WO2016164392A1 - A h3t3a mutant protein efficiently reduces h3t3p and causes increased cell death of rapidly dividing cells - Google Patents
A h3t3a mutant protein efficiently reduces h3t3p and causes increased cell death of rapidly dividing cells Download PDFInfo
- Publication number
- WO2016164392A1 WO2016164392A1 PCT/US2016/026114 US2016026114W WO2016164392A1 WO 2016164392 A1 WO2016164392 A1 WO 2016164392A1 US 2016026114 W US2016026114 W US 2016026114W WO 2016164392 A1 WO2016164392 A1 WO 2016164392A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- h3t3a
- h3t3p
- nos
- cell
- gfp
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/1703—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- A61K38/1709—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/39558—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/3053—Skin, nerves, brain
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/575—Immunoassay; Biospecific binding assay; Materials therefor for cancer
- G01N33/5751—Immunoassay; Biospecific binding assay; Materials therefor for cancer of the skin, e.g. melanoma
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/435—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
- G01N2333/46—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans from vertebrates
- G01N2333/47—Assays involving proteins of known structure or function as defined in the subgroups
- G01N2333/4701—Details
- G01N2333/4722—Proteoglycans, e.g. aggreccan
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/50—Determining the risk of developing a disease
Definitions
- This invention relates generally to the field of cell cycle arrest.
- Cancer is one of the most prevalent diseases, accounting for 25% of all deaths in the United States. As such, prior to the invention described herein, there was a pressing need to develop new strategies to inhibit rapidly dividing cancer cells.
- the invention is based, at least in part, on the surprising discovery that histone H3 threonine 3 phosphorylation regulates asymmetric H3 inheritance and male germline activity in Drosophila and that an H3T3A mutant protein efficiently reduces H3T3P and causes increased cell death of rapidly-dividing cells.
- the methods described herein introduce a point mutation of the Thr3 residue of the transgenic histone H3 protein to reduce the post- translational modification of H3 (i.e., to reduce the H3T3 phosphorylation in rapidly dividing cells) to cause cell cycle arrest followed by cell death.
- a transgene that carries a mutation that converts threonine 3 (Thr3 or T3) to the unphosphorylatable alanine (Ala or A) greatly reduces the phosphorylation at T3 of histone 3 (H3T3P) mark. Furthermore, converting T3 to the unphosphorylatable residue alanine (H3T3A) or to the phosphomimetic aspartate (H3T3D) disrupts assymetric H3 inheritance.
- the H3T3P mark is important for mitosis, and the reduction of which leads to increased cell death in rapidly-divising cells including cancer cells.
- compositions and methods described herein antagonize growth in rapidly dividing cells.
- the compositions described herein are anti-cancer agents, e.g., H3T3A and/or H3T3D, that are utilized in methods to reduce tumor cell growth.
- Described herein are methods of inducing cell death in a rapidly dividing cell comprising contacting a rapidly dividing cell with an agent that reduces phosphorylation at threonine 3 of histone 3 (H3T3P), thereby inducing cell cycle arrest followed by cell death.
- the rapidly dividing cell is a tumor cell, e.g., a cancer cell.
- the rapidly dividing cell is not a germline stem cell.
- methods of inhibiting tumor growth are carried out by contacting a tumor cell with an agent that reduces phosphorylation at threonine 3 of histone 3 (H3T3P), thereby inhibiting tumor growth.
- the agent that reduces phosphorylation of H3T3P comprises an H3T3A mutant protein, e.g., a mutant transgenic protein.
- the H3T3A mutant protein comprises a point mutation of threonine 3 of H3 such as a substitution of threonine 3 with alanine (H3T3A).
- the agent that reduces phosphorylation of H3T3P comprises an H3T3D mutant protein, e.g., a mutant transgenic protein.
- the H3T3D mutant protein comprises a point mutation of threonine 3 of H3 such as a substitution of threonine 3 with aspartic acid (H3T3D).
- the method further comprises administering a chemotherapeutic agent such as radiotherapy or a cell death-inducing agent.
- isolated transgenes encoding H3T3A and isolated peptides comprising H3T3A. Additionally, described herein are isolated transgenes encoding H3T3D and isolated peptides comprising H3T3D.
- the nucleic acid sequence of wild type Drosophila melanogaster histone H3 is set forth below (SEQ ID NO: 1).
- the nucleic acid sequence of Drosophila melanogaster H3T3A mutant is set forth below (SEQ ID NO: 2).
- the nucleic acid sequence of Drosophila melanogaster H3T3D mutant is set forth below (SEQ ID NO: 13).
- the nucleic acid sequence of wild type human histone H3 is set forth below (SEQ ID NO:
- the nucleic acid sequence of human H3T3A mutant is set forth below (SEQ ID NO:
- the nucleic acid sequence of human H3T3D mutant is set forth below (SEQ ID NO:
- TATCCGCGGGGAGCGGGCCTAG The nucleic acid sequence of wild type Mus Musculus H3 is set forth below (SEQ ID NO: 5).
- the nucleic acid sequence of Mus Musculus H3T3D mutant is set forth below (SEQ ID NO: 15).
- amino acid sequence of wild type Drosophila melanogaster histone H3 is set forth below (SEQ ID NO: 7).
- the amino acid sequence of Drosophila melanogaster H3T3A mutant is set forth below (SEQ ID NO: 8).
- the amino acid sequence of Drosophila melanogaster H3T3D mutant is set forth below (SEQ ID NO: 16).
- amino acid sequence of wild type human histone H3 is set forth below (SEQ ID NO:
- amino acid sequence of human H3T3A mutant is set forth below (SEQ ID NO:
- amino acid sequence of human H3T3D mutant is set forth below (SEQ ID NO:
- the amino acid sequence of wild type Mus Musculus histone H3 is set forth below (SEQ ID NO: 11).
- the amino acid sequence of Mus Musculus H3T3A mutant is set forth below (SEQ ID NO: 12).
- kits for arresting cell cycle comprising an agent that reduces phosphorylation H3T3P.
- Suitable agents that reduce phosphorylation H3T3P comprises an H3T3A mutant protein comprising a substitution of threonine 3 with alanine (H3T3A).
- suitable agents that reduce phosphorylation H3T3P comprise an H3T3D mutant protein comprising a substitution of threonine 3 with aspartic acid (H3T3D).
- the methods described herein are useful as anti-cancer agents to inhibit tumor growth in a subject.
- the subject is preferably a mammal in need of such treatment, e.g., a subject that has been diagnosed with cancer or a predisposition thereto.
- the mammal is any mammal, e.g., a human, a primate, a mouse, a rat, a dog, a cat, a horse, as well as livestock or animals grown for food consumption, e.g., cattle, sheep, pigs, chickens, and goats.
- the mammal is a human.
- the methods described herein are useful in treating, delaying the progression of, preventing relapse of or alleviating a symptom of a cancer or other neoplastic or preneoplastic condition.
- the methods described herein are useful in treating hematological malignancies and/or tumors.
- non-Hodgkin's lymphoma NHL
- ALL acute lymphocytic leukemia
- AML acute myeloid leukemia
- CLL chronic lymphocytic leukemia
- CML chronic myelogenous leukemia
- MM multiple myeloma
- breast cancer ovarian cancer, head and neck cancer, bladder cancer, melanoma, colorectal cancer, pancreatic cancer, lung cancer, leiomyoma, leiomyosarcoma, glioma, glioblastoma, and so on.
- Solid tumors include, e.g.
- breast tumors breast tumors, ovarian tumors, lung tumors, pancreatic tumors, prostate tumors, melanoma tumors, colorectal tumors, lung tumors, head and neck tumors, bladder tumors, esophageal tumors, liver tumors, and kidney tumors.
- the methods described herein are used in conjunction with one or more agents or a combination of additional agents, e.g., an anti-cancer agent.
- Suitable agents include current pharmaceutical and/or surgical therapies for an intended application, such as, for example, cancer.
- the methods described herein can be used in conjunction with one or more chemotherapeutic or anti-neoplastic agents.
- the additional chemotherapeutic agent is radiotherapy.
- the chemotherapeutic agent is a cell death-inducing agent.
- anti-plastic agent is used herein to refer to agents that have the functional property of inhibiting a development or progression of a neoplasm in a human, particularly a malignant (cancerous) lesion, such as a carcinoma, sarcoma, lymphoma, or leukemia. Inhibition of metastasis is frequently a property of antineoplastic agents.
- compositions of the invention are administered orally or systemically.
- Other modes of administration include rectal, topical, intraocular, buccal, intravaginal, intracisternal, intracerebroventricular, intratracheal, nasal, transdermal, within/on implants, or parenteral routes.
- parenteral includes subcutaneous, intrathecal, intravenous, intramuscular, intraperitoneal, or infusion. Intravenous or intramuscular routes are not particularly suitable for long-term therapy and prophylaxis. They could, however, be preferred in emergency situations.
- Compositions comprising a composition of the invention can be added to a physiological fluid, such as blood.
- Oral administration can be preferred for prophylactic treatment because of the convenience to the patient as well as the dosing schedule.
- Parenteral modalities subcutaneous or intravenous
- Inhaled therapy may be most appropriate for pulmonary vascular diseases (e.g., pulmonary hypertension).
- compositions may be assembled into kits or pharmaceutical systems for use in arresting cell cycle in rapidly dividing cells, e.g., cancer cells. Kits or
- kits or pharmaceutical systems comprise a carrier means, such as a box, carton, tube, having in close confinement therein one or more container means, such as vials, tubes, ampoules, bottles, syringes, or bags.
- container means such as vials, tubes, ampoules, bottles, syringes, or bags.
- the kits or pharmaceutical systems of the invention may also comprise associated instructions for using the kit.
- analog is meant a molecule that is not identical, but has analogous functional or structural features.
- a polypeptide analog retains the biological activity of a corresponding naturally-occurring polypeptide, while having certain biochemical
- An analog may include an unnatural amino acid.
- binding to a molecule is meant having a physicochemical affinity for that molecule.
- Detect refers to identifying the presence, absence or amount of the analyte to be detected.
- disease is meant any condition or disorder that damages or interferes with the normal function of a cell, tissue, or organ.
- diseases include those associated with endothelial dysfunction.
- an effective amount is meant an amount of a compound, alone or in a combination, required to ameliorate the symptoms of a disease relative to an untreated patient.
- the effective amount of active compound(s) used to practice the present invention for therapeutic treatment of a disease varies depending upon the manner of administration, the age, body weight, and general health of the subject. Ultimately, the attending physician or veterinarian will decide the appropriate amount and dosage regimen. Such amount is referred to as an "effective" amount.
- fragment is meant a portion of a polypeptide or nucleic acid molecule. This portion contains, preferably, at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90% of the entire length of the reference nucleic acid molecule or polypeptide.
- a fragment may contain 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100, 200, 300, 400, 500, 600, 700, 800, 900, or 1000 nucleotides or amino acids.
- the invention also comprises polypeptides and nucleic acid fragments, so long as they exhibit the desired biological activity of the full length polypeptides and nucleic acid, respectively. A nucleic acid fragment of almost any length is employed.
- illustrative polynucleotide segments with total lengths of about 10,000, about 5000, about 3000, about 2,000, about 1,000, about 500, about 200, about 100, about 50 base pairs in length (including all intermediate lengths) are included in many implementations of this invention.
- a polypeptide fragment of almost any length is employed.
- illustrative polypeptide segments with total lengths of about 10,000, about 5,000, about 3,000, about 2,000, about 1,000, about 5,000, about 1,000, about 500, about 200, about 100, or about 50 amino acids in length (including all intermediate lengths) are included in many implementations of this invention.
- isolated refers to material that is free to varying degrees from components which normally accompany it as found in its native state.
- Isolate denotes a degree of separation from original source or surroundings.
- Purify denotes a degree of separation that is higher than isolation.
- a “purified” or “biologically pure” protein is sufficiently free of other materials such that any impurities do not materially affect the biological properties of the protein or cause other adverse consequences. That is, a nucleic acid or peptide of this invention is purified if it is substantially free of cellular material, viral material, or culture medium when produced by recombinant DNA techniques, or chemical precursors or other chemicals when chemically synthesized. Purity and homogeneity are typically determined using analytical chemistry techniques, for example, polyacrylamide gel electrophoresis or high performance liquid chromatography. The term “purified” can denote that a nucleic acid or protein gives rise to essentially one band in an electrophoretic gel. For a protein that can be subjected to modifications, for example, phosphorylation or glycosylation, different modifications may give rise to different isolated proteins, which can be separately purified.
- substantially pure is meant a nucleotide or polypeptide that has been separated from the components that naturally accompany it.
- the nucleotides and polypeptides are substantially pure when they are at least 60%, 70%, 80%, 90%, 95%, or even 99%, by weight, free from the proteins and naturally-occurring organic molecules with they are naturally associated.
- isolated nucleic acid is meant a nucleic acid that is free of the genes which flank it in the naturally-occurring genome of the organism from which the nucleic acid is derived.
- the term covers, for example: (a) a DNA which is part of a naturally occurring genomic DNA molecule, but is not flanked by both of the nucleic acid sequences that flank that part of the molecule in the genome of the organism in which it naturally occurs; (b) a nucleic acid incorporated into a vector or into the genomic DNA of a prokaryote or eukaryote in a manner, such that the resulting molecule is not identical to any naturally occurring vector or genomic DNA; (c) a separate molecule such as a synthetic cDNA, a genomic fragment, a fragment produced by polymerase chain reaction (PCR), or a restriction fragment; and (d) a recombinant nucleotide sequence that is part of a hybrid gene, i.e., a gene encoding a fusion
- Isolated nucleic acid molecules according to the present invention further include molecules produced synthetically, as well as any nucleic acids that have been altered chemically and/or that have modified backbones.
- the isolated nucleic acid is a purified cDNA or RNA polynucleotide.
- Isolated nucleic acid molecules also include messenger ribonucleic acid (mRNA) molecules.
- an “isolated polypeptide” is meant a polypeptide of the invention that has been separated from components that naturally accompany it.
- the polypeptide is isolated when it is at least 60%, by weight, free from the proteins and naturally-occurring organic molecules with which it is naturally associated.
- the preparation is at least 75%, more preferably at least 90%, and most preferably at least 99%, by weight, a polypeptide of the invention.
- An isolated polypeptide of the invention may be obtained, for example, by extraction from a natural source, by expression of a recombinant nucleic acid encoding such a polypeptide; or by chemically synthesizing the protein. Purity can be measured by any appropriate method, for example, column chromatography, polyacrylamide gel electrophoresis, or by HPLC analysis.
- reduces is meant a negative alteration of at least 5%, 10%, 25%, 50%, 75%, or
- telomere binding By “specifically binds” is meant a compound or antibody that recognizes and binds a polypeptide of the invention, but which does not substantially recognize and bind other molecules in a sample, for example, a biological sample, which naturally includes a polypeptide of the invention.
- Nucleic acid molecules useful in the methods of the invention include any nucleic acid molecule that encodes a polypeptide of the invention or a fragment thereof. Such nucleic acid molecules need not be 100% identical with an endogenous nucleic acid sequence, but will typically exhibit substantial identity. Polynucleotides having "substantial identity" to an endogenous sequence are typically capable of hybridizing with at least one strand of a double- stranded nucleic acid molecule. Nucleic acid molecules useful in the methods of the invention include any nucleic acid molecule that encodes a polypeptide of the invention or a fragment thereof. Such nucleic acid molecules need not be 100% identical with an endogenous nucleic acid sequence, but will typically exhibit substantial identity.
- Polynucleotides having "substantial identity" to an endogenous sequence are typically capable of hybridizing with at least one strand of a double-stranded nucleic acid molecule.
- hybridize is meant pair to form a double-stranded molecule between complementary polynucleotide sequences (e.g., a gene described herein), or portions thereof, under various conditions of stringency.
- complementary polynucleotide sequences e.g., a gene described herein
- stringent salt concentration will ordinarily be less than about 750 mM NaCl and 75 mM trisodium citrate, preferably less than about 500 mM NaCl and 50 mM trisodium citrate, and more preferably less than about 250 mM NaCl and 25 mM trisodium citrate.
- Low stringency hybridization can be obtained in the absence of organic solvent, e.g., formamide, while high stringency hybridization can be obtained in the presence of at least about 35% formamide, and more preferably at least about 50% formamide.
- Stringent temperature conditions will ordinarily include temperatures of at least about 30° C, more preferably of at least about 37° C, and most preferably of at least about 42° C.
- Varying additional parameters, such as hybridization time, the concentration of detergent, e.g., sodium dodecyl sulfate (SDS), and the inclusion or exclusion of carrier DNA, are well known to those skilled in the art.
- concentration of detergent e.g., sodium dodecyl sulfate (SDS)
- SDS sodium dodecyl sulfate
- Various levels of stringency are accomplished by combining these various conditions as needed.
- hybridization will occur at 30° C in 750 mM NaCl, 75 mM trisodium citrate, and 1% SDS.
- hybridization will occur at 37° C in 500 mM NaCl, 50 mM trisodium citrate, 1% SDS, 35% formamide, and 100 .mu.g/ml denatured salmon sperm DNA (ssDNA).
- hybridization will occur at 42° C in 250 mM NaCl, 25 mM trisodium citrate, 1% SDS, 50% formamide, and 200 ⁇ g/ml ssDNA. Useful variations on these conditions will be readily apparent to those skilled in the art.
- wash stringency conditions can be defined by salt concentration and by temperature. As above, wash stringency can be increased by decreasing salt concentration or by increasing temperature.
- stringent salt concentration for the wash steps will preferably be less than about 30 mM NaCl and 3 mM trisodium citrate, and most preferably less than about 15 mM NaCl and 1.5 mM trisodium citrate.
- Stringent temperature conditions for the wash steps will ordinarily include a temperature of at least about 25° C, more preferably of at least about 42° C, and even more preferably of at least about 68° C.
- wash steps will occur at 25° C in 30 mM NaCl, 3 mM trisodium citrate, and 0.1% SDS. In a more preferred embodiment, wash steps will occur at 42 C in 15 mM NaCl, 1.5 mM trisodium citrate, and 0.1% SDS. In a more preferred embodiment, wash steps will occur at 68° C in 15 mM NaCl, 1.5 mM trisodium citrate, and 0.1% SDS.
- Hybridization techniques are well known to those skilled in the art and are described, for example, in Benton and Davis (Science 196:180, 1977); Grunstein and Hogness (Proc. Natl. Acad. Sci., USA 72:3961, 1975); Ausubel et al. (Current Protocols in Molecular Biology, Wiley Interscience, New York, 2001); Berger and Kimmel (Guide to Molecular Cloning Techniques, 1987, Academic Press, New York); and Sambrook et al., Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, New York.
- substantially identical is meant a polypeptide or nucleic acid molecule exhibiting at least 50% identity to a reference amino acid sequence (for example, any one of the amino acid sequences described herein) or nucleic acid sequence (for example, any one of the nucleic acid sequences described herein).
- a reference amino acid sequence for example, any one of the amino acid sequences described herein
- nucleic acid sequence for example, any one of the nucleic acid sequences described herein.
- such a sequence is at least 60%, more preferably 80% or 85%, and more preferably 90%, 95% or even 99% identical at the amino acid level or nucleic acid to the sequence used for comparison.
- Sequence identity is typically measured using sequence analysis software (for example, Sequence Analysis Software Package of the Genetics Computer Group, University of Wisconsin Biotechnology Center, 1710 University Avenue, Madison, Wis. 53705, BLAST, BESTFIT, GAP, or PILEUP/PRETTYBOX programs). Such software matches identical or similar sequences by assigning degrees of homology to various substitutions, deletions, and/or other modifications. Conservative substitutions typically include substitutions within the following groups: glycine, alanine; valine, isoleucine, leucine;
- BLAST program may be used, with a probability score between e "3 and e "100 indicating a closely related sequence.
- Ranges provided herein are understood to be shorthand for all of the values within the range.
- a range of 1 to 50 is understood to include any number, combination of numbers, or sub-range from the group consisting 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50.
- treating and “treatment” as used herein refer to the administration of an agent or formulation to a clinically symptomatic individual afflicted with an adverse condition, disorder, or disease, so as to effect a reduction in severity and/or frequency of symptoms, eliminate the symptoms and/or their underlying cause, and/or facilitate improvement or remediation of damage. It will be appreciated that, although not precluded, treating a disorder or condition does not require that the disorder, condition or symptoms associated therewith be completely eliminated.
- preventing and prevention refer to the administration of an agent or composition to a clinically asymptomatic individual who is susceptible or predisposed to a particular adverse condition, disorder, or disease, and thus relates to the prevention of the occurrence of symptoms and/or their underlying cause.
- the term "about” is understood as within a range of normal tolerance in the art, for example within 2 standard deviations of the mean. About can be understood as within 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, 0.5%, 0.1%, 0.05%, or 0.01% of the stated value. Unless otherwise clear from context, all numerical values provided herein are modified by the term about.
- compositions or methods provided herein can be combined with one or more of any of the other compositions and methods provided herein.
- Figure 1A- Figure 1R is a series of photomicrographs showing that phosphorylation at threonine 3 of histone 3 (H3T3P) distinguishes preexisting H3-green fluorescent protein (GFP) (green) from newly synthesized H3- mKusabira Orange (mKO; red) in Drosophila male germline stem cells (GSCs). Also shown are a GSC ( Figure 1A- Figure 1C) and a gonialblast (GB) ( Figure ID- Figure IF) at prophase. Also shown are immunostaining H3T3P signals in a GSC ( Figure lG- Figure 1L) and a GB ( Figure 1M- Figure 1R) at prometaphase. Asterisk: hub. Scale bars: 5 ⁇ .
- Figure 2A- Figure 2H is a series of photomicrographs showing that expression of an H3T3A transgene greatly reduces H3T3P in mitotic germ cells. Specifically, these panels show immunostaining using anti-H3T3P and anti-H3S10P: outlined are mitotic germ cells expressing either nos>H3T3A-GFP ( Figure 2A- Figure 2D) or nos>H3-GFP ( Figure 2E- Figure 2H). Scale bars: 10 ⁇ .
- Figure 3A- Figure 3J is a series of photomicrographs showing that expression of H3T3A randomizes H3 inheritance pattern. Specifially, the panels show immunostaining signals using anti-FasIII and anti-a-Spectrin at the tip of nos>H3 ( Figure 3A- Figure 3C) or nos>H3T3A ( Figure 3D- Figure 31) testes. Scale bars: 5 ⁇ .
- Figure 4A- Figure 4L is a series of photomicrographs showing expression of H3T3 A and H3T3D causes similar defects. Shown are immunostaining signals using anti-FasIII and anti- ⁇ -Spectrin at the tip of nos>H3 ( Figure 4A- Figure 4D), nos>H3T3A ( Figure 4E- Figure 4H), or nos>H3T3D ( Figure 4I- Figure 4L) testes. Scale bars: 20 ⁇ .
- Figure 5A- Figure 5B is a cartoon showing Drosophila testis tip and a model for asymmetric H3 inheritance during GSC asymmetric division. Specifically, Figure 5A is a cartoon showing the asymmetric H3 inheritance during male GSC asymmetric cell division.
- Figure 5B is a schematic diagram of a two-step model to explain how asymmetric epigenome is established during S phase (Step one) and recognized followed by asymmetric segregation in M phase (Step two) GSC, adapted from (Tran et al., 2013 Chromosome Res 21, 255).
- Figure 6A- Figure 6N is a series of photomicrographs showing that H3-GFP and H3- mKO signals are separable in prophase GSC, but not in the GB control. Shown is immunostaining using anti-H3T3P: a prophase GSC ( Figure 6A- Figure 6G) and a prophase GB ( Figure 6H- Figure 6N): both were undergoing mitosis 18 hours after heat shock- induced genetic switch from H3-GFP-encoding to H3-mKO-encoding sequences. Asterisk: hub. Scale bars: 5 ⁇ .
- Figure 7A- Figure 7X is a series of photomicrographs showing spatial and temporal specificity of the ⁇ 3 ⁇ 3 ⁇ signal.
- Figure 7A- Figure 7L show co-immunostaining using antibodies against ⁇ 3 ⁇ 3 ⁇ and a centromere- specific marker CID in germ cells from y,w control ( Figure 7A- Figure 7D) and nos>H3-GFP (E-L) males.
- Figure 7M- Figure 7X show co-immunostaining using antibodies against ⁇ 3 ⁇ 3 ⁇ and H3S10P in a prophase GB (Figure 7M- Figure 7P), a metaphase GSC (Figure 7Q- Figure 7T), and an anaphase GSC (Figure 7U- Figure 7X) from nos>H3-GFP males.
- Figure 8A- Figure 8E is a series of photomicrographs and immunoblots showing abundant endogenous histone proteins in nos>upd; H3T3A-GFP testes.
- Figure 8A- Figure 8D show immunostaining using anti-Vasa in a nos>upd; H3T3A-GFP testis (outlined).
- FIG. 8E is a series of immunoblots using antibodies against GFP, H3, and H4, respectively, as well as Ponceau S staining to show load of total crude extract in each lane of SDS gel. All blots are duplicates using the same samples with the same amount, nos>upd testes were used as a negative control for the H3-GFP and H3T3A-GFP transgenes.
- Figure 9A- Figure 9B is a series of schematics showing the predicted pattern when sister chromatids enriched with either preexisting H3-GFP (old, green) or H3-mKO (new, red) are segregated randomly during GSC division.
- Figure 9A is a schematic diagram showing the dual color-switch design that expresses preexisting H3T3A (or D)-GFP and newly synthesized H3T3A (or D)-mKO by heat shock treatment, as adapted from (Tran et al., 2012, Science 338: 679).
- Figure 9B is a schematic showing Drosophila male has two sex chromosomes: X and Y chromosomes; as well as three autosomes: the second (II), the third (III), and the fourth chromosomes. But because the fourth chromosomes are very small, the prediction is focused on X, Y, II and III chromosomes. With each sex chromosome having two and each autosome having four potential segregation patterns, the total would be 64 different combinations.
- Figure 10A- Figure 10P is a series of photomicrographs showing the effects of temperature shift on the dominant negative activity of the H3T3A transgene.
- Figure 10A- Figure 10H show immunostaining using anti-H3T3P and anti-H3S10P in testes from hs-FLP; nos-GaU; UAS-FRT-H3-GFP-PolyA-FRT-H3-mKO males. Flies were raised at 18°C without heat shock (Figure 10A- Figure 10D) and heat shocked at 37°C for two hours followed by 48 hour recovery at 29°C (Figure 10E- Figure 10H).
- H3-GFP was expressed at a low, but detectable level (Figure 10A) because nos- Gal4 has relatively low activity at 18°C (Tran et al., 2012, Science 338: 679; Eliazer et al., 2011 Proc Natl Acad Sci USA, 108, 7064), while no H3-mKO signal was detectable (Figure 10B).
- H3-GFP was negligible (Figure 10E), but H3-mKO was robustly turned on (Figure 10F). No effect on either H3T3P ( Figure IOC, Figure 10G) or H3S10P (Figure 10D, Figure 10H) signals could be detected.
- Figure 101- Figure 10P show immunostaining using anti-H3T3P and anti-H3S10P in testes from hs-FLP; nos-Gal4; UAS- FRT-H3T3A-GFP-PolyA-FRT-H3T3A-mKO males. Flies were raised at 18°C without heat shock (Figure 101- Figure 10L, inset in Figure 101 and Figure 10J are shown with higher magnification in Figure 10K and Figure 10L) and heat shocked at 37°C for two hours followed by 48-hour recovery at 29°C (Figure 10M- Figure 10P, inset in Figure 10M and Figure ION are shown with higher magnification in Figure 10O and Figure 10P).
- H3T3A-GFP was expressed at a low, but detectable level (Figure 101), while no H3T3A-mKO signal was detectable (Figure 10J).
- H3T3A- GFP was negligible (Figure 10M), but H3T3A-mKO was robustly turned on (Figure ION).
- the H3T3P signal was reduced in males that are heat shocked and recovered (Figure 10O) compared to those raised at 18°C constantly (Figure 10K), most likely due to higher H3T3A expression by the nos-Gal4 driver at 29°C (Eun et al., 2014 Science, 343, 1513).
- the temperature change had little effect on the H3S10P (Figure 10L, Figure 10P) signals.
- Scale bars 10 ⁇ .
- Figure 11A- Figure 110 is a series of photomicrographs showing that expression of the H3T3A transgene leads to gradual progression of germline tumor and decreased male fertility.
- Figure 11A- Figure 110 shows immunostaining using anti-FasIII, ⁇ -Spectrin and Vasa antibodies in testes from 15-day old nos>H3-GFP males (Figure l lA- Figure HE), 1- day (Figure 11F- Figure 11J) and 15-day (Figure 11K- Figure 110) nos>H3T3A-GFP males.
- Figure IIP shows the results of a fertility test using nos>H3-GFP (red dots) and nos>H3T3A-GFP (blue dots) males. Flies were raised at 18 °C until eclosion and crossed with y,w virgin females. All crosses were shifted to 29 °C and progenies were counted after the indicated time, for both
- Figure 12A- Figure 12H is a series of photomicrographs showing the heterogeneous germline tumor in nos> H3T3A-GFP testes.
- Figure 12A- Figure 12H show immunostaining using anti-FasIII and ⁇ -Spectrin antibodies in testes from nos>H3T3A-GFP males.
- a testicular tumor developed (insets in Figure 12 A and Figure 12B are shown at higher magnification in Figure 12C and Figure 12D) with over-proliferated very early stage germ cells with GFP expression (Figure 12C) and spectrosome structure (Figure 12D, arrowhead).
- testicular tumor developed (insets in Figure 12E and Figure 12F are shown at higher magnification in Figure 12G and Figure 12H) with over-proliferated spermatogonial cells without GFP expression (Figure 12G) and fusome structure (Figure 12H, arrow).
- Asterisk hub. Scale bars: 20 ⁇ .
- Figure 13A- Figure 13E is a series of matrices, a dot plot and a venn diagram.
- Figure 13A is a Spearman correlation coefficient matrix between pairs of transcription level profiles of wild-type, nos>upd, nos>H3T3A and bam mutant testes plotted in a heatmap. The color bar indicates the high (red) to low (blue) correlation. The distance is defined as 1- Spearman correlation coefficient (see Materials and Methods).
- Figure 13B is a dimension reduction representation of the pairwise distance matrix of wild-type (blue dot), nos>upd (green dots), nos>H3T3A (red dots) and bam mutant (yellow dot) testis samples.
- Figure 13C is a Venn diagram of actively expressed genes in four genotypes. Individual samples were combined for each genotype.
- Figure 13D is a heatmap of the representative wild-type-specific genes.
- Figure 14A- Figure 14V is a series of photomicrographs, a dolt plot, and a bar chart showing that the expression of H3T3 A or H3T3D using the nos-Gal4 driver leads to similar phenotypes in testis. Shown is immunostaining using antibodies against FasIII, ⁇ -Spectrin, Zfh-1, and Vasa in testes from nos>H3-GFP (Figure 14A- Figure 14D), nos>H3T3A-GFP (Figure 14E- Figure 14H, Figure 14N- Figure 14Q), and nos>H3T3D-GFP ( Figure 141- Figure 14L, Figure 14R- Figure 14U) males.
- Figure 15A- Figure 15Q is a schematic and a series of photomicrographs showing that the expression of H3T3A or H3T3D using the bam-Gal4 driver did not lead to phenotypes like those driven by the nos-Gal4 driver.
- Figure 15A is a cartoon showing stage-specificity of nos-Gal4 and bam-Gal4 drivers: nos-Gal4 is turned on in early-stage germline, including GSCs, while bam-Gal4 expresses from 4-cell spermatogonial cells.
- Figure 15B- Figure 151 show expression of the H3T3A transgene using a later stage germline driver bam-Gal4 greatly reduces H3T3P in later stage mitotic spermatogonial cells, by anti-FasIII, H3T3P, H3S10P and Vasa immunostaining in testes from bam>H3T3A-GFP males.
- a two-cell stage mitotic spermatogonia cyst without H3T3A-GFP expression had detectable H3T3P (Figure 15C) and H3S10P (Figure 15D), both H3T3P and H3S10P overlapped with DNA signal stained with Hoechst ( Figure 15E).
- Figure 15J- Figure 15Q show immunostaining using anti-FasIII and ⁇ -Spectrin: tip of the testis expressing either bam>H3T3A-GFP (Figure 15J- Figure 15M) or bam>H3T3D-GFP (Figure 15N- Figure 15Q). Scale bars: 20 ⁇ . Asterisk: hub.
- Figure 16 A- Figure 161 is a series of photomicrographs and a dot plot showing that the expression of H3T3D randomizes preexisting vs. newly synthesized H3 inheritance during GSC asymmetric division.
- Figure 16A- Figure 16H show immunostaining using anti-FasIII, ⁇ -Spectrin and Vasa antibodies in testes expressing the dual-color H3T3D (Figure 9A- Figure 9B): representative GSC-GB pair expressing H3T3D-GFP and H3T3D-mKO in a symmetric manner ( Figure 16B- Figure 16C) or opposite asymmetric manner (Figure 16F- Figure 16G).
- Asterisk hub. Scale bars: 5 ⁇ .
- the mKO ratio in GB/GSC in H3T3D-expressing testes is significantly greater than 1: 1 ratio.
- Figure 17A- Figure 17M is a series of photomicrographs and a bar chart showing that the knockdown of the H3T3P kinase Haspin in early stage germ cells leads to increased cell death.
- Figure 17A- Figure 17D show immunostaining using anti-Fas III, H3T3P, H3S10P and Vasa antibodies in testes from nos>haspin shRNA males.
- a mitotic GSC (arrow, Figure 17B- Figure 17D) had diffusive Vasa (Figure 17B) (Yadlapalli et al., 2011 J Cell Sci 124, 933; Yuan et al., 2012 Dev Biol 361, 57), overlapping H3S10P (Figure 17C) and Hoechst (Figure 17D) staining signals, but undetectable H3T3P ( Figure 17B).
- a mitotic CySC (arrowhead, Figure 17B- Figure 17D) with normal Haspin level has detectable H3T3P ( Figure 17B) and H3S10P ( Figure 17C), both signals overlap with Hoechst ( Figure 17D) staining signal.
- Figure 17E- Figure 17L show lysotrack staining and immunostaining using anti-Vasa in testes from nos-Gal4 control males (Figure 17E- Figure 17H) and nos>haspin shRNA males (Figure 171- Figure 17L). More germ cells are positive with lysotrack staining (yellow arrow) in testes from nos>haspin shRNA males (Figure 17J- Figure 17K) compared to the nos-Gal4 control males (Figure 17F- Figure 17G).
- Asterisk hub. Scale bars: ⁇ .
- Figure 18 A- Figure 18W is a series of photomicrographs, bar charts, and a dot plot showing that mutations in the haspin gene enhance nos>H3T3A, but suppress nos>H3T3D germline phenotype.
- Figure 18A- Figure 18L show immunostaining using anti-FasIII, ⁇ - Spectrin and Vasa antibodies in testes from nos>H3T3A (Figure 18A- Figure 18D), Df (haspin)/+;nos>H3T3A ( Figure 18E- Figure 18H) or haspin mi09386/+ ;nos>H3T3A ( Figure 181- Figure 18L) males at constant 18 °C.
- Figure 18N- Figure 18U show immunostaining using anti-FasIII, a-Spectrin and Vasa antibodies in testes from nos>H3T3D ( Figure 18N- Figure 18Q) or Df(haspin)/+;
- nos>H3T3D Figure 18R- Figure 18U
- Males (siblings from the same crosses) grown at 18°C, shifted to 29°C as newly eclosed flies and kept at 29°C for seven days.
- Germline tumors were detected in testes from nos>H3T3D males ( Figure 180, Figure 18Q), but not in testes from Df(haspin)/+;nos>H3T3D males ( Figure 18S, Figure 18U).
- Figure 19 is a diagram demonstrating prophase of Drosophila GSC.
- a transient mitosis-specific phosphate modification on histone H3 distinguishes pre-existing and newly synthesized histones and is required for the asymmetric segregation of sister chromatids— one enriched with new histones and the other with old histones— during stem cell division.
- Figure 20U- Figure 20Z is a series of photographs demonstrating that H3T3P distinguishes pre-existing H3-GFP from newly synthesized H3-mKO in mitotic male GSCs.
- a metaphase GSC where GFP and mKO signals are indistinguishable see Figures 20U, Figure 20X, and Figure 20Y
- H3T3P Figure 20Z
- Figure 20V and Figure 20X overlaps with both GFP
- Figure 21A- Figure 21Z is a series of diagrams and photographs demonstrating that expression of H3T3A changes the asymmetric H3 segregation pattern in mitotic GSCs.
- Figure 21A shows a schematic diagram showing the dual color-switch design that expresses pre-existing H3T3A-GFP and newly synthesized H3T3A-mKO by heat-shock treatment, as adapted from Tran et al. (2012).
- Figure 21B- Figure 21D shows a telophase GSC expressing nos>FRT-H3-GFP-PolyA-FRT-H3-rnKO-PolyA (nos>H3) during the second mitosis after heat-shock-induced genetic switch show conventional asymmetric segregation pattern.
- Figure 21E- Figure 21M shows telophase GSCs expressing nos> FRT-H3T3A-GFP-PolyA-FRT- H3T3A-mKO-PolyA (nos>H3T3A) during the second mitosis after heat-shock-induced genetic switch show convention asymmetric pattern (Figure 21E - Figure 21G), symmetric pattern (Figure 21H - Figure 21J), or inverted asymmetric pattern (see Figure 21K- Figure 21M).
- a prophase GSC expressing nos> FRT-H3T3A-GFP- PolyA-FRT-H3T3A-rnKO-PolyA (nos>H3T3A) during the second mitosis after heat-shock- induced genetic switch show separable GFP and mKO signals.
- Figure 22J- Figure22K is a series of graphs depicting that expression of H3T3A or H3T3D changes pre-existing and newly synthesized H3 distribution patterns in post-mitotic GSC-GB pairs.
- Figure 22K shows percentage of GSC-GB pairs with conventional asymmetric (GFP in GSC/GB >1.55), symmetric (GSC/GB GFP ratio between 1-1.45 and GB/GSC GFP ratio between 1-1.45), inverted asymmetric (GFP in GB/GSC >1.55), and borderline (GSC/GB GFP ratio between 1.45-1.55 and GB/GSC GFP ratio between 1.45- 1.55) patterns, respectively in nos>H3, nos>H3T3A, and nos>H3T3D testes, as well as the predicted patterns according to randomized segregation modeling (Table 2A, Table 2B, and Figure 27).
- Figure 23 A- Figure 23C is a series of photographs demonstrating that molecular and cellular specificity of histone separation patterns in prophase germ cells, and spatial and temporal specificity of the H3T3P signal.
- Figure 23A shows a prophase GSC expressing nos>FRT-H3.3-GFP-PolyA-FRT-H3.3-mKO-PolyA transgene during the second mitosis after heat-shock-induced genetic switch from H3.3-GFP-encoding to H3.3-mKO-encoding sequences.
- Figure 23B and Figure 23C show prophase GSC (Figure 23B) and GB ( Figure 23C) expressing nos>FRT-H3T3A-GFP-PolyA-FRT-H3T3A-mKO-PolyA transgene during the second mitosis after heat-shock-induced genetic switch from H3T3A-GFP-encoding to H3T3A-mKO-encoding sequences.
- Figure 24 is a series of photographs demonstrating that H3T3P signal in H3T3D- expressing cells and the effects of H3T3 A or H3T3D on histone inheritance patterns.
- Figure 25A - Figure 25F is a series of photographs and graphs demonstratimg that Expression of H3T3A or H3T3D Using the nos-Gal4 Driver Leads to Similar Phenotypes.
- Figure 25A and Figure 25B show immunostaining using antibodies against a hub marker FasIII and a spectrosome/fusome marker a-Spectrin in nos>H3-GFP ( Figure 25 A) or nos>H3T3A-GFP ( Figure 25B) testes, inserts in the merged panel are shown at higher magnification in single-channel panels, respectively.
- Arrows in (Figure 25A) point to dotted spectrosome, arrowheads in ( Figure 25B) point to branched fusomes.
- Figure 25C shows quantification of the GSC number in nos>H3-GFP or nos>H3T3A-GFP testes.
- Figure 25D - Figure 25F shows immunostaining using antibodies against a hub marker FasIII and a spectrosome/fusome marker a-Spectrin in testes from nos>H3-GFP (Figure 25D), nos>H3T3A-GFP ( Figure 25E), or nos>H3T3D-GFP (Figure 25F) males.
- Early-stage germ cells expressing GFP expand, hub size increases (Figure 25E) and ( Figure 25F), in comparison with (Figure 25D), insets in the merged panel (the first column) are shown at higher magnification in single-channel panels, respectively).
- Scale bars 20 uM.
- Figure 26A - Figure 26C shows a series of photographs demonstrating that expression of H3T3A in somatic gonadal cells does not lead to obvious cellular defects.
- Figure 26A shows immunostaining using antibodies against a hub marker FasIII, a germ cell-specific marker Vasa, H3T3P, and H3S10P in Tj>H3T3A-GFP testes.
- a metaphase GB cell with Vasa staining but without H3T3A-GFP expression (arrow in Figure 26A) is positive with both H3T3P and H3S10P (arrow) signals.
- a metaphase cyst stem cell without Vasa staining but with H3T3A-GFP expression is negative with H3T3P signal) but positive with H3S10P signal (arrowhead).
- Figure 26B and Figure 26C show immunostaining using antibodies against FasIII, a-Spectrin, and Vasa in Tj>H3-GFP ( Figure 26B) or Tj>H3T3A-GFP ( Figure 26C) testes. Scale bars: 20 ⁇ .
- Figure 27 is a diagram depicting Drosphila melanogaster chromosomes X, Y, 2, 3, and 4. Mbps values correspond with similar values in Table 2A and Table 2B.
- the invention is based, at least in part, on the surprising discovery that histone H3 Thr 3 phosphorylation regulates asymmetric H3 inheritance and male germline activity in Drosophila and that an H3T3A mutant protein efficiently reduces H3T3P and causes increased cell death of rapidly-dividing cells.
- the methods described herein introduce a point mutation of the Thr3 residue of the transgenic histone H3 protein to produce a mutant transgenic protein to reduce the post-translational modification of H3 (i.e., to reduce the H3T3 phosphorylation in rapidly dividing cells) to cause cell cycle arrest followed by cell death. Because the mutant transgenic protein effectively reduces Thr3 phosphorylation including endogenous H3, this mutant form acts dominant negatively.
- a transgene that carries a mutation that converts threonine 3 (Thr3 or T3) to the unphosphorylatable alanine (Ala or A) greatly reduces the phosphorylation at T3 of histone 3 (H3T3P) mark.
- H3T3P regulates asymmetric H3 inheritance and affects germ cell function.
- Cancer is one of the most prevalent diseases, accounting for 25% of all deaths in the United States (Siege et al., 2012 Cancer statistics, 2: 10-29).
- the H3T3P mark is important for mitosis and the reduction of which leads to increased cell death in rapidly-dividing cells including cancer cells.
- the methods described herein antagonize growth in rapidly dividing cells.
- the compositions described herein are anti-cancer agents that are utilized in methods to reduce tumor cell growth.
- histone H3 shows asymmetric distribution during Drosophila male germline stem cell (GSC) asymmetric division.
- H3T3P phosphorylation at threonine 3 of H3
- a mutation that converts T3 to the unphosphorylatable alanine reduces H3T3P and results in randomized H3 inheritance patterns.
- Reduction of H3T3P causes GSC maintenance and germline differentiation defects including germ cell loss and tumors.
- Expression of H3 with T3 changed to phosphor-mimic aspartic acid results in similar phenotypes, indicating tight temporal control of H3T3P.
- the results presented herein indicate that mitosis-specific H3T3P distinguishes sister chromatids enriched with distinct H3 proteins and coordinates their proper inheritance, which is important for proper activity of both daughter cells derived from GSC asymmetric division.
- H3 histone the cellular specificity exhibited by the H3 histone suggests that global asymmetric histone inheritance occurs uniquely in a cell-type (GSC) where the mother cell must divide to produce two daughter cells each with a unique cell fate. Because this asymmetry is not observed in symmetrically dividing GB cells, asymmetric histone inheritance was proposed to be a phenomenon specifically employed by GSCs to establish unique epigenetic identities in each of the two daughter cells.
- GSCs cell-type
- a mitosis-enriched H3T3P mark acts as a transient landmark that distinguishes sister chromatids with identical genetic code but different epigenetic information, shown as pre-existing H3-GFP and newly synthesized H3-mKO.
- H3T3P functions to allow these molecularly distinct sisters to be segregated and inherited differentially to the two daughter cells derived from one asymmetric cell division.
- the selective segregation of different populations of histones likely allows these two cells to assume distinct fates: self- renewal versus differentiation. Consequently, loss of proper epigenetic inheritance might lead to defects in both GSC maintenance and GB differentiation, suggesting that both cells need this active partitioning process to either LLremember" or LLreset" their molecular properties.
- H3T3P is only detectable from prophase to metaphase, the window of time during which the mitotic spindle actively tries to attach to chromatids through microtubule-kinetochore interactions.
- H3T3P signal is enriched at the peri-centro-meric region, where kinetochore components robustly crosstalk with chromatin-associate factors.
- H3T3 shows a sequential order of phosphorylation, first appearing primarily on sister chromatids enriched with pre-existing H3 and then subsequently appearing on sister chromatids enriched with newly synthesized H3 as the GSC nears metaphase.
- the distinct temporal patterns shown by H3T3P are unique to GSCs and would allow the mitotic machinery to differentially recognize sister chromatids bearing distinct epigenetic information; an essential step necessary for proper segregation during asymmetric GSC division.
- the tight temporal control of H3T3 phosphorylation suggests that rather than serving as an inherited epigenetic signature, H3T3P may act as transient signaling mark to allow for the proper partitioning of H3.
- H3T3P needs to be under tight temporal control in order to ensure proper H3 inheritance and germline activity.
- H3T3P is indeed subject to stringent temporal controls during mitosis.
- the H3T3P mark is undetectable during G2 phase.
- sister chromatids enriched with pre-existing H3-GFP histone begin to show H3T3 phosphorylation prior to sister chromatids enriched with newly synthesized H3- mKO.
- H3T3P signal begins to appear on sister chromatids enriched with newly synthesized H3-mKO.
- Such a tight regulation of H3T3P is compromised when levels of H3T3P are altered due to the incorporation of mutant H3T3A or H3T3D.
- H3T3A mutant results in a significant decrease in the levels of H3T3P on sister chromatids throughout mitosis, such that neither sister becomes enriched with H3T3P as the GSC progresses toward metaphase.
- incorporation of the H3T3D mutant would result in seemingly elevated levels of H3T3P early in mitosis.
- H3T3A and H3T3D act in different ways, both mutations significantly disrupt the highly regulated temporal patterns associated with H3T3 phos-phorylation, the result of which is randomized H3 inheritance patterns and germ cell defects in testes expressing either H3T3A or H3T3D.
- Haspin kinase will also affect the temporal control of H3T3 phosphorylation.
- a further decrease in H3T3P by reducing Haspin levels should limit the GSC's ability to distinguish between sister chromatids enriched with distinct H3.
- haspin mutants enhance the phenotypes in nos>H3T3A testes.
- Haspin kinase A different situation appears in the context of H3T3D where sister chromatids experience seemingly elevated levels of H3T3P at the start of mitosis. These elevated H3T3P levels may be exacerbated by the phosphorylation activity of the Haspin kinase. Therefore, it is conceivable that by halving the levels of the Haspin kinase, H3T3 phosphorylation should be reduced to a level more closely resembling wild-type. In this way, some of the temporal specificity that is lost in the H3T3D mutant is restored, resulting in suppression of the phenotypes observed in nos>H3T3D testes. An exciting topic for future study would be to further explore how exactly Haspin
- H3T3A and H3T3D mutations act synergistically or antagonisti-ically in regulating asymmetric sister chromatids segregation through differential phosphorylation of a key histone residue.
- compositions for use as a therapeutic.
- the composition is administered systemically, for example, formulated in a pharmaceutically-acceptable buffer such as physiological saline.
- a pharmaceutically-acceptable buffer such as physiological saline.
- routes of administration include, for example, instillation into the bladder, subcutaneous, intravenous, intraperitoneal, intramuscular, or intradermal injections that provide continuous, sustained levels of the composition in the patient.
- Treatment of human patients or other animals is carried out using a therapeutically effective amount of a therapeutic identified herein in a physiologically-acceptable carrier. Suitable carriers and their formulation are described, for example, in Remington's Pharmaceutical Sciences by E. W. Martin.
- the amount of the therapeutic agent to be administered varies depending upon the manner of administration, the age and body weight of the patient, and with the clinical symptoms of the neoplasia or infection. Generally, amounts will be in the range of those used for other agents used in the treatment of other diseases associated with neoplasia or infection, although in certain instances lower amounts will be needed because of the increased specificity of the compound.
- a compound is administered at a dosage that enhances an immune response of a subject, or that reduces the proliferation, survival, or invasiveness of a neoplastic cell as determined by a method known to one skilled in the art.
- compositions for the treatment of a condition associated with endothelial dysfunction may be by any suitable means that results in a concentration of the therapeutic that, combined with other components, is effective in ameliorating, reducing, or stabilizing a condition associated with endothelial dysfunction.
- the composition may be contained in any appropriate amount in any suitable carrier substance, and is generally present in an amount of 1-95% by weight of the total weight of the composition.
- the composition may be provided in a dosage form that is suitable for parenteral (e.g., subcutaneously, intravenously, intramuscularly, intravesicularly or intraperitoneally) administration route.
- the pharmaceutical compositions may be formulated according to conventional pharmaceutical practice (see, e.g., Remington: The Science and Practice of Pharmacy (20th ed.), ed. A. R. Gennaro, Lippincott Williams & Wilkins, 2000 and
- Human dosage amounts can initially be determined by extrapolating from the amount of compound used in mice or nonhuman primates, as a skilled artisan recognizes it is routine in the art to modify the dosage for humans compared to animal models. In certain embodiments it is envisioned that the dosage may vary from between about 0.1 ⁇ g compound/kg body weight to about 5000 ⁇ g compound/kg body weight; or from about 1 ⁇ g/kg body weight to about 4000 ⁇ g/kg body weight or from about 10 ⁇ g/kg body weight to about 3000 ⁇ g/kg body weight.
- this dose may be about 0.1, 0.3, 0.5, 1, 3, 5, 10, 25, 50, 75, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1000, 1050, 1100, 1150, 1200, 1250, 1300, 1350, 1400, 1450, 1500, 1600, 1700, 1800, 1900, 2000, 2500, 3000, 3500, 4000, 4500, or 5000 ⁇ g/kg body weight. In other embodiments, it is envisaged that doses may be in the range of about 0.5 ⁇ g
- compound/kg body weight to about 20 ⁇ g compound/kg body weight.
- the doses may be about 0.5, 1, 3, 6, 10, or 20 mg/kg body weight.
- this dosage amount may be adjusted upward or downward, as is routinely done in such treatment protocols, depending on the results of the initial clinical trials and the needs of a particular patient.
- compositions are formulated with appropriate excipients into a pharmaceutical composition that, upon administration, releases the therapeutic in a controlled manner.
- suitable excipients include single or multiple unit tablet or capsule compositions, oil solutions, suspensions, emulsions, microcapsules, microspheres, molecular complexes, nanoparticles, patches, and liposomes.
- Kits or Pharmaceutical Systems Pharmaceutical compositions may be assembled into kits or pharmaceutical systems for use in arresting cell cycle in rapidly dividing cells, e.g., cancer cells. Kits or
- kits or pharmaceutical systems comprise a carrier means, such as a box, carton, tube, having in close confinement therein one or more container means, such as vials, tubes, ampoules, bottles, syringes, or bags.
- container means such as vials, tubes, ampoules, bottles, syringes, or bags.
- the kits or pharmaceutical systems of the invention may also comprise associated instructions for using the kit.
- mitosis-specific epigenetic mark H3T3P distinguishes preexisting versus newly synthesized H3 to regulate their proper segregation during cell division. Mutating this threonine to either unphosphorylatable alanine or phosphor-mimic aspartic acid leads to mis-segregation of sister chromatids and dramatic germ cell defects including germline tumor and germ cell loss. The results presented herein highlight the importance of proper epigenetic inheritance in stem cells.
- fly stocks were raised using standard Bloomington medium at 18°C, 25°C, or 29°C as noted. The following fly stocks were used: hs-flp on the X chromosome (Bloomington Stock Center BL-26902), haspin TRIP line (Bloomington Stock 35276), Oi(haspin)
- the H3T3A/D-mKO fusion sequences were recovered as an Xbal flanked fragment and were subsequently inserted into the Xbal site of the UASp plasmid to construct the UASp- H3T3A/D-mKO plasmid.
- the H3T3A/D-GFP fusion sequences were inserted to
- Flies with UASp-FRT-H3-GFP-PolyA-FRT-H- mKO or their mutant transgenes were paired with nos-Gal4 drivers. Flies were raised at 18°C throughout development until adulthood to avoid pre-flip (Tran et al., 2012 Science 338, 679). Before heat shock, 0-3 day old males were transferred to vials that had been air dried for 24 hours. Vials were submerged with all air area (i.e., up to the plug) underneath water in a circulating 37 °C water bath for two hours and recovered in a 29°C incubator for indicated time before dissection and immunostaining experiments.
- H3T3A or H3T3D e.g., UASp-FRT-H3T3A/D-GFP-PolyA-FRT-H3T3A/D- mKO
- nos-Gal4 or bam-Gal4 driver were raised at 18°C throughout development until adulthood. Newly enclosed males were collected and shifted to 29 °C for indicated time before dissection and immunostaining experiments.
- Immunofluorescence staining was performed using standard procedures (Tran et al., 2012 Science 338, 679; Hime et al., 1996 J Cell Sci 109 ( Pt 12), 2779).
- Primary antibodies were mouse anti-a spectrin (1:50, DSHB 3A9), mouse anti-Fas III (1:50, DSHB, 7G10), mouse anti-Armadillo (1 : 100; DSHB, N2 7A1 clone), rabbit anti- H3T3P (1:200, Millipore 05-746R), mouse anti-H3S10P (1:200; Millipore, #05-806), anti-CID (1: 100; gift from Dr.
- Images were taken using the Zeiss LSM 510 META or Zeiss LSM 700 Multiphoton confocal microscope with a 40x or 63 x oil immersion objectives and processed using Adobe Photoshop software.
- EdU labeling of the GSC-GB pairs at S phase was performed using Click-iT EdU Alexa Fluor 647 Imaging Kit (Life Science CI 0640) according to manufacturer's instructions. Dissected testes were immediately incubated in S2 medium with 100 ⁇ EdU for 30 minutes at room temperature. The testes were subsequently fixed and proceed to primary antibodies (anti-FasIII, anti-a spectrin and anti-Vasa) incubation. Fluorophore conjugation to EdU was performed along manufacturer's instructions and followed by secondary antibodies incubation. The addition of EdU facilitates recognition of the GSC-GB pairs undergoing active DNA synthesis from those without EdU, which might be arrested due to the heat shock treatment. The cell cycle progression is important for the incorporation and segregation of preexisting versus newly synthesized H3.
- Light sheet measurements were performed using a massively parallel linear array of non-diffracting beams that coherently interfere to create a 2D optical lattice confined to a single plane (Gao et al., 2014 Nat Protoc 9, 1083; B. C. Chen et al., 2014 Science 346, 1257998).
- This structured was then oscillated rapidly within the plane to create time- averaged uniform excitation in a 400 nm thick section across the entire field of view.
- the desired coherent pattern was generated using a spatial light modulator (SXGA-3DM, Forth Dimension Displays) that was conjugate to the sample plane, and that projected a binarized version of the desired pattern to be imaged at the sample.
- SXGA-3DM Spath Dimension Displays
- the fluorescence generated within the specimen by the light sheet was collected by an objective (Nikon, CFI Apo LWD 25XW, 1.1 NA, 2 mm WD) and then imaged on a fast camera (ORCA-flash4.0, Hamamatsu).
- Four lasers of excitations wavelengths 405 nm, 488 nm, 532 nm, and 640 nm were used, and a multi-band emission filter (Semrock, FF02-435/40-25, FF03-525/50-25, FF01-562/40-25, BLP01-647R-25) rejected the excitation wavelengths.
- the fixed sample was mounted on 5 mm coverslip through the light sheet at 50 ms exposure per 2D image.
- the excitation numerical aperture of light sheet is 0.42 for outer ring and 0.325 for inner one.
- the image voxel is 104 xl04 x 250 nm in x, y, z respectively.
- Multi-color experiments were performed by switching the color stack by stack.
- the 3D images obtained by sweeping the light sheet plane by plane through the specimen were deconvolved using a Richardson- Lucy algorithm. Immunoblot experiments
- Histone H3 antibody (Abeam Cat# abl791), H4 antibody (Abeam Cat# abl0158), and GFP antibody (Abeam Cat# abl3970) were used for immunoblot analyses. 15 testes were dissected in lxPBS and transferred to lxRIPA to prepare for the lysate of each sample.
- Arcturus Picopure RNA isolation kit (Life Tecknologies, KIT0204) was utilized to prepare total RNA from dissected testis samples. Sequencing libraries were prepared by following the Illumina TruSeq RNA sample prep kit V2 (Illumina, RS-122-2001). Five H3T3A samples and two nos-Gal4; UAS-upd (nos>upd) (24, 42, 43) samples were sequenced on Illumina Mi-seq or Hi-seq 2500 sequencer. The Hi-seq 2500 runs were single-end 50 cycle sequencing, and the Mi-seq runs were pair-end 75*2 cycle sequencing. In the analysis, the pair-end reads were merged and treated as single-end.
- transcriptome profiling analysis there are two transcriptome profiles from a previous published work (Gan et al., 2010 Cell Res 20, 763), one from wild-type testis tissue sample and one from bag-of -marbles (bam) mutant testis tissue sample. Thus, a total of nine samples/data were input for the transcriptome profiling analysis.
- the reads retrieved from multiple sequencing runs were examined by fastqc quality control software (bioinformatics.babraham.ac.uk/projects/fastqc/).
- the reads passed quality filter were mapped back to Drosophila melanogaster genome (dm3) (Flybase dmel_r5.43, as of Jan 2012, ftp.flybase.net/releases/FB2012_01/dmel_r5.43/).
- Bowtie aligner [version 0.12.7 (Langmead et al., 2009 Genome Biol 10, R25)] was utilized with the following configuration (-a— hred33-quals -n 2 -e 70 -1 28 -m 1 -best -strata) which is basically allowing two mismatches and only one alignment site. Each read was then assigned into gene regions.
- the annotation for protein coding genes, ribosomal RNAs, tRNAs, snoRNA, snRNAss, pre_miRNAs, and other non-coding RNAs were retrieved from Flybase database (as of Jan 2012, ftp.flybase.net/releases/FB2012_01/dmel_r5.43/).
- exons from different alternative splicing isoforms were merged to find the maximum genome coverage regions per gene.
- the count is split as equal possibilities into these two genes, half count for each.
- a matrix file with the number of reads assigned into each gene per sample was prepared for the following data analysis.
- the edgeR software package Robot et al., 2010 Bioinformatics 26, 139 was utilized to find the normalization factors for each sample with various sizes (by the TMM (Trimmed Mean of M value) and upper quantile normalization methods).
- the edgeR method models short reads into negative binomial distribution and estimates the biological replicate variance (dispersion).
- Tag-wise dispersion estimation was performed in "H3T3A”, “nos- UPD”, “bam” and "wild-type” four groupings of read count profiles. Quantity term
- corrected RPKM (cRPKM) was introduced by the formula: pseudo.alt * le+09 / (length of merged transcripts)/ (common.lib.size).
- the common.lib.size was calculated from the calcNormFactors function of edgeR, which performs TMM and upper quantile normalization methods and set a reference library.
- the pseudo.alt contains read counts after normalization across the input multiple profiles.
- the pseudo.alt was calculated by edgeR using quantile normalization and maximum likelihood method.
- the pseudo.alt contains pseudo read counts after correcting the library size and composition difference.
- Described herein is a two-step model to explain this asymmetric H3 inheritance.
- H3-GFP and H3-mKO signals are already separable in a prophase GSC ( Figure 1A- Figure 1C; Figure 6A- Figure 6B, and Figure 6E), but not in a control GB ( Figure ID- Figure IF; Figure 6H- Figure 61, and Figure 6L), which is consistent with the hypothesis that their differential distribution is established in GSCs prior to mitosis (Step one in Figure 5B).
- Figure ID- Figure IF Figure 6H- Figure 61, and Figure 6L
- Such a separation was not detected using a H3.3 dual-color transgene under the same heat-shock regime (Figure 23A), consistent with H3.3 being inherited symmetrically (Tran et al., 2012).
- H3T3P The phosphorylation at threonine 3 of H3 (H3T3P) is enriched on mitotic
- H3-GFP Figure 1G an Figure 1J
- H3-mKO Figure 1G and Figure IK
- H3T3P Figure 1H- Figure II, and Figure 1L
- H3- GFP signals and H3-mKO signals are not separable and H3T3P does not distinguish them in a control GB ( Figure 1M- Figure 1R; Figure 6J, and Figure 6M- Figure 6N).
- H3T3P acts as an epigenetic mark to distinguish sister chromatids enriched with preexisting H3 from those enriched with newly synthesized H3.
- H3T3P immunostaining signal observed is not restricted to the centromeric region (Figure 7A- Figure 7L), in contrast to centromere- specific H3T3P signal reported in mammalian cells (Wang et al., 2010 Science 330, 231). Moreover, H3T3P is only detectable in prophase (Figure 7G, and Figure 7M-Figure 7P) to metaphase (Figure 7Q- Figure 7T), but not in anaphase (Figure 7U-Figue 7X) germ cells, consistent with previous report in other insect cells (C. Escriba and C. Goday, 2013 J Cell Sci 126, 3214).
- H3T3P human immunodeficiency virus
- fly lines were generated with an H3-GFP transgene carrying a point mutation that converts T3 to the unphosphorylatable Alanine (Ala or A, H3T3A).
- Al or A, H3T3A unphosphorylatable Alanine
- H3T3A affects asymmetric H3 segregation during GSC asymmetric division using the dual-color labeling system (Figure 9A). Because mitotic GSCs account for less than 2% of all GSCs (Tran et al., 2012 Science 338, 679; X. R. Sheng and E. Matunis, 2011 Development 138, 3367; Yadlapalli et al., 2011 J Cell Sci 124, 933; and S. Yadlapalli and Y. M. Yamashita, 2013 Nature), post- mitotic GSC-GB pairs derived from GSC asymmetric divisions were examined to assess patterns of histone inheritance (Tran et al., 2012 Science 338, 679, see also below).
- asymmetric H3 segregation (Step two; Figure 5B) is mis -regulated, resulting in randomized patterns. Because male flies have two major autosomes and two sex
- H3T3A-expressing testes exhibited an expansion of germ cells carrying early stage cellular markers. These markers include nanos-driven GFP expression (Figure 4E- Figure 4F; Figure 11K- Figure 11L), spectrosome structure (Lin et al., 1994 Development 120, 947; M. de Cuevas and A. C.
- Figure 14D and Figure 14M most likely as a secondary defect due to GSC loss as reported previously (Tazuke et al., 2002 Development 129, 2529; Monk et al., 2010Cell Stem Cell 6, 348; P. Gonczy and S. DiNardo, 1996 Development 122, 2437; and Dinardo et al., 2011 Development 138, 1687).
- the expanded hub cells were not tightly associated with each other (Figure 14H vs. Figure 14D) and expressed an early cyst cell marker Zfh-1 (Issigonis et al., 2009 Science 326, 153; Eun et al., 2014 Science 343, 1513; and L. Leatherman and S. Dinardo, 2008 Cell Stem Cell 3, 44) ( Figure 14G), suggesting that the niche architecture and gene expression are abnormal.
- H3T3P Since loss of H3T3P by H3T3A-expression and gain of H3T3P by H3T3D-expression in early stage germ cells resulted in similar histone inheritance and cellular defects, phosphorylation of H3T3 requires a tight temporal control.
- the epigenetic 'writer' that generates the H3T3P mark has been characterized as the Haspin kinase (Dai et al., 2005 Genes Dev 19, 472), loss-of-function phenotypes of the haspin gene were examined.
- shRNA short hairpin RNA
- nos-Gal4 driver significant decrease of H3T3P in GSC was observed [arrow in Figure 17B vs. a mitotic CySC (arrowhead)].
- Haspin may function with H3T3A or H3T3D in early-stage germ cells. It was examined whether halving the level of Haspin could modify either nos>H3T3A or nos>H3T3D phenotypes. Using a deficiency chromosome that uncovers the haspin gene region, it was identified that it substantially enhanced the nos>H3T3A phenotype (compare Figure 18E- Figure 18H to Figure 18A- Figure 18D, and Figure 18M) under a permissive condition for nos>H3T3A.
- Example 3 Expression of H3T3A Changes the Assymetric H3 Segregation Pattern in Mitotic GSCs.
- H3T3A changes H3 distribution patterns in post mitotic GSC- GB pairs (see Figure 3A- Figure 31), the percentage of each of these distribution pattern was quantified.
- GFP signal was mainly used to account for different patterns, for example, in Figure 22J: the conventional asymmetric patterns are in zone I, with GFP ratio in GSC/GB >1.55; the symmetric patterns are in zone II, with GFP ratio in GSC/GB ⁇ 1.45 but >0.69 (i.e., GB/GSC ⁇ 1.45); and the inverted asymmetric patterns are in zone III, with GFP ratio in GB/GSC >1.55.
- the 1.5-fold cutoff is based on the quantification range of symmetric H3 distribution in spermatogonial cells and symmetric H3.3 distribution in GSC-GB pairs (Tran et al., 2012, 2013).
- the GFP ratio reflects the establishment of asymmetric histone distribution on sister chromatids more reliably than mKO ratio for two reasons. First, when mKO fluorescence intensity is measured in post-mitotic GSC-GB pairs, both cells are actively undergoing S phase for the next mitosis and exhibit robust incorporation of mKO- labeled newly synthesized histones (Figure 3C). Second, any histone turn-over that incorporates newly synthesized mKO-labeled histones (Deal et al., 2010; Dion et al., 2007) during processes such as transcription may not be sister chromatid-specific.
- the tumors of progenitor germ cells developed in nos>H3T3A testes were noticeably heterogeneous (Figure 12A- Figure 12H).
- some tumor cells maintained strong GFP expression (Figure 12A- Figure 12H), a mark indicative of active nos-Gal4 activity, and exhibited spectrosome structure (Figure 12A- Figure 12H), suggesting that they are an early-stage GSC and/or GB cell tumor.
- other tumor cells exhibited loss of GFP expression and a fusome structure (Figure 12A- Figure 12H), suggesting that they are a later-stage spermatogonial tumor.
- nos>H3T3A testes ( Figures 4G, inset, and Figure 25B, yellow outline) showed a substantial hub enlargement (Figure 14M) compared to nos>H3 testes ( Figures 4C, inset, and Figure 25 A, yellow outline), most likely as a secondary defect due to GSC loss as reported previously (Dinardo et al., 2011; Got nczy and DiNardo, 1996; Monk et al., 2010; Tazuke et al., 2002).
- H3T3P is likely required for both GSC maintenance and proper differentiation of GB.
- Example 5 Expression of H3T3A in Late-Stage Germ Cells or Somatic Cells Does Not Cause Germline Tumors.
- cyst stem cell In addition to GSCs, another type of adult stem cell residing in the Drosophila testis niche is the cyst stem cell (CySC), which, under normal conditions, is the only mitotically active somatic gonadal cell type (Dinardo et al., 2011).
- CySC cyst stem cell
- Tj-Gal4 driver Tetzapf et al., 2007
- Example 6 Expression of H3T3D in Early-, but Not Late-Stage, Germ Cells Leads to Randomized H3 Inheritance and Cellular Defects.
- H3T3D in early germ cells using a similar dual-color labeling strategy (as described for H3T3A in Figure 21 A) also randomizes pre-existing H3T3D and newly synthesized H3T3D inheritance patterns ( Figures 22J, Figure 22K, and Figure 161; Table 1): approximately 79.0% (45/57) of GSC-GB pairs showed symmetric inheritance patterns, 7.0% (4/57) showed conventional asymmetry, and 10.5% (6/57) showed inverted asymmetry, with the remaining 3.5% (2/57) of pairs at the borderline between asymmetry and symmetry (1.45- to 1.55-fold).
- H3T3P Since both reduction of H3T3P by expression of H3T3 A and the mimicking of H3T3P by expression of H3T3D result in similar histone inheritance and germline defects, phosphorylation of H3T3 might require a tight temporal control during GSC mitosis.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Immunology (AREA)
- Engineering & Computer Science (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Molecular Biology (AREA)
- Epidemiology (AREA)
- Gastroenterology & Hepatology (AREA)
- Zoology (AREA)
- Biochemistry (AREA)
- Biomedical Technology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- General Chemical & Material Sciences (AREA)
- Toxicology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Marine Sciences & Fisheries (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Microbiology (AREA)
- Cell Biology (AREA)
- Hematology (AREA)
- Urology & Nephrology (AREA)
- Oncology (AREA)
- Neurology (AREA)
- Mycology (AREA)
- Biotechnology (AREA)
- Food Science & Technology (AREA)
- Physics & Mathematics (AREA)
- Analytical Chemistry (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
Abstract
The invention features compositions comprising an H3T3A mutant protein. Described herein are methods of inducing cell death in a rapidly dividing cell comprising contacting a rapidly dividing cell with an agent that reduces phosphorylation at threonine 3 of histone 3 (H3T3P), thereby inducing cell cycle arrest followed by cell death. In some cases, the rapidly dividing cell is a tumor cell, e.g., a cancer cell. The agent that reduces phosphorylation of H3T3P comprises an H3T3A mutant protein, e.g., a mutant transgenic protein. Described herein is a kit for arresting cell cycle comprising an agent that reduces phosphorylation H3T3P.
Description
A H3T3A MUTANT PROTEIN EFFICIENTLY REDUCES H3T3P AND CAUSES INCREASED CELL DEATH OF RAPIDLY DIVIDING CELLS
CROSS-REFERENCE TO RELATED APPLICATIONS
This application is an International Patent Application which claims the benefit of priority under 35 U.S.C. § 119(e) to U.S. Provisional Application No. 62/143,546, filed April 6, 2015, which is incorporated by reference herein in its entirety.
STATEMENT OF RIGHTS TO INVENTIONS MADE UNDER FEDERALLY SPONSORED RESEARCH
This work was supported by the National Institute of Child Health and Human Development under grant number R21HD065089 and by the National Institutes of Health under grant numbers R01HD065816 and ROIGMI 12008. The Government has certain rights in this invention.
FIELD OF THE INVENTION
This invention relates generally to the field of cell cycle arrest.
BACKGROUND OF THE INVENTION
Cancer is one of the most prevalent diseases, accounting for 25% of all deaths in the United States. As such, prior to the invention described herein, there was a pressing need to develop new strategies to inhibit rapidly dividing cancer cells.
SUMMARY OF THE INVENTION
The invention is based, at least in part, on the surprising discovery that histone H3 threonine 3 phosphorylation regulates asymmetric H3 inheritance and male germline activity in Drosophila and that an H3T3A mutant protein efficiently reduces H3T3P and causes increased cell death of rapidly-dividing cells. The methods described herein introduce a point mutation of the Thr3 residue of the transgenic histone H3 protein to reduce the post- translational modification of H3 (i.e., to reduce the H3T3 phosphorylation in rapidly dividing cells) to cause cell cycle arrest followed by cell death. Specifically, a transgene that carries a mutation that converts threonine 3 (Thr3 or T3) to the unphosphorylatable alanine (Ala or A) greatly reduces the phosphorylation at T3 of histone 3 (H3T3P) mark. Furthermore, converting T3 to the unphosphorylatable residue alanine (H3T3A) or to the phosphomimetic
aspartate (H3T3D) disrupts assymetric H3 inheritance. The H3T3P mark is important for mitosis, and the reduction of which leads to increased cell death in rapidly-divising cells including cancer cells.
As such, the compositions and methods described herein antagonize growth in rapidly dividing cells. For example, the compositions described herein are anti-cancer agents, e.g., H3T3A and/or H3T3D, that are utilized in methods to reduce tumor cell growth.
Described herein are methods of inducing cell death in a rapidly dividing cell comprising contacting a rapidly dividing cell with an agent that reduces phosphorylation at threonine 3 of histone 3 (H3T3P), thereby inducing cell cycle arrest followed by cell death. In some cases, the rapidly dividing cell is a tumor cell, e.g., a cancer cell. Preferably, the rapidly dividing cell is not a germline stem cell. Similarly, methods of inhibiting tumor growth are carried out by contacting a tumor cell with an agent that reduces phosphorylation at threonine 3 of histone 3 (H3T3P), thereby inhibiting tumor growth.
The agent that reduces phosphorylation of H3T3P comprises an H3T3A mutant protein, e.g., a mutant transgenic protein. For example, the H3T3A mutant protein comprises a point mutation of threonine 3 of H3 such as a substitution of threonine 3 with alanine (H3T3A). In other embodiments, the agent that reduces phosphorylation of H3T3P comprises an H3T3D mutant protein, e.g., a mutant transgenic protein. For example, the H3T3D mutant protein comprises a point mutation of threonine 3 of H3 such as a substitution of threonine 3 with aspartic acid (H3T3D). In some cases, the method further comprises administering a chemotherapeutic agent such as radiotherapy or a cell death-inducing agent.
Also described herein are isolated transgenes encoding H3T3A and isolated peptides comprising H3T3A. Additionally, described herein are isolated transgenes encoding H3T3D and isolated peptides comprising H3T3D.
The nucleic acid sequence of wild type Drosophila melanogaster histone H3 is set forth below (SEQ ID NO: 1).
ATGGCTCGTACC AAGCAAACTGCTCGCAAATCGACTGGTGGAAAGGCGCCACGC
AAACAACTGGCTACTAAGGCCGCTCGCAAGAGTGCTCCAGCCACCGGAGGTGTG
AAGAAGCCCCACCGCTATCGCCCTGGAACCGTGGCCTTGCGTGAAATTCGTCGCT
ACCAAAAGAGCACCGAGCTTCTAATCCGCAAGCTGCCTTTCCAGCGTCTGGTGCG
TGAAATCGCTCAGGACTTTAAGACGGACTTGCGATTCCAGAGCTCGGCGGTTATG
GCTCTGCAGGAAGCTAGCGAAGCCTACCTGGTTGGTCTCTTCGAAGATACCAACT
TGTGTGCCATTCATGCCAAGCGTATCACCATAATGCCCAAAGACATCCAGTTAGC GCGACGCATTCGCGGCGAGCGTGCTTAA
The nucleic acid sequence of Drosophila melanogaster H3T3A mutant is set forth below (SEQ ID NO: 2).
ATGGCTCGTCCCAAGCAAACTGCTCGCAAATCGACTGGTGGAAAGGCGCCACGC
AAACAACTGGCTACTAAGGCCGCTCGCAAGAGTGCTCCAGCCACCGGAGGTGTG
AAGAAGCCCCACCGCTATCGCCCTGGAACCGTGGCCTTGCGTGAAATTCGTCGCT
ACCAAAAGAGCACCGAGCTTCTAATCCGCAAGCTGCCTTTCCAGCGTCTGGTGCG
TGAAATCGCTCAGGACTTTAAGACGGACTTGCGATTCCAGAGCTCGGCGGTTATG
GCTCTGCAGGAAGCTAGCGAAGCCTACCTGGTTGGTCTCTTCGAAGATACCAACT
TGTGTGCCATTCATGCCAAGCGTATCACCATAATGCCCAAAGACATCCAGTTAGC
GCGACGCATTCGCGGCGAGCGTGCTTAA
The nucleic acid sequence of Drosophila melanogaster H3T3D mutant is set forth below (SEQ ID NO: 13).
ATGGCTCGTGACAAGCAAACTGCTCGCAAATCGACTGGTGGAAAGGCGCCACGC
AAACAACTGGCTACTAAGGCCGCTCGCAAGAGTGCTCCAGCCACCGGAGGTGTG
AAGAAGCCCCACCGCTATCGCCCTGGAACCGTGGCCTTGCGTGAAATTCGTCGCT
ACCAAAAGAGCACCGAGCTTCTAATCCGCAAGCTGCCTTTCCAGCGTCTGGTGCG
TGAAATCGCTCAGGACTTTAAGACGGACTTGCGATTCCAGAGCTCGGCGGTTATG
GCTCTGCAGGAAGCTAGCGAAGCCTACCTGGTTGGTCTCTTCGAAGATACCAACT
TGTGTGCCATTCATGCCAAGCGTATCACCATAATGCCCAAAGACATCCAGTTAGC
GCGACGCATTCGCGGCGAGCGTGCTTAA
The nucleic acid sequence of wild type human histone H3 is set forth below (SEQ ID
NO: 3).
ATGGCCCGAACCAAGCAGACTGCGCGCAAGTCAACGGGTGGCAAGGCGCCGCGC AAGCAGCTGGCCACCAAGGTGGCTCGCAAGAGCGCACCTGCCACTGGCGGCGTG
AAGAAGCCGCACCGCTACCGGCCCGGCACGGTGGCGCTTCGCGAGATCCGCCGC TACCAGAAGTCCACTGAGCTGCTAATCCGCAAGTTGCCCTTCCAGCGGCTGATGC GCGAGATCGCTCAGGACTTTAAGACCGACCTGCGCTTCCAGAGCTCGGCCGTGAT GGCGCTGC
AGGAGGCGTGCGAGTCTTACCTGGTGGGGCTGTTTGAGGACACCAACCTGTGTGT
CATCCATGCCAAACGGGTCACCATCATGCCTAAGGACATCCAGCTGGCACGCCG
TATCCGCGGGGAGCGGGCCTAG
The nucleic acid sequence of human H3T3A mutant is set forth below (SEQ ID NO:
4).
ATGGCCCGAGCCAAGCAGACTGCGCGCAAGTCAACGGGTGGCAAGGCGCCGCGC
AAGCAGCTGGCCACCAAGGTGGCTCGCAAGAGCGCACCTGCCACTGGCGGCGTG
AAGAAGCCGCACCGCTACCGGCCCGGCACGGTGGCGCTTCGCGAGATCCGCCGC
TACCAGAAGTCCACTGAGCTGCTAATCCGCAAGTTGCCCTTCCAGCGGCTGATGC
GCGAGATCGCTCAGGACTTTAAGACCGACCTGCGCTTCCAGAGCTCGGCCGTGAT
GGCGCTGC
AGGAGGCGTGCGAGTCTTACCTGGTGGGGCTGTTTGAGGACACCAACCTGTGTGT
CATCCATGCCAAACGGGTCACCATCATGCCTAAGGACATCCAGCTGGCACGCCG
TATCCGCGGGGAGCGGGCCTAG
The nucleic acid sequence of human H3T3D mutant is set forth below (SEQ ID NO:
14).
ATGGCCCGAGACAAGCAGACTGCGCGCAAGTCAACGGGTGGCAAGGCGCCGCG
CAAGCAGCTGGCCACCAAGGTGGCTCGCAAGAGCGCACCTGCCACTGGCGGCGT
GAAGAAGCCGCACCGCTACCGGCCCGGCACGGTGGCGCTTCGCGAGATCCGCCG
CTACCAGAAGTCCACTGAGCTGCTAATCCGCAAGTTGCCCTTCCAGCGGCTGATG
CGCGAGATCGCTCAGGACTTTAAGACCGACCTGCGCTTCCAGAGCTCGGCCGTG
ATGGCGCTGC
AGGAGGCGTGCGAGTCTTACCTGGTGGGGCTGTTTGAGGACACCAACCTGTGTGT
CATCCATGCCAAACGGGTCACCATCATGCCTAAGGACATCCAGCTGGCACGCCG
TATCCGCGGGGAGCGGGCCTAG
The nucleic acid sequence of wild type Mus Musculus H3 is set forth below (SEQ ID NO: 5).
ATGGCTCGTAC 1 AAGCAGACCGCTCGCAAGTCTACCGGCGGCAAGGCCCCGCGC
AAGCAGCTGGCCACCAAGGCCGCCCGCAAGAGCGCCCCGGCCACCGGCGGCGTG
AAGAAGCCTCACCGCTACCGTCCCGGCACTGTGGCACTGCGCGAGATCCGGCGC
TACCAGAAGTCGACCGAGCTGCTGATCCGCAAGCTGCCGTTCCAGCGCCTGGTGC
GCGAGATCGCGCAGGACTTCAAGACCGACCTGCGCTTCCAGAGCTCGGCCGTCA
TGGCTCT
GCAGGAGGCCTGTGAGGCCTACCTCGTGGGTCTGTTTGAGGACACCAACCTGTGC GCCATCCACGCCAAGCGTGTCACCATCATGCCCAAGGACATCCAGCTGGCCCGTC GCATCCGCGGGGAGAGGGCTTAA
The nucleic acid sequence of Mus Musculus H3T3A mutant is set forth below (SEQ ID NO: 6).
ATGGCTCGTGCTAAGCAGACCGCTCGCAAGTCTACCGGCGGCAAGGCCCCGCGC
AAGCAGCTGGCCACCAAGGCCGCCCGCAAGAGCGCCCCGGCCACCGGCGGCGTG
AAGAAGCCTCACCGCTACCGTCCCGGCACTGTGGCACTGCGCGAGATCCGGCGC
TACCAGAAGTCGACCGAGCTGCTGATCCGCAAGCTGCCGTTCCAGCGCCTGGTGC
GCGAGATCGCGCAGGACTTCAAGACCGACCTGCGCTTCCAGAGCTCGGCCGTCA
TGGCTCT
GCAGGAGGCCTGTGAGGCCTACCTCGTGGGTCTGTTTGAGGACACCAACCTGTGC GCCATCCACGCCAAGCGTGTCACCATCATGCCCAAGGACATCCAGCTGGCCCGTC GCATCCGCGGGGAGAGGGCTTAA
The nucleic acid sequence of Mus Musculus H3T3D mutant is set forth below (SEQ ID NO: 15).
ATGGCTCGTGACAAGCAGACCGCTCGCAAGTCTACCGGCGGCAAGGCCCCGCGC
AAGCAGCTGGCCACCAAGGCCGCCCGCAAGAGCGCCCCGGCCACCGGCGGCGTG
AAGAAGCCTCACCGCTACCGTCCCGGCACTGTGGCACTGCGCGAGATCCGGCGC
TACCAGAAGTCGACCGAGCTGCTGATCCGCAAGCTGCCGTTCCAGCGCCTGGTGC
GCGAGATCGCGCAGGACTTCAAGACCGACCTGCGCTTCCAGAGCTCGGCCGTCA
TGGCTCT
GCAGGAGGCCTGTGAGGCCTACCTCGTGGGTCTGTTTGAGGACACCAACCTGTGC GCCATCCACGCCAAGCGTGTCACCATCATGCCCAAGGACATCCAGCTGGCCCGTC GCATCCGCGGGGAGAGGGCTTAA
The amino acid sequence of wild type Drosophila melanogaster histone H3 is set forth below (SEQ ID NO: 7).
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRY QKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAI HAKRVTIMPKDIQLARRIRGERA
The amino acid sequence of Drosophila melanogaster H3T3A mutant is set forth below (SEQ ID NO: 8).
MARA KQTARKSTGGKAPRKQLATKAARKS APATGGVKKPHRYRPGTVALREIRRY QKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAI HAKRVTIMPKDIQLARRIRGERA
The amino acid sequence of Drosophila melanogaster H3T3D mutant is set forth below (SEQ ID NO: 16).
MARD KQTARKSTGGKAPRKQLATKAARKS APATGGVKKPHRYRPGTVALREIRRY QKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAI HAKRVTIMPKDIQLARRIRGERA
The amino acid sequence of wild type human histone H3 is set forth below (SEQ ID
NO: 9).
MAR Ϊ KQTARKSTGGKAPRKQLATKAARKS APATGGVKKPHRYRPGTVALREIRRY
QKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAI
HAKRVTIMPKDIQLARRIRGERA
The amino acid sequence of human H3T3A mutant is set forth below (SEQ ID
NO: 10).
MAR AKQTARKSTGGKAPRKQLATKAARKS APATGGVKKPHRYRPGTVALREIRRY QKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAI HAKRVTIMPKDIQLARRIRGERA
The amino acid sequence of human H3T3D mutant is set forth below (SEQ ID
NO: 17).
MARDKQTARKSTGGKAPRKQLATKAARKS APATGGVKKPHRYRPGTVALREIRRY QKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAI HAKRVTIMPKDIQLARRIRGERA
The amino acid sequence of wild type Mus Musculus histone H3 is set forth below (SEQ ID NO: 11).
MARTKQTARKSTGGKAPRKQLATKAARKS APATGGVKKPHRYRPGTVALREIRRY
QKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAI
HAKRVTIMPKDIQLARRIRGERA
The amino acid sequence of Mus Musculus H3T3A mutant is set forth below (SEQ ID NO: 12).
MARAKQTARKSTGGKAPRKQLATKAARKS APATGGVKKPHRYRPGTVALREIRRY QKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAI HAKRVTIMPKDIQLARRIRGERA
The amino acid sequence of Mus Musculus H3T3D mutant is set forth below (SEQ ID NO: 18).
MARDKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRY QKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAI HAKRVTIMPKDIQLARRIRGERA
Also provided are kits for arresting cell cycle comprising an agent that reduces phosphorylation H3T3P. Suitable agents that reduce phosphorylation H3T3P comprises an H3T3A mutant protein comprising a substitution of threonine 3 with alanine (H3T3A). In other embodiments, suitable agents that reduce phosphorylation H3T3P comprise an H3T3D mutant protein comprising a substitution of threonine 3 with aspartic acid (H3T3D).
The methods described herein are useful as anti-cancer agents to inhibit tumor growth in a subject. The subject is preferably a mammal in need of such treatment, e.g., a subject that has been diagnosed with cancer or a predisposition thereto. The mammal is any mammal, e.g., a human, a primate, a mouse, a rat, a dog, a cat, a horse, as well as livestock or animals grown for food consumption, e.g., cattle, sheep, pigs, chickens, and goats. In a preferred embodiment, the mammal is a human.
The methods described herein are useful in treating, delaying the progression of, preventing relapse of or alleviating a symptom of a cancer or other neoplastic or preneoplastic condition. For example, the methods described herein are useful in treating hematological malignancies and/or tumors. The methods described herein are also useful in treating non-Hodgkin's lymphoma (NHL), acute lymphocytic leukemia (ALL), acute myeloid leukemia (AML), chronic lymphocytic leukemia (CLL), chronic myelogenous leukemia (CML), multiple myeloma (MM), breast cancer, ovarian cancer, head and neck cancer, bladder cancer, melanoma, colorectal cancer, pancreatic cancer, lung cancer, leiomyoma, leiomyosarcoma, glioma, glioblastoma, and so on. Solid tumors include, e.g. , breast tumors, ovarian tumors, lung tumors, pancreatic tumors, prostate tumors, melanoma tumors, colorectal tumors, lung tumors, head and neck tumors, bladder tumors, esophageal tumors, liver tumors, and kidney tumors.
In some cases, the methods described herein are used in conjunction with one or more agents or a combination of additional agents, e.g., an anti-cancer agent. Suitable agents include current pharmaceutical and/or surgical therapies for an intended application, such as,
for example, cancer. For example, the methods described herein can be used in conjunction with one or more chemotherapeutic or anti-neoplastic agents. In some cases, the additional chemotherapeutic agent is radiotherapy. In some cases, the chemotherapeutic agent is a cell death-inducing agent.
The term "antineoplastic agent" is used herein to refer to agents that have the functional property of inhibiting a development or progression of a neoplasm in a human, particularly a malignant (cancerous) lesion, such as a carcinoma, sarcoma, lymphoma, or leukemia. Inhibition of metastasis is frequently a property of antineoplastic agents.
In some cases, a composition of the invention is administered orally or systemically. Other modes of administration include rectal, topical, intraocular, buccal, intravaginal, intracisternal, intracerebroventricular, intratracheal, nasal, transdermal, within/on implants, or parenteral routes. The term "parenteral" includes subcutaneous, intrathecal, intravenous, intramuscular, intraperitoneal, or infusion. Intravenous or intramuscular routes are not particularly suitable for long-term therapy and prophylaxis. They could, however, be preferred in emergency situations. Compositions comprising a composition of the invention can be added to a physiological fluid, such as blood. Oral administration can be preferred for prophylactic treatment because of the convenience to the patient as well as the dosing schedule. Parenteral modalities (subcutaneous or intravenous) may be preferable for more acute illness, or for therapy in patients that are unable to tolerate enteral administration due to gastrointestinal intolerance, ileus, or other concomitants of critical illness. Inhaled therapy may be most appropriate for pulmonary vascular diseases (e.g., pulmonary hypertension).
Pharmaceutical compositions may be assembled into kits or pharmaceutical systems for use in arresting cell cycle in rapidly dividing cells, e.g., cancer cells. Kits or
pharmaceutical systems according to this aspect of the invention comprise a carrier means, such as a box, carton, tube, having in close confinement therein one or more container means, such as vials, tubes, ampoules, bottles, syringes, or bags. The kits or pharmaceutical systems of the invention may also comprise associated instructions for using the kit.
By "analog" is meant a molecule that is not identical, but has analogous functional or structural features. For example, a polypeptide analog retains the biological activity of a corresponding naturally-occurring polypeptide, while having certain biochemical
modifications that enhance the analog's function relative to a naturally occurring polypeptide. Such biochemical modifications could increase the analog's protease resistance, membrane
permeability, or half-life, without altering, for example, ligand binding. An analog may include an unnatural amino acid.
By "binding to" a molecule is meant having a physicochemical affinity for that molecule.
"Detect" refers to identifying the presence, absence or amount of the analyte to be detected.
By "disease" is meant any condition or disorder that damages or interferes with the normal function of a cell, tissue, or organ. Examples of diseases include those associated with endothelial dysfunction.
By the terms "effective amount" and "therapeutically effective amount" of a formulation or formulation component is meant a sufficient amount of the formulation or component, alone or in a combination, to provide the desired effect. For example, by "an effective amount" is meant an amount of a compound, alone or in a combination, required to ameliorate the symptoms of a disease relative to an untreated patient. The effective amount of active compound(s) used to practice the present invention for therapeutic treatment of a disease varies depending upon the manner of administration, the age, body weight, and general health of the subject. Ultimately, the attending physician or veterinarian will decide the appropriate amount and dosage regimen. Such amount is referred to as an "effective" amount.
By "fragment" is meant a portion of a polypeptide or nucleic acid molecule. This portion contains, preferably, at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90% of the entire length of the reference nucleic acid molecule or polypeptide. For example, a fragment may contain 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100, 200, 300, 400, 500, 600, 700, 800, 900, or 1000 nucleotides or amino acids. However, the invention also comprises polypeptides and nucleic acid fragments, so long as they exhibit the desired biological activity of the full length polypeptides and nucleic acid, respectively. A nucleic acid fragment of almost any length is employed. For example, illustrative polynucleotide segments with total lengths of about 10,000, about 5000, about 3000, about 2,000, about 1,000, about 500, about 200, about 100, about 50 base pairs in length (including all intermediate lengths) are included in many implementations of this invention. Similarly, a polypeptide fragment of almost any length is employed. For example, illustrative polypeptide segments with total lengths of about 10,000, about 5,000, about 3,000, about 2,000, about 1,000, about 5,000, about 1,000, about 500, about 200, about 100, or about 50 amino acids in
length (including all intermediate lengths) are included in many implementations of this invention.
The terms "isolated," "purified," or "biologically pure" refer to material that is free to varying degrees from components which normally accompany it as found in its native state. "Isolate" denotes a degree of separation from original source or surroundings. "Purify" denotes a degree of separation that is higher than isolation.
A "purified" or "biologically pure" protein is sufficiently free of other materials such that any impurities do not materially affect the biological properties of the protein or cause other adverse consequences. That is, a nucleic acid or peptide of this invention is purified if it is substantially free of cellular material, viral material, or culture medium when produced by recombinant DNA techniques, or chemical precursors or other chemicals when chemically synthesized. Purity and homogeneity are typically determined using analytical chemistry techniques, for example, polyacrylamide gel electrophoresis or high performance liquid chromatography. The term "purified" can denote that a nucleic acid or protein gives rise to essentially one band in an electrophoretic gel. For a protein that can be subjected to modifications, for example, phosphorylation or glycosylation, different modifications may give rise to different isolated proteins, which can be separately purified.
Similarly, by "substantially pure" is meant a nucleotide or polypeptide that has been separated from the components that naturally accompany it. Typically, the nucleotides and polypeptides are substantially pure when they are at least 60%, 70%, 80%, 90%, 95%, or even 99%, by weight, free from the proteins and naturally-occurring organic molecules with they are naturally associated.
By "isolated nucleic acid" is meant a nucleic acid that is free of the genes which flank it in the naturally-occurring genome of the organism from which the nucleic acid is derived. The term covers, for example: (a) a DNA which is part of a naturally occurring genomic DNA molecule, but is not flanked by both of the nucleic acid sequences that flank that part of the molecule in the genome of the organism in which it naturally occurs; (b) a nucleic acid incorporated into a vector or into the genomic DNA of a prokaryote or eukaryote in a manner, such that the resulting molecule is not identical to any naturally occurring vector or genomic DNA; (c) a separate molecule such as a synthetic cDNA, a genomic fragment, a fragment produced by polymerase chain reaction (PCR), or a restriction fragment; and (d) a recombinant nucleotide sequence that is part of a hybrid gene, i.e., a gene encoding a fusion protein. Isolated nucleic acid molecules according to the present invention further include
molecules produced synthetically, as well as any nucleic acids that have been altered chemically and/or that have modified backbones. For example, the isolated nucleic acid is a purified cDNA or RNA polynucleotide. Isolated nucleic acid molecules also include messenger ribonucleic acid (mRNA) molecules.
By an "isolated polypeptide" is meant a polypeptide of the invention that has been separated from components that naturally accompany it. Typically, the polypeptide is isolated when it is at least 60%, by weight, free from the proteins and naturally-occurring organic molecules with which it is naturally associated. Preferably, the preparation is at least 75%, more preferably at least 90%, and most preferably at least 99%, by weight, a polypeptide of the invention. An isolated polypeptide of the invention may be obtained, for example, by extraction from a natural source, by expression of a recombinant nucleic acid encoding such a polypeptide; or by chemically synthesizing the protein. Purity can be measured by any appropriate method, for example, column chromatography, polyacrylamide gel electrophoresis, or by HPLC analysis.
By "reduces" is meant a negative alteration of at least 5%, 10%, 25%, 50%, 75%, or
100%.
By "specifically binds" is meant a compound or antibody that recognizes and binds a polypeptide of the invention, but which does not substantially recognize and bind other molecules in a sample, for example, a biological sample, which naturally includes a polypeptide of the invention.
Nucleic acid molecules useful in the methods of the invention include any nucleic acid molecule that encodes a polypeptide of the invention or a fragment thereof. Such nucleic acid molecules need not be 100% identical with an endogenous nucleic acid sequence, but will typically exhibit substantial identity. Polynucleotides having "substantial identity" to an endogenous sequence are typically capable of hybridizing with at least one strand of a double- stranded nucleic acid molecule. Nucleic acid molecules useful in the methods of the invention include any nucleic acid molecule that encodes a polypeptide of the invention or a fragment thereof. Such nucleic acid molecules need not be 100% identical with an endogenous nucleic acid sequence, but will typically exhibit substantial identity. Polynucleotides having "substantial identity" to an endogenous sequence are typically capable of hybridizing with at least one strand of a double-stranded nucleic acid molecule. By "hybridize" is meant pair to form a double-stranded molecule between complementary polynucleotide sequences (e.g., a gene described herein), or portions thereof, under various
conditions of stringency. (See, e.g., Wahl, G. M. and S. L. Berger (1987) Methods Enzymol. 152:399; Kimmel, A. R. (1987) Methods Enzymol. 152:507).
For example, stringent salt concentration will ordinarily be less than about 750 mM NaCl and 75 mM trisodium citrate, preferably less than about 500 mM NaCl and 50 mM trisodium citrate, and more preferably less than about 250 mM NaCl and 25 mM trisodium citrate. Low stringency hybridization can be obtained in the absence of organic solvent, e.g., formamide, while high stringency hybridization can be obtained in the presence of at least about 35% formamide, and more preferably at least about 50% formamide. Stringent temperature conditions will ordinarily include temperatures of at least about 30° C, more preferably of at least about 37° C, and most preferably of at least about 42° C. Varying additional parameters, such as hybridization time, the concentration of detergent, e.g., sodium dodecyl sulfate (SDS), and the inclusion or exclusion of carrier DNA, are well known to those skilled in the art. Various levels of stringency are accomplished by combining these various conditions as needed. In a preferred: embodiment, hybridization will occur at 30° C in 750 mM NaCl, 75 mM trisodium citrate, and 1% SDS. In a more preferred embodiment, hybridization will occur at 37° C in 500 mM NaCl, 50 mM trisodium citrate, 1% SDS, 35% formamide, and 100 .mu.g/ml denatured salmon sperm DNA (ssDNA). In a most preferred embodiment, hybridization will occur at 42° C in 250 mM NaCl, 25 mM trisodium citrate, 1% SDS, 50% formamide, and 200 μg/ml ssDNA. Useful variations on these conditions will be readily apparent to those skilled in the art.
For most applications, washing steps that follow hybridization will also vary in stringency. Wash stringency conditions can be defined by salt concentration and by temperature. As above, wash stringency can be increased by decreasing salt concentration or by increasing temperature. For example, stringent salt concentration for the wash steps will preferably be less than about 30 mM NaCl and 3 mM trisodium citrate, and most preferably less than about 15 mM NaCl and 1.5 mM trisodium citrate. Stringent temperature conditions for the wash steps will ordinarily include a temperature of at least about 25° C, more preferably of at least about 42° C, and even more preferably of at least about 68° C. In a preferred embodiment, wash steps will occur at 25° C in 30 mM NaCl, 3 mM trisodium citrate, and 0.1% SDS. In a more preferred embodiment, wash steps will occur at 42 C in 15 mM NaCl, 1.5 mM trisodium citrate, and 0.1% SDS. In a more preferred embodiment, wash steps will occur at 68° C in 15 mM NaCl, 1.5 mM trisodium citrate, and 0.1% SDS.
Additional variations on these conditions will be readily apparent to those skilled in the art.
Hybridization techniques are well known to those skilled in the art and are described, for example, in Benton and Davis (Science 196:180, 1977); Grunstein and Hogness (Proc. Natl. Acad. Sci., USA 72:3961, 1975); Ausubel et al. (Current Protocols in Molecular Biology, Wiley Interscience, New York, 2001); Berger and Kimmel (Guide to Molecular Cloning Techniques, 1987, Academic Press, New York); and Sambrook et al., Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, New York.
By "substantially identical" is meant a polypeptide or nucleic acid molecule exhibiting at least 50% identity to a reference amino acid sequence (for example, any one of the amino acid sequences described herein) or nucleic acid sequence (for example, any one of the nucleic acid sequences described herein). Preferably, such a sequence is at least 60%, more preferably 80% or 85%, and more preferably 90%, 95% or even 99% identical at the amino acid level or nucleic acid to the sequence used for comparison.
Sequence identity is typically measured using sequence analysis software (for example, Sequence Analysis Software Package of the Genetics Computer Group, University of Wisconsin Biotechnology Center, 1710 University Avenue, Madison, Wis. 53705, BLAST, BESTFIT, GAP, or PILEUP/PRETTYBOX programs). Such software matches identical or similar sequences by assigning degrees of homology to various substitutions, deletions, and/or other modifications. Conservative substitutions typically include substitutions within the following groups: glycine, alanine; valine, isoleucine, leucine;
aspartic acid, glutamic acid, asparagine, glutamine; serine, threonine; lysine, arginine; and phenylalanine, tyrosine. In an exemplary approach to determining the degree of identity, a BLAST program may be used, with a probability score between e"3 and e"100 indicating a closely related sequence.
Ranges provided herein are understood to be shorthand for all of the values within the range. For example, a range of 1 to 50 is understood to include any number, combination of numbers, or sub-range from the group consisting 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50.
The terms "treating" and "treatment" as used herein refer to the administration of an agent or formulation to a clinically symptomatic individual afflicted with an adverse condition, disorder, or disease, so as to effect a reduction in severity and/or frequency of symptoms, eliminate the symptoms and/or their underlying cause, and/or facilitate improvement or remediation of damage. It will be appreciated that, although not precluded,
treating a disorder or condition does not require that the disorder, condition or symptoms associated therewith be completely eliminated.
The terms "preventing" and "prevention" refer to the administration of an agent or composition to a clinically asymptomatic individual who is susceptible or predisposed to a particular adverse condition, disorder, or disease, and thus relates to the prevention of the occurrence of symptoms and/or their underlying cause.
Unless specifically stated or obvious from context, as used herein, the term "or" is understood to be inclusive. Unless specifically stated or obvious from context, as used herein, the terms "a", "an", and "the" are understood to be singular or plural.
Unless specifically stated or obvious from context, as used herein, the term "about" is understood as within a range of normal tolerance in the art, for example within 2 standard deviations of the mean. About can be understood as within 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, 0.5%, 0.1%, 0.05%, or 0.01% of the stated value. Unless otherwise clear from context, all numerical values provided herein are modified by the term about.
Any compositions or methods provided herein can be combined with one or more of any of the other compositions and methods provided herein.
The transitional term "comprising," which is synonymous with "including,"
"containing," or "characterized by," is inclusive or open-ended and does not exclude additional, unrecited elements or method steps. By contrast, the transitional phrase
"consisting of excludes any element, step, or ingredient not specified in the claim. The transitional phrase "consisting essentially of limits the scope of a claim to the specified materials or steps "and those that do not materially affect the basic and novel
characteristic(s)" of the claimed invention.
Other features and advantages of the invention will be apparent from the following description of the preferred embodiments thereof, and from the claims. Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Although methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention, suitable methods and materials are described below. All published foreign patents and patent applications cited herein are incorporated herein by reference. Genbank and NCBI submissions indicated by accession number cited herein are incorporated herein by reference. All other published references, documents, manuscripts and scientific literature cited herein are incorporated herein by reference. In the
case of conflict, the present specification, including definitions, will control. In addition, the materials, methods, and examples are illustrative only and not intended to be limiting.
BRIEF DESCRIPTION OF THE DRAWINGS
Figure 1A-Figure 1R is a series of photomicrographs showing that phosphorylation at threonine 3 of histone 3 (H3T3P) distinguishes preexisting H3-green fluorescent protein (GFP) (green) from newly synthesized H3- mKusabira Orange (mKO; red) in Drosophila male germline stem cells (GSCs). Also shown are a GSC (Figure 1A-Figure 1C) and a gonialblast (GB) (Figure ID-Figure IF) at prophase. Also shown are immunostaining H3T3P signals in a GSC (Figure lG-Figure 1L) and a GB (Figure 1M-Figure 1R) at prometaphase. Asterisk: hub. Scale bars: 5 μιη.
Figure 2A-Figure 2H is a series of photomicrographs showing that expression of an H3T3A transgene greatly reduces H3T3P in mitotic germ cells. Specifically, these panels show immunostaining using anti-H3T3P and anti-H3S10P: outlined are mitotic germ cells expressing either nos>H3T3A-GFP (Figure 2A-Figure 2D) or nos>H3-GFP (Figure 2E- Figure 2H). Scale bars: 10 μιη.
Figure 3A-Figure 3J is a series of photomicrographs showing that expression of H3T3A randomizes H3 inheritance pattern. Specifially, the panels show immunostaining signals using anti-FasIII and anti-a-Spectrin at the tip of nos>H3 (Figure 3A- Figure 3C) or nos>H3T3A (Figure 3D- Figure 31) testes. Scale bars: 5 μιη. Figure 3 J shows quantification of the ratio of GFP (X-axis: log2 scale) and mKO (Y-axis: log2 scale) fluorescence intensity in GSC-GB pairs: nos>H3 (opened circle, N=55) and nos>H3T3A (solid triangle, N=38), based on Table 1. Red dotted outline delineates symmetric distribution [the 1.5-fold cutoff line is based on the quantification range of symmetric H3 distribution in spermatogonial cells and H3.3 distribution in GSC-GB pairs (Tran et al., 2012, Science 338: 679; Tran et al., 2013 Chromosome Res, 21: 255). H3 (N=55): GSC/GB GFP ratio= 10.11± 1.66 (P <10"4 for the ratio 1), GB/GSC mKO ratio= 1.61± 0.19 (P =0.001 for the ratio 1). H3T3A (N=38): GSC/GB GFP ratio= 1.11+ 0.23 (P = 0.65 therefore is insignificantly different from 1), GB/GSC mKO ratio= 1.31+ 0.10 (P =0.001 for the ratio 1). Noticeably, the mKO ratio in GB/GSC in nos>H3T3A testes is significantly greater than 1: 1 ratio. Previous data showed that a post-mitotic histone turn-over mechanism acts in the GB (Tran et al., 2012 Science 338, 679), which may be responsible for this significant enrichment of mKO signal in GB cells. All ratios= Avg+ SE; -value: one-sample t test.
Figure 4A-Figure 4L is a series of photomicrographs showing expression of H3T3 A and H3T3D causes similar defects. Shown are immunostaining signals using anti-FasIII and anti-α-Spectrin at the tip of nos>H3 (Figure 4A-Figure 4D), nos>H3T3A (Figure 4E-Figure 4H), or nos>H3T3D (Figure 4I-Figure 4L) testes. Scale bars: 20 μιη.
Figure 5A-Figure 5B is a cartoon showing Drosophila testis tip and a model for asymmetric H3 inheritance during GSC asymmetric division. Specifically, Figure 5A is a cartoon showing the asymmetric H3 inheritance during male GSC asymmetric cell division. Figure 5B is a schematic diagram of a two-step model to explain how asymmetric epigenome is established during S phase (Step one) and recognized followed by asymmetric segregation in M phase (Step two) GSC, adapted from (Tran et al., 2013 Chromosome Res 21, 255).
Figure 6A-Figure 6N is a series of photomicrographs showing that H3-GFP and H3- mKO signals are separable in prophase GSC, but not in the GB control. Shown is immunostaining using anti-H3T3P: a prophase GSC (Figure 6A- Figure 6G) and a prophase GB (Figure 6H-Figure 6N): both were undergoing mitosis 18 hours after heat shock- induced genetic switch from H3-GFP-encoding to H3-mKO-encoding sequences. Asterisk: hub. Scale bars: 5 μιη.
Figure 7A-Figure 7X is a series of photomicrographs showing spatial and temporal specificity of the Η3Τ3Ρ signal. Figure 7A-Figure 7L show co-immunostaining using antibodies against Η3Τ3Ρ and a centromere- specific marker CID in germ cells from y,w control (Figure 7A-Figure 7D) and nos>H3-GFP (E-L) males. Figure 7M-Figure 7X show co-immunostaining using antibodies against Η3Τ3Ρ and H3S10P in a prophase GB (Figure 7M-Figure 7P), a metaphase GSC (Figure 7Q-Figure 7T), and an anaphase GSC (Figure 7U- Figure 7X) from nos>H3-GFP males. Asterisk: hub. Scale bars: 5 μιη.
Figure 8A-Figure 8E is a series of photomicrographs and immunoblots showing abundant endogenous histone proteins in nos>upd; H3T3A-GFP testes. Figure 8A-Figure 8D show immunostaining using anti-Vasa in a nos>upd; H3T3A-GFP testis (outlined).
Overexpression of the JAK-STAT pathway ligand Upd leads to overpopulation of early stage germ cells (Kigeret al., 2001 Science 294, 2542; Tulina et al., 2001 Science 294, 2546) labeled with GFP (Figure 8B) and Vasa (Figure 8C). Scale bar: 100 μιη. Figure 8E is a series of immunoblots using antibodies against GFP, H3, and H4, respectively, as well as Ponceau S staining to show load of total crude extract in each lane of SDS gel. All blots are duplicates using the same samples with the same amount, nos>upd testes were used as a negative control for the H3-GFP and H3T3A-GFP transgenes.
Figure 9A-Figure 9B is a series of schematics showing the predicted pattern when sister chromatids enriched with either preexisting H3-GFP (old, green) or H3-mKO (new, red) are segregated randomly during GSC division. Figure 9A is a schematic diagram showing the dual color-switch design that expresses preexisting H3T3A (or D)-GFP and newly synthesized H3T3A (or D)-mKO by heat shock treatment, as adapted from (Tran et al., 2012, Science 338: 679). Figure 9B is a schematic showing Drosophila male has two sex chromosomes: X and Y chromosomes; as well as three autosomes: the second (II), the third (III), and the fourth chromosomes. But because the fourth chromosomes are very small, the prediction is focused on X, Y, II and III chromosomes. With each sex chromosome having two and each autosome having four potential segregation patterns, the total would be 64 different combinations. Among all 64, only four when the two autosomes "agree" to partition the H3-GFP-enriched chromatids to GSC show wild-type H3 asymmetric pattern (pattern 1- 4); whereas the other four when the two autosomes "agree" to partition the H3-mKO- enriched chromatids to GSC show the opposite asymmetric pattern (pattern 5-8).
Figure 10A-Figure 10P is a series of photomicrographs showing the effects of temperature shift on the dominant negative activity of the H3T3A transgene. Figure 10A- Figure 10H show immunostaining using anti-H3T3P and anti-H3S10P in testes from hs-FLP; nos-GaU; UAS-FRT-H3-GFP-PolyA-FRT-H3-mKO males. Flies were raised at 18°C without heat shock (Figure 10A-Figure 10D) and heat shocked at 37°C for two hours followed by 48 hour recovery at 29°C (Figure 10E-Figure 10H). Before heat shock treatment, H3-GFP was expressed at a low, but detectable level (Figure 10A) because nos- Gal4 has relatively low activity at 18°C (Tran et al., 2012, Science 338: 679; Eliazer et al., 2011 Proc Natl Acad Sci USA, 108, 7064), while no H3-mKO signal was detectable (Figure
10B). After heat shock and recovery, H3-GFP was negligible (Figure 10E), but H3-mKO was robustly turned on (Figure 10F). No effect on either H3T3P (Figure IOC, Figure 10G) or H3S10P (Figure 10D, Figure 10H) signals could be detected. Figure 101-Figure 10P show immunostaining using anti-H3T3P and anti-H3S10P in testes from hs-FLP; nos-Gal4; UAS- FRT-H3T3A-GFP-PolyA-FRT-H3T3A-mKO males. Flies were raised at 18°C without heat shock (Figure 101-Figure 10L, inset in Figure 101 and Figure 10J are shown with higher magnification in Figure 10K and Figure 10L) and heat shocked at 37°C for two hours followed by 48-hour recovery at 29°C (Figure 10M-Figure 10P, inset in Figure 10M and Figure ION are shown with higher magnification in Figure 10O and Figure 10P). Before heat shock treatment, H3T3A-GFP was expressed at a low, but detectable level (Figure 101), while no H3T3A-mKO signal was detectable (Figure 10J). After heat shock and recovery, H3T3A- GFP was negligible (Figure 10M), but H3T3A-mKO was robustly turned on (Figure ION). The H3T3P signal was reduced in males that are heat shocked and recovered (Figure 10O) compared to those raised at 18°C constantly (Figure 10K), most likely due to higher H3T3A expression by the nos-Gal4 driver at 29°C (Eun et al., 2014 Science, 343, 1513). By contrast, the temperature change had little effect on the H3S10P (Figure 10L, Figure 10P) signals. Scale bars: 10 μιη.
Figure 11A- Figure 110 is a series of photomicrographs showing that expression of the H3T3A transgene leads to gradual progression of germline tumor and decreased male fertility. Figure 11A-Figure 110 shows immunostaining using anti-FasIII, α-Spectrin and Vasa antibodies in testes from 15-day old nos>H3-GFP males (Figure l lA-Figure HE), 1- day (Figure 11F-Figure 11J) and 15-day (Figure 11K-Figure 110) nos>H3T3A-GFP males. Early germ cells judged by nuclear morphology (Tran et al., 2000 Nature 407, 754; Chen et al., 2013 Cell Stem Cell 13, 73) are delineated by the yellow dotted lines in (Figure HE, Figure 11 J), but is throughout the sample in (Figure 110). Figure IIP shows the results of a fertility test using nos>H3-GFP (red dots) and nos>H3T3A-GFP (blue dots) males. Flies were raised at 18 °C until eclosion and crossed with y,w virgin females. All crosses were shifted to 29 °C and progenies were counted after the indicated time, for both
immunostaining experiments and fertility tests. For Day 11-15 and Day 16-20 groups: P< 10- 7 based on two-tailed t-test. Asterisk: hub. Scale bars: 20 μιη.
Figure 12A-Figure 12H is a series of photomicrographs showing the heterogeneous germline tumor in nos> H3T3A-GFP testes. Figure 12A-Figure 12H show immunostaining using anti-FasIII and α-Spectrin antibodies in testes from nos>H3T3A-GFP males. A
testicular tumor developed (insets in Figure 12 A and Figure 12B are shown at higher magnification in Figure 12C and Figure 12D) with over-proliferated very early stage germ cells with GFP expression (Figure 12C) and spectrosome structure (Figure 12D, arrowhead). A testicular tumor developed (insets in Figure 12E and Figure 12F are shown at higher magnification in Figure 12G and Figure 12H) with over-proliferated spermatogonial cells without GFP expression (Figure 12G) and fusome structure (Figure 12H, arrow). Asterisk: hub. Scale bars: 20 μιη.
Figure 13A-Figure 13E is a series of matrices, a dot plot and a venn diagram. Figure 13A is a Spearman correlation coefficient matrix between pairs of transcription level profiles of wild-type, nos>upd, nos>H3T3A and bam mutant testes plotted in a heatmap. The color bar indicates the high (red) to low (blue) correlation. The distance is defined as 1- Spearman correlation coefficient (see Materials and Methods). Figure 13B is a dimension reduction representation of the pairwise distance matrix of wild-type (blue dot), nos>upd (green dots), nos>H3T3A (red dots) and bam mutant (yellow dot) testis samples. Figure 13C is a Venn diagram of actively expressed genes in four genotypes. Individual samples were combined for each genotype. Figure 13D is a heatmap of the representative wild-type-specific genes. Figure 13E is a heatmap of the representative nos>H3T3A-specific genes. Genes involved in DNA repair pathway (q value= 1.4x1ο-4) and RNA PolII-dependent transcription initiation (q value= 0.167) are enriched in nos>H3T3A testis samples. Z score shown in heatmap index.
Figure 14A-Figure 14V is a series of photomicrographs, a dolt plot, and a bar chart showing that the expression of H3T3 A or H3T3D using the nos-Gal4 driver leads to similar phenotypes in testis. Shown is immunostaining using antibodies against FasIII, α-Spectrin, Zfh-1, and Vasa in testes from nos>H3-GFP (Figure 14A- Figure 14D), nos>H3T3A-GFP (Figure 14E- Figure 14H, Figure 14N- Figure 14Q), and nos>H3T3D-GFP (Figure 141- Figure 14L, Figure 14R- Figure 14U) males. Germline tumors develop (Figure 14E, Figure 141, Figure 14R- Figure 14U), Vasa+ germ cells are not maintained properly (Figure 14N, Figure 14P, Figure 14R, Figure 14T), hub size increases (Figure 14E and Figure 141, insets in Figure 14E and Figure 141 are shown at higher magnification in Figure 14F- Figure 14H and Figure 14J- Figure 14L, respectively) and FasIII+ hub cells co-express Zfh-1 (Figure 14G, Figure 14K) in testes from nos>H3T3A-GFP or nos>H3T3D-GFP males, but not in testes from nos>H3-GFP males. Scale bars: 20 μιη. Figure 14M shows the quantification of hub size: 108+2.393 μιη2 in nos>H3-GFP (N=50) testes vs. 198.5+15.22 μιη2 in nos>H3T3A- GFP testes (N=37) (***P <0.0001) or 145.2 + 9.702 μιη2 in nos>H3T3D-GFP testes (N=37)
(***P < 0.0001). P-value calculated by unpaired t test. Figure 14V shows the quantification of the percentage of testes with germline tumor and Vasa+ germ cell loss in testes expressing nos>H3-GFP (n=19), nos>H3T3A-GFP (n=42), and nos>H3T3D-GFP (n=43).
Figure 15A-Figure 15Q is a schematic and a series of photomicrographs showing that the expression of H3T3A or H3T3D using the bam-Gal4 driver did not lead to phenotypes like those driven by the nos-Gal4 driver. Figure 15A is a cartoon showing stage-specificity of nos-Gal4 and bam-Gal4 drivers: nos-Gal4 is turned on in early-stage germline, including GSCs, while bam-Gal4 expresses from 4-cell spermatogonial cells. Figure 15B-Figure 151 show expression of the H3T3A transgene using a later stage germline driver bam-Gal4 greatly reduces H3T3P in later stage mitotic spermatogonial cells, by anti-FasIII, H3T3P, H3S10P and Vasa immunostaining in testes from bam>H3T3A-GFP males. A two-cell stage mitotic spermatogonia cyst without H3T3A-GFP expression (Figure 15B) had detectable H3T3P (Figure 15C) and H3S10P (Figure 15D), both H3T3P and H3S10P overlapped with DNA signal stained with Hoechst (Figure 15E). By contrast, a four-cell stage mitotic spermatogonia with H3T3A-GFP expression (Figure 15F) had undetectable H3T3P (Figure 15G), but abundant H3S10P (Figure 15H), the H3S10P signal overlapped with DNA signal stained with Hoechst (Figure 151). The diffusive signal in (Figure 15C) and (Figure 15G) came from anti-Vasa, which stained the entire cell undergoing mitosis (Yadlapalli et al., 2011 J Cell Sci 124, 933; Yuan et al., 2012 Dev Biol 361, 57). Scale bars: 10 μιη. Figure 15J- Figure 15Q show immunostaining using anti-FasIII and α-Spectrin: tip of the testis expressing either bam>H3T3A-GFP (Figure 15J-Figure 15M) or bam>H3T3D-GFP (Figure 15N- Figure 15Q). Scale bars: 20 μιη. Asterisk: hub.
Figure 16 A- Figure 161 is a series of photomicrographs and a dot plot showing that the expression of H3T3D randomizes preexisting vs. newly synthesized H3 inheritance during GSC asymmetric division. Figure 16A-Figure 16H show immunostaining using anti-FasIII, α-Spectrin and Vasa antibodies in testes expressing the dual-color H3T3D (Figure 9A-Figure 9B): representative GSC-GB pair expressing H3T3D-GFP and H3T3D-mKO in a symmetric manner (Figure 16B- Figure 16C) or opposite asymmetric manner (Figure 16F- Figure 16G). Asterisk: hub. Scale bars: 5 μιη. Figure 161 shows quantification of the ratio of GFP (X- axis: log2 scale) and mKO (Y-axis: log2 scale) fluorescence intensity in GSC-GB pairs expressing H3T3D (opened square, N=31), most of which are in zone III and IV, based on Table 1. H3T3D (N=31): GSC/GB GFP ratio= 0.83± 0.05 (P = 0.001 for the ratio< 1), GB/GSC mKO ratio= 1.08+ 0.04 (P =0.03 for the ratio 1). Noticeably, the mKO ratio in
GB/GSC in H3T3D-expressing testes is significantly greater than 1: 1 ratio. Previous data showed that a post-mitotic histone turn-over mechanism acts in the GB cell (Tran et al., 2012 Science 338, 679), which may be responsible for this significant enrichment of mKO signal in the GB cell in H3T3D-expressing testes. All ratios= Avg+ SE; P-value: one-sample t test.
Figure 17A-Figure 17M is a series of photomicrographs and a bar chart showing that the knockdown of the H3T3P kinase Haspin in early stage germ cells leads to increased cell death. Figure 17A- Figure 17D show immunostaining using anti-Fas III, H3T3P, H3S10P and Vasa antibodies in testes from nos>haspin shRNA males. A mitotic GSC (arrow, Figure 17B- Figure 17D) had diffusive Vasa (Figure 17B) (Yadlapalli et al., 2011 J Cell Sci 124, 933; Yuan et al., 2012 Dev Biol 361, 57), overlapping H3S10P (Figure 17C) and Hoechst (Figure 17D) staining signals, but undetectable H3T3P (Figure 17B). A mitotic CySC (arrowhead, Figure 17B- Figure 17D) with normal Haspin level has detectable H3T3P (Figure 17B) and H3S10P (Figure 17C), both signals overlap with Hoechst (Figure 17D) staining signal. Figure 17E-Figure 17L show lysotrack staining and immunostaining using anti-Vasa in testes from nos-Gal4 control males (Figure 17E- Figure 17H) and nos>haspin shRNA males (Figure 171- Figure 17L). More germ cells are positive with lysotrack staining (yellow arrow) in testes from nos>haspin shRNA males (Figure 17J- Figure 17K) compared to the nos-Gal4 control males (Figure 17F- Figure 17G). Asterisk: hub. Scale bars: ΙΟμιη. Figure 17M shows the quantification of lysotrack-positive germline cysts in nos-Gal4 control testes (n=20) and nos>haspin shRNA testes (n=20). **: P< 0.001. P-value calculated by unpaired t test.
Figure 18 A- Figure 18W is a series of photomicrographs, bar charts, and a dot plot showing that mutations in the haspin gene enhance nos>H3T3A, but suppress nos>H3T3D germline phenotype. Figure 18A-Figure 18L show immunostaining using anti-FasIII, α- Spectrin and Vasa antibodies in testes from nos>H3T3A (Figure 18A- Figure 18D), Df (haspin)/+;nos>H3T3A (Figure 18E- Figure 18H) or haspinmi09386/+ ;nos>H3T3A (Figure 181- Figure 18L) males at constant 18 °C. Larval testes were used for analysis because at this developmental stage and at 18 °C, H3T3P is retained (Figure 10K) and cellular defects in nos>H3T3A were minimal (Figure 1 IF- Figure 11J). Therefore, it was used as a permissive condition to test genetic enhancement. The germline tumor is detected in testes from Df (haspin)/+;nos>H3T3A (Figure 18H) or haspinmi09386/+ ;nos>H3T3A (Figure 18L) males, but not in testes from nos>H3T3A (Figure 18D) by itself. Figure 18M shows the percentage of testes that are normal or have germline tumor(s) from males of the following genotypes:
nos>H3T3A (n=18); Df(haspin)/+;nos>H3T3A (n=16); and haspinmi09386/+ ;nos>H3T3A (n=19). Figure 18N-Figure 18U show immunostaining using anti-FasIII, a-Spectrin and Vasa antibodies in testes from nos>H3T3D (Figure 18N-Figure 18Q) or Df(haspin)/+;
nos>H3T3D (Figure 18R- Figure 18U) males (siblings from the same crosses) grown at 18°C, shifted to 29°C as newly eclosed flies and kept at 29°C for seven days. Germline tumors were detected in testes from nos>H3T3D males (Figure 180, Figure 18Q), but not in testes from Df(haspin)/+;nos>H3T3D males (Figure 18S, Figure 18U). Early germ cells, as determined by nuclear morphology (Tran et al., 2000 Nature 407, 754; Chen et al., 2013Cell Stem Cell 13, 73), are delineated by the yellow dotted lines in (Figure 18D, Figure 18H, Figure 18L, Figure 18Q, Figure 18U). Figure 18V shows the percentage of testes that have germline tumor(s) or germ cell loss from males with the following genotypes: nos>H3T3D (n=17) and Df(haspin)/+; nos>H3T3D (n=12). Figure 18W shows the quantification of hub size: 172.2 + 14.72 μιη2 in nos>H3T3D (n=17) testes vs. 115.0 + 9.802 μιη2 in Df(haspin)/+; nos>H3T3D (n=12) testes (*P < 0.005, calculated by unpaired t test). Scale bars: 20 μιη.
Figure 19 is a diagram demonstrating prophase of Drosophila GSC. A transient mitosis-specific phosphate modification on histone H3 distinguishes pre-existing and newly synthesized histones and is required for the asymmetric segregation of sister chromatids— one enriched with new histones and the other with old histones— during stem cell division.
Figure 20U- Figure 20Z is a series of photographs demonstrating that H3T3P distinguishes pre-existing H3-GFP from newly synthesized H3-mKO in mitotic male GSCs. A metaphase GSC where GFP and mKO signals are indistinguishable (see Figures 20U, Figure 20X, and Figure 20Y), H3T3P (Figure 20Z) overlaps with both GFP (Figure 20V and Figure 20X) and mKO (Figure 20 W and Figure 20 Y). Asterisks in (Figure 20U), and (Figure 20X), hub. Scale bars, 5 μιη.
Figure 21A- Figure 21Z is a series of diagrams and photographs demonstrating that expression of H3T3A changes the asymmetric H3 segregation pattern in mitotic GSCs.
Figure 21A shows a schematic diagram showing the dual color-switch design that expresses pre-existing H3T3A-GFP and newly synthesized H3T3A-mKO by heat-shock treatment, as adapted from Tran et al. (2012). Figure 21B-Figure 21D shows a telophase GSC expressing nos>FRT-H3-GFP-PolyA-FRT-H3-rnKO-PolyA (nos>H3) during the second mitosis after heat-shock-induced genetic switch show conventional asymmetric segregation pattern. Figure 21E-Figure 21M shows telophase GSCs expressing nos> FRT-H3T3A-GFP-PolyA-FRT- H3T3A-mKO-PolyA (nos>H3T3A) during the second mitosis after heat-shock-induced
genetic switch show convention asymmetric pattern (Figure 21E - Figure 21G), symmetric pattern (Figure 21H - Figure 21J), or inverted asymmetric pattern (see Figure 21K- Figure 21M). For Figure 21N- Figure 21P, a prophase GSC expressing nos> FRT-H3T3A-GFP- PolyA-FRT-H3T3A-rnKO-PolyA (nos>H3T3A) during the second mitosis after heat-shock- induced genetic switch show separable GFP and mKO signals. Asterisk, hub; white dotted outline, mitotic GSCs at telophase (Figure 21B-Figure 21M) or prophase (Figure 21N-Figure 21P); arrowheads, interphase GSCs or GBs that show much less condensed nuclei. Scale bars, 5 μιη.
Figure 22J-Figure22K is a series of graphs depicting that expression of H3T3A or H3T3D changes pre-existing and newly synthesized H3 distribution patterns in post-mitotic GSC-GB pairs. Figure 22J shows quantification of the ratio of GFP (y axis: log2 scale) fluorescence intensity in GSC-GB pairs (see Figures 3J, 16, and Table 1 for details): nos>H3 (open circle, n = 55), nos>H3T3A (solid triangle, n = 64), and nos>H3T3D (open square, n = 57). Red dotted outline delineates symmetric distribution zone (see explanations below). H3 (n = 55): GSC/GB GFP ratio = 10.11 + 1.66 (p < 10 4 for the ratio >1, one-tailed t test). H3T3A (n = 64): GSC/GB GFP ratio = 1.50 + 0.28 (p > 0.05 therefore is insignificantly different from 1, two-tailed t test). H3T3D (n = 57): GSC/GB GFP ratio = 1.56 + 0.51 (p > 0.05 therefore is insignificantly different from 1, two-tailed t test). All ratios = Avg + SE; p value, one sample t test. Figure 22K shows percentage of GSC-GB pairs with conventional asymmetric (GFP in GSC/GB >1.55), symmetric (GSC/GB GFP ratio between 1-1.45 and GB/GSC GFP ratio between 1-1.45), inverted asymmetric (GFP in GB/GSC >1.55), and borderline (GSC/GB GFP ratio between 1.45-1.55 and GB/GSC GFP ratio between 1.45- 1.55) patterns, respectively in nos>H3, nos>H3T3A, and nos>H3T3D testes, as well as the predicted patterns according to randomized segregation modeling (Table 2A, Table 2B, and Figure 27). In nos>H3 testes, conventional asymmetric: 87.3% (48/55); symmetric: 12.7% (7/55); no inverted asymmetric or borderline pairs. In nos>H3T3A testes, conventional asymmetric: 9.4% (6/64); symmetric: 71.9% (46/64); inverted asymmetric: 12.5% (8/64); borderline: 6.3% (4/64). In nos>H3T3D testes, conventional asymmetric: 7.0% (4/57); symmetric: 79.0% (45/57); inverted asymmetric: 10.5% (6/57); borderline: 3.5% (2/57). Predicted patterns: conventional asymmetric: 18.7% (12/64); symmetric: 53.1% (34/64); inverted asymmetric: 18.7% (12/64); borderline: 9.4% (6/64). See also Figures 3J, 16, and Table 1.
Figure 23 A- Figure 23C is a series of photographs demonstrating that molecular and cellular specificity of histone separation patterns in prophase germ cells, and spatial and temporal specificity of the H3T3P signal. Figure 23A shows a prophase GSC expressing nos>FRT-H3.3-GFP-PolyA-FRT-H3.3-mKO-PolyA transgene during the second mitosis after heat-shock-induced genetic switch from H3.3-GFP-encoding to H3.3-mKO-encoding sequences. Figure 23B and Figure 23C show prophase GSC (Figure 23B) and GB (Figure 23C) expressing nos>FRT-H3T3A-GFP-PolyA-FRT-H3T3A-mKO-PolyA transgene during the second mitosis after heat-shock-induced genetic switch from H3T3A-GFP-encoding to H3T3A-mKO-encoding sequences.
Figure 24 is a series of photographs demonstrating that H3T3P signal in H3T3D- expressing cells and the effects of H3T3 A or H3T3D on histone inheritance patterns.
Immunostaining using antibody against H3T3P in a prophase GSC and a metaphase GSC expressing the dual-color H3T3D: pre-existing H3T3D-GFP and newly synthesized H3T3D- mKO signals largely overlap and H3T3P is detectable. Asterisks: hub. Scale bars: 5 μιη.
Figure 25A - Figure 25F is a series of photographs and graphs demonstratimg that Expression of H3T3A or H3T3D Using the nos-Gal4 Driver Leads to Similar Phenotypes. Figure 25A and Figure 25B show immunostaining using antibodies against a hub marker FasIII and a spectrosome/fusome marker a-Spectrin in nos>H3-GFP (Figure 25 A) or nos>H3T3A-GFP (Figure 25B) testes, inserts in the merged panel are shown at higher magnification in single-channel panels, respectively. Arrows in (Figure 25A) point to dotted spectrosome, arrowheads in (Figure 25B) point to branched fusomes. Figure 25C shows quantification of the GSC number in nos>H3-GFP or nos>H3T3A-GFP testes. GSCs with branched fusome (black): 0.65 + 0.95 in nos>H3-GFP testes (n = 30) versus 2.68 + 1.27 in nos>H3T3A-GFP testes (n = 30); GSCs with dotted spectrosome: 9.45 + 1.65 in nos>H3- GFP testes versus 6.97 + 1.76 in nos>H3T3A-GFP testes (All ratios = Avg + SE; ***p < 0.001). Figure 25D - Figure 25F shows immunostaining using antibodies against a hub marker FasIII and a spectrosome/fusome marker a-Spectrin in testes from nos>H3-GFP (Figure 25D), nos>H3T3A-GFP (Figure 25E), or nos>H3T3D-GFP (Figure 25F) males. Early-stage germ cells expressing GFP expand, hub size increases (Figure 25E) and (Figure 25F), in comparison with (Figure 25D), insets in the merged panel (the first column) are shown at higher magnification in single-channel panels, respectively). Scale bars: 20 uM.
Figure 26A - Figure 26C shows a series of photographs demonstrating that expression of H3T3A in somatic gonadal cells does not lead to obvious cellular defects. Figure 26A
shows immunostaining using antibodies against a hub marker FasIII, a germ cell-specific marker Vasa, H3T3P, and H3S10P in Tj>H3T3A-GFP testes. A metaphase GB cell with Vasa staining but without H3T3A-GFP expression (arrow in Figure 26A) is positive with both H3T3P and H3S10P (arrow) signals. By contrast, a metaphase cyst stem cell (CySC) without Vasa staining but with H3T3A-GFP expression is negative with H3T3P signal) but positive with H3S10P signal (arrowhead). Figure 26B and Figure 26C show immunostaining using antibodies against FasIII, a-Spectrin, and Vasa in Tj>H3-GFP (Figure 26B) or Tj>H3T3A-GFP (Figure 26C) testes. Scale bars: 20 μιη.
Figure 27 is a diagram depicting Drosphila melanogaster chromosomes X, Y, 2, 3, and 4. Mbps values correspond with similar values in Table 2A and Table 2B.
DETAILED DESCRIPTION
The invention is based, at least in part, on the surprising discovery that histone H3 Thr 3 phosphorylation regulates asymmetric H3 inheritance and male germline activity in Drosophila and that an H3T3A mutant protein efficiently reduces H3T3P and causes increased cell death of rapidly-dividing cells. The methods described herein introduce a point mutation of the Thr3 residue of the transgenic histone H3 protein to produce a mutant transgenic protein to reduce the post-translational modification of H3 (i.e., to reduce the H3T3 phosphorylation in rapidly dividing cells) to cause cell cycle arrest followed by cell death. Because the mutant transgenic protein effectively reduces Thr3 phosphorylation including endogenous H3, this mutant form acts dominant negatively. Specifically, as described in detail below, a transgene that carries a mutation that converts threonine 3 (Thr3 or T3) to the unphosphorylatable alanine (Ala or A) greatly reduces the phosphorylation at T3 of histone 3 (H3T3P) mark. As described herein, during male germline stem cell asymmetric division, H3T3P regulates asymmetric H3 inheritance and affects germ cell function.
Cancer is one of the most prevalent diseases, accounting for 25% of all deaths in the United States (Siege et al., 2012 Cancer statistics, 2: 10-29). Prior to the invention described herein, there was a pressing need to develop new strategies to inhibit rapidly dividing cancer cells. As described herein, the H3T3P mark is important for mitosis and the reduction of which leads to increased cell death in rapidly-dividing cells including cancer cells. As such, the methods described herein antagonize growth in rapidly dividing cells. For example, the compositions described herein are anti-cancer agents that are utilized in methods to reduce tumor cell growth.
As described in detail below, histone H3 shows asymmetric distribution during Drosophila male germline stem cell (GSC) asymmetric division. Prior to the invention described herein, the molecular mechanism and the biological relevance underlying this phenomenon were unclear. Described herein are experiments that demonstrate that phosphorylation at threonine 3 of H3 (H3T3P) distinguishes preexisting versus newly synthesized H3 in mitotic GSCs. A mutation that converts T3 to the unphosphorylatable alanine reduces H3T3P and results in randomized H3 inheritance patterns. Reduction of H3T3P causes GSC maintenance and germline differentiation defects including germ cell loss and tumors. Expression of H3 with T3 changed to phosphor-mimic aspartic acid results in similar phenotypes, indicating tight temporal control of H3T3P. The results presented herein indicate that mitosis-specific H3T3P distinguishes sister chromatids enriched with distinct H3 proteins and coordinates their proper inheritance, which is important for proper activity of both daughter cells derived from GSC asymmetric division.
Many types of adult stem cells undergo asymmetric cell division to generate a self- renewed stem cell and a daughter cell which will subsequently differentiate (Morrison et al., 2006 Nature 441, 1068; Betschinger et al., 2004 Curr Biol 14, R674; H. Clevers, 2005 Nat Genet 37, 1027;M. Inaba and Y. M. Yamashita, 2012 Cell Stem Cell 11, 461). During the asymmetric division of Drosophila male germline stem cell (GSC), the preexisting histone H3 is selectively segregated to the GSC, whereas the newly synthesized H3 is enriched in the differentiating daughter cell known as a gonialblast (GB) (Figure 5A; Tran et al., 2012 Science 338, 679). Described herein is a two-step model to explain this asymmetric H3 inheritance. First, prior to mitosis, preexisting and newly synthesized H3 are differentially distributed at the two sets of sister chromatids. Second, during mitosis, the set of sister chromatids containing preexisting H3 is segregated to GSCs, while the set of sister chromatids enriched with newly synthesized H3 is segregated to the GB that differentiates (Figure 5B; Tran et al., 2012 Science 338, 679; Tran et al., Chromosome Res 21, 255).
During the asymmetric division of the Drosophila male germline stem cell (GSC), the pre-existing his-tone 3 (H3) is selectively segregated to the self-renewed GSC daughter cell whereas newly synthesized H3 is enriched in the differentiating daughter cell known as a gonialblast (GB) (Tran et al., 2012) (Figure 5A). In contrast, the histone variant H3.3, which is incorporated in a replication-independent manner, does not exhibit such an asymmetric pattern. Furthermore, asymmetric H3 inheritance occurs specifically in asymmetrically dividing GSCs, but not in the symmetrically dividing progenitor cells. These findings
demonstrate that global asymmetric H3 histone inheritance possesses both molecular and cellular specificity. The following model was proposed to explain these findings.
First, the cellular specificity exhibited by the H3 histone suggests that global asymmetric histone inheritance occurs uniquely in a cell-type (GSC) where the mother cell must divide to produce two daughter cells each with a unique cell fate. Because this asymmetry is not observed in symmetrically dividing GB cells, asymmetric histone inheritance was proposed to be a phenomenon specifically employed by GSCs to establish unique epigenetic identities in each of the two daughter cells. Second, a major difference between H3 and H3.3 is that H3 is incorporated to chromatin during DNA replication, while H3.3 variant is incorporated in a replication-independent manner. Because this asymmetric inheritance mode is specific to H3, a two-step model was proposed to explain asymmetric H3 inheritance: (1) prior to mitosis, pre-existing and newly synthesized H3 are differentially distributed on the two sets of sister chromatids, and (2) during mitosis, the set of sister chromatids containing pre-existing H3 is segregated to GSCs, while the set of sister chromatids enriched with newly synthesized H3 is segregated to the GB that differentiates (Tran et al., 2012, 2013) (Figure 5B).
As described herein, a mitosis-enriched H3T3P mark acts as a transient landmark that distinguishes sister chromatids with identical genetic code but different epigenetic information, shown as pre-existing H3-GFP and newly synthesized H3-mKO. By
distinguishing sister chromatids containing different epigenetic information, H3T3P functions to allow these molecularly distinct sisters to be segregated and inherited differentially to the two daughter cells derived from one asymmetric cell division. The selective segregation of different populations of histones likely allows these two cells to assume distinct fates: self- renewal versus differentiation. Consequently, loss of proper epigenetic inheritance might lead to defects in both GSC maintenance and GB differentiation, suggesting that both cells need this active partitioning process to either LLremember" or LLreset" their molecular properties.
As described in detail below, the temporal and spatial specificities of H3T3P make it a great candidate to regulate asymmetric sister chromatid segregation. First, H3T3P is only detectable from prophase to metaphase, the window of time during which the mitotic spindle actively tries to attach to chromatids through microtubule-kinetochore interactions. Second, the H3T3P signal is enriched at the peri-centro-meric region, where kinetochore components robustly crosstalk with chromatin-associate factors. Third, H3T3 shows a sequential order of
phosphorylation, first appearing primarily on sister chromatids enriched with pre-existing H3 and then subsequently appearing on sister chromatids enriched with newly synthesized H3 as the GSC nears metaphase. The distinct temporal patterns shown by H3T3P are unique to GSCs and would allow the mitotic machinery to differentially recognize sister chromatids bearing distinct epigenetic information; an essential step necessary for proper segregation during asymmetric GSC division. Furthermore, the tight temporal control of H3T3 phosphorylation suggests that rather than serving as an inherited epigenetic signature, H3T3P may act as transient signaling mark to allow for the proper partitioning of H3. H3T3P needs to be under tight temporal control in order to ensure proper H3 inheritance and germline activity.
As described herein, these studies have shown that H3T3P is indeed subject to stringent temporal controls during mitosis. The H3T3P mark is undetectable during G2 phase. Upon entry to mitosis, sister chromatids enriched with pre-existing H3-GFP histone begin to show H3T3 phosphorylation prior to sister chromatids enriched with newly synthesized H3- mKO. As the cell continues to progress toward metaphase, H3T3P signal begins to appear on sister chromatids enriched with newly synthesized H3-mKO. Such a tight regulation of H3T3P is compromised when levels of H3T3P are altered due to the incorporation of mutant H3T3A or H3T3D. Incorporation of the H3T3A mutant results in a significant decrease in the levels of H3T3P on sister chromatids throughout mitosis, such that neither sister becomes enriched with H3T3P as the GSC progresses toward metaphase. Conversely, incorporation of the H3T3D mutant would result in seemingly elevated levels of H3T3P early in mitosis. Although H3T3A and H3T3D act in different ways, both mutations significantly disrupt the highly regulated temporal patterns associated with H3T3 phos-phorylation, the result of which is randomized H3 inheritance patterns and germ cell defects in testes expressing either H3T3A or H3T3D.
As described in detail below, to further evaluate the extent of H3T3A and H3T3D roles in the segregation of sister chromatids enriched with different populations of H3 during mitosis (Figure 5B, step two), all possible segregation patterns in male GSCs were modeled and these estimateswere compared to the experimental results. To simplify the calculations, two important assumptions were made: first, nucleosomal density was assumed to be even throughout the genome. This assumption allows the inference that the overall fluorescent signal contributed by each chromosome is proportional to their respective number of DNA
base pairs. Second, by quantifying pre-existing H3-GFP asymmetry in anaphase and telophase GSCs, the estimate of the establishment of H3-GFP asymmetry is 4-fold biased, i.e., 80% on one set of sister chromatids and 20% on the other set of sister chromatids, based on quantification of GFP signal in anaphase (GFP GSC side/GB side = 4.5) and telophase (GFP GSC side/GB side = 3.8) GSCs (Tran et al., 2012). With these two simplifying assumptions, both GFP and mKO ratios were calculated among all 64 possible combinations (Figure 27, Table 2A and Table 2B: 2 (for X-ch) x 2 (for Y-ch) x 4 (for 2nd ch) x 4 (for 3rd ch) = 64 combinations in total). If asymmetry is defined as a greater than 1.5-fold difference in fluorescence intensity, then based on a model of randomized sister chromatid segregation, a symmetric pattern should appear for 53.1% (34/64) of GSC-GB pairs whereas both conventional and inverted asymmetric patterns should occur with equal frequencies and account for 18.7% (12/64) of total GSC-GB pairs. The remaining 9.4% (6/64) of GSC-GB pairs should produce histone inheritance patterns with a 1.45- to 1.55-fold difference in signal intensity (predicted ratios in Figure 22K).
This estimation is close to experimental data, as described herein, in both H3T3A- and H3T3D-expressing testes (Figures 22J and Figure 22K; Table 1). Of the 64 quantified post-mitotic GSC-GB pairs in nos>H3T3A testes, 71.9% showed symmetric inheritance pattern. Conventional and inverted asymmetric patterns were detected at 9.4% and 12.5%, respectively, and 6.3% at the borderline. Similarly, of the 57 quantified post-mitotic GSC-GB pairs in nos>H3T3D testes, 79.0% showed symmetric inheritance pattern. Conventional and inverted asymmetric patterns were detected at 7.0% and 10.5%, respectively with 3.5% of pairs at the borderline. Some differences between predicted ratios and our experimental data could be due to the simplified assumptions, the limited sensitivity of our measurement, and/or some coordinated chromatid segregation modes that bias the eventual read-out (Yadlapalli and Yamashita, 2013). In summary, comparison between the modeling ratios and
experimental data described herein suggest that loss of the tight control of H3T3
phosphorylation in GSCs randomizes segregation of sister chromatids enriched with different populations of H3.
If the temporal separation in the phosphorylation of H3T3 on epigenetically distinct sister chromatids facilitates their proper segregation and inheritance during asymmetric cell division, it is likely that mutations of the Haspin kinase will also affect the temporal control of H3T3 phosphorylation. In the context of H3T3A, where the levels of H3T3P are already
reduced, a further decrease in H3T3P by reducing Haspin levels should limit the GSC's ability to distinguish between sister chromatids enriched with distinct H3. Indeed, haspin mutants enhance the phenotypes in nos>H3T3A testes. A different situation appears in the context of H3T3D where sister chromatids experience seemingly elevated levels of H3T3P at the start of mitosis. These elevated H3T3P levels may be exacerbated by the phosphorylation activity of the Haspin kinase. Therefore, it is conceivable that by halving the levels of the Haspin kinase, H3T3 phosphorylation should be reduced to a level more closely resembling wild-type. In this way, some of the temporal specificity that is lost in the H3T3D mutant is restored, resulting in suppression of the phenotypes observed in nos>H3T3D testes. An exciting topic for future study would be to further explore how exactly Haspin
phosphorylates H3T3 in the context of chromatin and whether H3T3A and H3T3D mutations act synergistically or antagonisti-ically in regulating asymmetric sister chromatids segregation through differential phosphorylation of a key histone residue.
Also described herein is the potential connection between asymmetric histone inheritance and another phe-nomenon reported by several investigators: selective DNA strand segregation (reviewed by Evano and Tajbakhsh, 2013; Rando, 2007; Tajbakhsh and
Gonzalez, 2009). Recent development of the chromosome orientation fluorescence in situ hybridization (CO-FISH) technique (Falconer et al., 2010) allows study of selective chromatid segregation at single-chromosome resolution. Using this technique in mouse satellite cells, it has been demonstrated that all chromosomes are segregated in a biased manner, such that pre-existing template DNA strands are preferentially retained in the daughter cell that retains stem cell identity. Interestingly, this biased segregation becomes randomized in progenitor non-stem cells (Rocheteau et al., 2012). Using CO-FISH in Drosophila male GSCs, sex chromosomes have been shown to segregate in a biased manner. Remarkably, sister chromatids from homologous autosomes have been shown to co-segregate independent of any specific strand preference (Yadlapalli and Yamashita, 2013). Thus, as described herein, there is a possible epigenetic source guiding the coordinated inheritance of Drosophila homologous autosomes. In many cases of biased inheritance, researchers have speculated about the existence of a molecular signature that would allow the cell to recognize and segregate sister chromatids bearing differential epigenetic information (Klar, 1994, 2007; Lansdorp, 2007; Rando, 2007; Yen-nek and Tajbakhsh, 2013). However, prior to the invention described herein, the identity of such a signature has remained elusive. Described
herein is experimental evidence demonstrating that a tightly-controlled histone modification, H3T3P, is able to distinguish sister chromatids and coordinate their segregation.
Epigenetic processes play important roles in regulating stem cell identity and activity. Failure to appropriately regulate epigenetic information may lead to abnormalities in stem cell behaviors, which underlie early progress toward diseases such as cancer and tissue degeneration. Priro to the invention described herein, due to the crucial role that such processes play in regulating cell identity and behavior, the field has long sought to understand whether and how stem cells maintain their epigenetic memory through many cell divisions. The results described herein suggest that the asymmetric segregation of pre-existing and newly synthesized H3-enriched chromosomes may function to determine distinct cell fates of GSCs versus differentiating daughter cells.
Pharmaceutical Therapeutics
The invention provides pharmaceutical compositions for use as a therapeutic. In one aspect, the composition is administered systemically, for example, formulated in a pharmaceutically-acceptable buffer such as physiological saline. Preferable routes of administration include, for example, instillation into the bladder, subcutaneous, intravenous, intraperitoneal, intramuscular, or intradermal injections that provide continuous, sustained levels of the composition in the patient. Treatment of human patients or other animals is carried out using a therapeutically effective amount of a therapeutic identified herein in a physiologically-acceptable carrier. Suitable carriers and their formulation are described, for example, in Remington's Pharmaceutical Sciences by E. W. Martin. The amount of the therapeutic agent to be administered varies depending upon the manner of administration, the age and body weight of the patient, and with the clinical symptoms of the neoplasia or infection. Generally, amounts will be in the range of those used for other agents used in the treatment of other diseases associated with neoplasia or infection, although in certain instances lower amounts will be needed because of the increased specificity of the compound. A compound is administered at a dosage that enhances an immune response of a subject, or that reduces the proliferation, survival, or invasiveness of a neoplastic cell as determined by a method known to one skilled in the art.
Formulation of Pharmaceutical Compositions
The administration of compositions for the treatment of a condition associated with endothelial dysfunction may be by any suitable means that results in a concentration of the therapeutic that, combined with other components, is effective in ameliorating, reducing, or
stabilizing a condition associated with endothelial dysfunction. The composition may be contained in any appropriate amount in any suitable carrier substance, and is generally present in an amount of 1-95% by weight of the total weight of the composition. The composition may be provided in a dosage form that is suitable for parenteral (e.g., subcutaneously, intravenously, intramuscularly, intravesicularly or intraperitoneally) administration route. The pharmaceutical compositions may be formulated according to conventional pharmaceutical practice (see, e.g., Remington: The Science and Practice of Pharmacy (20th ed.), ed. A. R. Gennaro, Lippincott Williams & Wilkins, 2000 and
Encyclopedia of Pharmaceutical Technology, eds. J. Swarbrick and J. C. Boylan, 1988-1999, Marcel Dekker, New York).
Human dosage amounts can initially be determined by extrapolating from the amount of compound used in mice or nonhuman primates, as a skilled artisan recognizes it is routine in the art to modify the dosage for humans compared to animal models. In certain embodiments it is envisioned that the dosage may vary from between about 0.1 μg compound/kg body weight to about 5000 μg compound/kg body weight; or from about 1 μg/kg body weight to about 4000 μg/kg body weight or from about 10 μg/kg body weight to about 3000 μg/kg body weight. In other embodiments this dose may be about 0.1, 0.3, 0.5, 1, 3, 5, 10, 25, 50, 75, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1000, 1050, 1100, 1150, 1200, 1250, 1300, 1350, 1400, 1450, 1500, 1600, 1700, 1800, 1900, 2000, 2500, 3000, 3500, 4000, 4500, or 5000 μg/kg body weight. In other embodiments, it is envisaged that doses may be in the range of about 0.5 μg
compound/kg body weight to about 20 μg compound/kg body weight. In other embodiments the doses may be about 0.5, 1, 3, 6, 10, or 20 mg/kg body weight. Of course, this dosage amount may be adjusted upward or downward, as is routinely done in such treatment protocols, depending on the results of the initial clinical trials and the needs of a particular patient.
Pharmaceutical compositions are formulated with appropriate excipients into a pharmaceutical composition that, upon administration, releases the therapeutic in a controlled manner. Examples include single or multiple unit tablet or capsule compositions, oil solutions, suspensions, emulsions, microcapsules, microspheres, molecular complexes, nanoparticles, patches, and liposomes.
Kits or Pharmaceutical Systems
Pharmaceutical compositions may be assembled into kits or pharmaceutical systems for use in arresting cell cycle in rapidly dividing cells, e.g., cancer cells. Kits or
pharmaceutical systems according to this aspect of the invention comprise a carrier means, such as a box, carton, tube, having in close confinement therein one or more container means, such as vials, tubes, ampoules, bottles, syringes, or bags. The kits or pharmaceutical systems of the invention may also comprise associated instructions for using the kit.
As described in detail below, mitosis-specific epigenetic mark H3T3P distinguishes preexisting versus newly synthesized H3 to regulate their proper segregation during cell division. Mutating this threonine to either unphosphorylatable alanine or phosphor-mimic aspartic acid leads to mis-segregation of sister chromatids and dramatic germ cell defects including germline tumor and germ cell loss. The results presented herein highlight the importance of proper epigenetic inheritance in stem cells.
The data presented herein demonstrate that a mitotic-specific H3T3P mark acts as an epigenetic landmark that distinguishes sister chromatids with identical genetic code, but different epigenetic information. Initiated by this recognition, different epigenetic information is inherited differentially to the two daughter cells derived from one asymmetric cell division, which allows these two cells to take distinct fates. Loss of this epigenetic inheritance might lead to defects in both GSC maintenance and GB differentiation, suggesting that both cells need this active partitioning process to either 'remember' or 'reset' their molecular properties.
The practice of the present invention employs, unless otherwise indicated, conventional techniques of molecular biology (including recombinant techniques), microbiology, cell biology, biochemistry and immunology, which are well within the purview of the skilled artisan. Such techniques are explained fully in the literature, such as,
"Molecular Cloning: A Laboratory Manual", second edition (Sambrook, 1989);
"Oligonucleotide Synthesis" (Gait, 1984); "Animal Cell Culture" (Freshney, 1987);
"Methods in Enzymology" "Handbook of Experimental Immunology" (Weir, 1996); "Gene Transfer Vectors for Mammalian Cells" (Miller and Calos, 1987); "Current Protocols in Molecular Biology" (Ausubel, 1987); "PCR: The Polymerase Chain Reaction", (Mullis, 1994); "Current Protocols in Immunology" (Coligan, 1991). These techniques are applicable to the production of the polynucleotides and polypeptides of the invention, and, as such, may be considered in making and practicing the invention. Particularly useful techniques for particular embodiments will be discussed in the sections that follow.
The following examples are put forth so as to provide those of ordinary skill in the art with a complete disclosure and description of how to make and use the assay, screening, and therapeutic methods of the invention, and are not intended to limit the scope of what the inventors regard as their invention.
Example 1 : Materials and Methods
Fly strains and husbandry
Fly stocks were raised using standard Bloomington medium at 18°C, 25°C, or 29°C as noted. The following fly stocks were used: hs-flp on the X chromosome (Bloomington Stock Center BL-26902), haspin TRIP line (Bloomington Stock 35276), Oi(haspin)
(Bloomington Stock 7155), haspinMI09386 (Bloomington Stock 53099), UAS-upd on the 2nd chromosome (Terry et al., 2006 Dev Biol, 294, 246), nos-Gal4 on the 2nd chromosome (Van Doren et al., 1998 Curr Biol 8, 243, bam-Gal4 on the 2nd chromosome (Eun et al., 2014 Science, 343, 1513).
Generation of fly strains with different switchable dual-color transgenes
Standard procedures were used for all molecular cloning experiments. Enzymes used for plasmid construction were obtained from New England Biolabs (Beverly, MA). H3T3A and H3T3D point mutations were generated with quick change site-directed mutagenesis kit (Agilent Technologies 200521) according to manufacturer's instructions, based on the plasmids containing wild-type H3 sequences described in (Tran et al., 2012 Science 338, 679). Similar tagged histone proteins were used for previous studies (K. Ahmad and S. Henikoff, 2002 Mol Cell 9, 1191; K. Ahmad and S. Henikoff, 2001 J Cell Biol 153, 101). The H3T3A/D-mKO fusion sequences were recovered as an Xbal flanked fragment and were subsequently inserted into the Xbal site of the UASp plasmid to construct the UASp- H3T3A/D-mKO plasmid. The H3T3A/D-GFP fusion sequences were inserted to
pBluescript-FRT-NheI-SV40 PolyA-FRT plasmid at the unique Nhel site. The entire FRT- H3T3A/D-GFP-SV40 PolyA-FRT sequences were then subcloned into the UASp-H3T3A/D- mKO plasmid, as described previously (Tran et al., 2012 Science 338, 679), digested by NotI and BamHI (note: Bglll and BamHI produce compatible cohesive ends). The final UASp plasmids were introduced to w1118 flies by P-element-mediated germline transformation (Bestgene Inc.).
Heat shock scheme
Flies with UASp-FRT-H3-GFP-PolyA-FRT-H- mKO or their mutant transgenes (H3T3A or H3T3D, e.g., UASp-FRT-H3T3A/D-GFP-PolyA-FRT-H3T3A/D- mKO) were
paired with nos-Gal4 drivers. Flies were raised at 18°C throughout development until adulthood to avoid pre-flip (Tran et al., 2012 Science 338, 679). Before heat shock, 0-3 day old males were transferred to vials that had been air dried for 24 hours. Vials were submerged with all air area (i.e., up to the plug) underneath water in a circulating 37 °C water bath for two hours and recovered in a 29°C incubator for indicated time before dissection and immunostaining experiments.
Temperature shift assay to induce germline tumor in adult flies
Flies with UASp-FRT-H3-GFP-PolyA-FRT-H- mKO or their mutant transgenes (H3T3A or H3T3D, e.g., UASp-FRT-H3T3A/D-GFP-PolyA-FRT-H3T3A/D- mKO) paired with either nos-Gal4 or bam-Gal4 driver were raised at 18°C throughout development until adulthood. Newly enclosed males were collected and shifted to 29 °C for indicated time before dissection and immunostaining experiments.
Immunostaining experiments
Immunofluorescence staining was performed using standard procedures (Tran et al., 2012 Science 338, 679; Hime et al., 1996 J Cell Sci 109 ( Pt 12), 2779). Primary antibodies were mouse anti-a spectrin (1:50, DSHB 3A9), mouse anti-Fas III (1:50, DSHB, 7G10), mouse anti-Armadillo (1 : 100; DSHB, N2 7A1 clone), rabbit anti- H3T3P (1:200, Millipore 05-746R), mouse anti-H3S10P (1:200; Millipore, #05-806), anti-CID (1: 100; gift from Dr. Sylvia Erhardt, University of Heidelberg, Germany), and rabbit anti-Vasa (1:200; Santa Cruz SC-30210). Secondary antibodies were the Alexa Fluor-conjugated series (1:200; Molecular Probes). Lysotracker (Invitrogen L7528) was applied according to manufacturer
recommendation. Images were taken using the Zeiss LSM 510 META or Zeiss LSM 700 Multiphoton confocal microscope with a 40x or 63 x oil immersion objectives and processed using Adobe Photoshop software.
EdU incorporation to label GSC-GB pair at S-phase
EdU labeling of the GSC-GB pairs at S phase was performed using Click-iT EdU Alexa Fluor 647 Imaging Kit (Life Science CI 0640) according to manufacturer's instructions. Dissected testes were immediately incubated in S2 medium with 100 μΜ EdU for 30 minutes at room temperature. The testes were subsequently fixed and proceed to primary antibodies (anti-FasIII, anti-a spectrin and anti-Vasa) incubation. Fluorophore conjugation to EdU was performed along manufacturer's instructions and followed by secondary antibodies incubation.
The addition of EdU facilitates recognition of the GSC-GB pairs undergoing active DNA synthesis from those without EdU, which might be arrested due to the heat shock treatment. The cell cycle progression is important for the incorporation and segregation of preexisting versus newly synthesized H3.
Lattice light sheet microscopy
Light sheet measurements were performed using a massively parallel linear array of non-diffracting beams that coherently interfere to create a 2D optical lattice confined to a single plane (Gao et al., 2014 Nat Protoc 9, 1083; B. C. Chen et al., 2014 Science 346, 1257998). This structured was then oscillated rapidly within the plane to create time- averaged uniform excitation in a 400 nm thick section across the entire field of view. The desired coherent pattern was generated using a spatial light modulator (SXGA-3DM, Forth Dimension Displays) that was conjugate to the sample plane, and that projected a binarized version of the desired pattern to be imaged at the sample. The fluorescence generated within the specimen by the light sheet was collected by an objective (Nikon, CFI Apo LWD 25XW, 1.1 NA, 2 mm WD) and then imaged on a fast camera (ORCA-flash4.0, Hamamatsu). Four lasers of excitations wavelengths 405 nm, 488 nm, 532 nm, and 640 nm were used, and a multi-band emission filter (Semrock, FF02-435/40-25, FF03-525/50-25, FF01-562/40-25, BLP01-647R-25) rejected the excitation wavelengths. The fixed sample was mounted on 5 mm coverslip through the light sheet at 50 ms exposure per 2D image. The excitation numerical aperture of light sheet is 0.42 for outer ring and 0.325 for inner one. The image voxel is 104 xl04 x 250 nm in x, y, z respectively. Multi-color experiments were performed by switching the color stack by stack. The 3D images obtained by sweeping the light sheet plane by plane through the specimen were deconvolved using a Richardson- Lucy algorithm. Immunoblot experiments
Histone H3 antibody (Abeam Cat# abl791), H4 antibody (Abeam Cat# abl0158), and GFP antibody (Abeam Cat# abl3970) were used for immunoblot analyses. 15 testes were dissected in lxPBS and transferred to lxRIPA to prepare for the lysate of each sample.
Novex 4-20% Tris-Glycine Mini Protein Gels (Life Science EC6025BOX) were used for SDS-PAGE. Rabbit anti- histone H3 (1:1000 Abeam abl791) and Chicken anti-GFP (1: 1000, Abeam abl3970) were used as primary antibodies. Goat anti-Chicken IgG (1:1000, Abeam ab97135) and goat anti-rabbit IgG (1:1000, Santa Cruz SC-2030) were used as secondary antibodies.
Quantification of GFP and niKO intensity
No antibody was added to enhance either GFP or mKO signal. Values of GFP and mKO intensity were calculated using Image J software. DAPI signal was used to determine the area of nucleus for measuring both GFP and mKO fluorescent signals, the raw reading was subsequently adjusted by subtracting fluorescence signals in the hub region used as background in both GSC and GB nuclei and compared between each other.
Male fly fertility test
For the fertility test, newly eclosed single nos> H3T3A-GFP males were mated with three y,w virgin females and at least ten crosses were set up simultaneously. Similar crosses were also made for the nos> H3-GFP control males. All crosses were kept at 29°C and males were transferred into new vials with three y,w virgin females every five days until they were 20-day old. The progenies of each cross was counted for three days consecutively after they eclosed. Vials which did not contain all four flies alive (one male and three females) at the end of each 5-day mating period, were excluded from the counting and the plotting. Transcriptome profiling (RNAseq) and Data Analyses
Sample isolation and mRNA library preparation
Arcturus Picopure RNA isolation kit (Life Tecknologies, KIT0204) was utilized to prepare total RNA from dissected testis samples. Sequencing libraries were prepared by following the Illumina TruSeq RNA sample prep kit V2 (Illumina, RS-122-2001). Five H3T3A samples and two nos-Gal4; UAS-upd (nos>upd) (24, 42, 43) samples were sequenced on Illumina Mi-seq or Hi-seq 2500 sequencer. The Hi-seq 2500 runs were single-end 50 cycle sequencing, and the Mi-seq runs were pair-end 75*2 cycle sequencing. In the analysis, the pair-end reads were merged and treated as single-end. In addition, there are two transcriptome profiles from a previous published work (Gan et al., 2010 Cell Res 20, 763), one from wild-type testis tissue sample and one from bag-of -marbles (bam) mutant testis tissue sample. Thus, a total of nine samples/data were input for the transcriptome profiling analysis.
The alignment to fly genome and gene mapping
The reads retrieved from multiple sequencing runs were examined by fastqc quality control software (bioinformatics.babraham.ac.uk/projects/fastqc/). The reads passed quality filter were mapped back to Drosophila melanogaster genome (dm3) (Flybase dmel_r5.43, as of Jan 2012, ftp.flybase.net/releases/FB2012_01/dmel_r5.43/). Bowtie aligner [version 0.12.7 (Langmead et al., 2009 Genome Biol 10, R25)] was utilized with the following
configuration (-a— hred33-quals -n 2 -e 70 -1 28 -m 1 -best -strata) which is basically allowing two mismatches and only one alignment site. Each read was then assigned into gene regions. The annotation for protein coding genes, ribosomal RNAs, tRNAs, snoRNA, snRNAss, pre_miRNAs, and other non-coding RNAs were retrieved from Flybase database (as of Jan 2012, ftp.flybase.net/releases/FB2012_01/dmel_r5.43/). The exons from different alternative splicing isoforms were merged to find the maximum genome coverage regions per gene. When a read is mapped to a region with more than one gene, i.e., one merged exon region overlapping with a non-coding gene, the count is split as equal possibilities into these two genes, half count for each. A matrix file with the number of reads assigned into each gene per sample was prepared for the following data analysis.
Estimation of transcription level and other analysis
The edgeR software package (Robinson et al., 2010 Bioinformatics 26, 139) in R was utilized to find the normalization factors for each sample with various sizes (by the TMM (Trimmed Mean of M value) and upper quantile normalization methods). The edgeR method models short reads into negative binomial distribution and estimates the biological replicate variance (dispersion). Tag-wise dispersion estimation was performed in "H3T3A", "nos- UPD", "bam" and "wild-type" four groupings of read count profiles. Quantity term
"corrected RPKM (cRPKM)" was introduced by the formula: pseudo.alt * le+09 / (length of merged transcripts)/ (common.lib.size). The common.lib.size was calculated from the calcNormFactors function of edgeR, which performs TMM and upper quantile normalization methods and set a reference library. The pseudo.alt contains read counts after normalization across the input multiple profiles. The pseudo.alt was calculated by edgeR using quantile normalization and maximum likelihood method. The pseudo.alt contains pseudo read counts after correcting the library size and composition difference.
After cRPKM calculation, gene expression levels per sample were pair- wisely compared with spearman correlation (correlation coefficient rho). A pair-wise inter-profile distance was defined as (1-rho) and set up a distance matrix. A dimension reduction method, multidimensional scaling in R (stat.ethz.ch/R-manual/R- devel/library/stats/html/cmdscale.html), was utilized to visualize the global similarity relationship among the nine samples (five nos>H3T3A samples, two nos>upd samples, one bam sample and one wild-type sample), as shown in Figure 13A-Figure 13B.
In order to identify aberrant gene expression in nos>H3T3A testes, similarity among all nos>H3T3A samples is observed by hierarchical clustering. Kmeans method was utilized,
with log2 transformation and Z score scaling. A Venn diagram shown in Figure 13C was drawn to illustrate the actively expressed genes in each genotype using cRPKM >=20 as a cutoff. In this scenario, the five nos>H3T3A samples were combined and the two nos>upd samples were combined. The specific cluster with high expression in wild-type testes and all nos>H3T3A samples was piped into GO enrichment analysis with Benjamini correction (q_value), as shown in Figure 13D and Figure 13E, respectively.
Example 2: Histone H3 Thr 3 Phosphorylation Regulates Asymmetric H3 Inheritance and Male Germline Activity in Drosophila
Described herein is a two-step model to explain this asymmetric H3 inheritance. First, prior to mitosis, preexisting and newly synthesized H3 are differentially distributed at the two sets of sister chromatids. Second, during mitosis, the set of sister chromatids containing preexisting H3 is segregated to GSCs, while the set of sister chromatids enriched with newly synthesized H3 is segregated to the GB that differentiates (Figure 5B; Tran et al., 2012 Science 338, 679; Tran et al., Chromosome Res 21, 255).
To examine this model, a temporally controlled dual-color system was used to label preexisting H3 with GFP (green fluorescent protein) and newly synthesized H3 with mKO (monomeric Kusabira Orange) precisely (Tran et al., 2012 Science 338, 679). Asymmetric segregation of H3-GFP and H3-mKO were clearly visualized in anaphase and telophase GSCs imaged during the second mitosis following heat shock-induced H3-GFP- to H3-mKO- coding sequences switch (Tran et al., 2012 Science 338, 679). As described herein, H3-GFP and H3-mKO signals are already separable in a prophase GSC (Figure 1A-Figure 1C; Figure 6A-Figure 6B, and Figure 6E), but not in a control GB (Figure ID-Figure IF; Figure 6H- Figure 61, and Figure 6L), which is consistent with the hypothesis that their differential distribution is established in GSCs prior to mitosis (Step one in Figure 5B). By contrast, such a separation was not detected using a H3.3 dual-color transgene under the same heat-shock regime (Figure 23A), consistent with H3.3 being inherited symmetrically (Tran et al., 2012).
The phosphorylation at threonine 3 of H3 (H3T3P) is enriched on mitotic
chromosomes (Wang et al., 2010 Science 330, 231; Kelly et al., 2010 Science 330, 235; and Yamagishi et al., 2010 Science 330, 239) and has been proposed to function to ensure proper chromosome congression to the metaphase plate for reliable segregation of sister chromatids during anaphase (Dai et al., 2005 Genes Dev 19, 472). When immunostaining experiments were performed using an H3T3P-specific antibody, it was identified that H3-GFP (Figure 1G an Figure 1J), but not H3-mKO (Figure 1G and Figure IK), is co-labeled by H3T3P (Figure
1H-Figure II, and Figure 1L) in a prometaphase GSC. A similar observation was made in a prophase GSC (Figure 6C, and Figure 6F-Figure 6G), suggesting that preexisting H3-GFP and newly synthesized H3-mKO are not phosphorylated simultaneously. By contrast, H3- GFP signals and H3-mKO signals are not separable and H3T3P does not distinguish them in a control GB (Figure 1M-Figure 1R; Figure 6J, and Figure 6M-Figure 6N). Furthermore, when sister chromatids congressed to the equator in metaphase GSCs, such a distinction became un-detectable (Figures 20U-20Z). Therefore, H3T3P acts as an epigenetic mark to distinguish sister chromatids enriched with preexisting H3 from those enriched with newly synthesized H3. The H3T3P immunostaining signal observed is not restricted to the centromeric region (Figure 7A-Figure 7L), in contrast to centromere- specific H3T3P signal reported in mammalian cells (Wang et al., 2010 Science 330, 231). Moreover, H3T3P is only detectable in prophase (Figure 7G, and Figure 7M-Figure 7P) to metaphase (Figure 7Q- Figure 7T), but not in anaphase (Figure 7U-Figue 7X) germ cells, consistent with previous report in other insect cells (C. Escriba and C. Goday, 2013 J Cell Sci 126, 3214).
To understand the function of H3T3P in germ cells, fly lines were generated with an H3-GFP transgene carrying a point mutation that converts T3 to the unphosphorylatable Alanine (Ala or A, H3T3A). Expression of the H3T3A-GFP transgene in early germ cells by the nanos-Gal4 [nos-Gal4, (Van Doren et al., 1998 Curr Biol 8, 243)] driver greatly reduced the H3T3P signal (Figure 2A-Figure 2C). This reduction of immunostaining signal was specific to H3T3P, as immunostaining using antibodies against mitosis-enriched H3S10P (SerlO-phosphorylation of H3) showed normal signals in H3T3 A-expressing cells (Figure 2D). Because endogenous H3 are still abundant in testes where H3T3A is expressed in almost all germ cells (Figure 8A-Figure 8E), the absence of H3T3P signal suggests a dominant negative effect of H3T3A. The dominant negative effect of point mutations of H3 has recently been identified for multiple residues (Lewis et al., 2013 Science 340, 857; Herz et al., 2014 Science 345, 1065). By contrast, expression of a wild-type H3 had no effect on either the H3T3P (Figure 2E-Figure 2G) or the H3S10P (Figure 2H) signal, confirming that it is not a transgene-induced effect.
It was next identified whether H3T3A affects asymmetric H3 segregation during GSC asymmetric division using the dual-color labeling system (Figure 9A). Because mitotic GSCs account for less than 2% of all GSCs (Tran et al., 2012 Science 338, 679; X. R. Sheng and E. Matunis, 2011 Development 138, 3367; Yadlapalli et al., 2011 J Cell Sci 124, 933; and S. Yadlapalli and Y. M. Yamashita, 2013 Nature), post- mitotic GSC-GB pairs derived
from GSC asymmetric divisions were examined to assess patterns of histone inheritance (Tran et al., 2012 Science 338, 679, see also below). In contrast to the asymmetric pattern of wild-type H3 (Figure 3A-Figure 3C, open circles mainly in zone I and II in Figure 3J), 86.8% (33/38) GSC-GB pairs showed symmetric distribution of H3T3A-GFP and H3T3A-mKO signals (Figure 3D-Figure 3F, solid triangles in zone III in Figure 3J). Moreover, asymmetric distributions could be observed in two distinct patterns: wild-type asymmetry (left pair in Figure 3G-Figure 31, solid triangles in zone I in Figure 3J) and opposite asymmetry (right pair in Figure 3G-Figure 31, solid triangles in zone IV in Figure 3J). Since no asymmetric pattern should be observed if the incorporation of preexisting and newly synthesized H3 on sister chromatids is randomized (Step one; Figure 5B), these data suggest that the
establishment of asymmetric H3 prior to mitosis may not be affected. However, when cells enter mitosis, asymmetric H3 segregation (Step two; Figure 5B) is mis -regulated, resulting in randomized patterns. Because male flies have two major autosomes and two sex
chromosomes, all possible segregation patterns were calculated if only the second step in Figure 5B is affected (Figure 9B). According to this estimation, only when the two autosomes have the same segregation pattern was overall asymmetric H3 distribution (12.5%) observed; and for the rest, symmetric pattern should be observed (87.5%). This estimation is very close to the data presented herein: approximately 13.2% GSC-GB pairs showed asymmetric inheritance pattern (5/38 in zone I and IV in Figure 3J) in nos>H3T3A testes. By contrast, 89.1% of GSC-GB pairs showed asymmetric inheritance pattern (49/55 in zone I and II in Figure 3J) in wild-type tO-expressing testes. Noticeably, no GSC-GB pair showed the opposite asymmetric pattern (zone IV) in wild- type H3 -expressing testes, but such an opposite asymmetry could be detected in H3T3A-expressing testes. Furthermore, the asymmetry for GFP is more obvious than that for mKO, most likely due to the fact that their fluorescence intensity was measured in post-mitotic GSC-GB pairs, when both cells are undergoing S phase with robust incorporation of mKO-labeled new histones. Therefore the difference of mKO signals in GSC and GB becomes less dramatic than that of GFP, consistent with what has been reported previously (Tran et al., 2012 Science 338, 679; Tran et al., 2013 Chromosome Res 21, 255).
Expression of H3T3A in early germ cells (nos> H3T3A) also caused a spectrum of cellular defects after H3T3P is effectively reduced (Figure 10A-Figure 10P). Compared to testes expressing the wild-type H3 (Figure 4A-Figure 4D; Figure 11A-Figure HE), H3T3A- expressing testes exhibited an expansion of germ cells carrying early stage cellular markers.
These markers include nanos-driven GFP expression (Figure 4E-Figure 4F;Figure 11K- Figure 11L), spectrosome structure (Lin et al., 1994 Development 120, 947; M. de Cuevas and A. C. Spradling, 1998 Development 125, 2781; Hime et al., 1996 J Cell Sci 109 ( Pt 12), 2779) (Figure 4E, Figure 4G, Figure 11K, and Figure 11M) and condensed nuclei (Tran et al., 2000 Nature 407, 754; Chen et al., 2013 Cell Stem Cell 13, 73; Schulz et al., 2004 Genetics 167, 707) (Figure 4H; Figure 110). Noticeably, based on these cellular markers, the germline tumors developed in nos> H3T3A testes were heterogeneous (Figure 12A-Figure 12H). RNA-seq was performed to characterize the molecular features of nos>H3T3A testes. Although individual nos>H3T3A testis samples had a high degree of variation in their transcriptomes (Figure 13A-Figure 13B), all samples share early stage germline signatures (Figure 13C), such as lack of meiotic and terminal differentiation gene expression (Figure 13D). Furthermore, genes in DNA repair pathway and Pol II transcriptional initiation were up-regulated in all nos>H3T3A testis samples (Figure 13E), suggesting that they may have activated DNA repair activity and possibly aberrant transcription. These data are consistent with the germ cell loss and progenitor germline tumor phenotypes observed. Noticeably, the transcriptome signature of nos>H3T3A testes was not similar to either the GSC-like-cell- enriched nos>upd testis sample (Terry et al., 2006 Dev Biol 294, 246) or spermatogonia- enriched bam testis sample (Gan et al., 2010 Cell Res 20, 763) (Figure 13A-Figure 13C). This heterogeneity is likely due to the different H3 inheritance patterns by randomized segregation (Figure 9B). However, using the entire testis with mixed cell types and stages may also contribute to this heterogeneity. The nos>H3T3A males also had progressively decreased fertility (Figure IIP), consistent with deterioration of germline defects over time (Figure 1 IF- Figure 11J vs. Figure 1 IK- Figure 110) and germ cell loss likely due to GSC loss (Figure 14N, Figure 14P, and Figure 14V). Development of these germline defects in adult flies suggests that H3T3P is required for GSC maintenance and for proper differentiation of GB. Lastly, compared to the hub region in nos> H3 testes (inset in Figure 4C), nos> H3T3A testes (inset in Figure 4G) showed substantially enlarged hub area (Figure 14H vs. Figure 14D and Figure 14M), most likely as a secondary defect due to GSC loss as reported previously (Tazuke et al., 2002 Development 129, 2529; Monk et al., 2010Cell Stem Cell 6, 348; P. Gonczy and S. DiNardo, 1996 Development 122, 2437; and Dinardo et al., 2011 Development 138, 1687). The expanded hub cells were not tightly associated with each other (Figure 14H vs. Figure 14D) and expressed an early cyst cell marker Zfh-1 (Issigonis et al., 2009 Science 326, 153; Eun et al., 2014 Science 343, 1513; and L. Leatherman and S.
Dinardo, 2008 Cell Stem Cell 3, 44) (Figure 14G), suggesting that the niche architecture and gene expression are abnormal.
These phenotypes in nos>H3T3A testes were specifically caused by expressing H3T3A in early-stage germ cells. Using a later-stage germline driver bam-Gal4 (C. Schulz et al., 2004 Genetics 167, 707; Eun et al., 2014 Science 343, 1513; and J. Cheng et al., 2008 Nature 456, 599) (Figure 15A) to turn on the same H3T3A transgene specifically in 4-cell spermatogonia and later stage germ cells was sufficient to reduce the H3T3P in later-stage germ cells (Figure 15B-Figure 151). However, bam>H3T3A did not lead to germline tumor or enlarged hub phenotypes (Figure 15J-Figure 15M). This stage-specificity suggests that normal H3T3P is required in very early-stage germ cells, such as GSC, GB and/or two-cell spermatogonia, to be responsible for the observed phenotypes.
Expression of another H3T3 mutant that converts T to the phosphor-mimic Aspartic acid (Asp or D) using the dual-color labeling system (Figure 9A) also randomized inheritance pattern (Figure 16A-Figure 16H). Approximately 81.2% GSC-GB pairs showed symmetric inheritance pattern (26/31 in zone III in fig. S12I) and only 16.1% GSC-GB pairs showed the opposite asymmetric inheritance pattern (5/31 in zone IV in fig. S12I) in nos>H3T3D testes, consistent with the estimation of randomized patterns (Figure 9B). The nos>H3T3D also resulted in similar germline tumor (Figure 4I-Figure 4L, Figure 141, Figure 14R-Figure 14U, Figure 14V), hub enlargement (inset in Figure 4K; Figure 14L0Figure 14M), and ectopic Zfh-1 expression in hub cells (Figure 14K), as observed in nos>H3T3A testes. Similar to the H3T3A, H3T3D-GFP driven by the bam-Gal4 driver did not lead to these phenotypes (Figure 15N-Figure 15Q). Since loss of H3T3P by H3T3A-expression and gain of H3T3P by H3T3D-expression in early stage germ cells resulted in similar histone inheritance and cellular defects, phosphorylation of H3T3 requires a tight temporal control.
The epigenetic 'writer' that generates the H3T3P mark has been characterized as the Haspin kinase (Dai et al., 2005 Genes Dev 19, 472), loss-of-function phenotypes of the haspin gene were examined. When short hairpin RNA [shRNA, (Ni et al., 2011 Nat Methods 8, 405] was used to knock down haspin in early-stage germ cells using the nos-Gal4 driver, significant decrease of H3T3P in GSC was observed [arrow in Figure 17B vs. a mitotic CySC (arrowhead)]. However, germ cell death in nos> haspin shRNA testes was much more substantial compared to nos>H3T3A or nos>H3T3D testes (Figure 171-Figure 17J, and Figure 17M), probably because Haspin has other substrate(s) required for cell survival. For example, the yeast Haspin homolog has potential substrates in the regulation of mitotic
spindle polarity (Panigada et al., 2013 Dev Cell 26, 483), and a recent proteomic study revealed many chromatin proteins as potential substrates of Haspin in Hela cells (Panigada et al., 2013 Dev Cell 26, 483).
To explore how Haspin may function with H3T3A or H3T3D in early-stage germ cells, it was examined whether halving the level of Haspin could modify either nos>H3T3A or nos>H3T3D phenotypes. Using a deficiency chromosome that uncovers the haspin gene region, it was identified that it substantially enhanced the nos>H3T3A phenotype (compare Figure 18E- Figure 18H to Figure 18A-Figure 18D, and Figure 18M) under a permissive condition for nos>H3T3A. Enhancement of the nos>H3T3A phenotype was also detected using a hypomorphic haspin™09386 allele (Venken et al., 2011 Nat Methods 8, 737), although at a lower penetrance and severity (Figure 181-Figure 18M). By contrast, halving the level of Haspin suppressed the germ cell defects induced by nos> H3T3D (compare Figure 18R- Figure 18U to Figure 18N-Figure 18Q, and Figure 18V-Figure 18W), probably due to decreased phosphorylation on endogenous H3. These opposite genetic interactions further indicate that H3T3P needs to be tightly controlled for proper H3 inheritance and germline activity.
Table 1. Quantification of preexisting vs. newly synthesized H3, H3T3A and H3T3D in GSC-GB pairs for Figure 3K and Figure 161.
Example 3: Expression of H3T3A Changes the Assymetric H3 Segregation Pattern in Mitotic GSCs.
Because expression of the H3T3A provides a loss-of-function condition for H3T3P, as described herein, it was examined whether asymmetric histone segregation is affected in H3T3A-expressing GSCs using the dual-color labeling strategy (Figure 21 A). As a control, a similar system was used with wild- type H3 and it was found that pre-existing H3-GFP and newly synthesized H3-mKO are asymmetrically segregated in telophase GSCs during the second mitosis after heat-shock-induced genetic switch (Figures 21B-Figure 21D), consistent with previous reports (Tran et al., 2012). By contrast, a dramatic shift in histone inheritance patterns from predominantly asymmetric to predominantly symmetric pattern (Figures 21H- Figure 21J) was found, using the dual-color trans-gene with H3T3A (Figure 21A). Although the majority of GSCs expressing H3T3A exhibited a symmetric pattern of histone inheritance (Figures 21H- Figure 21J), the conventional asymmetric pattern resembling that of wild-type H3 in telophase GSCs (Figures 2 IE- Figure 21G) was still detected. Surprisingly, the inverted
asymmetric pattern (Figures 3K-3M) was also observed. If pre-existing and newly synthesized histones are randomly incorporated during the first step (Figure 5B), no separation between GFP and mKO signals should be detectable during GSC asymmetric division. The fact that conventional and inverted asymmetric segregation patterns in telophase GSCs (Figures 2 IE- Figure 21 G and Figure 2 IK- Figure 21M) were identified suggests that the establishment of histone asymmetry prior to mitosis may not be affected. The observed defects in proper asymmetric segregation therefore arise upon mitotic entry when sister chromatids containing different populations of H3 need to be recognized and segregated to the appropriate daughter cell (Figure 5B, step two). Consistent with this hypothesis, separable H3T3A-GFP and H3T3A-mKO could still be detected in prophase GSCs (Figures 21N- Figure 21P and Figure 23B), but not in a control prophase GB (Figure 23C).
Because expression of H3T3A changes H3 distribution patterns in post mitotic GSC- GB pairs (see Figure 3A- Figure 31), the percentage of each of these distribution pattern was quantified. GFP signal was mainly used to account for different patterns, for example, in Figure 22J: the conventional asymmetric patterns are in zone I, with GFP ratio in GSC/GB >1.55; the symmetric patterns are in zone II, with GFP ratio in GSC/GB <1.45 but >0.69 (i.e., GB/GSC <1.45); and the inverted asymmetric patterns are in zone III, with GFP ratio in GB/GSC >1.55. The 1.5-fold cutoff is based on the quantification range of symmetric H3 distribution in spermatogonial cells and symmetric H3.3 distribution in GSC-GB pairs (Tran et al., 2012, 2013). The GFP ratio reflects the establishment of asymmetric histone distribution on sister chromatids more reliably than mKO ratio for two reasons. First, when mKO fluorescence intensity is measured in post-mitotic GSC-GB pairs, both cells are actively undergoing S phase for the next mitosis and exhibit robust incorporation of mKO- labeled newly synthesized histones (Figure 3C). Second, any histone turn-over that incorporates newly synthesized mKO-labeled histones (Deal et al., 2010; Dion et al., 2007) during processes such as transcription may not be sister chromatid-specific.
The GFP distribution patterns were quantified in post-mitotic GSC-GB pairs in H3T3A-expressing testes (Figures 22J and Figure 3J), 71.9% (46/64) of pairs showed a symmetric pattern of inheritance (Figure 22K; Table 1). By contrast, in wild-type H3- expressing testes, 87.3% (48/55) of pairs showed an asymmetric pattern of inheritance (Figure 22K; Table 1). Moreover, in H3T3A-expressing testes, asymmetric patterns could be observed in two distinct modes at lower frequencies: 9.4% (6/64) conventional asymmetry,
12.5% (8/64) inverted asymmetry, and 6.3% (4/64) at the borderline (1.45- to 1.55-fold) between asymmetry and symmetry (Figure 22K; Table 1). Noticeably, no GSC-GB pair showed the inverted asymmetric pattern (zone III in Figure 22J) in wild- type H3 -expressing testes (Figures 22J and Figure 22K), suggesting that such a pattern is specifically induced by H3T3A-expression.
Example 4: Expression of H3T3A Causes Several Germline Defects.
A spectrum of cellular defects could be detected in nos>H3T3A testes after the level of H3T3P is effectively reduced (Figures 10A- Figure 10P). Compared to testes expressing the wild-type H3 (Figures 4A- Figure 4D, Figure 25A, Figure 25D, and Figure 11 A- Figure HE), H3T3A-expressing testes exhibited phenotypes with both germline and somatic defects (Figures 4E- Figure 4H, Figure 14N- Figure 14Q, Figure 25B, Figure 25E, and Figure 11F- Figure 11 J). First, GSCs expressing the H3T3A transgene were not maintained properly. In testes without transgene or expressing H3-GFP, only germ cells with dotted spectrosome structure (de Cuevas and Spradling, 1998; Hime et al., 1996; Lin et al., 1994) were detectable next to the hub cells (Figure 25 A, arrows). However, in nos>H3T3A testes, germ cells with branched fusome structure were detected adjacent to the hub region (arrowheads in Figure 25B), suggesting that GSCs either undergo precocious differentiation or cell death, thereby allowing more differentiated spermatogonial cysts to take their place. Quantification of these two distinct cellular structures (spectrosome versus fusome) showed a significant loss of GSCs in H3T3A-expressing testes (Figure 25C). Second, a significant expansion of germline tumors carrying early-stage cellular markers, including nos-driven GFP expression (Figures 4E, Figure 4F, Figure 25E, and Figure 11F- Figure 110), spectrosome structure (Figure 4E, Figure 4G, Figure 25E, Figure 11F- Figure 110, and Figure 12A- Figure 12H), and condensed nuclei (Chen et al., 2013; Schulz et al., 2004; Tran et al., 2000) (Figures 4H and Figure 11F- Figure 110) were observed. Based on these cellular markers, the tumors of progenitor germ cells developed in nos>H3T3A testes were noticeably heterogeneous (Figure 12A- Figure 12H). For example, some tumor cells maintained strong GFP expression (Figure 12A- Figure 12H), a mark indicative of active nos-Gal4 activity, and exhibited spectrosome structure (Figure 12A- Figure 12H), suggesting that they are an early-stage GSC and/or GB cell tumor. Conversely, other tumor cells exhibited loss of GFP expression and a fusome structure (Figure 12A- Figure 12H), suggesting that they are a later-stage spermatogonial tumor. This heterogeneity in tumor types is likely due to the heterogeneity observed in histone inheritance patterns (Figures 21A- Figure 21P, Figure 3A - Figure 31, and Figure 22J
and Figure 22K). Third, the nos>H3T3A males had gradually decreased fertility (Figure IIP), consistent with the progression of germline defects (Figure 11F- Figure 110) and eventual germ cell loss (Figure 14N- Figure 14Q and Figure 14V). While the progenitor germ cell tumor phenotype was not detected in nos>H3 (n = 19) control testes, it was observed in 42.9% of nos>H3T3A testes (n = 42) (Figure 14V). The germ cell loss phenotype was detected in 15.8% of nos>H3 (n = 19) control testes but in 47.6% of nos>H3T3A testes (n = 42) (Figure 14V). The loss of germ cells in 15.8% of control testes is likely due to age-related effect (Boyle et al., 2007; Cheng et al., 2008; Toledano et al., 2012; Wallenfang et al., 2006). Last, nos>H3T3A testes (Figures 4G, inset, and Figure 25B, yellow outline) showed a substantial hub enlargement (Figure 14M) compared to nos>H3 testes (Figures 4C, inset, and Figure 25 A, yellow outline), most likely as a secondary defect due to GSC loss as reported previously (Dinardo et al., 2011; Got nczy and DiNardo, 1996; Monk et al., 2010; Tazuke et al., 2002). In summary, development of these germline defects in adult flies suggests that H3T3P is likely required for both GSC maintenance and proper differentiation of GB.
Example 5: Expression of H3T3A in Late-Stage Germ Cells or Somatic Cells Does Not Cause Germline Tumors.
The GSC loss, germline tumor and hub enlargement phenotypes in nos>H3T3A testes were specifically caused by expressing H3T3A in early-stage germ cells. A later-stage germline driver, bam-GaU (Cheng et al., 2008; Eun et al., 2014; Schulz et al., 2004) (Figure 15A), was used to turn on the same H3T3A transgene in four-cell and later stage germ cells. In doing so, H3T3P was effectively reduced in the more differentiated germ cells (Figure 15G). However, in this population of symmetrically dividing cells, the phenotypes (Figures 15 J- Figure 15M) observed in nos>H3T3A testes (Figure 4 A- Figure 4L, Figure 14N- Figurel4V, Figure 25 A- Figure 25F, Figure 11 A- Figure I IP, and Figure 12A- Figure 12H) were not detected.
In addition to GSCs, another type of adult stem cell residing in the Drosophila testis niche is the cyst stem cell (CySC), which, under normal conditions, is the only mitotically active somatic gonadal cell type (Dinardo et al., 2011). When a somatic cell-specific Tj-Gal4 driver (Tanentzapf et al., 2007) was used to express H3T3A, it is sufficient to reduce H3T3P signal specifically in CySCs (Figure 26A). However, no dramatic cellular defects were detected when comparing Tj>H3T3A (Figure 26C) with Tj>H3 testes (Figure 26B). In summary, these stage- specific and cell type-specific effects caused by H3T3A expression
suggest that the phenotype observed in nos>H3T3A testes is unlikely the result of a global perturbation of general cellular machineries.
Example 6: Expression of H3T3D in Early-, but Not Late-Stage, Germ Cells Leads to Randomized H3 Inheritance and Cellular Defects.
To further understand how H3T3P functions in GSCs, a different H3T3 mutant was expressed for which the T3 residue was converted to the phosphomimetic aspartic acid (D), under the hypothesis that such a mutation may disrupt the temporal order of H3T3 phosphorylation (Figures 1G- Figure 1L and Figure 7M - Figure 7X). Indeed, expression of H3T3D in early germ cells using a similar dual-color labeling strategy (as described for H3T3A in Figure 21 A) also randomizes pre-existing H3T3D and newly synthesized H3T3D inheritance patterns (Figures 22J, Figure 22K, and Figure 161; Table 1): approximately 79.0% (45/57) of GSC-GB pairs showed symmetric inheritance patterns, 7.0% (4/57) showed conventional asymmetry, and 10.5% (6/57) showed inverted asymmetry, with the remaining 3.5% (2/57) of pairs at the borderline between asymmetry and symmetry (1.45- to 1.55-fold). The randomized H3T3D inheritance patterns cannot be attributed to loss of H3T3P, as H3T3P is still detectable in H3T3D-expressing GSCs (Figure 24). These data suggest that it is likely the timing of the H3T3 phosphorylation that is important for normal GSC activity.
In addition, both progenitor germline tumor (Figures 41- Figure 4L and Figure 25F) and germ cell loss (Figures 14R - Figure 14U) phenotypes could be detected in nos-H3T3D testes (Figure 14V). Quantification showed significant decrease of GSCs in nos>H3T3D testes (6.84 + 0.41, n = 37) compared to that of the control nos>H3 testes (8.68 + 0.31, n = 19; p < 0.001). Moreover, similar to the nos>H3T3A testes, the hub region in nos>H3T3D testes was also enlarged compared to the control nos>H3 testes (Figures 14M and Figure 25F), most likely as a secondary effect due to the loss of GSCs. By contrast, no germline tumor phenotype was found when the same transgene H3T3D-GFP was driven by the bam- Gal4 driver (Figure 15N- Figure 15Q).
Since both reduction of H3T3P by expression of H3T3 A and the mimicking of H3T3P by expression of H3T3D result in similar histone inheritance and germline defects, phosphorylation of H3T3 might require a tight temporal control during GSC mitosis.
Therefore, expressing either the H3T3A or the H3T3D may lead to loss of this control and similar defects in histone inheritance patterns as well as abnormal germline activity.
OTHER EMBODIMENTS
While the invention has been described in conjunction with the detailed description thereof, the foregoing description is intended to illustrate and not limit the scope of the invention, which is defined by the scope of the appended claims. Other aspects, advantages, and modifications are within the scope of the following claims.
The patent and scientific literature referred to herein establishes the knowledge that is available to those with skill in the art. All United States patents and published or unpublished United States patent applications cited herein are incorporated by reference. All published foreign patents and patent applications cited herein are hereby incorporated by reference. Genbank and NCBI submissions indicated by accession number cited herein are hereby incorporated by reference. All other published references, documents, manuscripts and scientific literature cited herein are hereby incorporated by reference.
While this invention has been particularly shown and described with references to preferred embodiments thereof, it will be understood by those skilled in the art that various changes in form and details may be made therein without departing from the scope of the invention encompassed by the appended claims.
Claims
1. A method of inducing cell death in a rapidly dividing cell comprising:
contacting a rapidly dividing cell with an agent that reduces phosphorylation at threonine 3 of histone 3 (H3T3P), thereby inducing cell cycle arrest followed by cell death.
2. The method of claim 1 , wherein said rapidly dividing cell is a tumor cell.
3. The method of claim 1, wherein said agent that reduces phosphorylation of H3T3P comprises an H3T3A mutant protein or an H3T3D mutant protein.
4. The method of claim 3, wherein said H3T3A mutant protein comprises a mutant transgenic protein.
5. The method of claim 3, wherein said H3T3D mutant protein comprises a mutant transgenic protein.
6. The method of claim 3, wherein said H3T3A mutant protein comprises a point mutation of threonine 3 of H3.
7. The method of claim 3, wherein said H3T3D mutant protein comprises a point mutation of threonine 3 of H3.
8. The method of claim 6, wherein said H3T3A mutant protein comprises a substitution of threonine 3 with alanine (H3T3A).
9. The method of claim 7, wherein said H3T3D mutant protein comprises a substitution of threonine 3 with aspartic acid (H3T3D).
10. The method of claim 8, wherein said method further comprises administering a chemotherapeutic agent.
11. The method of claim 10, wherein said chemotherapeutic agent comprises radiotherapy or a cell death-inducing agent.
12. A method of inhibiting tumor growth comprising:
contacting a tumor cell with an agent that reduces phosphorylation at threonine 3 of histone 3 (H3T3P), thereby inhibiting tumor growth.
13. An isolated transgene encoding H3T3A, wherein said isolated transgene comprises SEQ ID NO: 2, SEQ ID NO: 4, or SEQ ID NO: 6.
14. An isolated transgene encoding H3T3D, wherein said isolated transgene comprises SEQ ID NO: 13, SEQ ID NO: 14, or SEQ ID NO: 15.
15. An isolated peptide comprising H3T3A, wherein said isolated peptide comprises SEQ ID NO: 8, SEQ ID NO: 10, or SEQ ID NO: 12.
16. An isolated peptide comprising H3T3D, wherein said isolated peptide comprises SEQ ID NO: 16, SEQ ID NO: 17, or SEQ ID NO: 18.
17. A kit for arresting cell cycle comprising an agent that reduces phosphorylation H3T3P.
18. The kit of claim 17, wherein said agent that reduces phosphorylation of H3T3P comprises an H3T3A mutant protein comprising a substitution of threonine 3 with alanine (H3T3A).
19. The kit of claim 17, wherein said agent that reduces phosphorylation of H3T3P comprises an H3T3D mutant protein comprising a substitution of threonine 3 with aspartic acid (H3T3D).
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US15/565,120 US10639349B2 (en) | 2015-04-06 | 2016-04-06 | H3T3A mutant protein efficiently reduces H3T3P and causes increased cell death of rapidly dividing cells |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201562143546P | 2015-04-06 | 2015-04-06 | |
| US62/143,546 | 2015-04-06 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2016164392A1 true WO2016164392A1 (en) | 2016-10-13 |
Family
ID=57072394
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2016/026114 Ceased WO2016164392A1 (en) | 2015-04-06 | 2016-04-06 | A h3t3a mutant protein efficiently reduces h3t3p and causes increased cell death of rapidly dividing cells |
Country Status (2)
| Country | Link |
|---|---|
| US (1) | US10639349B2 (en) |
| WO (1) | WO2016164392A1 (en) |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10441644B2 (en) | 2015-05-05 | 2019-10-15 | The Regents Of The University Of California | H3.3 CTL peptides and uses thereof |
Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20130267579A1 (en) * | 2007-08-22 | 2013-10-10 | The Ohio State University Research Foundation | Methods and Compositions for Inducing Deregulation of EPHA7 and ERK Phosphorylation in Human Acute Leukemias |
Family Cites Families (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN101259120B (en) | 2002-03-04 | 2012-07-04 | Hdac默克研究有限责任公司 | Methods of inducing terminal differentiation |
| WO2005028620A2 (en) | 2003-09-16 | 2005-03-31 | The Rockefeller University | Histone modifications as binary switches controlling gene expression |
| WO2010120942A2 (en) | 2009-04-14 | 2010-10-21 | The Regents Of The University Of California | Histone modification patterns for clinical diagnosis and prognosis of cancer |
| CA2849903A1 (en) | 2011-09-26 | 2013-04-04 | Celgene Corporation | Combination therapy for chemoresistant cancers |
| US8921367B2 (en) | 2012-05-31 | 2014-12-30 | Amgen Inc. | Use of AMG 900 for the treatment of cancer |
-
2016
- 2016-04-06 US US15/565,120 patent/US10639349B2/en active Active
- 2016-04-06 WO PCT/US2016/026114 patent/WO2016164392A1/en not_active Ceased
Patent Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20130267579A1 (en) * | 2007-08-22 | 2013-10-10 | The Ohio State University Research Foundation | Methods and Compositions for Inducing Deregulation of EPHA7 and ERK Phosphorylation in Human Acute Leukemias |
Non-Patent Citations (4)
| Title |
|---|
| ANTONI ET AL.: "A small-molecule inhibitor of Haspin alters the kinetochore functions of Aurora B", J. CELL BIOL., vol. 199, no. 2, 15 October 2012 (2012-10-15), pages 269 - 284, XP055322655 * |
| TRAN ET AL.: "Asymmetric Division of Drosophila Male Germline Stem Cell Shows Asymmetric Histone Distribution", SCIENCE, vol. 338, 2 November 2012 (2012-11-02), pages 679 - 682, XP055322668 * |
| VAGNARELLI ET AL.: "Repo-Man Coordinates Chromosomal Reorganization with Nuclear Envelope Reassembly during Mitotic Exit", DEVELOPMENTAL CELL, vol. 21, no. 2, 16 August 2011 (2011-08-16), pages 328 - 342, XP028262140 * |
| X IE ET AL.: "Histone H3 Threonine Phosphorylation Regulates Asymmetric Histone Inheritance in the Drosophila Male Germline", CELL, vol. 163, no. 4, 5 November 2016 (2016-11-05), pages 920 - 933, XP055322699 * |
Cited By (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10441644B2 (en) | 2015-05-05 | 2019-10-15 | The Regents Of The University Of California | H3.3 CTL peptides and uses thereof |
| US10849965B2 (en) | 2015-05-05 | 2020-12-01 | The Regents Of The University Of California | H3.3 CTL peptides and uses thereof |
| US11185577B2 (en) | 2015-05-05 | 2021-11-30 | The Regents Of The University Of California | H3.3 CTL peptides and uses thereof |
| US11925679B2 (en) | 2015-05-05 | 2024-03-12 | The Regents Of The University Of California | H3.3 CTL peptides and uses thereof |
Also Published As
| Publication number | Publication date |
|---|---|
| US10639349B2 (en) | 2020-05-05 |
| US20180256680A1 (en) | 2018-09-13 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| Pane et al. | The Cutoff protein regulates piRNA cluster expression and piRNA production in the Drosophila germline | |
| Rosu et al. | The C. elegans DSB-2 protein reveals a regulatory network that controls competence for meiotic DSB formation and promotes crossover assurance | |
| Beatty et al. | The C. elegans homolog of Drosophila Lethal giant larvae functions redundantly with PAR-2 to maintain polarity in the early embryo | |
| Archambault et al. | Mutations in Drosophila Greatwall/Scant reveal its roles in mitosis and meiosis and interdependence with Polo kinase | |
| Mische et al. | Dynein light intermediate chain: an essential subunit that contributes to spindle checkpoint inactivation | |
| Willsey et al. | Katanin-like protein Katnal2 is required for ciliogenesis and brain development in Xenopus embryos | |
| Nadarajan et al. | The MAP kinase pathway coordinates crossover designation with disassembly of synaptonemal complex proteins during meiosis | |
| Morris et al. | Function and regulation of the Caenorhabditis elegans Rab32 family member GLO-1 in lysosome-related organelle biogenesis | |
| Baxley et al. | The role of the Suppressor of Hairy-wing insulator protein in Drosophila oogenesis | |
| Kumar et al. | Syndapin is dispensable for synaptic vesicle endocytosis at the Drosophila larval neuromuscular junction | |
| Leung et al. | Drosophila tweety facilitates autophagy to regulate mitochondrial homeostasis and bioenergetics in Glia | |
| US10639349B2 (en) | H3T3A mutant protein efficiently reduces H3T3P and causes increased cell death of rapidly dividing cells | |
| Eguchi et al. | The Drosophila DOCK family protein sponge is involved in differentiation of R7 photoreceptor cells | |
| Fan et al. | Multifunctional RNA processing protein SRm160 induces apoptosis and regulates eye and genital development in Drosophila | |
| Sharma et al. | Differential expression of Cux-1 and p21 in polycystic kidneys from Pkd1 null and cpk mice | |
| US20070122395A1 (en) | Genetic and pharmacological regulation of antidepressant-sensitive biogenic amine transporters through PKG/p38 map kinase | |
| CA2408166A1 (en) | Presenilin enhancers | |
| WO2022072793A1 (en) | Marf/mfn modulators and uses thereof | |
| Vasileva et al. | ZAD mediates chromatin binding and insulator activity of Drosophila Pita and can be replaced with the human ZFP276 ZAD-like domain | |
| Bhandari | The Role of 5’-Tyrosyl-DNA-Phosphodiesterase TWB (TDPT-1) Mediated Suppression of DNA Topoisomerase 2 (TOP-2) During Meiosis in C. elegans | |
| US20240350581A1 (en) | Methods for treatment of neuron degeneration | |
| Koch | How PAR Polarity Is Established and Regulates Spindle Positioning in Early C. elegans Embryo | |
| ES3034207T3 (en) | Single immunoglobulin interleukin-1 receptor related (sigirr) variants and uses thereof | |
| Hauck | Function of Cytoplasmic FMR1-interacting protein 2 (CYFIP2) in spinal motor neuron morphology during mouse embryonic development | |
| Popiel | The Role of the Kinase MRCK-1 in Seamless Tube Development in Caenorhabditis elegans |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 16777156 Country of ref document: EP Kind code of ref document: A1 |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| 32PN | Ep: public notification in the ep bulletin as address of the adressee cannot be established |
Free format text: NOTING OF LOSS OF RIGHTS PURSUANT TO RULE 112(1) EPC (EPO FORM 1205 DATED 02/02/2018) |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 16777156 Country of ref document: EP Kind code of ref document: A1 |














