
ANONYMOUS: "FOR IMMEDIATE RELEASE Affimed ASCO Data Demonstrate Consistent Potency of NK- Cell-Engaging Combination Therapy with Checkpoint Modulators", 29 May 2015 (2015-05-29), XP055218463, Retrieved from the Internet <URL:http://www.affimed.com/pdf/20150529_affimed_asco_poster_afm13_final.pdf> [retrieved on 20151006] *
ANSELL S ET AL., N. ENGL J. MED., vol. 372, 2015, pages 311 - 319
ARNDT MA ET AL., BLOOD, vol. 94, 1999, pages 2562 - 8
DOLAN D; GUPTA S, CANCER CONTROL, vol. 21, 2014, pages 231 - 237
DOLAN, DAWN E: "PD-1 pathway inhibitors: changing the landscape of cancer immunotherapy", CANCER CONTROL, vol. 21, no. 3, July 2014 (2014-07-01), pages 231 - 237, XP055238943 *
KEIR ME ET AL., ANNU. REV. IMMUNOL., vol. 26, 2008, pages 677 - 704
KIPRIYANOV SM, METHODS MOL BIOL, vol. 207, 2003, pages 323 - 33
KIPRIYANOV SM, METHODS MOL. BIOL, vol. 562, 2009, pages 177 - 93
KONTERMANN, R.E.; BRINKMANN, U., DRUG DISCOV. TODAY, vol. 20, no. 7, July 2015 (2015-07-01), pages 838 - 47
MILLER J., HEMATOLOGY, 2013, pages 247 - 253
REUSCH U. ET AL., MABS, vol. 6, no. 3, 2014, pages 727 - 738
ROTHE A. ET AL., BLOOD, vol. 125, no. 26, 2015, pages 4024 - 4031
SCHLAPSCHY M. ET AL., PROTEIN ENG DES SEL, vol. 12, 2004, pages 847 - 60
SPIESS, C. ET AL., MOL IMMUNOL., vol. 67, October 2015 (2015-10-01), pages 95 - 106
UWE REUSCH ET AL: "A novel tetravalent bispecific TandAb (CD30/CD16A) efficiently recruits NK cells for the lysis of CD30 + tumor cells", MABS, vol. 6, no. 3, 26 March 2014 (2014-03-26), pages 727 - 738, XP055197046, ISSN: 1942-0870, DOI: 10.4161/mabs.28591 *
WEBER J, SEMIN ONCOL., vol. 37, 2010, pages 430 - 9
WEICHEL ET AL., EUROPEAN PHARMACEUTICAL REVIEW, vol. 20, 2015, pages 27 - 32

Cited By (32)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11535672B2 (en) 2017-02-28 2022-12-27 Affimed Gmbh Combination of an anti-CD16A antibody with a cytokine
WO2018158349A1 (en) * 2017-02-28 2018-09-07 Affimed Gmbh Tandem diabody for cd16a-directed nk-cell engagement
WO2018158350A1 (en) 2017-02-28 2018-09-07 Affimed Gmbh Combination of an anti-cd16a antibody with a cytokine
US11180558B2 (en) 2017-02-28 2021-11-23 Affimed Gmbh Tandem diabody for CD16A-directed NK-cell engagement
JP7115758B2 (en) 2017-02-28 2022-08-09 アッフィメッド・ゲー・エム・ベー・ハー Tandem diabodies for CD16A-directed NK cell engagement
US12264198B2 (en) 2017-02-28 2025-04-01 Affimed Gmbh Tandem diabody for CD16A-directed NK-cell engagement
CN110461357A (en) * 2017-02-28 2019-11-15 阿菲姆德股份有限公司 Combination of Anti-CD16A Antibody and Cytokines
JP2020510659A (en) * 2017-02-28 2020-04-09 アッフィメッド・ゲー・エム・ベー・ハーAffimed Gmbh Tandem Diabody for CD16A Directional NK Cell Engagement
CN109706163A (en) * 2017-10-26 2019-05-03 深圳新诺微环生物科技有限公司 Bridging molecules and its application of minicircle dna expression connection people and animal target cells and effector cell
CN109706164A (en) * 2017-10-26 2019-05-03 深圳新诺微环生物科技有限公司 The bridging molecules and its application of minicircle dna expression connection people and monkey CD20 and effector cell's antigen
JP7288913B2 (en) 2018-03-14 2023-06-08 アフィメッド ゲゼルシャフト ミット ベシュレンクテル ハフツンク Bispecific EGFR/CD16 antigen binding protein
US12076384B2 (en) 2018-03-14 2024-09-03 Affimed Gmbh Bispecific EGFR/CD16 antigen-binding protein
JP2021515798A (en) * 2018-03-14 2021-06-24 アフィメッド ゲゼルシャフト ミット ベシュレンクテル ハフツンク Bispecific EGFR / CD16 antigen-binding protein
US11510972B2 (en) 2018-03-14 2022-11-29 Affimed Gmbh Bispecific EGFR/CD16 antigen-binding protein
WO2019175368A1 (en) * 2018-03-14 2019-09-19 Affimed Gmbh Bispecific egfr/cd16 antigen-binding protein
RU2774711C2 (en) * 2018-04-13 2022-06-22 Аффимед Гмбх Fused antibody structures for involvement of nk-cells
CN112119097A (en) * 2018-04-13 2020-12-22 艾菲默德有限责任公司 Natural killer cell-conjugated antibody fusion constructs
JP2021521275A (en) * 2018-04-13 2021-08-26 アフィメド ゲーエムベーハー NK cell binding antibody fusion construct
CN112119097B (en) * 2018-04-13 2021-10-15 艾菲默德有限责任公司 Natural Killer Cell Conjugated Antibody Fusion Constructs
JP2025081307A (en) * 2018-04-13 2025-05-27 アフィメド ゲーエムベーハー Nk cell engaging antibody fusion construct
US11001633B2 (en) 2018-04-13 2021-05-11 Affimed Gmbh NK cell engaging antibody fusion constructs
WO2019198051A3 (en) * 2018-04-13 2019-11-14 Affimed Gmbh Nk cell engaging antibody fusion constructs
US20210169936A1 (en) * 2018-08-27 2021-06-10 Affimed Gmbh Cryopreserved NK cells preloaded with an antibody construct
EP3983007A4 (en) * 2019-06-11 2023-11-15 Myeloid Therapeutics, Inc. Macrophage specific engager compositions and methods of use thereof
WO2021130383A1 (en) * 2019-12-27 2021-07-01 Affimed Gmbh Method for the production of bispecific fcyriii x cd30 antibody construct
WO2023274183A1 (en) 2021-06-29 2023-01-05 江苏先声药业有限公司 Cd16 antibody and use thereof
US11814437B2 (en) 2021-10-08 2023-11-14 Genmab A/S Antibodies binding to CD30 and CD3
WO2023057571A1 (en) 2021-10-08 2023-04-13 Genmab A/S Antibodies binding to cd30 and cd3
WO2024056097A1 (en) * 2022-09-16 2024-03-21 四川大学华西医院 Use of nkg2d-based cell adapter molecule in removal of aging cells
WO2024114676A1 (en) 2022-11-29 2024-06-06 江苏恒瑞医药股份有限公司 Cldn18.2/4-1bb binding protein and medical use thereof
EP4628507A1 (en) 2022-11-29 2025-10-08 Jiangsu Hengrui Pharmaceuticals Co., Ltd. Cldn18.2/4-1bb binding protein and medical use thereof
WO2024208898A1 (en) 2023-04-05 2024-10-10 Genmab A/S Pharmaceutical compositions comprising antibodies binding to cd30 and cd3

Also Published As

Publication number Publication date
JP2018514576A (en) 2018-06-07
PT3292153T (en) 2019-11-05
CN107847587A (en) 2018-03-27
RU2761352C2 (en) 2021-12-07
RS59489B1 (en) 2019-12-31
CN107847587B (en) 2020-10-09
LT3292153T (en) 2019-11-11
US11167029B2 (en) 2021-11-09
JP6609784B2 (en) 2019-11-27
AU2016257334B2 (en) 2021-08-12
BR112017023579A2 (en) 2018-07-24
CY1122283T1 (en) 2020-11-25
ES2754557T3 (en) 2020-04-20
PL3292153T3 (en) 2020-02-28
HUE045866T2 (en) 2020-01-28
CA2983706A1 (en) 2016-11-10
CA3219372A1 (en) 2016-11-10
AU2016257334A1 (en) 2017-11-09
SI3292153T1 (en) 2020-01-31
EP3292153A1 (en) 2018-03-14
US20180085456A1 (en) 2018-03-29
RU2017137251A3 (en) 2019-10-10
HK1253022A1 (en) 2019-06-06
HRP20191933T1 (en) 2020-01-10
DK3292153T3 (en) 2019-10-21
EP3292153B1 (en) 2019-07-31
RU2017137251A (en) 2019-06-04
SMT201900598T1 (en) 2020-01-14
CA2983706C (en) 2024-01-02

Similar Documents

Publication Publication Date Title
CA2983706C (en) Combination of a cd30xcd16 antibody with a pd-1 antagonist for therapy
US11034766B2 (en) Anti-B7-H6 antibody, fusion proteins, and methods of using the same
US20250163152A1 (en) Compositions comprising a combination of an anti-lag-3 antibody, a pd-1 pathway inhibitor, and an immunotherapeutic agent
AU2014351308B2 (en) Compositions comprising anti-CEACAM1 and anti-PD antibodies for cancer therapy
KR20220005627A (en) Methods and antibodies for modulation of immunoresponse
CN110312525A (en) Combinations of T cell redirecting multifunctional antibodies and immune checkpoint modulators and their uses
WO2015198312A1 (en) Compositions comprising antibodies to ceacam-1 and lag-3 for cancer therapy
JP2021520201A (en) Anti-CD27 antibody and its use
JP2022176250A (en) Combination treatment with netrin-1 inhibitors and immune checkpoint inhibitors
US20220213203A1 (en) Dosing Regimens of Bispecific CD123 x CD3 Diabodies in the Treatment of Hematologic Malignancies
EP3091031A1 (en) Combination of a bispecific antibody with an immune modulating molecule for the treatment of a tumor
TWI790193B (en) Methods and antibodies for modulation of immunoresponse
HK1253022B (en) Combination of a cd30xcd16 antibody with a pd-1 antagonist
TW202207977A (en) Compositions comprising a t cell redirection therapeutic and a vla-4 adhesion pathway inhibitor

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 16723968

Country of ref document: EP

Kind code of ref document: A1

DPE1 Request for preliminary examination filed after expiration of 19th month from priority date (pct application filed from 20040101)
ENP Entry into the national phase

Ref document number: 2983706

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2017557405

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2016257334

Country of ref document: AU

Date of ref document: 20160504

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2016723968

Country of ref document: EP

Ref document number: 2017137251

Country of ref document: RU

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112017023579

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 112017023579

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20171031