WO2016160976A2 - Monovalent tnf binding proteins - Google Patents
Monovalent tnf binding proteins Download PDFInfo
- Publication number
- WO2016160976A2 WO2016160976A2 PCT/US2016/024992 US2016024992W WO2016160976A2 WO 2016160976 A2 WO2016160976 A2 WO 2016160976A2 US 2016024992 W US2016024992 W US 2016024992W WO 2016160976 A2 WO2016160976 A2 WO 2016160976A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- binding protein
- polypeptide
- seq
- binding
- tnfα
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/24—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
- C07K16/241—Tumor Necrosis Factors
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/24—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
- C07K16/244—Interleukins [IL]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/64—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising a combination of variable region and constant region components
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/94—Stability, e.g. half-life, pH, temperature or enzyme-resistance
Definitions
- the present disclosure provides novel TNF ⁇ binding proteins and methods of treatment using the same. Also provided are nucleic acids encoding the binding proteins and 25 recombinant expression vectors and host cells for making such binding proteins.
- the present disclosure is based, at least in part, on the discovery that multivalent binding proteins which have a single monovalent binding specificity for TNF ⁇ (e.g., anti-TNF ⁇ monoclonal antibodies) (i.e., each binding protein is only able to bind to one TNF ⁇ molecule, e.g., on the surface of an antigen presenting cell) and bivalent for a second specificity), exhibit improved 30 half-life over multivalent binding proteins having binding specificity for multiple TNF ⁇ molecules (see Figures 1 and 2).
- a binding protein comprising first, second, third and fourth polypeptide chains
- said first polypeptide chain comprises VD1-(X1)n- VD2-C-(X2)n
- VD1 is a first heavy chain variable domain
- VD2 is a second heavy chain variable domain
- C is a CH1 domain
- X1 is a linker with the proviso that it is not a constant domain
- n is 0 or 1
- X2 is an Fc region
- said second polypeptide chain comprises VD1-(X1)n-VD2-C, wherein VD1 is a first light chain variable domain, VD2 is a second light chain variable domain, C is a CL domain
- X1 is a linker with the proviso that it 5 is not a constant domain
- n is 0 or 1
- the VD1 of the heavy chain and the VD1 of the light chain form a functional binding site and wherein the VD2 of the heavy chain and the VD2 of
- polypeptide chain comprises VD3-C, wherein VD3 is a first light chain variable domain; and C is a CL domain; wherein the VD3 of the heavy chain and the VD3 of the light chain form a functional binding site for TNF ⁇ .
- the TNF ⁇ is human TNF ⁇ .
- the VD3 heavy chain variable domain and the VD3 light chain variable 15 domain are a heavy chain variable domain and a light chain variable domain from infliximab, adalimumab, certolizumab pegol, or golimumab.
- the Fc region of the first and third polypeptide chains each comprises a mutation, wherein said mutations on the two Fc regions enhance
- the Fc 20 region of one of the first polypeptide and the second polypeptide comprises the sequence of SEQ ID NO: 121 and the Fc region of the other of the first polypeptide and the second polypeptide comprises the sequence of SEQ ID NO: 137.
- the Fc region of the first and third polypeptide chains comprise one or more of the sequences provided in Table 4.
- the non-TNF ⁇ antigen is a soluble ligand.
- the non-TNF ⁇ antigen is IL-17. In some embodiments, the non-TNF ⁇ antigen is human IL-17.
- VD1 of the first polypeptide comprises CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 114-116
- VD2 of the first polypeptide comprises the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 118-120
- VD1 of the second polypeptide comprises the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 124-126
- 10 VD2 of the second polypeptide comprises the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 128-130
- VD3 of the third polypeptide comprises the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 134-136
- VD3 of the fourth polypeptide comprises the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 140-142.
- VD1- (X1)n-VD2 of the first polypeptide comprise the sequence of SEQ ID NO: 113
- VD1-(X1)n- 15 VD2 of the second polypeptide comprise the sequence of SEQ ID NO: 123
- VD3 of the third polypeptide comprises the sequence of SEQ ID NO: 133
- VD3 of the fourth polypeptide comprises the sequence of SEQ ID NO: 139.
- the first polypeptide comprises the sequence of SEQ ID NO: 112
- the second polypeptide comprises the sequence of SEQ ID NO: 122
- the third polypeptide comprises the sequence of SEQ ID NO: 132
- 20 the fourth polypeptide comprises the sequence of SEQ ID NO: 138.
- a binding protein comprising first, second, third and fourth polypeptide chains
- said first polypeptide chain comprises VD1-(X1)n- VD2-C-(X2)n
- VD1 is a first heavy chain variable domain
- VD2 is a second heavy chain variable domain
- C is a CH1 domain
- X1 is a linker with the proviso that it is not a 25 constant domain
- n is 0 or 1
- X2 is an Fc region
- said second polypeptide chain comprises VD1-(X1)n-VD2-C, wherein VD1 is a first light chain variable domain, VD2 is a second light chain variable domain, C is a CL domain
- X1 is a linker with the proviso that it is not a constant domain
- the VD1 of the heavy chain and the VD1 of the light chain form a 30 functional binding site and wherein the VD2 of the heavy chain and the VD2 of the light chain form a functional binding site; and wherein the VD1 and VD2 functional binding sites bind TNF ⁇ ; and wherein said third polypeptide chain comprises VD3-C-(X1)n, wherein VD3 is a third heavy chain variable domain, C is a CH1 domain, X1 is an Fc region, and n is 0 or 1; wherein said fourth polypeptide chain comprises VD3-C, wherein VD3 is a first light chain variable domain; and C is a CL domain; wherein the VD3 of the heavy chain and the VD3 of the light chain form a functional binding site for a non-TNF ⁇ antigen.
- the TNF ⁇ is human TNF ⁇ .
- the VD1 and VD2 heavy chain variable domains and light 5 chain variable domains are heavy chain variable domains and light chain variable domains from infliximab, adalimumab, certolizumab pegol, or golimumab.
- the Fc region of the first and third polypeptide chains each comprises a mutation, wherein said mutations on the two Fc regions enhance
- the Fc 10 region of one of the first polypeptide and the second polypeptide comprises the sequence of SEQ ID NO: 153 and the Fc region of the other of the first polypeptide and the second polypeptide comprises the sequence of SEQ ID NO: 169.
- the Fc region of the first and third polypeptide chains comprise one or more of the sequences provided in Table 4.
- the non-TNF ⁇ antigen is a soluble ligand.
- the non-TNF ⁇ antigen is IL-17. In some embodiments, the non-TNF ⁇ antigen is human IL-17.
- the binding protein comprises one or more of the sequences provided in Tables 2, 5 or 6. In some embodiments, the binding protein comprises one or 20 more of the sequences of SEQ ID NOs: 144-175. In some embodiments, the VD1 and VD2 heavy chain variable domains and light chain variable domains comprise one or more of the sequences provided in Table 2, 5 or 6. In some embodiments, the VD3 heavy chain variable domain and light chain variable domain comprise one or more of the sequences provided in Tables 3. In some embodiments, the first polypeptide comprises the sequence of SEQ ID 25 NO: 144, the second polypeptide comprises the sequence of SEQ ID NO:154 the third
- polypeptide comprises the sequence of SEQ ID NO: 164 and the fourth polypeptide comprises the sequence of SEQ ID NO: 170.
- a binding protein comprising one or more of the sequences in Tables 5 or 6. In some embodiments, the binding protein comprises one or 30 more of the sequences of SEQ ID NOs: 112-143. In some embodiments, the binding protein comprises one or more of the sequences of SEQ ID NOs: 144-175.
- a method of treating a TNF-associated disorder in a subject in need thereof comprising administering to the subject an effective amount of any one of the binding proteins described herein.
- a nucleic acid encoding any one of the binding proteins described herein is provided.
- a vector expressing the nucleic acid is provided.
- a host cell comprising the vector is provided.
- a method of producing a binding protein is provided, comprising culturing the host cell in culture medium 5 under conditions sufficient to produce the binding protein.
- a pharmaceutical composition comprising any one of the binding proteins described herein, and a pharmaceutically acceptable carrier. 10
- Figure 1B represents a MBMM1 (PR-1621615), which has bivalent binding
- Figure 2B represents JMB-GS molecules, which have bivalent in-tandem binding 20 specificity for TNF ⁇ .
- Figure 2C represents Ambromab molecules, which have monovalent in-tandem binding specificity for TNF ⁇ and IL-17.
- Figure 3A illustrates the serum concentration of MBMM2 after 5 mg/kg IV dose in CD-1 mice (Table 10).
- Figure 3B illustrates the serum concentration of MBMM2 after 5 mg/kg IV dose in CD-1 mice (Table 12).
- Figure 3C illustrates the superior pK characteristics of MBMM2 over MBMM1 after 5 mg/kg IV dose in CD-1 mice.
- FIG 4 illustrates the serum concentration of TV-GS Molecule after 5 mg/kg IV 30 dose in CD-1 mice (PR-1580725) (Table 15).
- Figure 5 illustrates the serum concentration of TV-GS Molecule after 5 mg/kg IV dose in CD-1 mice (PR-1603912) (Table 17).
- Figure 6 illustrates the serum concentration of TV-LS Molecule after 5 mg/kg IV dose in CD-1 mice (PR-1580724) (Table 19).
- FIG 8 illustrates the serum concentration of Ambromabs (PR-1603912 and PR- 1603915) TV-GS (PR-1580725), TV-LS (PR-1580724), and JMB-GS Tandem (PR-1603136) Molecules after 5 mg/kg IV dose in CD-1 mice (PR-1603136) (Table 23).
- the present disclosure provides novel TNF binding proteins and methods of treatment using the same. Also provided are nucleic acids encoding the binding proteins and recombinant expression vectors and host cells for making such binding proteins.
- the present disclosure is based, at least in part, on the discovery that bivalent TNF binding proteins (e.g., anti-TNF monoclonal antibodies) can bind to TNF on the cell surface of antigen presenting 15 cells and become internalized.
- the binding proteins disclosed herein are generally
- each binding protein is only able to bind to one TNF molecule on the surface of an antigen presenting cell.
- the monovalency with regard to TNF binding of these trivalent molecules resulted in enhanced
- human TNF ⁇ includes recombinant human TNF ⁇ , which can be prepared by standard recombinant expression methods or purchased commercially (R & D Systems, Catalog No. 210-TA, Minneapolis, Minn.).
- TNF- ⁇ is a multifunctional pro-inflammatory cytokine secreted predominantly by monocytes/macrophages that also has effects on lipid metabolism, 10 coagulation, insulin resistance, and endothelial function.
- TNF- ⁇ triggers pro-inflammatory pathways that result in tissue injury, such as degradation of cartilage and bone, induction of adhesion molecules, induction of pro-coagulant activity on vascular endothelial cells, an increase in the adherence of neutrophils and lymphocytes, and stimulation of the release of platelet activating factor from macrophages, neutrophils and vascular endothelial cells.
- infliximab refers to the anti-TNF antibody marketed as REMICADE ® , having Chemical Abstracts Service (CAS) designation 170277-31-3.
- gliumab refers to the anti-TNF antibody marketed as SIMPONI ® , having Chemical Abstracts Service (CAS) designation 476181-74-5.
- certolizumab pegol refers to the anti-TNF antibody marketed as
- adalimumab or“D2E7” refer to the anti-TNF antibody marketed as HUMIRA ® , having Chemical Abstracts Service (CAS) designation 331731-18-1.
- etanercept refers to the anti-TNF antibody marketed as ENBREL ® , having Chemical Abstracts Service (CAS) designation 1094-08-2.
- IL-17 refers to an inflammatory cytokine produced by T H 17 T cells that contributes to the etiology of a number of inflammatory diseases.
- IL-17A may exist as either a homodimer or as a heterodimer complexed with its homolog IL-17F to form heterodimeric IL-17A/F.
- IL-17A and IL-17F share 55% amino acid identity and bind to the same receptor (IL-17R), which is expressed on a wide variety of cells 30 including vascular endothelial cells, peripheral T cells, B cells, fibroblast, lung cells,
- antibody refers to any immunoglobulin (Ig) molecule comprised of four 5 polypeptide chains, two heavy (H) chains and two light (L) chains, or any functional
- mutant, variant, or derivative antibody formats are known in the art. Non-limiting embodiments of which are discussed below.
- CDR is a 30 CDR as defined by Kabat, based on sequence comparisons.
- frame region refers to the amino acid residues that are part of the variable region, but are not part of the CDRs (e.g., using the Kabat definition of CDRs).
- Fc region is used to define the C-terminal region of an immunoglobulin heavy chain, which may be generated by papain digestion of an intact antibody.
- the Fc region may be a native sequence Fc region or a variant Fc region.
- the Fc region of an immunoglobulin generally comprises two constant domains, a CH2 domain and a CH3 5 domain, and optionally comprises a CH4 domain. Replacements of amino acid residues in the Fc portion to alter antibody effector function are known in the art (Winter et al. U.S.
- Neonatal Fc receptors are the critical components 15 determining the circulating half-life of antibodies.
- at least one amino acid residue is replaced in the constant region of the antibody, e.g., the Fc region of the antibody, such that effector functions of the antibody are altered.
- the dimerization of two identical heavy chains of an immunoglobulin is mediated by the dimerization of CH3 domains and is stabilized by the disulfide bonds within the hinge region (Huber et al. (1976) 20 Nature 264: 415-20; Thies et al. (1999) J. Mol. Biol.293: 67-79).
- binding fragments encompassed within the term "antigen-binding portion" of an antibody with regard to the trivalent molecules of the present disclosure include fragments that comprise (i) a trivalent fragment consisting of one VH-VH- CH1, one VL-VL-CL, one VH-CH1, and one VL-CL where the anti TNF binder is on the monovalent arm; (ii) a trivalent fragment consisting of one VH-VH-CH1, one VL-VL-CL, one VH-CH1, and one VL-CL where the anti TNF binder is on the bivalent arm; (iii) a F(ab') 2 fragment of the above, a trivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iv) a triabody where two of the variable domains are the 5 same and the third is different; (v) a t
- the two domains of the Fv fragment, VH and VL are coded for by separate genes, they can be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the VH and VL regions pair to form monovalent molecules (known as single chain Fv (scFv).
- scFv single chain Fv
- Such 10 single chain antibodies are also intended to be encompassed within the term "antigen-binding portion" of an antibody.
- Other forms of single chain antibodies, such as diabodies are also encompassed.
- antigens may be the same or different.
- bispecific refers to a binding molecule that binds two different antigens.
- trivalent refers to a binding molecule that binds three antigens. The antigens may be the same or different.
- trispecific refers to a binding molecule that binds three different antigens.
- the term “specifically binds to” refers to the ability of a binding
- the binding polypeptides of the invention are capable of specifically binding to two or more antigens which are related in sequence.
- the binding polypeptides of the invention can specifically bind to both human and a non-human (e.g., mouse or non-human primate) ortholog of an antigen.
- polypeptide refers to any polymeric chain of amino acids.
- polypeptide and protein are used interchangeably with the term polypeptide and also refer to a polymeric chain of amino acids.
- polypeptide encompasses native or artificial proteins, protein fragments and polypeptide analogs of a protein sequence.
- a polypeptide may be monomeric or polymeric.
- K on refers to the on rate constant for association of an antibody to the antigen to form the antibody/antigen complex.
- K off refers to the off rate constant for dissociation of an antibody from the antibody/antigen complex.
- Kd refers to the dissociation constant of a particular antibody-antigen interaction.
- vector refers to a nucleic acid molecule capable of transporting another 20 nucleic acid to which it has been linked.
- plasmid refers to a circular double stranded DNA loop into which additional DNA segments may be ligated.
- viral vector Another type of vector is a viral vector, wherein additional DNA segments may be ligated into the viral genome.
- Certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors having a bacterial origin of replication 25 and episomal mammalian vectors).
- vectors e.g., non-episomal mammalian vectors
- vectors can be integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome.
- certain vectors are capable of directing the expression of genes to which they are operatively linked.
- Such vectors are referred to herein as "recombinant expression vectors” (or simply, "expression vectors”).
- expression vectors of utility in recombinant DNA techniques are often in the form of plasmids.
- plasmid and vector may be used interchangeably as the plasmid is the most commonly used form of vector.
- the invention is intended to include such other forms of expression vectors, such as viral vectors (e.g., replication defective retroviruses, adenoviruses and adeno-associated viruses), which serve equivalent functions.
- host cell refers to a cell into which exogenous DNA has been introduced. Such terms are intended to refer not only to the 5 particular subject cell, but, to the progeny of such a cell. Because certain modifications may occur in succeeding generations due to either mutation or environmental influences, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope of the term "host cell” as used herein.
- host cells include prokaryotic and eukaryotic cells selected from any of the Kingdoms of life.
- Preferred eukaryotic cells include 10 protist, fungal, plant and animal cells. Most preferably host cells include but are not limited to the prokaryotic cell line E. Coli; mammalian cell lines CHO, HEK 293 and COS; the insect cell line Sf9; and the fungal cell Saccharomyces cerevisiae. II. Improved TNF Binding Proteins
- the binding proteins exhibit monovalent binding to TNF alpha on the surface of a cell (e.g., an antigen presenting cell), i.e., each binding protein is only able to bind to one TNF molecule on the surface of an antigen presenting).
- the binding proteins disclosed herein binds to human TNF, wherein the binding protein exhibits a reduced of cellular 20 internalization upon binding to cell surface TNF compared to the cellular internalization
- a reference antibody e.g., infliximab, adalimumab, certolizumab pegol, or golimumab.
- the TNF binding domains of known TNF binding agents are reformatted to produce the novel TNF binding proteins disclosed herein.
- the TNF binding 25 domains of any TNF binding agents can be employed.
- the variable domains (or CDRs thereof) of the anti-TNF antibodies infliximab, adalimumab, certolizumab pegol, and/or golimumab are employed.
- the TNF binding domain of etanercept is employed.
- one or more of the variable domain amino an amino acid set forth in Tables 2, 3, 5, and 6 are employed.
- a binding protein comprising first, second, third and fourth polypeptide chains
- said first polypeptide chain comprises VD1-(X1)n- VD2-C-(X2)n
- VD1 is a first heavy chain variable domain
- VD2 is a second heavy chain variable domain
- C is a CH1 domain
- X1 is a linker with the proviso that it is not a constant domain
- n is 0 or 1
- X2 is an Fc region
- said second polypeptide chain comprises VD1-(X1)n-VD2-C, wherein VD1 is a first light chain variable domain, VD2 is a second light chain variable domain, C is a CL domain
- X1 is a linker with the proviso that it is not a constant domain
- n is 0 or 1
- the VD1 of the heavy chain and the VD1 of the light chain form a functional binding site and wherein the VD2 of the heavy chain and the 5 VD
- said third polypeptide chain comprises VD3-C-(X1)n, wherein VD3 is a third heavy chain variable domain, C is a CH1 domain, X1 is an Fc region, and n is 0 or 1; wherein said fourth polypeptide chain comprises VD3-C, wherein VD3 is a first light chain variable domain; and C is a CL domain; wherein 10 the VD3 of the heavy chain and the VD3 of the light chain form a functional binding site for TNF ⁇ .
- a binding protein comprising first, second, third and fourth polypeptide chains
- said first polypeptide chain comprises VD1-CH- (X2)n, wherein VD1 is a first heavy chain variable domain, CH is a heavy chain constant15 domain, and X2 is an Fc region
- said second polypeptide chain comprises VD1 -CL- (X2)n, wherein VD1 is a first light chain variable domain, VD2 is a second light chain variable domain, CL is a light chain constant domain, X2 does not comprise an Fc region
- said third polypeptide chain comprises VD2-(X3)n-VD3-CL-(X4)n, wherein VD2 is a second heavy chain variable domain, VD3 is a third heavy chain variable domain, CL is a 20 light chain constant domain, X3 is a linker with the proviso that it is not a constant domain, and X4 is an Fc region
- said fourth polypeptide chain comprises VD2-(X3)n-VD3-CL-
- the Fc region of the first and third polypeptide chains each comprises 30 a mutation, wherein said mutations on the two Fc regions enhance heterodimerization of the first and third polypeptide chains.
- the VD1 domains that form the functional binding site for human TNF ⁇ are from infliximab, adalimumab, certolizumab pegol, or golimumab.
- the binding protein binds monovalently to cell surface human TNF on antigen presenting cells.
- the non-TNF ⁇ antigen is a soluble ligand.
- the non-TNF ⁇ antigen is IL17.
- a method of treating a TNF-associated disorder in a subject in need thereof comprising administering to the subject an effective amount of the binding protein.
- the TNF binding proteins are receptor DVD (rDVD)
- linker can be used in the TNF binding proteins disclosed herein.
- the linker comprises amino an amino acid sequence selected from those set forth in Table 1.
- the IL-17 binding protein or domains comprise one or more amino acid sequences selected from those set forth in Table 3 or any of those disclosed in US Patent No: 8,835,610, which is incorporated by reference herein for any purpose.
- any Fc mutants can be used to achieve the half-molecules disclosed herein.
- the Fc mutants are selected from those set forth in Table 4.
- the binding protein may dissociate from the 5 target with a k off rate constant of about 1 x 10 -3 s -1 or less, as determined by surface plasmon resonance, or may inhibit the target with an IC 50 of about 1 x 10 -8 M or less.
- binding protein may dissociate from the target with a k off rate constant of about 1 x 10 -4 s -1 or less, as determined by surface plasmon resonance, or may inhibit its activity with an IC 50 of about 1 x 10 -9 M or less.
- binding protein may dissociate from the target with a 10 k -5
- binding protein may dissociate from the target with a k off rate constant of about 1 x 10 -5 s -1 or less, as determined by surface plasmon resonance, or may inhibit its activity with an IC 50 of about 1 x 10 -11 M or less.
- the engineered binding protein comprises a heavy chain constant region, such as an IgG1, IgG2, IgG3, IgG4, IgA, IgE, IgM or IgD constant region.
- the heavy chain constant region is an IgG1 heavy chain constant region or an IgG4 heavy chain constant region.
- the binding protein can comprise a light chain constant region, either a kappa light chain constant region or a lambda light chain 20 constant region.
- the binding protein comprises a kappa light chain constant region.
- the binding protein portion can be, for example, a Fab fragment or a single chain Fv fragment.
- the engineered binding protein comprises an engineered effector function known in the art.
- the Fc portion of a binding protein mediates several25 important effector functions, e.g., cytokine induction, ADCC, phagocytosis, CDC, and half- life/ clearance rate of binding protein and antigen-binding protein complexes. In some cases these effector functions are desirable for therapeutic binding protein but in other cases might be unnecessary or even deleterious, depending on the therapeutic objectives.
- Neonatal Fc receptors are the critical components determining the circulating half-life of binding proteins.
- at least one amino acid residue is replaced in the constant region of the binding protein, for example the Fc region of the binding protein, such that effector functions of the binding protein are altered.
- Useful detectable agents with which a binding protein or binding protein portion of the invention may be derivatized include fluorescent compounds.
- Exemplary fluorescent detectable agents include fluorescein, fluorescein isothiocyanate, rhodamine, 5- dimethylamine-1-napthalenesulfonyl chloride, phycoerythrin and the like.
- a binding protein 15 may also be derivatized with detectable enzymes, such as alkaline phosphatase, horseradish peroxidase, glucose oxidase and the like. When a binding protein is derivatized with a detectable enzyme, it is detected by adding additional reagents that the enzyme uses to produce a detectable reaction product.
- a binding protein may also be derivatized with biotin, and detected through indirect measurement of avidin or streptavidin binding.
- the engineered binding protein is further modified to generate glycosylation site mutants in which the O- or N-linked glycosylation site of the binding protein has been mutated.
- glycosylation site mutants in which the O- or N-linked glycosylation site of the binding protein has been mutated.
- One skilled in the art can generate such mutants using standard 25 well-known technologies.
- Glycosylation site mutants that retain the biological activity, but have increased or decreased binding activity, are another object of the present invention.
- the glycosylation of the engineered binding protein or antigen-binding portion of the invention is modified.
- an aglycoslated binding protein can be made (i.e., the binding protein lacks glycosylation).
- Glycosylation can be 30 altered to, for example, increase the affinity of the binding protein for antigen.
- an engineered binding protein of the invention can be 5 further modified with an altered type of glycosylation, such as a hypofucosylated binding protein having reduced amounts of fucosyl residues or a binding protein having increased bisecting GlcNAc structures.
- an altered glycosylation patterns have been demonstrated to increase the ADCC ability of binding proteins.
- carbohydrate modifications can be accomplished by, for example, expressing the binding protein in a host cell with altered 10 glycosylation machinery. Cells with altered glycosylation machinery have been described in the art and can be used as host cells in which to express recombinant binding proteins of the invention to thereby produce a binding protein with altered glycosylation. See, for example, Shields et al. (2002) J. Biol. Chem.277: 26733-26740; Umana et al. (1999) Nat. Biotech.17: 176-1, as well as, European Patent No: EP 1,176,195; and PCT Publications Nos WO
- yeast strains have been genetically modified to express non-naturally occurring glycosylation enzymes such that glycosylated proteins (glycoproteins) produced in these yeast strains exhibit protein glycosylation identical 20 to that of animal cells, especially human cells (U.S. Patent Nos.7,449,308 and 7,029,872 and PCT Publication No. WO2005100584 A2).
- glycosylated proteins glycosylated proteins
- TNF Binding proteins of the present invention may be produced by any of a number 25 of techniques known in the art. For example, expression from host cells, wherein expression vector(s) encoding the heavy and light chains is (are) transfected into a host cell by standard techniques.
- the various forms of the term "transfection" are intended to encompass a wide variety of techniques commonly used for the introduction of exogenous DNA into a prokaryotic or eukaryotic host cell, e.g., electroporation, calcium-phosphate precipitation, 30 DEAE-dextran transfection and the like. Although it is possible to express the binding
- binding proteins of the invention in either prokaryotic or eukaryotic host cells, expression of binding proteins in eukaryotic cells is preferable, and most preferable in mammalian host cells, because such eukaryotic cells (and in particular mammalian cells) are more likely than prokaryotic cells to assemble and secrete a properly folded and immunologically active binding protein.
- Preferred mammalian host cells for expressing the recombinant binding proteins of the invention include Chinese Hamster Ovary (CHO cells) (including dhfr- CHO cells, 5 described in Urlaub and Chasin (1980) Proc. Natl. Acad. Sci. USA 77:4216-4220, used with a DHFR selectable marker, e.g., as described in Kaufman and Sharp (1982) Mol. Biol.
- Chinese Hamster Ovary CHO cells
- dhfr- CHO cells including dhfr- CHO cells, 5 described in Urlaub and Chasin (1980) Proc. Natl. Acad. Sci. USA 77:4216-4220, used with a DHFR selectable marker, e.g., as described in Kaufman and Sharp (1982) Mol. Biol.
- Host cells can also be used to produce functional binding protein fragments, such as Fab fragments or scFv molecules. It will be understood that variations on the above
- 15 procedure are within the scope of the present invention.
- Recombinant DNA technology may also be used to remove some, or all, of the DNA encoding either or both of the light and heavy chains that is not necessary for binding to the antigens of interest.
- the molecules 20 expressed from such truncated DNA molecules are also encompassed by the binding proteins of the invention.
- a recombinant expression vector encoding both the binding protein heavy chain and the binding protein light chain is introduced into dhfr- CHO cells by calcium phosphate-mediated transfection.
- the binding protein heavy and light chain genes are each operatively linked to CMV
- the recombinant expression vector also carries a DHFR gene, which allows for selection of CHO cells that have been transfected with the vector using methotrexate selection/amplification.
- the selected transformant host cells are cultured to allow for expression of the binding protein heavy and light chains and intact binding protein is recovered from the culture medium.
- Standard molecular biology techniques are used to prepare the recombinant expression vector, transfect the host cells, select for transformants, culture the host cells and recover the binding protein from the culture medium.
- the invention provides a method of synthesizing a recombinant binding protein of the
- compositions by culturing a host cell of the invention in a suitable culture medium until a recombinant binding protein of the invention is synthesized.
- the method can further comprise isolating the recombinant binding protein from the culture medium. 10 V.
- compositions comprising one or more binding proteins, either alone or in combination with prophylactic agents, therapeutic agents, and/or pharmaceutically acceptable carriers are provided.
- the pharmaceutical compositions comprising binding proteins provided herein are for use in, but not limited to, diagnosing, 15 detecting, or monitoring a disorder, in preventing, treating, managing, or ameliorating a
- compositions either alone or in combination with prophylactic agents, therapeutic agents, and/or pharmaceutically acceptable carriers, are known to one skilled in the art (see e.g., US Patent No.9,035,027).
- Methods of administering a prophylactic or therapeutic agent provided herein include, but are not limited to, parenteral administration (e.g., intradermal, intramuscular,
- mucosal administration e.g., intranasal and oral routes
- pulmonary administration e.g., aerosolized compounds administered with an inhaler or nebulizer.
- the 25 formulation of pharmaceutical compositions for specific routes of administration, and the materials and techniques necessary for the various methods of administration are available and known to one skilled in the art (see e.g., US Patent No.9,035,027).
- Dosage regimens may be adjusted to provide the optimum desired response (e.g., a therapeutic or prophylactic response). For example, a single bolus may be administered, 30 several divided doses may be administered over time or the dose may be proportionally
- dosage unit form refers to physically discrete units suited as unitary dosages for the mammalian subjects to be treated; each unit containing a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier.
- the specification for the dosage unit forms provided herein are dictated by and directly dependent on (a) the unique characteristics of the active compound and the particular therapeutic or prophylactic 5 effect to be achieved, and (b) the limitations inherent in the art of compounding such an
- An exemplary, non-limiting range for a therapeutically or prophylactically effective amount of a binding protein provided herein is 0.1-20 mg/kg, for example, 1-10 mg/kg. It is to be noted that dosage values may vary with the type and severity of the condition to be 10 alleviated. It is to be further understood that for any particular subject, specific dosage
- regimens may be adjusted over time according to the individual need and the professional judgment of the person administering or supervising the administration of the compositions, and that dosage ranges set forth herein are exemplary only and are not intended to limit the scope or practice of the claimed composition.
- TNF-associated disorder in a subject by administering to the individual in need of such treatment a therapeutically effective amount a TNF binding molecule disclosed herein.
- Such methods can be used to 20 treat any TNF-associated disorder including, without limitation: A. Sepsis
- Tumor necrosis factor has an established role in the pathophysiology of sepsis, with biological effects that include hypotension, myocardial suppression, vascular leakage 25 syndrome, organ necrosis, stimulation of the release of toxic secondary mediators and
- a TNF binding protein of the invention can be used to treat sepsis in any of its clinical settings, including septic shock, endotoxic shock, gram negative sepsis and toxic shock syndrome.
- a combination of the invention can be coadministered 30 with one or more additional therapeutic agents that may further alleviate sepsis, such as an interleukin-1 inhibitor (such as those described in PCT Publication Nos. WO 92/16221 and WO 92/17583), the cytokine interleukin-6 (see e.g., PCT Publication No. WO 93/11793) or an antagonist of platelet activating factor (see e.g., European Patent Application Publication No. EP 374510).
- additional therapeutic agents such as an interleukin-1 inhibitor (such as those described in PCT Publication Nos. WO 92/16221 and WO 92/17583), the cytokine interleukin-6 (see e.g., PCT Publication No. WO 93/11793) or an antagonist of platelet activating factor (see e.g., European Patent Application Publication No. EP 374510).
- additional therapeutic agents such as an interleukin-1 inhibitor (such as those described in PC
- a TNF binding protein of the invention is administered to a human subject within a subgroup of sepsis patients having a serum or 5 plasma concentration of IL-6 above 500 pg/ml (e.g., above 1000 pg/ml) at the time of
- Anti-TNF/IL-17 combinations of the invention can be used to treat autoimmune diseases, in particular those associated with inflammation, including rheumatoid arthritis, rheumatoid spondylitis, osteoarthritis and gouty arthritis, allergy, multiple sclerosis,
- Tumor necrosis factor has been implicated in mediating biological effects observed in a variety of infectious diseases.
- TNF ⁇ has been implicated in mediating brain inflammation and capillary thrombosis and infarction in malaria.
- TNF ⁇ also has been implicated in mediating brain inflammation, inducing breakdown of the blood-brain bather, triggering septic shock syndrome and activating venous infarction in meningitis.
- TNF ⁇ also has been implicated in inducing cachexia, stimulating viral proliferation and mediating central nervous system injury in acquired immune deficiency syndrome (AIDS).
- AIDS acquired immune deficiency syndrome
- Anti-TNF/IL-17 combinations of the invention also can be used to alleviate symptoms associated with infectious diseases, including fever and myalgias due to infection (such as 10 influenza) and cachexia secondary to infection (e.g., secondary to AIDS or ARC).
- infectious diseases including fever and myalgias due to infection (such as 10 influenza) and cachexia secondary to infection (e.g., secondary to AIDS or ARC).
- cachexia secondary to infection e.g., secondary to AIDS or ARC.
- Tumor necrosis factor has been implicated as a key mediator of allograft rejection and graft versus host disease (GVHD) and in mediating an adverse reaction that has been 15 observed when the rat antibody OKT3, directed against the T cell receptor CD3 complex, is used to inhibit rejection of renal transplants.
- anti-TNF/IL-17 combinations of the invention can be used to inhibit transplant rejection, including rejections of allografts and xenografts and to inhibit GVHD.
- the combination may be used alone, it can be used in combination with one or more other agents that inhibit the immune response against 20 the allograft or inhibit GVHD.
- a TNF binding protein is used in combination with OKT3 to inhibit OKT3-induced reactions.
- a TNF binding protein is used in combination with one or more antibodies directed at other targets involved in regulating immune responses, such as the cell surface molecules CD25 (interleukin-2 receptor-.alpha.), CD11a (LFA-1), CD54 (ICAM-1), CD4, CD45,
- a TNF 25 CD28/CTLA4, CD80 (B7-1) and/or CD86 (B7-2).
- a TNF a TNF
- binding protein of the invention is used in combination with one or more general
- immunosuppressive agents such as cyclosporin A or FK506.
- Tumor necrosis factor has been implicated in inducing cachexia, stimulating tumor growth, enhancing metastatic potential and mediating cytotoxicity in malignancies.
- a TNF binding protein of the invention can be used in the treatment of malignancies, to inhibit tumor growth or metastasis and/or to alleviate cachexia secondary to malignancy.
- the anti-TNF/ IL-17 combination may be administered systemically or locally to the tumor site.
- Tumor necrosis factor has been implicated in the pathophysiology of adult respiratory 5 distress syndrome (ARDS), including stimulating leukocyte-endothelial activation, directing cytotoxicity to pneumocytes and inducing vascular leakage syndrome.
- ARDS adult respiratory 5 distress syndrome
- a TNF binding protein of the invention can be used to treat various pulmonary disorders, including adult respiratory distress syndrome (see e.g., PCT Publication No. WO 91/04054), shock lung, chronic pulmonary inflammatory disease, pulmonary sarcoidosis, pulmonary fibrosis 10 and silicosis.
- the anti-TNF/ IL-17 combination may be administered systemically or locally to the lung surface, for example as an aerosol.
- An anti-TNF/ IL-17 combination of the invention also can be administered with one or more additional therapeutic agents useful in the treatment of pulmonary disorders, as discussed further in herein. 15 G. Intestinal Disorders
- combination of the invention also can be administered with one or more additional therapeutic agents useful in the treatment of intestinal disorders, as discussed further in herein. 25 H. Cardiac Disorders
- the anti-TNF/ IL-17 combinations of the invention also can be used to treat various cardiac disorders, including ischemia of the heart (see e.g., European Patent Application Publication No. EP 453898) and heart insufficiency (weakness of the heart muscle)(see e.g., PCT Publication No. WO 94/20139).
- ischemia of the heart see e.g., European Patent Application Publication No. EP 453898
- heart insufficiency weakness of the heart muscle
- the anti-TNF/ IL-17 combination of the invention also can be used to treat various other disorders in which TNF-alpha activity is detrimental.
- diseases and disorders in which TNF-alpha activity has been implicated in the pathophysiology, and thus which can be treated using a TNF binding protein of the invention include inflammatory bone disorders and bone resorption disease; hepatitis, including alcoholic hepatitis, viral hepatitis, and fulminant hepatitis; coagulation disturbances, burns, reperfusion injury, keloid formation, scar tissue formation; pyrexia; periodontal disease; obesity and radiation toxicity.
- an anti-TNF/ IL-17 combinations of the invention is used for the treatment of a TNF-associated disorder selected from the group consisting of
- osteoarthritis rheumatoid arthritis, juvenile chronic arthritis, septic arthritis, Lyme arthritis, psoriatic arthritis, reactive arthritis, spondyloarthropathy, systemic lupus erythematosus, Crohn's disease, ulcerative colitis, inflammatory bowel disease, insulin dependent diabetes 10 mellitus, thyroiditis, asthma, allergic diseases, psoriasis, dermatitis, scleroderma, graft versus host disease, organ transplant rejection, acute or chronic immune disease associated with organ transplantation, sarcoidosis, atherosclerosis, disseminated intravascular coagulation, Kawasaki's disease, Grave's disease, nephrotic syndrome, chronic fatigue syndrome,
- seronegative arthropathy arthropathy, Reiter's disease, psoriatic arthropathy, ulcerative colitic arthropathy, enteropathic synovitis, Chlamydia-associated arthropathy, Yersinia- associated arthropathy, Salmonella-associated arthropathy, spondyloarthropathy,
- Atheromatous disease/arteriosclerosis atopic allergy, autoimmune bullous disease, pemphigus 25 vulgaris, pemphigus foliaceus, pemphigoid, linear IgA disease, autoimmune haemolytic
- anaemia Coombs positive haemolytic anaemia, acquired pernicious anaemia, juvenile pernicious anaemia, myalgic encephalitis/Royal Free disease, chronic mucocutaneous candidiasis, giant cell arteritis, primary sclerosing hepatitis, cryptogenic autoimmune hepatitis, acquired immunodeficiency syndrome, acquired immunodeficiency related
- hypogammaglobulinaemia dilated cardiomyopathy
- female infertility female infertility
- ovarian failure premature ovarian failure
- fibrotic lung disease cryptogenic fibrosing alveolitis
- post- inflammatory interstitial lung disease interstitial pneumonitis
- connective tissue disease associated interstitial lung disease mixed connective tissue disease associated lung disease
- systemic sclerosis associated interstitial lung disease rheumatoid arthritis associated interstitial lung disease
- systemic lupus erythematosus associated lung disease systemic lupus erythematosus associated lung disease
- dermatomyositis/polymyositis associated lung disease dermatomyositis/polymyositis associated lung disease, Sjogren's disease associated lung disease, ankylosing spondylitis associated lung disease, vasculitic diffuse lung disease, 5 haemosiderosis associated lung disease, drug-induced interstitial lung disease, fibrosis,
- autoimmune hepatitis type-1 autoimmune hepatitis (classical autoimmune or lupoid hepatitis), type-2 autoimmune hepatitis (anti-LKM antibody hepatitis), autoimmune mediated hypoglycemia, 10 type B insulin resistance with acanthosis nigricans, hypoparathyroidism, acute immune
- glomerulonephritides microscopic vasculitis of the kidneys, Lyme disease, discoid lupus 15 erythematosus, male infertility idiopathic or NOS, sperm autoimmunity, multiple sclerosis (all subtypes), sympathetic ophthalmia, pulmonary hypertension secondary to connective tissue disease, Goodpasture's syndrome, pulmonary manifestation of polyarteritis nodosa, acute rheumatic fever, rheumatoid spondylitis, Still's disease, systemic sclerosis, Sjorgren's syndrome, Takayasu's disease/arteritis, autoimmune thrombocytopaenia, idiopathic
- thrombocytopaenia autoimmune thyroid disease, hyperthyroidism, goitrous autoimmune hypothyroidism (Hashimoto's disease), atrophic autoimmune hypothyroidism, primary myxoedema, phacogenic uveitis, primary vasculitis, vitiligo, acute liver disease, chronic liver diseases, alcoholic cirrhosis, alcohol-induced liver injury, cholestasis, idiosyncratic liver disease, drug-induced hepatitis, non-alcoholic steatohepatitis, allergy, group B streptococci 25 (GBS) infection, mental disorders (e.g., depression and schizophrenia), Th2 Type and Th1 Type mediated diseases, acute and chronic pain (different forms of pain), cancers such as lung, breast, stomach, bladder, colon, pancreas, ovarian, prostate and rectal cancer and hematopoietic malignancies (leukemia and lymphoma), abetalipoproteinemia, acrocyanosis,
- CML chronic myelocytic leukemia
- CLL chronic lymphocytic leukemia
- COPD pulmonary disease
- chronic salicylate intoxication congestive heart failure
- conjunctivitis contact dermatitis, cor pulmonale, coronary artery disease
- Creutzfeldt-Jakob disease culture negative sepsis
- cystic fibrosis cytokine therapy associated disorders
- dementia pugilistica demyelinating diseases, dengue hemorrhagic fever, dermatitis, dermatologic conditions
- diabetes diabetic arteriosclerotic disease, diffuse Lewy 15 body disease
- dilated congestive cardiomyopathy disorders of the basal ganglia, Down's syndrome in middle age, drug-induced movement disorders induced by drugs which block CNS dopamine receptors, drug sensitivity, eczema, encephalomyelitis, endocarditis, endocrinopathy, epiglottitis, Epstein-Barr virus infection, erythromelalgia, extrapyramidal and cerebellar disorders, familial
- COPD pulmonary disease
- gangrene gastric ulcer, glomerular nephritis, graft rejection of any organ or tissue, gram negative sepsis, gram positive sepsis, granulomas due to intracellular organisms, hairy cell leukemia, Hallervorden-Spatz disease, Hashimoto's thyroiditis, hay fever, heart transplant rejection, hemochromatosis, hemodialysis, hemolytic uremic syndrome/thrombolytic
- HIV neuropathy infection/HIV neuropathy, Hodgkin's disease, hyperkinetic movement disorders,
- hypersensitivity reactions hypersensitivity pneumonitis, hypertension, hypokinetic movement disorders, hypothalamic-pituitary-adrenal axis evaluation, idiopathic Addison's disease, idiopathic pulmonary fibrosis, antibody mediated cytotoxicity, asthenia, infantile 30 spinal muscular atrophy, inflammation of the aorta, influenza A, ionizing radiation exposure, iridocyclitis/uveitis/optic neuritis, ischemia-reperfusion injury, ischemic stroke, juvenile rheumatoid arthritis, juvenile spinal muscular atrophy, Kaposi's sarcoma, kidney transplant rejection, legionella, leishmaniasis, leprosy, lesions of the corticospinal system, lipedema, liver transplant rejection, lymphedema, malaria, malignant lymphoma, malignant histiocytosis, malignant melanoma, meningitis, meningococcemia, metabolic migraine headache, idiopathic migraine headache
- organomegaly 15 organomegaly, endocrinopathy, monoclonal gammopathy, and skin changes syndrome), post perfusion syndrome, post pump syndrome, post-MI cardiotomy syndrome, preeclampsia, progressive supranucleo palsy, primary pulmonary hypertension, radiation therapy,
- 25 anaphylaxis, systemic inflammatory response syndrome, systemic onset juvenile rheumatoid arthritis, telangiectasia, thromboangiitis obliterans, thrombocytopenia, toxicity, transplants, trauma/hemorrhage, type III hypersensitivity reactions, type IV hypersensitivity, unstable angina, uremia, urosepsis, urticaria, valvular heart diseases, varicose veins, vasculitis, venous diseases, venous thrombosis, ventricular fibrillation, viral and fungal infections, viral30 encephalitis/aseptic meningitis, viral-associated hemophagocytic syndrome, Wernicke- Korsakoff syndrome, Wilson's disease, xenograft rejection of any organ or tissue, acute coronary syndromes, acute idiopathic polyneuritis, acute inflammatory demyelinating polyradiculoneuropathy, acute ischemia, adult Still's disease, alopecia greata, ana
- lymphoproliferative syndrome autoimmune myocarditis, autoimmune premature ovarian failure, blepharitis, bronchiectasis, bullous pemphigoid, cardiovascular disease, 5 catastrophic antiphospholipid syndrome, celiac disease, cervical spondylosis, chronic
- ischemia cicatricial pemphigoid
- clinically isolated syndrome with risk for multiple sclerosis, childhood onset psychiatric disorder, chronic obstructive pulmonary disease (COPD), dacryocystitis, dermatomyositis, diabetic retinopathy, disk herniation, disk prolapse, drug induced immune hemolytic anemia, endocarditis, endometriosis, endophthalmitis, 10 episcleritis, erythema multiforme, erythema multiforme major, gestational pemphigoid,
- COPD chronic obstructive pulmonary disease
- GBS Guillain-Barre syndrome
- Hughes syndrome idiopathic Parkinson's disease, idiopathic interstitial pneumonia, IgE-mediated allergy, immune hemolytic anemia, inclusion body myositis, infectious ocular inflammatory disease, inflammatory demyelinating disease, inflammatory heart disease, inflammatory kidney disease, IPF/UIP, ulceris, keratitis,
- TNF-associated disease or disorder is rheumatoid arthritis.
- the disclosure herein also provides diagnostic applications including, but not limited to, diagnostic assay methods, diagnostic kits containing one or more TNF binding proteins, and adaptation of the methods and kits for use in automated and/or semi-automated systems.
- diagnostic applications including, but not limited to, diagnostic assay methods, diagnostic kits containing one or more TNF binding proteins, and adaptation of the methods and kits for use in automated and/or semi-automated systems.
- the methods, kits, and adaptations provided may be employed in the detection, monitoring, and/or treatment of a disease or disorder in an individual. This is further elucidated below. 10 Method of assay
- the present disclosure also provides a method for determining the presence, amount or concentration of an analyte, or fragment thereof, in a test sample using at least one binding protein as described herein.
- Any suitable assay as is known in the art can be used in the method. Examples include, but are not limited to, immunoassays and/or methods employing 15 mass spectrometry.
- Immunoassays provided by the present disclosure may include sandwich immunoassays, radioimmunoassay (RIA), enzyme immunoassay (EIA), enzyme-linked immunosorbent assay (ELISA), competitive-inhibition immunoassays, fluorescence polarization immunoassay (FPIA), enzyme multiplied immunoassay technique (EMIT), 20 bioluminescence resonance energy transfer (BRET), and homogenous chemiluminescent assays, among others.
- sandwich immunoassays radioimmunoassay (RIA), enzyme immunoassay (EIA), enzyme-linked immunosorbent assay (ELISA), competitive-inhibition immunoassays, fluorescence polarization immunoassay (FPIA), enzyme multiplied immunoassay technique (EMIT), 20 bioluminescence resonance energy transfer (BRET), and homogenous chemiluminescent assays, among others.
- a chemiluminescent microparticle immunoassay in particular one employing the ARCHITECT® automated analyzer (Abbott Laboratories, Abbott Park, IL), is an example of an immunoassay.
- Methods employing mass spectrometry include, but are not limited to MALDI (matrix-assisted laser desorption/ionization) or by SELDI (surface-enhanced laser desorption/ionization).
- MALDI matrix-assisted laser desorption/ionization
- SELDI surface-enhanced laser desorption/ionization
- kits for assaying a test sample for the presence, amount or concentration of an analyte, or fragment thereof, in a test sample comprises at least one component for assaying the test sample for the analyte, or fragment thereof, and instructions 5 for assaying the test sample for the analyte, or fragment thereof.
- the at least one component for assaying the test sample for the analyte, or fragment thereof can include a composition comprising a binding protein, as disclosed herein, and/or an anti-analyte binding protein (or a fragment, a variant, or a fragment of a variant thereof), which is optionally immobilized on a solid phase.
- the kit may comprise a calibrator or control, which may comprise isolated or purified analyte.
- the kit can comprise at least one component for assaying the test sample for an analyte by immunoassay and/or mass spectrometry.
- the kit components including the analyte, binding protein, and/or anti-analyte binding protein, or fragments thereof, may be optionally labeled using any art-known detectable label.
- the materials and methods for the 15 creation provided for in the practice of the present disclosure would be known to one skilled in the art (US Patent No.9,035,027). Adaptation of kit and method
- kits or components thereof, as well as the method of determining the presence, 20 amount or concentration of an analyte in a test sample by an assay, such as an immunoassay as described herein, can be adapted for use in a variety of automated and semi-automated systems (including those wherein the solid phase comprises a microparticle), as described, for example, in US Patent Nos.5,089,424 and 5,006,309, and as commercially marketed, for example, by Abbott Laboratories (Abbott Park, IL) as ARCHITECT®.
- an assay such as an immunoassay as described herein
- kits and kit components can be employed in other formats, for example, on electrochemical or other hand-held or point-of-care assay systems.
- the present disclosure is, for example, applicable to the
- FIG. 1A shows a molecule that is bivalent for IL-17 and monovalent for TNF named
- MBMM2 The amino acid sequence for MBMM2 is provided in Table 5.
- Figure 1B shows a molecule that is bivalent for TNF and monovalent for IL-17 named MBMM1.
- the amino acid sequence for MBMM1 is provided in Table 6.
- Figure 2A shows a molecule that is
- TV-GS PR-1580725 or PR-1603912
- TV-LS PR-1580724
- Figure 2B shows a molecule that is bivalent for TNF
- JMB-GS PR-1603136
- the sequence for JMB-GS is provided in Table 8.
- Figure 2C shows a molecule that is monovalent for both for TNF and IL-17 named PR-1603912 or PR- 1603915.
- the sequences for 1603912 or 1603915 are provided in Table 9. Not shown are a 15 molecule that is tetravalent for IL-17 named PR-1611416 (with GS linker) or PR-1611418
- PR-1611416 or PR-1611418 are provided in Table 10.
- Table 5 Amino Acid Sequences of MBMM2 (PR-1621611) Anti-TNF/IL-17 Bispecific
- Binding protein concentrations were measured by an electrochemiluminescent (MSD) method using biotinylated IL-17 capture (PR-1264676) and sulfo tagged (goat) anti-human IgG (MSD Cat# R32AJ-1) for detection. The samples were analyzed at a 1% final matrix concentration. MSD standard curve fitting and data evaluation was performed using XLfit4 15 software (Version 4.2.1 Build 16). A calibration curve was plotted from MSD luminescence units versus theoretical standard concentrations. A four-parameter logistic model was used for curve fitting. The regression equation for the calibration curve was then used to back calculate the measured concentrations. The lower limit of quantitation (LLOQ) was 0.02 ⁇ g.mL.
- the linear range was 0.02-15 ⁇ g/mL. Values that were below the quantitation limit 20 were omitted from calculation.
- whole blood concentrations were multiplied by two to estimate serum concentrations.
- Pharmacokinetic parameters were calculated with Non-compartmental analysis using WinNonlin Professional (version 5.0.1, Pharsight, Mountain View, California, USA).
- Table 10 and Figure 3A illustrate the results of the MBMM2 study over 21 days.
- Table 10 Serum Concentration ( ⁇ g/mL) of MBMM2 After 5 mg/kg IV Dose in CD-1 Mice
- Table 11 shows the serum concentrations of MBMM2.
- Table 11 Serum Concentration ( ⁇ g/mL) of MBMM2 After 5 mg/kg IV Dose in CD-1 10 Mice
- AUC area under curve
- AUC 0-t area under the plasma concentration-time curve from time zero to the last measurable 15 concentration
- MRT mean residence time; represents the average time a molecule stays in the body n.f.: no fit
- Table 12 and Figure 3B illustrate the results of the MBMM1 study over 21 days.
- Table 12 Serum Concentration ( ⁇ g/mL) of MBMM1 After 5 mg/kg IV Dose in CD-1 5 Mice
- Table 13 shows the serum concentration of MBMM1.
- Table 13 Serum Concentration ( ⁇ g/mL) of MBMM1 After 5 mg/kg IV Dose in CD-1 15 Mice
- Anti-TNF/IL-17 molecule PR-1621611 (MBMM2) displayed a long half-life (14.7 days), low clearance (0.13 mL/h/kg), and small volume of distribution (64 mL/kg).
- PK 15 calculations were based on 2 out of 5 mice.
- Animals in the PR-1621615 (MBMM1) group displayed short half-life and probable ADA, interfering in PK calculations.
- the MBMM molecules were designed to test the impacts of binding geometries and molecular valency on the effects of ADA as seen in mouse PK models with regard to anti- 20 TNF biologics.
- TNF ⁇ antigen is a trimer, consisting of 3 potential binding sites, which poses interesting dynamics when it is targeted and bound by a bivalent antibody.
- a bivalent therapeutic can and will cross link TNF ⁇ antigen, and if in a high enough concentration, form a lattice of mAB- antigen complex that is easily recognizable by immune cells. It is postulated that this 25 complex can contribute to and exacerbate the immunogenicity of a biologic.
- the molecules described herein contain either a bivalent anti-TNF ⁇ in-tandem paired with a monovalent anti-IL17 (MBMM1, PR-1621615), or a bivalent in-tandem anti-IL17 paired with a monovalent D2E7 (MBMM2, PR-1621611).
- Example 3 Pharmacokinetic Parameters of Monospecific Tetravalent and Monospecific 5 Bivalent Anti-TNF ⁇ Molecules After 5 mg/kg IV Dosing in CD-1 Mice
- Three tetravalent anti-TNF molecules named TV-GS (PR-1580725 or PR-1603912) or TV-LS (PR-1580724) ( Figure 2a) and one bivalent anti-TNF molecule named JMB-GS (PR-1603136) ( Figure 2b) were prepared by standard methods known in the art and their 10 pharmacokinetic parameters tested.
- Table 15 and Figure 4 illustrate the results of the PR-1580725 study over 21 days Table 15: Serum Concentration ( ⁇ g/mL) of TV-GS Molecule (PR-1580725) After 5 mg/kg IV Dose in CD-1 Mice
- Table 18 shows the serum concentrations of PR-1603912.
- Table 18 Serum Concentration ( ⁇ g/mL) of Ambromab Molecule (PR-1603912) After 5 m 5 5 . . . . 0 5
- Table 19 Serum Concentration ( ⁇ g/mL) of TV-LS Molecule (PR-1580724) After 5 mg/kg IV Dose in CD-1 Mice
- Table 20 shows the serum concentrations of PR-1580724.
- Table 21 and Figure 7 illustrate the results of the PR-1603136 study over 21 days.
- Table 21 Serum Concentration ( ⁇ g/mL) of JMB-GS Tandem (PR-1603136) Molecule After 5 mg/kg IV Dose in CD-1 Mice
- Table 22 shows the serum concentrations of PR-1603136.
- Table 22 Serum Concentration ( ⁇ g/mL) of JMB-GS Tandem (PR-1603136) Molecule After 5 mg/kg IV Dose in CD-1 Mice
- Figure 8 features PK results from a monovalent anti-TNF ⁇ molecule (PR-1603912) versus tetravalent (PR- 1580725, PR-1580724) and in-tandem, bivalent anti-TNF ⁇ ⁇ ⁇ ⁇ PR ⁇ ⁇ ⁇ ⁇ ⁇ ⁇ ⁇ ⁇ molecules; and15 the same extended PK is seen with the monovalent format when compared to the bivalent, in- tandem and tetravalent molecules, which again exhibit low half-lives and probable ADA responses in mice.
- the molecules tested herein provide evidence of an improved half-life and mitigated 20 ADA response in mice, while remaining bivalent and exhibiting full potency in its binding to a second antigen.
- MBMM2 is advantageous in that it can modify potential ADA responses from an anti-TNF ⁇ ⁇ targeting molecule while retaining full affinity and activity for an additional target and allow for the production of a disease-specific, fit-for-purpose bispecific molecule.
Landscapes
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Health & Medical Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Life Sciences & Earth Sciences (AREA)
- Genetics & Genomics (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Immunology (AREA)
- Peptides Or Proteins (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Abstract
Provided are TNF binding proteins and methods of treatment using the same. Also provided are nucleic acids encoding the binding proteins and recombinant expression vectors and host cells for making such binding proteins.
Description
MONOVALENT TNF BINDING PROTEINS Related Applications
This application claims priority to U.S. Provisional Application Serial No. 5 62/140,155, filed March 30, 2015, which is incorporated herein by reference in its entirety.
This application is related to U.S. Application Serial No.14/210,703 which claims priority to U.S. Provisional Application Serial No.61/788,113, filed March 15, 2013, which is incorporated herein by reference in its entirety. 10 Background of the Invention
The use of therapeutic tissue necrosis factor alpha (TNFα) binding proteins, such as infliximab, adalimumab, etanercept, golimumab, and certolizumab pegol has revolutionized the treatment of many chronic inflammatory diseases, including inflammatory bowel disease (IBD), ankylosing spondylitis, multiple sclerosis, psoriasis and rheumatoid arthritis (RA). 15 Despite their success in improving the quality of life of patients, long-term treatment with therapeutic TNFα binding proteins can elicit strong immunogenic responses that result in the development of anti-drug antibodies (ADA). Such ADA responses can impact both the safety and pharmacokinetics of therapeutic TNFα binding proteins, which, in turn, can affect the utility and efficacy of these drugs. Accordingly, there is a need in the art for novel TNFα 20 binding proteins for use as therapeutics, which are less immunogenic in patients Summary
The present disclosure provides novel TNFα binding proteins and methods of treatment using the same. Also provided are nucleic acids encoding the binding proteins and 25 recombinant expression vectors and host cells for making such binding proteins. The present disclosure is based, at least in part, on the discovery that multivalent binding proteins which have a single monovalent binding specificity for TNFα (e.g., anti-TNFα monoclonal antibodies) (i.e., each binding protein is only able to bind to one TNFα molecule, e.g., on the surface of an antigen presenting cell) and bivalent for a second specificity), exhibit improved 30 half-life over multivalent binding proteins having binding specificity for multiple TNFα molecules (see Figures 1 and 2).
In some aspects, a binding protein comprising first, second, third and fourth polypeptide chains is provided, wherein said first polypeptide chain comprises VD1-(X1)n- VD2-C-(X2)n, wherein VD1 is a first heavy chain variable domain, VD2 is a second heavy
chain variable domain, C is a CH1 domain, X1 is a linker with the proviso that it is not a constant domain, n is 0 or 1, and X2 is an Fc region; wherein said second polypeptide chain comprises VD1-(X1)n-VD2-C, wherein VD1 is a first light chain variable domain, VD2 is a second light chain variable domain, C is a CL domain, X1 is a linker with the proviso that it 5 is not a constant domain, and n is 0 or 1; wherein the VD1 of the heavy chain and the VD1 of the light chain form a functional binding site and wherein the VD2 of the heavy chain and the VD2 of the light chain form a functional binding site; and wherein the VD1 and VD2 functional binding sites bind to the same non-TNFα antigen; and wherein said third polypeptide chain comprises VD3-C-(X1)n, wherein VD3 is a third heavy chain variable 10 domain, C is a CH1 domain, X1 is an Fc region, and n is 0 or 1; wherein said fourth
polypeptide chain comprises VD3-C, wherein VD3 is a first light chain variable domain; and C is a CL domain; wherein the VD3 of the heavy chain and the VD3 of the light chain form a functional binding site for TNFα. In some embodiments, the TNFα is human TNFα. In some embodiments, the VD3 heavy chain variable domain and the VD3 light chain variable 15 domain are a heavy chain variable domain and a light chain variable domain from infliximab, adalimumab, certolizumab pegol, or golimumab.
In some embodiments, the Fc region of the first and third polypeptide chains each comprises a mutation, wherein said mutations on the two Fc regions enhance
heterodimerization of the first and third polypeptide chains. In some embodiments, the Fc 20 region of one of the first polypeptide and the second polypeptide comprises the sequence of SEQ ID NO: 121 and the Fc region of the other of the first polypeptide and the second polypeptide comprises the sequence of SEQ ID NO: 137. In some embodiments, the Fc region of the first and third polypeptide chains comprise one or more of the sequences provided in Table 4.
25 In some embodiments, monovalent binding of the binding protein to cell surface
TNFα on antigen presenting cells provides a halflife greater than a molecule that is bivalent or tetravalent for TNFα. In some embodiments, monovalent binding of the binding protein to cell surface TNFα on antigen presenting cells generates less anti-drug antibodies (ADA) than a molecule that is bivalent or tetravalent for TNFα.
30 In some embodiments, the non-TNFα antigen is a soluble ligand. In some
embodiments, the non-TNFα antigen is IL-17. In some embodiments, the non-TNFα antigen is human IL-17.
In some embodiments, the binding protein comprises one or more of the sequences provided in Tables 2, 5 or 6. In some embodiments, the binding protein comprises one or
more of the sequences of SEQ ID NOs: 112-143. In some embodiments, the VD3 heavy chain variable domain and light chain variable domain comprise one or more of the sequences provided in Tables 2, 5 or 6. In some embodiments, the VD1 and VD2 heavy chain variable domains and light chain variable domains comprise one or more of the 5 sequences provided in Table 3.
In some embodiments, VD1 of the first polypeptide comprises CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 114-116, VD2 of the first polypeptide comprises the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 118-120, VD1 of the second polypeptide comprises the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 124-126, 10 VD2 of the second polypeptide comprises the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 128-130, VD3 of the third polypeptide comprises the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 134-136, and VD3 of the fourth polypeptide comprises the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 140-142. In some embodiments, VD1- (X1)n-VD2 of the first polypeptide comprise the sequence of SEQ ID NO: 113, VD1-(X1)n- 15 VD2 of the second polypeptide comprise the sequence of SEQ ID NO: 123, VD3 of the third polypeptide comprises the sequence of SEQ ID NO: 133, and VD3 of the fourth polypeptide comprises the sequence of SEQ ID NO: 139. In some embodiments, the first polypeptide comprises the sequence of SEQ ID NO: 112, the second polypeptide comprises the sequence of SEQ ID NO: 122, the third polypeptide comprises the sequence of SEQ ID NO: 132 and 20 the fourth polypeptide comprises the sequence of SEQ ID NO: 138.
In other aspects, a binding protein comprising first, second, third and fourth polypeptide chains is provided, wherein said first polypeptide chain comprises VD1-(X1)n- VD2-C-(X2)n, wherein VD1 is a first heavy chain variable domain, VD2 is a second heavy chain variable domain, C is a CH1 domain, X1 is a linker with the proviso that it is not a 25 constant domain, n is 0 or 1, and X2 is an Fc region; wherein said second polypeptide chain comprises VD1-(X1)n-VD2-C, wherein VD1 is a first light chain variable domain, VD2 is a second light chain variable domain, C is a CL domain, X1 is a linker with the proviso that it is not a constant domain,
and n is 0 or 1; wherein the VD1 of the heavy chain and the VD1 of the light chain form a 30 functional binding site and wherein the VD2 of the heavy chain and the VD2 of the light chain form a functional binding site; and wherein the VD1 and VD2 functional binding sites bind TNFα; and wherein said third polypeptide chain comprises VD3-C-(X1)n, wherein VD3 is a third heavy chain variable domain, C is a CH1 domain, X1 is an Fc region, and n is 0 or 1; wherein said fourth polypeptide chain comprises VD3-C, wherein VD3 is a first light chain
variable domain; and C is a CL domain; wherein the VD3 of the heavy chain and the VD3 of the light chain form a functional binding site for a non-TNFα antigen. In some embodiments, the TNFα is human TNFα.
In some embodiments, the VD1 and VD2 heavy chain variable domains and light 5 chain variable domains are heavy chain variable domains and light chain variable domains from infliximab, adalimumab, certolizumab pegol, or golimumab.
In some embodiments, the Fc region of the first and third polypeptide chains each comprises a mutation, wherein said mutations on the two Fc regions enhance
heterodimerization of the first and third polypeptide chains. In some embodiments, the Fc 10 region of one of the first polypeptide and the second polypeptide comprises the sequence of SEQ ID NO: 153 and the Fc region of the other of the first polypeptide and the second polypeptide comprises the sequence of SEQ ID NO: 169. In some embodiments, the Fc region of the first and third polypeptide chains comprise one or more of the sequences provided in Table 4.
15 In some embodiments, the non-TNFα antigen is a soluble ligand. In some
embodiments, the non-TNFα antigen is IL-17. In some embodiments, the non-TNFα antigen is human IL-17.
In some embodiments, the binding protein comprises one or more of the sequences provided in Tables 2, 5 or 6. In some embodiments, the binding protein comprises one or 20 more of the sequences of SEQ ID NOs: 144-175. In some embodiments, the VD1 and VD2 heavy chain variable domains and light chain variable domains comprise one or more of the sequences provided in Table 2, 5 or 6. In some embodiments, the VD3 heavy chain variable domain and light chain variable domain comprise one or more of the sequences provided in Tables 3. In some embodiments, the first polypeptide comprises the sequence of SEQ ID 25 NO: 144, the second polypeptide comprises the sequence of SEQ ID NO:154 the third
polypeptide comprises the sequence of SEQ ID NO: 164 and the fourth polypeptide comprises the sequence of SEQ ID NO: 170.
In yet other aspects, a binding protein is provided comprising one or more of the sequences in Tables 5 or 6. In some embodiments, the binding protein comprises one or 30 more of the sequences of SEQ ID NOs: 112-143. In some embodiments, the binding protein comprises one or more of the sequences of SEQ ID NOs: 144-175.
In other aspects, a method of treating a TNF-associated disorder in a subject in need thereof is provided, comprising administering to the subject an effective amount of any one of the binding proteins described herein.
In other aspects, a nucleic acid encoding any one of the binding proteins described herein is provided. In yet other aspects, a vector expressing the nucleic acid is provided. In another aspect, a host cell comprising the vector is provided. In other aspects, a method of producing a binding protein is provided, comprising culturing the host cell in culture medium 5 under conditions sufficient to produce the binding protein. In another aspect, a protein
produced according to the method is provided.
In yet other aspects, a pharmaceutical composition is provided comprising any one of the binding proteins described herein, and a pharmaceutically acceptable carrier. 10
Brief Description Of The Drawings
Figure 1A represents a MBMM2 (PR-1621611) molecule, which has monovalent binding specificity for TNFα and bivalent binding specificity for IL-17.
15 Figure 1B represents a MBMM1 (PR-1621615), which has bivalent binding
specificity for TNFα and monovalent binding specificity for IL-17.
Figure 2A represents TV-GS or TV-LS molecules, which have tetravalent binding specificity for TNFα.
Figure 2B represents JMB-GS molecules, which have bivalent in-tandem binding 20 specificity for TNFα.
Figure 2C represents Ambromab molecules, which have monovalent in-tandem binding specificity for TNFα and IL-17.
Figure 3A illustrates the serum concentration of MBMM2 after 5 mg/kg IV dose in CD-1 mice (Table 10).
25 Figure 3B illustrates the serum concentration of MBMM2 after 5 mg/kg IV dose in CD-1 mice (Table 12).
Figure 3C illustrates the superior pK characteristics of MBMM2 over MBMM1 after 5 mg/kg IV dose in CD-1 mice.
Figure 4 illustrates the serum concentration of TV-GS Molecule after 5 mg/kg IV 30 dose in CD-1 mice (PR-1580725) (Table 15).
Figure 5 illustrates the serum concentration of TV-GS Molecule after 5 mg/kg IV dose in CD-1 mice (PR-1603912) (Table 17).
Figure 6 illustrates the serum concentration of TV-LS Molecule after 5 mg/kg IV dose in CD-1 mice (PR-1580724) (Table 19).
Figure 7 illustrates the serum concentration of JMB-GS Tandem Molecule after 5 mg/kg IV dose in CD-1 mice (PR-1603136) (Table 21).
5 Figure 8 illustrates the serum concentration of Ambromabs (PR-1603912 and PR- 1603915) TV-GS (PR-1580725), TV-LS (PR-1580724), and JMB-GS Tandem (PR-1603136) Molecules after 5 mg/kg IV dose in CD-1 mice (PR-1603136) (Table 23).
Detailed Description
10 The present disclosure provides novel TNF binding proteins and methods of treatment using the same. Also provided are nucleic acids encoding the binding proteins and recombinant expression vectors and host cells for making such binding proteins. The present disclosure is based, at least in part, on the discovery that bivalent TNF binding proteins (e.g., anti-TNF monoclonal antibodies) can bind to TNF on the cell surface of antigen presenting 15 cells and become internalized. The binding proteins disclosed herein are generally
monovalent with regard to cell surface TNF binding (i.e., each binding protein is only able to bind to one TNF molecule on the surface of an antigen presenting cell). The monovalency with regard to TNF binding of these trivalent molecules resulted in enhanced
pharmacokinetic characteristics.
20
I. Definitions
Unless otherwise defined herein, scientific and technical terms used in connection with the present invention shall have the meanings that are commonly understood by those of ordinary skill in the art. The meaning and scope of the terms should be clear, however, in the 25 event of any latent ambiguity, definitions provided herein take precedent over any dictionary or extrinsic definition. Further, unless otherwise required by context, singular terms shall include pluralities and plural terms shall include the singular. Generally, nomenclature used in connection with, and techniques of, cell and tissue culture, molecular biology,
immunology, microbiology, genetics and protein and nucleic acid chemistry and
30 hybridization described herein are those well known and commonly used in the art.
In order that the present invention may be more readily understood, certain terms are first defined.
The term "human TNFα" refers to a human cytokine that exists as a 17 kD secreted form and a 26 kD membrane associated form, the biologically active form of which is composed of a trimer of noncovalently bound 17 kD molecules. The structure of human TNFα is described further in, e.g., Pennica et al. (1984) Nature 312:724-729; Davis et al. 5 (1987) Biochem.26:1322-1326; and Jones et al. (1989) Nature 338:225-228. The term
human TNFα includes recombinant human TNFα, which can be prepared by standard recombinant expression methods or purchased commercially (R & D Systems, Catalog No. 210-TA, Minneapolis, Minn.). TNF-α is a multifunctional pro-inflammatory cytokine secreted predominantly by monocytes/macrophages that also has effects on lipid metabolism, 10 coagulation, insulin resistance, and endothelial function. TNF-α triggers pro-inflammatory pathways that result in tissue injury, such as degradation of cartilage and bone, induction of adhesion molecules, induction of pro-coagulant activity on vascular endothelial cells, an increase in the adherence of neutrophils and lymphocytes, and stimulation of the release of platelet activating factor from macrophages, neutrophils and vascular endothelial cells.
15 The term "infliximab" refers to the anti-TNF antibody marketed as REMICADE®, having Chemical Abstracts Service (CAS) designation 170277-31-3.
The term "golimumab" refers to the anti-TNF antibody marketed as SIMPONI®, having Chemical Abstracts Service (CAS) designation 476181-74-5.
The term "certolizumab pegol" refers to the anti-TNF antibody marketed as
20 CIMZIA®, having Chemical Abstracts Service (CAS) designation 428863-50-7.
The terms "adalimumab" or“D2E7” refer to the anti-TNF antibody marketed as HUMIRA®, having Chemical Abstracts Service (CAS) designation 331731-18-1.
The term "etanercept" refers to the anti-TNF antibody marketed as ENBREL®, having Chemical Abstracts Service (CAS) designation 1094-08-2.
25 The terms“interleukin-17” or“IL-17” or“IL-17A” refer to an inflammatory cytokine produced by TH17 T cells that contributes to the etiology of a number of inflammatory diseases. IL-17A may exist as either a homodimer or as a heterodimer complexed with its homolog IL-17F to form heterodimeric IL-17A/F. IL-17A and IL-17F share 55% amino acid identity and bind to the same receptor (IL-17R), which is expressed on a wide variety of cells 30 including vascular endothelial cells, peripheral T cells, B cells, fibroblast, lung cells,
myelomonocytic cells, and marrow stromal cells. IL-17A is involved in the induction of pro- inflammatory responses and induces or mediates expression of a variety of other cytokines, factors, and mediators including TNF-α, IL-6, IL-8, IL-1β, granulocyte colony-stimulating factor (G-CSF), prostaglandin E2 (PGE2), IL-10, IL-12, IL-1R antagonist, leukemia inhibitory
factor, and stromelysin. Through its role in T cell mediated autoimmunity, IL-17 is an important local orchestrator of neutrophil accumulation and plays a role in cartilage and bone destruction in a number of inflammatory diseases.
The term "antibody" refers to any immunoglobulin (Ig) molecule comprised of four 5 polypeptide chains, two heavy (H) chains and two light (L) chains, or any functional
fragment, mutant, variant, or derivation thereof, which retains the essential epitope binding features of an Ig molecule. Such mutant, variant, or derivative antibody formats are known in the art. Non-limiting embodiments of which are discussed below.
In a full-length antibody, each heavy chain is comprised of a heavy chain variable 10 region (abbreviated herein as VH) and a heavy chain constant region (abbreviated herein as CH). The heavy chain constant region is comprised of three domains, CH1, CH2 and CH3. Each light chain is comprised of a light chain variable region (abbreviated herein as VL) and a light chain constant region (abbreviated herein as CL). The light chain constant region is comprised of one domain, CL. The VH and VL regions can be further subdivided into 15 regions of hypervariability, termed“complementarity determining regions” or“CDRs”, interspersed with regions that are more conserved, termed“framework regions” or“FRs”. Each VH and VL is composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
Immunoglobulin molecules can be of any type (e.g., IgG, IgE, IgM, IgD, IgA and IgY), class 20 (e.g., IgG 1, IgG2, IgG 3, IgG4, IgA1 and IgA2) or subclass.
The terms "VH domain" and "VL domain" refer to single antibody variable heavy and light domains, respectively, comprising FR (Framework Regions) 1, 2, 3 and 4 and CDR (Complementary Determinant Regions) 1, 2 and 3.
The term "complementarity determining region" or“CDR” means the noncontiguous 25 antigen combining sites found within the variable region of both heavy and light chain
polypeptides. These regions have been described by Kabat et al. (1977) J. Biol. Chem.252: 6609-6616 and by Chothia et al. (1987) J. Mol. Biol.196: 901-917 and by MacCallum et al. (1996) J. Mol. Biol.262: 732-745 where the definitions include overlapping or subsets of amino acid residues when compared against each other. Preferably, the term "CDR" is a 30 CDR as defined by Kabat, based on sequence comparisons.
The term "framework region" or "FR region" refers to the amino acid residues that are part of the variable region, but are not part of the CDRs (e.g., using the Kabat definition of CDRs).
The term "Fc region" is used to define the C-terminal region of an immunoglobulin heavy chain, which may be generated by papain digestion of an intact antibody. The Fc region may be a native sequence Fc region or a variant Fc region. The Fc region of an immunoglobulin generally comprises two constant domains, a CH2 domain and a CH3 5 domain, and optionally comprises a CH4 domain. Replacements of amino acid residues in the Fc portion to alter antibody effector function are known in the art (Winter et al. U.S. Patent Nos.5,648,260; 5,624,821). The Fc portion of an antibody mediates several important effector functions, e.g., cytokine induction, antibody dependent cell-mediated cytotoxicity (ADCC), phagocytosis, complement dependent cytotoxicity (CDC) and half-life/clearance 10 rate of antibody and antigen-antibody complexes. In some cases, these effector functions are desirable for a therapeutic antibody but in other cases they might be unnecessary or even deleterious, depending on the therapeutic objectives. Certain human IgG isotypes, particularly IgG1 and IgG3, mediate ADCC and CDC via binding to Fcγ receptors (FcγR) and complement C1q, respectively. Neonatal Fc receptors (FcRn) are the critical components 15 determining the circulating half-life of antibodies. In still another embodiment at least one amino acid residue is replaced in the constant region of the antibody, e.g., the Fc region of the antibody, such that effector functions of the antibody are altered. The dimerization of two identical heavy chains of an immunoglobulin is mediated by the dimerization of CH3 domains and is stabilized by the disulfide bonds within the hinge region (Huber et al. (1976) 20 Nature 264: 415-20; Thies et al. (1999) J. Mol. Biol.293: 67-79).
The term“knobs into holes” refers to heterodimerization technology in which complementary mutations are made in the constant region, e.g., CH3 domain, of each heavy chain such that non-covalent interactions drive assembly toward heterodimer formation. For example, a 'knob' variant is obtained by replacement of a small amino acid with a larger one 25 in the CH3 domain of an IgG, such as T366Y. The knob is designed to insert into a 'hole' in the CH3 domain of a different antibody created by judicious replacement of a large residue with a smaller one, such as Y407T.
The term "antigen-binding portion" of an antibody refers to one or more fragments of an antibody that retain the ability to specifically bind to an antigen. Such antibody
30 embodiments may also be bispecific, dual specific, or multi-specific, specifically binding to two or more different antigens. Examples of binding fragments encompassed within the term "antigen-binding portion" of an antibody with regard to the trivalent molecules of the present disclosure include fragments that comprise (i) a trivalent fragment consisting of one VH-VH- CH1, one VL-VL-CL, one VH-CH1, and one VL-CL where the anti TNF binder is on the
monovalent arm; (ii) a trivalent fragment consisting of one VH-VH-CH1, one VL-VL-CL, one VH-CH1, and one VL-CL where the anti TNF binder is on the bivalent arm; (iii) a F(ab')2 fragment of the above, a trivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iv) a triabody where two of the variable domains are the 5 same and the third is different; (v) a tribi-minibody; (vi) a tribody; (vii) a Fab3 DNL; and (viii) a barnase-barnstar trimer. Furthermore, although the two domains of the Fv fragment, VH and VL, are coded for by separate genes, they can be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the VH and VL regions pair to form monovalent molecules (known as single chain Fv (scFv). Such 10 single chain antibodies are also intended to be encompassed within the term "antigen-binding portion" of an antibody. Other forms of single chain antibodies, such as diabodies are also encompassed. Diabodies are bivalent, bispecific antibodies in which VH and VL domains are expressed on a single polypeptide chain, but using a linker that is too short to allow for pairing between the two domains on the same chain, thereby forcing the domains to pair with 15 complementary domains of another chain and creating two antigen binding sites (see e.g., Holliger et al. (1993) Proc. Natl. Acad. Sci. USA 90: 6444-6448; Poljak et al. (1994) Structure 2: 1121-1123). Such antibody binding portions are known in the art (Kontermann and Dubel eds., Antibody Engineering (2001) Springer-Verlag. New York.790 pp. (ISBN 3- 540-41354-5).
20 The term“bivalent” refers to a binding molecule that binds two antigens. The
antigens may be the same or different.
The term“bispecific” refers to a binding molecule that binds two different antigens. The term“trivalent” refers to a binding molecule that binds three antigens. The antigens may be the same or different.
25 The term“trispecific” refers to a binding molecule that binds three different antigens.
The term“tetravalent” refers to a binding molecule that binds four antigens. The antigens may be the same or different.
The term“tetraspecific” refers to a binding molecule that binds four different antigens.
30 As used herein, the term "specifically binds to" refers to the ability of a binding
polypeptide to bind to an antigen with a Kd of at least about 1 x 10~6 M, 1 x 10-7 M, 1 x 10-8 M, 1 x 10-9 M, 1 x 10-10 M, 1 x 10-11 M, 1 x 10-12 M, or more, and/or to bind to an antigen with an affinity that is at least two-fold greater than its affinity for a nonspecific antigen. It shall be understood, however, that the binding polypeptides of the invention are capable of
specifically binding to two or more antigens which are related in sequence. For example, the binding polypeptides of the invention can specifically bind to both human and a non-human (e.g., mouse or non-human primate) ortholog of an antigen.
The term "polypeptide" refers to any polymeric chain of amino acids. The terms 5 "peptide" and "protein" are used interchangeably with the term polypeptide and also refer to a polymeric chain of amino acids. The term "polypeptide" encompasses native or artificial proteins, protein fragments and polypeptide analogs of a protein sequence. A polypeptide may be monomeric or polymeric.
The term "linker" refers to polypeptides comprising two or more amino acid residues 10 joined by peptide bonds and are used to link one or more antigen binding portions. Such linker polypeptides are well known in the art. Preferred linkers include, but are not limited to, the amino acid linkers set forth in Table 1 herein.
The term "Kon" refers to the on rate constant for association of an antibody to the antigen to form the antibody/antigen complex.
15 The term "Koff" refers to the off rate constant for dissociation of an antibody from the antibody/antigen complex.
The term "Kd" refers to the dissociation constant of a particular antibody-antigen interaction.
The term "vector" refers to a nucleic acid molecule capable of transporting another 20 nucleic acid to which it has been linked. One type of vector is a "plasmid", which refers to a circular double stranded DNA loop into which additional DNA segments may be ligated. Another type of vector is a viral vector, wherein additional DNA segments may be ligated into the viral genome. Certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors having a bacterial origin of replication 25 and episomal mammalian vectors). Other vectors (e.g., non-episomal mammalian vectors) can be integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome. Moreover, certain vectors are capable of directing the expression of genes to which they are operatively linked. Such vectors are referred to herein as "recombinant expression vectors" (or simply, "expression vectors"). In 30 general, expression vectors of utility in recombinant DNA techniques are often in the form of plasmids. In the present specification, "plasmid" and "vector" may be used interchangeably as the plasmid is the most commonly used form of vector. However, the invention is intended to include such other forms of expression vectors, such as viral vectors (e.g.,
replication defective retroviruses, adenoviruses and adeno-associated viruses), which serve equivalent functions.
The term "recombinant host cell" (or simply "host cell") refers to a cell into which exogenous DNA has been introduced. Such terms are intended to refer not only to the 5 particular subject cell, but, to the progeny of such a cell. Because certain modifications may occur in succeeding generations due to either mutation or environmental influences, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope of the term "host cell" as used herein. Preferably host cells include prokaryotic and eukaryotic cells selected from any of the Kingdoms of life. Preferred eukaryotic cells include 10 protist, fungal, plant and animal cells. Most preferably host cells include but are not limited to the prokaryotic cell line E. Coli; mammalian cell lines CHO, HEK 293 and COS; the insect cell line Sf9; and the fungal cell Saccharomyces cerevisiae. II. Improved TNF Binding Proteins
15 In one aspect the invention provides novel TNF binding proteins. These binding
proteins exhibit monovalent binding to TNF alpha on the surface of a cell (e.g., an antigen presenting cell), i.e., each binding protein is only able to bind to one TNF molecule on the surface of an antigen presenting). In certain embodiments, the binding proteins disclosed herein binds to human TNF, wherein the binding protein exhibits a reduced of cellular 20 internalization upon binding to cell surface TNF compared to the cellular internalization
exhibited by a reference antibody (e.g., infliximab, adalimumab, certolizumab pegol, or golimumab).
In certain embodiments, the TNF binding domains of known TNF binding agents are reformatted to produce the novel TNF binding proteins disclosed herein. The TNF binding 25 domains of any TNF binding agents can be employed. In certain embodiments, the variable domains (or CDRs thereof) of the anti-TNF antibodies infliximab, adalimumab, certolizumab pegol, and/or golimumab are employed. In certain embodiments, the TNF binding domain of etanercept is employed. In certain embodiments, one or more of the variable domain amino an amino acid set forth in Tables 2, 3, 5, and 6 are employed.
30 In certain embodiments, a binding protein comprising first, second, third and fourth polypeptide chains is provided, wherein said first polypeptide chain comprises VD1-(X1)n- VD2-C-(X2)n, wherein VD1 is a first heavy chain variable domain, VD2 is a second heavy chain variable domain, C is a CH1 domain, X1 is a linker with the proviso that it is not a constant domain, n is 0 or 1, and X2 is an Fc region; wherein said second polypeptide chain
comprises VD1-(X1)n-VD2-C, wherein VD1 is a first light chain variable domain, VD2 is a second light chain variable domain, C is a CL domain, X1 is a linker with the proviso that it is not a constant domain, and n is 0 or 1; wherein the VD1 of the heavy chain and the VD1 of the light chain form a functional binding site and wherein the VD2 of the heavy chain and the 5 VD2 of the light chain form a functional binding site; and wherein the VD1 and VD2
functional binding sites bind a non-TNFα antigen; and wherein said third polypeptide chain comprises VD3-C-(X1)n, wherein VD3 is a third heavy chain variable domain, C is a CH1 domain, X1 is an Fc region, and n is 0 or 1; wherein said fourth polypeptide chain comprises VD3-C, wherein VD3 is a first light chain variable domain; and C is a CL domain; wherein 10 the VD3 of the heavy chain and the VD3 of the light chain form a functional binding site for TNFα.
In certain embodiments, a binding protein comprising first, second, third and fourth polypeptide chains is provided, wherein said first polypeptide chain comprises VD1-CH- (X2)n, wherein VD1 is a first heavy chain variable domain, CH is a heavy chain constant15 domain, and X2 is an Fc region; wherein said second polypeptide chain comprises VD1 -CL- (X2)n, wherein VD1 is a first light chain variable domain, VD2 is a second light chain variable domain, CL is a light chain constant domain, X2 does not comprise an Fc region; wherein said third polypeptide chain comprises VD2-(X3)n-VD3-CL-(X4)n, wherein VD2 is a second heavy chain variable domain, VD3 is a third heavy chain variable domain, CL is a 20 light chain constant domain, X3 is a linker with the proviso that it is not a constant domain, and X4 is an Fc region; wherein said fourth polypeptide chain comprises VD2-(X3)n-VD3- CH-(X4)n, wherein VD2 is a second light chain variable domain, VD3 is a third light chain variable domain, CH is a heavy chain constant domain, X3 is a linker with the proviso that it is not a constant domain, and X4 does not comprise an Fc region; wherein n is 0 or 1, and 25 wherein the VD1 domains on the first and second polypeptide chains form one functional binding site for human TNFα, the VD2 domains on the first and second polypeptide chains form one functional binding site for a non-TNFα antigen, the VD3 domains on the third and fourth polypeptide chains form one functional binding site for a second non-TNFα antigen. In some embodiments, the Fc region of the first and third polypeptide chains each comprises 30 a mutation, wherein said mutations on the two Fc regions enhance heterodimerization of the first and third polypeptide chains. In some embodiments, the VD1 domains that form the functional binding site for human TNFα are from infliximab, adalimumab, certolizumab pegol, or golimumab. In some embodiments, the binding protein binds monovalently to cell surface human TNF on antigen presenting cells. In some embodiments, the non-TNFα
antigen is a soluble ligand. In some embodiments, the non-TNFα antigen is IL17. In some embodiments, a method of treating a TNF-associated disorder in a subject in need thereof is provided, comprising administering to the subject an effective amount of the binding protein.
In certain embodiments, the TNF binding proteins are receptor DVD (rDVD)
5 molecules comprising first, second, third and fourth polypeptide chains, wherein said first polypeptide chain comprises RD1-(X)n-VD1-C-Y or VD1-(X)n-RD1-C-Y, wherein RD1 comprises a ligand-binding domain of a receptor; VD1 is a heavy chain variable domain; C is a CH1 domain; X is a linker with the proviso that it is not CH1; n is 0 or 1; and Y is an Fc region; and wherein said second polypeptide chain comprises RD1-(X)n-VD1-C or VD1- 10 (X)n-RD1-C, wherein RD1 comprises a ligand-binding domain of a receptor; VD1 is a light chain variable domain; C is a CL domain; X is a linker with the proviso that it is not CH1; n is 0 or 1; wherein the RD1 of the heavy chain and the RD1 of the light chain form a functional binding site and wherein the VD1 of the heavy chain and the VD1 of the light chain form a functional binding site and wherein the RD1 and VD1 functional binding sites 15 binds to the same antigen; and wherein said third polypeptide chain comprises VD3-C-(X1)n, wherein VD3 is a third heavy chain variable domain, C is a CH1 domain, X1 is an Fc region, and n is 0 or 1; wherein said fourth polypeptide chain comprises VD3-C, wherein VD3 is a first light chain variable domain, and C is a CL domain; wherein the VD3 of the heavy chain and the VD3 of the light chain form a functional binding site for TNFα.
20 Any amino acid linker can be used in the TNF binding proteins disclosed herein. In certain embodiments, the linker comprises amino an amino acid sequence selected from those set forth in Table 1.
In certain embodiments, the TNF binding protein or domains comprise one or more amino acid sequences selected from those set forth in Tables 2, 5, and 6.
25 In certain embodiments, the IL-17 binding protein or domains comprise one or more amino acid sequences selected from those set forth in Table 3 or any of those disclosed in US Patent No: 8,835,610, which is incorporated by reference herein for any purpose.
Any Fc mutants can be used to achieve the half-molecules disclosed herein. In certain embodiments, the Fc mutants are selected from those set forth in Table 4.
30
35
Table 1: List of Linkers Used in Construction of Monovalent TNF Binding Molecules SEQ Sequence
HNG-12 43 TSPPSPAPELLG
Table 2: Examples of Anti-TNF Binding Molecules
Name SEQ Sequence
Table 3: Examples of Anti-IL-17 Binding Molecules
Name SE Se uence
T l 4 n f F rin f r Pr in Mn ln Bin in Pr in 9 G V V W Q T A E E C R G V V W
Q
In certain preferred embodiments, the TNF binding proteins produced using the methods and compositions disclosed herein exhibit improved properties (e.g., affinity or 5 stability) with respect to a corresponding parental reference binding protein. For example, the engineered binding protein may dissociate from its target antigen with a koff rate constant of about 0.1s-1 or less, as determined by surface plasmon resonance, or inhibit the activity of
the target antigen with an IC50 of about 1 x 10-6M or less. Alternatively, the binding protein may dissociate from the target antigen with a koff rate constant of about 1 x 10-2s-1 or less, as determined by surface plasmon resonance, or may inhibit activity of the target antigen with an IC50 of about 1 x 10-7M or less. Alternatively, the binding protein may dissociate from the 5 target with a koff rate constant of about 1 x 10-3s-1 or less, as determined by surface plasmon resonance, or may inhibit the target with an IC50 of about 1 x 10-8M or less. Alternatively, binding protein may dissociate from the target with a koff rate constant of about 1 x 10-4s-1 or less, as determined by surface plasmon resonance, or may inhibit its activity with an IC50 of about 1 x 10-9M or less. Alternatively, binding protein may dissociate from the target with a 10 k -5
off rate constant of about 1 x 10 s-1 or less, as determined by surface plasmon resonance, or inhibit its activity with an IC50 of about 1 x 10-10M or less. Alternatively, binding protein may dissociate from the target with a koff rate constant of about 1 x 10-5s-1 or less, as determined by surface plasmon resonance, or may inhibit its activity with an IC50 of about 1 x 10-11M or less.
15 In certain embodiments, the engineered binding protein comprises a heavy chain constant region, such as an IgG1, IgG2, IgG3, IgG4, IgA, IgE, IgM or IgD constant region. Preferably, the heavy chain constant region is an IgG1 heavy chain constant region or an IgG4 heavy chain constant region. Furthermore, the binding protein can comprise a light chain constant region, either a kappa light chain constant region or a lambda light chain 20 constant region. The binding protein comprises a kappa light chain constant region.
Alternatively, the binding protein portion can be, for example, a Fab fragment or a single chain Fv fragment.
In certain embodiments, the engineered binding protein comprises an engineered effector function known in the art. The Fc portion of a binding protein mediates several25 important effector functions, e.g., cytokine induction, ADCC, phagocytosis, CDC, and half- life/ clearance rate of binding protein and antigen-binding protein complexes. In some cases these effector functions are desirable for therapeutic binding protein but in other cases might be unnecessary or even deleterious, depending on the therapeutic objectives. Certain human IgG isotypes, particularly IgG1 and IgG3, mediate ADCC and CDC via binding to Fc ^Rs and 30 complement C1q, respectively. Neonatal Fc receptors (FcRn) are the critical components determining the circulating half-life of binding proteins. In still another embodiment at least one amino acid residue is replaced in the constant region of the binding protein, for example
the Fc region of the binding protein, such that effector functions of the binding protein are altered.
In certain embodiments, the engineered binding protein is derivatized or linked to another functional molecule (e.g., another peptide or protein). For example, a labeled binding 5 protein of the invention can be derived by functionally linking a binding protein or binding protein portion of the invention (by chemical coupling, genetic fusion, non-covalent association or otherwise) to one or more other molecular entities, such as another binding protein (e.g., a bispecific binding protein or a diabody), a detectable agent, a cytotoxic agent, a pharmaceutical agent, and/or a protein or peptide that can mediate associate of the binding 10 protein with another molecule (such as a streptavidin core region or a polyhistidine tag).
Useful detectable agents with which a binding protein or binding protein portion of the invention may be derivatized include fluorescent compounds. Exemplary fluorescent detectable agents include fluorescein, fluorescein isothiocyanate, rhodamine, 5- dimethylamine-1-napthalenesulfonyl chloride, phycoerythrin and the like. A binding protein 15 may also be derivatized with detectable enzymes, such as alkaline phosphatase, horseradish peroxidase, glucose oxidase and the like. When a binding protein is derivatized with a detectable enzyme, it is detected by adding additional reagents that the enzyme uses to produce a detectable reaction product. For example, when the detectable agent horseradish peroxidase is present, the addition of hydrogen peroxide and diaminobenzidine leads to a 20 colored reaction product, which is detectable. A binding protein may also be derivatized with biotin, and detected through indirect measurement of avidin or streptavidin binding.
In other embodiment, the engineered binding protein is further modified to generate glycosylation site mutants in which the O- or N-linked glycosylation site of the binding protein has been mutated. One skilled in the art can generate such mutants using standard 25 well-known technologies. Glycosylation site mutants that retain the biological activity, but have increased or decreased binding activity, are another object of the present invention.
In still another embodiment, the glycosylation of the engineered binding protein or antigen-binding portion of the invention is modified. For example, an aglycoslated binding protein can be made (i.e., the binding protein lacks glycosylation). Glycosylation can be 30 altered to, for example, increase the affinity of the binding protein for antigen. Such
carbohydrate modifications can be accomplished by, for example, altering one or more sites of glycosylation within the binding protein sequence. For example, one or more amino acid substitutions can be made that result in elimination of one or more variable region glycosylation sites to thereby eliminate glycosylation at that site. Such aglycosylation may
increase the affinity of the binding protein for antigen. Such an approach is described in further detail in PCT Publication WO2003016466A2, and U.S. Pat. Nos.5,714,350 and 6,350,861, each of which is incorporated herein by reference in its entirety.
Additionally or alternatively, an engineered binding protein of the invention can be 5 further modified with an altered type of glycosylation, such as a hypofucosylated binding protein having reduced amounts of fucosyl residues or a binding protein having increased bisecting GlcNAc structures. Such altered glycosylation patterns have been demonstrated to increase the ADCC ability of binding proteins. Such carbohydrate modifications can be accomplished by, for example, expressing the binding protein in a host cell with altered 10 glycosylation machinery. Cells with altered glycosylation machinery have been described in the art and can be used as host cells in which to express recombinant binding proteins of the invention to thereby produce a binding protein with altered glycosylation. See, for example, Shields et al. (2002) J. Biol. Chem.277: 26733-26740; Umana et al. (1999) Nat. Biotech.17: 176-1, as well as, European Patent No: EP 1,176,195; and PCT Publications Nos WO
15 03/035835 and WO 99/5434280, each of which is incorporated herein by reference in its entirety. Using techniques known in the art a practitioner may generate binding proteins exhibiting human protein glycosylation. For example, yeast strains have been genetically modified to express non-naturally occurring glycosylation enzymes such that glycosylated proteins (glycoproteins) produced in these yeast strains exhibit protein glycosylation identical 20 to that of animal cells, especially human cells (U.S. Patent Nos.7,449,308 and 7,029,872 and PCT Publication No. WO2005100584 A2). IV. Production of TNF Binding Proteins
TNF Binding proteins of the present invention may be produced by any of a number 25 of techniques known in the art. For example, expression from host cells, wherein expression vector(s) encoding the heavy and light chains is (are) transfected into a host cell by standard techniques. The various forms of the term "transfection" are intended to encompass a wide variety of techniques commonly used for the introduction of exogenous DNA into a prokaryotic or eukaryotic host cell, e.g., electroporation, calcium-phosphate precipitation, 30 DEAE-dextran transfection and the like. Although it is possible to express the binding
proteins of the invention in either prokaryotic or eukaryotic host cells, expression of binding proteins in eukaryotic cells is preferable, and most preferable in mammalian host cells, because such eukaryotic cells (and in particular mammalian cells) are more likely than
prokaryotic cells to assemble and secrete a properly folded and immunologically active binding protein.
Preferred mammalian host cells for expressing the recombinant binding proteins of the invention include Chinese Hamster Ovary (CHO cells) (including dhfr- CHO cells, 5 described in Urlaub and Chasin (1980) Proc. Natl. Acad. Sci. USA 77:4216-4220, used with a DHFR selectable marker, e.g., as described in Kaufman and Sharp (1982) Mol. Biol.
159:601-621), NS0 myeloma cells, COS cells and SP2 cells. When recombinant expression vectors encoding binding protein genes are introduced into mammalian host cells, the binding proteins are produced by culturing the host cells for a period of time sufficient to allow for 10 expression of the binding protein in the host cells or, more preferably, secretion of the
binding protein into the culture medium in which the host cells are grown. Binding proteins can be recovered from the culture medium using standard protein purification methods.
Host cells can also be used to produce functional binding protein fragments, such as Fab fragments or scFv molecules. It will be understood that variations on the above
15 procedure are within the scope of the present invention. For example, it may be desirable to transfect a host cell with DNA encoding functional fragments of either the light chain and/or the heavy chain of a binding protein of this invention. Recombinant DNA technology may also be used to remove some, or all, of the DNA encoding either or both of the light and heavy chains that is not necessary for binding to the antigens of interest. The molecules 20 expressed from such truncated DNA molecules are also encompassed by the binding proteins of the invention. In addition, bifunctional binding proteins may be produced in which one heavy and one light chain are a binding protein of the invention and the other heavy and light chain are specific for an antigen other than the antigens of interest by crosslinking a binding protein of the invention to a second binding protein by standard chemical crosslinking 25 methods.
In a preferred system for recombinant expression of a binding protein, or antigen- binding portion thereof, of the invention, a recombinant expression vector encoding both the binding protein heavy chain and the binding protein light chain is introduced into dhfr- CHO cells by calcium phosphate-mediated transfection. Within the recombinant expression vector, 30 the binding protein heavy and light chain genes are each operatively linked to CMV
enhancer/AdMLP promoter regulatory elements to drive high levels of transcription of the genes. The recombinant expression vector also carries a DHFR gene, which allows for selection of CHO cells that have been transfected with the vector using methotrexate selection/amplification. The selected transformant host cells are cultured to allow for
expression of the binding protein heavy and light chains and intact binding protein is recovered from the culture medium. Standard molecular biology techniques are used to prepare the recombinant expression vector, transfect the host cells, select for transformants, culture the host cells and recover the binding protein from the culture medium. Still further 5 the invention provides a method of synthesizing a recombinant binding protein of the
invention by culturing a host cell of the invention in a suitable culture medium until a recombinant binding protein of the invention is synthesized. The method can further comprise isolating the recombinant binding protein from the culture medium. 10 V. Pharmaceutical Compositions
In one aspect, pharmaceutical compositions comprising one or more binding proteins, either alone or in combination with prophylactic agents, therapeutic agents, and/or pharmaceutically acceptable carriers are provided. The pharmaceutical compositions comprising binding proteins provided herein are for use in, but not limited to, diagnosing, 15 detecting, or monitoring a disorder, in preventing, treating, managing, or ameliorating a
disorder or one or more symptoms thereof, and/or in research. The formulation of
pharmaceutical compositions, either alone or in combination with prophylactic agents, therapeutic agents, and/or pharmaceutically acceptable carriers, are known to one skilled in the art (see e.g., US Patent No.9,035,027).
20 Methods of administering a prophylactic or therapeutic agent provided herein include, but are not limited to, parenteral administration (e.g., intradermal, intramuscular,
intraperitoneal, intravenous and subcutaneous), epidural administration, intratumoral administration, mucosal administration (e.g., intranasal and oral routes) and pulmonary administration (e.g., aerosolized compounds administered with an inhaler or nebulizer). The 25 formulation of pharmaceutical compositions for specific routes of administration, and the materials and techniques necessary for the various methods of administration are available and known to one skilled in the art (see e.g., US Patent No.9,035,027).
Dosage regimens may be adjusted to provide the optimum desired response (e.g., a therapeutic or prophylactic response). For example, a single bolus may be administered, 30 several divided doses may be administered over time or the dose may be proportionally
reduced or increased as indicated by the exigencies of the therapeutic situation. It is especially advantageous to formulate parenteral compositions in dosage unit form for ease of administration and uniformity of dosage. The term“dosage unit form” refers to physically discrete units suited as unitary dosages for the mammalian subjects to be treated; each unit
containing a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier. The specification for the dosage unit forms provided herein are dictated by and directly dependent on (a) the unique characteristics of the active compound and the particular therapeutic or prophylactic 5 effect to be achieved, and (b) the limitations inherent in the art of compounding such an
active compound for the treatment of sensitivity in individuals.
An exemplary, non-limiting range for a therapeutically or prophylactically effective amount of a binding protein provided herein is 0.1-20 mg/kg, for example, 1-10 mg/kg. It is to be noted that dosage values may vary with the type and severity of the condition to be 10 alleviated. It is to be further understood that for any particular subject, specific dosage
regimens may be adjusted over time according to the individual need and the professional judgment of the person administering or supervising the administration of the compositions, and that dosage ranges set forth herein are exemplary only and are not intended to limit the scope or practice of the claimed composition.
15
VI. Methods of Treatment Using TNF Binding Molecules
In one aspect, provided herein are methods of treating a TNF-associated disorder in a subject by administering to the individual in need of such treatment a therapeutically effective amount a TNF binding molecule disclosed herein. Such methods can be used to 20 treat any TNF-associated disorder including, without limitation: A. Sepsis
Tumor necrosis factor has an established role in the pathophysiology of sepsis, with biological effects that include hypotension, myocardial suppression, vascular leakage 25 syndrome, organ necrosis, stimulation of the release of toxic secondary mediators and
activation of the clotting cascade. Accordingly, a TNF binding protein of the invention can be used to treat sepsis in any of its clinical settings, including septic shock, endotoxic shock, gram negative sepsis and toxic shock syndrome.
Furthermore, to treat sepsis, a combination of the invention can be coadministered 30 with one or more additional therapeutic agents that may further alleviate sepsis, such as an interleukin-1 inhibitor (such as those described in PCT Publication Nos. WO 92/16221 and WO 92/17583), the cytokine interleukin-6 (see e.g., PCT Publication No. WO 93/11793) or an antagonist of platelet activating factor (see e.g., European Patent Application Publication
No. EP 374510). Other combination therapies for the treatment of sepsis are discussed further in herein.
Additionally, in certain embodiments, a TNF binding protein of the invention is administered to a human subject within a subgroup of sepsis patients having a serum or 5 plasma concentration of IL-6 above 500 pg/ml (e.g., above 1000 pg/ml) at the time of
treatment (see PCT Publication No. WO 95/20978). B. Autoimmune Diseases
Tumor necrosis factor has been implicated in playing a role in the pathophysiology of 10 a variety of autoimmune diseases. For example, TNFα has been implicated in activating tissue inflammation and causing joint destruction in rheumatoid arthritis. TNFα also has been implicated in promoting the death of islet cells and in mediating insulin resistance in diabetes. TNFα has been implicated in mediating cytotoxicity to oligodendrocytes and induction of inflammatory plaques in multiple sclerosis. Chimeric, humanized murine, and 15 fully human anti-hTNFα antibodies have undergone clinical testing for treatment of
rheumatoid arthritis.
Anti-TNF/IL-17 combinations of the invention can be used to treat autoimmune diseases, in particular those associated with inflammation, including rheumatoid arthritis, rheumatoid spondylitis, osteoarthritis and gouty arthritis, allergy, multiple sclerosis,
20 autoimmune diabetes, autoimmune uveitis and nephrotic syndrome. Typically, the
combination is administered systemically, although for certain disorders, local administration of the anti-TNF and/or IL-17 at a site of inflammation may be beneficial (e.g., local administration in the joints in rheumatoid arthritis or topical application to diabetic ulcers, alone or in combination with a cyclohexane-ylidene derivative as described in PCT
25 Publication No. WO 93/19751). Anti-TNF/IL-17 combinations of the invention also can be administered with one or more additional therapeutic agents useful in the treatment of autoimmune diseases, as discussed further herein. C. Infectious Diseases
30 Tumor necrosis factor has been implicated in mediating biological effects observed in a variety of infectious diseases. For example, TNFα has been implicated in mediating brain inflammation and capillary thrombosis and infarction in malaria. TNFα also has been implicated in mediating brain inflammation, inducing breakdown of the blood-brain bather, triggering septic shock syndrome and activating venous infarction in meningitis. TNFα also
has been implicated in inducing cachexia, stimulating viral proliferation and mediating central nervous system injury in acquired immune deficiency syndrome (AIDS).
Accordingly, the anti-TNF/IL-17 combinations of the invention, can be used in the treatment of infectious diseases, including bacterial meningitis (see e.g., European Patent Application 5 Publication No. EP 585705), cerebral malaria, AIDS and AIDS-related complex (ARC) (see e.g., European Patent Application Publication No. EP 230574), as well as cytomegalovirus infection secondary to transplantation (see e.g., Fietze et al. (1994) Transplantation 58: 675- 680). Anti-TNF/IL-17 combinations of the invention, also can be used to alleviate symptoms associated with infectious diseases, including fever and myalgias due to infection (such as 10 influenza) and cachexia secondary to infection (e.g., secondary to AIDS or ARC). D. Transplantation
Tumor necrosis factor has been implicated as a key mediator of allograft rejection and graft versus host disease (GVHD) and in mediating an adverse reaction that has been 15 observed when the rat antibody OKT3, directed against the T cell receptor CD3 complex, is used to inhibit rejection of renal transplants. Accordingly, anti-TNF/IL-17 combinations of the invention, can be used to inhibit transplant rejection, including rejections of allografts and xenografts and to inhibit GVHD. Although the combination may be used alone, it can be used in combination with one or more other agents that inhibit the immune response against 20 the allograft or inhibit GVHD. For example, in one embodiment, a TNF binding protein is used in combination with OKT3 to inhibit OKT3-induced reactions. In another embodiment, a TNF binding protein is used in combination with one or more antibodies directed at other targets involved in regulating immune responses, such as the cell surface molecules CD25 (interleukin-2 receptor-.alpha.), CD11a (LFA-1), CD54 (ICAM-1), CD4, CD45,
25 CD28/CTLA4, CD80 (B7-1) and/or CD86 (B7-2). In yet another embodiment, a TNF
binding protein of the invention is used in combination with one or more general
immunosuppressive agents, such as cyclosporin A or FK506. E. Malignancy
30 Tumor necrosis factor has been implicated in inducing cachexia, stimulating tumor growth, enhancing metastatic potential and mediating cytotoxicity in malignancies.
Accordingly, a TNF binding protein of the invention can be used in the treatment of malignancies, to inhibit tumor growth or metastasis and/or to alleviate cachexia secondary to malignancy. The anti-TNF/ IL-17 combination may be administered systemically or locally
to the tumor site. F. Pulmonary Disorders
Tumor necrosis factor has been implicated in the pathophysiology of adult respiratory 5 distress syndrome (ARDS), including stimulating leukocyte-endothelial activation, directing cytotoxicity to pneumocytes and inducing vascular leakage syndrome. Accordingly, a TNF binding protein of the invention, can be used to treat various pulmonary disorders, including adult respiratory distress syndrome (see e.g., PCT Publication No. WO 91/04054), shock lung, chronic pulmonary inflammatory disease, pulmonary sarcoidosis, pulmonary fibrosis 10 and silicosis. The anti-TNF/ IL-17 combination may be administered systemically or locally to the lung surface, for example as an aerosol. An anti-TNF/ IL-17 combination of the invention also can be administered with one or more additional therapeutic agents useful in the treatment of pulmonary disorders, as discussed further in herein. 15 G. Intestinal Disorders
Tumor necrosis factor has been implicated in the pathophysiology of inflammatory bowel disorders. Chimeric murine anti-hTNFα antibodies have undergone clinical testing for treatment of Crohn's disease. The anti-TNF/ IL-17 combinations of the invention, also can be used to treat intestinal disorders, such as idiopathic inflammatory bowel disease, which 20 includes two syndromes, Crohn's disease and ulcerative colitis. An anti-TNF/ IL-17
combination of the invention also can be administered with one or more additional therapeutic agents useful in the treatment of intestinal disorders, as discussed further in herein. 25 H. Cardiac Disorders
The anti-TNF/ IL-17 combinations of the invention, also can be used to treat various cardiac disorders, including ischemia of the heart (see e.g., European Patent Application Publication No. EP 453898) and heart insufficiency (weakness of the heart muscle)(see e.g., PCT Publication No. WO 94/20139).
30
I. Others Disorders
The anti-TNF/ IL-17 combination of the invention, also can be used to treat various other disorders in which TNF-alpha activity is detrimental. Examples of other diseases and disorders in which TNF-alpha activity has been implicated in the pathophysiology, and thus
which can be treated using a TNF binding protein of the invention, include inflammatory bone disorders and bone resorption disease; hepatitis, including alcoholic hepatitis, viral hepatitis, and fulminant hepatitis; coagulation disturbances, burns, reperfusion injury, keloid formation, scar tissue formation; pyrexia; periodontal disease; obesity and radiation toxicity. 5 In certain embodiments, an anti-TNF/ IL-17 combinations of the invention is used for the treatment of a TNF-associated disorder selected from the group consisting of
osteoarthritis, rheumatoid arthritis, juvenile chronic arthritis, septic arthritis, Lyme arthritis, psoriatic arthritis, reactive arthritis, spondyloarthropathy, systemic lupus erythematosus, Crohn's disease, ulcerative colitis, inflammatory bowel disease, insulin dependent diabetes 10 mellitus, thyroiditis, asthma, allergic diseases, psoriasis, dermatitis, scleroderma, graft versus host disease, organ transplant rejection, acute or chronic immune disease associated with organ transplantation, sarcoidosis, atherosclerosis, disseminated intravascular coagulation, Kawasaki's disease, Grave's disease, nephrotic syndrome, chronic fatigue syndrome,
Wegener's granulomatosis, Henoch-Schoenlein purpurea, microscopic vasculitis of the 15 kidneys, chronic active hepatitis, uveitis, septic shock, toxic shock syndrome, sepsis
syndrome, cachexia, infectious diseases, parasitic diseases, acute transverse myelitis, Huntington's chorea, Parkinson's disease, Alzheimer's disease, stroke, primary biliary cirrhosis, hemolytic anemia, malignancies, heart failure, myocardial infarction, Addison's disease, sporadic polyglandular deficiency type I, polyglandular deficiency type II (Schmidt's 20 syndrome), adult (acute) respiratory distress syndrome, alopecia, alopecia greata,
seronegative arthropathy, arthropathy, Reiter's disease, psoriatic arthropathy, ulcerative colitic arthropathy, enteropathic synovitis, Chlamydia-associated arthropathy, Yersinia- associated arthropathy, Salmonella-associated arthropathy, spondyloarthropathy,
atheromatous disease/arteriosclerosis, atopic allergy, autoimmune bullous disease, pemphigus 25 vulgaris, pemphigus foliaceus, pemphigoid, linear IgA disease, autoimmune haemolytic
anaemia, Coombs positive haemolytic anaemia, acquired pernicious anaemia, juvenile pernicious anaemia, myalgic encephalitis/Royal Free disease, chronic mucocutaneous candidiasis, giant cell arteritis, primary sclerosing hepatitis, cryptogenic autoimmune hepatitis, acquired immunodeficiency syndrome, acquired immunodeficiency related
30 diseases, hepatitis B, hepatitis C, common varied immunodeficiency (common variable
hypogammaglobulinaemia), dilated cardiomyopathy, female infertility, ovarian failure, premature ovarian failure, fibrotic lung disease, cryptogenic fibrosing alveolitis, post- inflammatory interstitial lung disease, interstitial pneumonitis, connective tissue disease associated interstitial lung disease, mixed connective tissue disease associated lung disease,
systemic sclerosis associated interstitial lung disease, rheumatoid arthritis associated interstitial lung disease, systemic lupus erythematosus associated lung disease,
dermatomyositis/polymyositis associated lung disease, Sjogren's disease associated lung disease, ankylosing spondylitis associated lung disease, vasculitic diffuse lung disease, 5 haemosiderosis associated lung disease, drug-induced interstitial lung disease, fibrosis,
radiation fibrosis, bronchiolitis obliterans, chronic eosinophilic pneumonia, lymphocytic infiltrative lung disease, postinfectious interstitial lung disease, gouty arthritis, autoimmune hepatitis, type-1 autoimmune hepatitis (classical autoimmune or lupoid hepatitis), type-2 autoimmune hepatitis (anti-LKM antibody hepatitis), autoimmune mediated hypoglycemia, 10 type B insulin resistance with acanthosis nigricans, hypoparathyroidism, acute immune
disease associated with organ transplantation, chronic immune disease associated with organ transplantation, osteoarthrosis, primary sclerosing cholangitis, psoriasis type 1, psoriasis type 2, idiopathic leucopaenia, autoimmune neutropaenia, renal disease NOS,
glomerulonephritides, microscopic vasculitis of the kidneys, Lyme disease, discoid lupus 15 erythematosus, male infertility idiopathic or NOS, sperm autoimmunity, multiple sclerosis (all subtypes), sympathetic ophthalmia, pulmonary hypertension secondary to connective tissue disease, Goodpasture's syndrome, pulmonary manifestation of polyarteritis nodosa, acute rheumatic fever, rheumatoid spondylitis, Still's disease, systemic sclerosis, Sjorgren's syndrome, Takayasu's disease/arteritis, autoimmune thrombocytopaenia, idiopathic
20 thrombocytopaenia, autoimmune thyroid disease, hyperthyroidism, goitrous autoimmune hypothyroidism (Hashimoto's disease), atrophic autoimmune hypothyroidism, primary myxoedema, phacogenic uveitis, primary vasculitis, vitiligo, acute liver disease, chronic liver diseases, alcoholic cirrhosis, alcohol-induced liver injury, cholestasis, idiosyncratic liver disease, drug-induced hepatitis, non-alcoholic steatohepatitis, allergy, group B streptococci 25 (GBS) infection, mental disorders (e.g., depression and schizophrenia), Th2 Type and Th1 Type mediated diseases, acute and chronic pain (different forms of pain), cancers such as lung, breast, stomach, bladder, colon, pancreas, ovarian, prostate and rectal cancer and hematopoietic malignancies (leukemia and lymphoma), abetalipoproteinemia, acrocyanosis, acute and chronic parasitic or infectious processes, acute leukemia, acute lymphoblastic 30 leukemia (ALL), acute myeloid leukemia (AML), acute or chronic bacterial infection, acute pancreatitis, acute renal failure, adenocarcinomas, atrial ectopic beats, AIDS dementia complex, alcohol-induced hepatitis, allergic conjunctivitis, allergic contact dermatitis, allergic rhinitis, allograft rejection, alpha-1-antitrypsin deficiency, amyotrophic lateral sclerosis, anemia, angina pectoris, anterior horn cell degeneration, antiphospholipid syndrome, anti-
receptor hypersensitivity reactions, aortic and peripheral aneurysms, aortic dissection, arterial hypertension, arteriosclerosis, arteriovenous fistula, ataxia, atrial fibrillation (sustained or paroxysmal), atrial flutter, atrioventricular block, B cell lymphoma, bone graft rejection, bone marrow transplant (BMT) rejection, bundle branch block, Burkitt's lymphoma, burns, cardiac 5 arrhythmias, cardiac stun syndrome, cardiac tumors, cardiomyopathy, cardiopulmonary
bypass inflammation response, cartilage transplant rejection, cerebellar cortical
degenerations, cerebellar disorders, chaotic or multifocal atrial tachycardia, chemotherapy associated disorders, chronic myelocytic leukemia (CML), chronic alcoholism, chronic inflammatory pathologies, chronic lymphocytic leukemia (CLL), chronic obstructive
10 pulmonary disease (COPD), chronic salicylate intoxication, colorectal carcinoma, congestive heart failure, conjunctivitis, contact dermatitis, cor pulmonale, coronary artery disease, Creutzfeldt-Jakob disease, culture negative sepsis, cystic fibrosis, cytokine therapy associated disorders, dementia pugilistica, demyelinating diseases, dengue hemorrhagic fever, dermatitis, dermatologic conditions, diabetes, diabetic arteriosclerotic disease, diffuse Lewy 15 body disease, dilated congestive cardiomyopathy, disorders of the basal ganglia, Down's syndrome in middle age, drug-induced movement disorders induced by drugs which block CNS dopamine receptors, drug sensitivity, eczema, encephalomyelitis, endocarditis, endocrinopathy, epiglottitis, Epstein-Barr virus infection, erythromelalgia, extrapyramidal and cerebellar disorders, familial hemophagocytic lymphohistiocytosis, fetal thymus implant 20 rejection, Friedreich's ataxia, functional peripheral arterial disorders, fungal sepsis, gas
gangrene, gastric ulcer, glomerular nephritis, graft rejection of any organ or tissue, gram negative sepsis, gram positive sepsis, granulomas due to intracellular organisms, hairy cell leukemia, Hallervorden-Spatz disease, Hashimoto's thyroiditis, hay fever, heart transplant rejection, hemochromatosis, hemodialysis, hemolytic uremic syndrome/thrombolytic
25 thrombocytopenic purpura, hemorrhage, hepatitis A, His bundle arrhythmias, HIV
infection/HIV neuropathy, Hodgkin's disease, hyperkinetic movement disorders,
hypersensitivity reactions, hypersensitivity pneumonitis, hypertension, hypokinetic movement disorders, hypothalamic-pituitary-adrenal axis evaluation, idiopathic Addison's disease, idiopathic pulmonary fibrosis, antibody mediated cytotoxicity, asthenia, infantile 30 spinal muscular atrophy, inflammation of the aorta, influenza A, ionizing radiation exposure, iridocyclitis/uveitis/optic neuritis, ischemia-reperfusion injury, ischemic stroke, juvenile rheumatoid arthritis, juvenile spinal muscular atrophy, Kaposi's sarcoma, kidney transplant rejection, legionella, leishmaniasis, leprosy, lesions of the corticospinal system, lipedema, liver transplant rejection, lymphedema, malaria, malignant lymphoma, malignant
histiocytosis, malignant melanoma, meningitis, meningococcemia, metabolic migraine headache, idiopathic migraine headache, mitochondrial multisystem disorder, mixed connective tissue disease, monoclonal gammopathy, multiple myeloma, multiple systems degenerations (Menzel, Dejerine-Thomas, Shy-Drager, and Machado-Joseph), myasthenia 5 gravis, mycobacterium avium intracellulare, mycobacterium tuberculosis, myelodysplastic syndrome, myocardial infarction, myocardial ischemic disorders, nasopharyngeal carcinoma, neonatal chronic lung disease, nephritis, nephrosis, neurodegenerative diseases, neurogenic muscular atrophies, neutropenic fever, non-Hodgkin's lymphoma, occlusion of the abdominal aorta and its branches, occlusive arterial disorders, orchitis/epididymitis, orchitis/vasectomy 10 reversal procedures, organomegaly, osteoporosis, pancreas transplant rejection, pancreatic carcinoma, paraneoplastic syndrome/hypercalcemia of malignancy, parathyroid transplant rejection, pelvic inflammatory disease, perennial rhinitis, pericardial disease, peripheral atherosclerotic disease, peripheral vascular disorders, peritonitis, pernicious anemia, pneumocystis carinii pneumonia, pneumonia, POEMS syndrome (polyneuropathy,
15 organomegaly, endocrinopathy, monoclonal gammopathy, and skin changes syndrome), post perfusion syndrome, post pump syndrome, post-MI cardiotomy syndrome, preeclampsia, progressive supranucleo palsy, primary pulmonary hypertension, radiation therapy,
Raynaud's phenomenon, Raynaud's disease, Refsum's disease, regular narrow QRS tachycardia, renovascular hypertension, reperfusion injury, restrictive cardiomyopathy, 20 sarcomas, senile chorea, senile dementia of Lewy body type, seronegative arthropathies, shock, sickle cell anemia, skin allograft rejection, skin changes syndrome, small bowel transplant rejection, solid tumors, specific arrhythmias, spinal ataxia, spinocerebellar degenerations, streptococcal myositis, structural lesions of the cerebellum, subacute sclerosing panencephalitis, syncope, syphilis of the cardiovascular system, systemic
25 anaphylaxis, systemic inflammatory response syndrome, systemic onset juvenile rheumatoid arthritis, telangiectasia, thromboangiitis obliterans, thrombocytopenia, toxicity, transplants, trauma/hemorrhage, type III hypersensitivity reactions, type IV hypersensitivity, unstable angina, uremia, urosepsis, urticaria, valvular heart diseases, varicose veins, vasculitis, venous diseases, venous thrombosis, ventricular fibrillation, viral and fungal infections, viral30 encephalitis/aseptic meningitis, viral-associated hemophagocytic syndrome, Wernicke- Korsakoff syndrome, Wilson's disease, xenograft rejection of any organ or tissue, acute coronary syndromes, acute idiopathic polyneuritis, acute inflammatory demyelinating polyradiculoneuropathy, acute ischemia, adult Still's disease, alopecia greata, anaphylaxis, anti-phospholipid antibody syndrome, aplastic anemia, arteriosclerosis, atopic eczema, atopic
dermatitis, autoimmune dermatitis, autoimmune disorder associated with streptococcus infection, autoimmune enteropathy, autoimmune hearing loss, autoimmune
lymphoproliferative syndrome (ALPS), autoimmune myocarditis, autoimmune premature ovarian failure, blepharitis, bronchiectasis, bullous pemphigoid, cardiovascular disease, 5 catastrophic antiphospholipid syndrome, celiac disease, cervical spondylosis, chronic
ischemia, cicatricial pemphigoid, clinically isolated syndrome (CIS) with risk for multiple sclerosis, childhood onset psychiatric disorder, chronic obstructive pulmonary disease (COPD), dacryocystitis, dermatomyositis, diabetic retinopathy, disk herniation, disk prolapse, drug induced immune hemolytic anemia, endocarditis, endometriosis, endophthalmitis, 10 episcleritis, erythema multiforme, erythema multiforme major, gestational pemphigoid,
Guillain-Barre syndrome (GBS), hay fever, Hughes syndrome, idiopathic Parkinson's disease, idiopathic interstitial pneumonia, IgE-mediated allergy, immune hemolytic anemia, inclusion body myositis, infectious ocular inflammatory disease, inflammatory demyelinating disease, inflammatory heart disease, inflammatory kidney disease, IPF/UIP, iritis, keratitis,
15 keratojunctivitis sicca, Kussmaul disease or Kussmaul-Meier disease, Landry's paralysis, Langerhan's cell histiocytosis, livedo reticularis, macular degeneration, microscopic polyangiitis, Morbus Bechterev, motor neuron disorders, mucous membrane pemphigoid, multiple organ failure, myasthenia gravis, myelodysplastic syndrome, myocarditis, nerve root disorders, neuropathy, non-A non-B hepatitis, optic neuritis, osteolysis, ovarian cancer, 20 pauciarticular JRA, peripheral artery occlusive disease (PAOD), peripheral vascular disease (PVD), peripheral artery disease (PAD), phlebitis, polyarteritis nodosa (or periarteritis nodosa), polychondritis, polymyalgia rheumatica, poliosis, polyarticular JRA, polyendocrine deficiency syndrome, polymyositis, polymyalgia rheumatica (PMR), post-pump syndrome, primary Parkinsonism, prostate and rectal cancer and hematopoietic malignancies (leukemia 25 and lymphoma), prostatitis, pure red cell aplasia, primary adrenal insufficiency, recurrent neuromyelitis optica, restenosis, rheumatic heart disease, SAPHO (synovitis, acne, pustulosis, hyperostosis, and osteitis), secondary amyloidosis, shock lung, scleritis, sciatica, secondary adrenal insufficiency, silicone associated connective tissue disease, Sneddon-Wilkinson dermatosis, spondylitis ankylosans, Stevens-Johnson syndrome (SJS), systemic inflammatory 30 response syndrome, temporal arteritis, toxoplasmic retinitis, toxic epidermal necrolysis,
transverse myelitis, TRAPS (tumor-necrosis factor receptor type 1 (TNFR)-associated periodic syndrome), type 1 allergic reaction, type II diabetes, urticaria, usual interstitial pneumonia (UIP), vasculitis, vernal conjunctivitis, viral retinitis, Vogt-Koyanagi-Harada
syndrome (VKH syndrome), and wet macular degeneration. In a particular embodiment, the TNF-associated disease or disorder is rheumatoid arthritis. VII. Diagnostics
5 The disclosure herein also provides diagnostic applications including, but not limited to, diagnostic assay methods, diagnostic kits containing one or more TNF binding proteins, and adaptation of the methods and kits for use in automated and/or semi-automated systems. The methods, kits, and adaptations provided may be employed in the detection, monitoring, and/or treatment of a disease or disorder in an individual. This is further elucidated below. 10 Method of assay
The present disclosure also provides a method for determining the presence, amount or concentration of an analyte, or fragment thereof, in a test sample using at least one binding protein as described herein. Any suitable assay as is known in the art can be used in the method. Examples include, but are not limited to, immunoassays and/or methods employing 15 mass spectrometry.
Immunoassays provided by the present disclosure may include sandwich immunoassays, radioimmunoassay (RIA), enzyme immunoassay (EIA), enzyme-linked immunosorbent assay (ELISA), competitive-inhibition immunoassays, fluorescence polarization immunoassay (FPIA), enzyme multiplied immunoassay technique (EMIT), 20 bioluminescence resonance energy transfer (BRET), and homogenous chemiluminescent assays, among others.
A chemiluminescent microparticle immunoassay, in particular one employing the ARCHITECT® automated analyzer (Abbott Laboratories, Abbott Park, IL), is an example of an immunoassay.
25 Methods employing mass spectrometry are provided by the present disclosure and include, but are not limited to MALDI (matrix-assisted laser desorption/ionization) or by SELDI (surface-enhanced laser desorption/ionization).
Methods for collecting, handling, processing, and analyzing biological test samples using immunoassays and mass spectrometry would be well-known to one skilled in the art, 30 are provided for in the practice of the present disclosure (US 2009-0311253 A1).
Kit
A kit for assaying a test sample for the presence, amount or concentration of an analyte, or fragment thereof, in a test sample is also provided. The kit comprises at least one component for assaying the test sample for the analyte, or fragment thereof, and instructions 5 for assaying the test sample for the analyte, or fragment thereof. The at least one component for assaying the test sample for the analyte, or fragment thereof, can include a composition comprising a binding protein, as disclosed herein, and/or an anti-analyte binding protein (or a fragment, a variant, or a fragment of a variant thereof), which is optionally immobilized on a solid phase.
10 Optionally, the kit may comprise a calibrator or control, which may comprise isolated or purified analyte. The kit can comprise at least one component for assaying the test sample for an analyte by immunoassay and/or mass spectrometry. The kit components, including the analyte, binding protein, and/or anti-analyte binding protein, or fragments thereof, may be optionally labeled using any art-known detectable label. The materials and methods for the 15 creation provided for in the practice of the present disclosure would be known to one skilled in the art (US Patent No.9,035,027). Adaptation of kit and method
The kit (or components thereof), as well as the method of determining the presence, 20 amount or concentration of an analyte in a test sample by an assay, such as an immunoassay as described herein, can be adapted for use in a variety of automated and semi-automated systems (including those wherein the solid phase comprises a microparticle), as described, for example, in US Patent Nos.5,089,424 and 5,006,309, and as commercially marketed, for example, by Abbott Laboratories (Abbott Park, IL) as ARCHITECT®.
25 Other platforms available from Abbott Laboratories include, but are not limited to,
AxSYM®, IMx® (see, for example, US Patent No.5,294,404, PRISM®, EIA (bead), and Quantum™ II, as well as other platforms. Additionally, the assays, kits and kit components can be employed in other formats, for example, on electrochemical or other hand-held or point-of-care assay systems. The present disclosure is, for example, applicable to the
30 commercial Abbott Point of Care (i-STAT®, Abbott Laboratories) electrochemical
immunoassay system that performs sandwich immunoassays. Immunosensors and their methods of manufacture and operation in single-use test devices are described, for example in, US Patent No.5,063,081; 7,419,821; 7,682,833; 7,723,099; and US 9,035,027; and US Publication Nos.20040018577
Exemplification
Example 1: Amino Acid Sequences of TNF and/or IL-17 Binding Molecules
Binding molecule structures were synthesized by standard recombinant methods. 5 Figure 1A shows a molecule that is bivalent for IL-17 and monovalent for TNF named
MBMM2. The amino acid sequence for MBMM2 is provided in Table 5. Figure 1B shows a molecule that is bivalent for TNF and monovalent for IL-17 named MBMM1. The amino acid sequence for MBMM1 is provided in Table 6. Figure 2A shows a molecule that is
tetravalent for TNF named TV-GS (PR-1580725 or PR-1603912) or TV-LS (PR-1580724), 10 depending upon which linker is used. The amino acid sequences for the TV-GS and TV-LS
molecules is provided in Table 7. Figure 2B shows a molecule that is bivalent for TNF
named JMB-GS (PR-1603136). The sequence for JMB-GS is provided in Table 8. Figure 2C shows a molecule that is monovalent for both for TNF and IL-17 named PR-1603912 or PR- 1603915. The sequences for 1603912 or 1603915 are provided in Table 9. Not shown are a 15 molecule that is tetravalent for IL-17 named PR-1611416 (with GS linker) or PR-1611418
(with LS linker). The sequences for PR-1611416 or PR-1611418 are provided in Table 10. Table 5: Amino Acid Sequences of MBMM2 (PR-1621611) Anti-TNF/IL-17 Bispecific
CKASGGSFGGYGIGWVRQAPGQGLEWMGGITPFFGFADYA
Table 6: Amino Acid Sequences of MBMM1 (PR-1621615) Anti-TNF/IL-17 Bispecific Name SEQ ID Amino Acid Sequence
Full Light
Table 7: Amino Acid Sequences Anti-TNF Tetravalent Constructs
PGK
xamp e : armaco ne c e o s an a er a s Pharmacokinetic Study
5 Male CD-1 mice (n=5 per group) received a single, 5 mg/kg intravenous dose of PR- study binding protein. Whole blood samples were collected over a period of 21 days from the tail vein, immediately diluted in assay buffer (1% MSD Blocker A in Tris-buffered saline with 0.02% Tween-20) and stored frozen at -80 until analysis. 10 Bioanalysis of PK Samples
Binding protein concentrations were measured by an electrochemiluminescent (MSD) method using biotinylated IL-17 capture (PR-1264676) and sulfo tagged (goat) anti-human IgG (MSD Cat# R32AJ-1) for detection. The samples were analyzed at a 1% final matrix concentration. MSD standard curve fitting and data evaluation was performed using XLfit4 15 software (Version 4.2.1 Build 16). A calibration curve was plotted from MSD luminescence units versus theoretical standard concentrations. A four-parameter logistic model was used for curve fitting. The regression equation for the calibration curve was then used to back calculate the measured concentrations. The lower limit of quantitation (LLOQ) was 0.02 µg.mL. The linear range was 0.02-15 µg/mL. Values that were below the quantitation limit 20 were omitted from calculation. Using the rationale that biologics do not generally partition into circulating blood cells, whole blood concentrations were multiplied by two to estimate serum concentrations. Pharmacokinetic parameters were calculated with Non-compartmental analysis using WinNonlin Professional (version 5.0.1, Pharsight, Mountain View, California, USA).
25
Table 10 and Figure 3A illustrate the results of the MBMM2 study over 21 days.
Table 10: Serum Concentration (µg/mL) of MBMM2 After 5 mg/kg IV Dose in CD-1 Mice
Time Animal Animal 2 Animal Animal Animal Avera e SD
-t .
BQL: below quantifiable levels
5 SD: standard deviation Table 11 shows the serum concentrations of MBMM2. Table 11: Serum Concentration (µg/mL) of MBMM2 After 5 mg/kg IV Dose in CD-1 10 Mice
T1/2: halflife
Vss: volume of distribution at steady state [(dose/AUC)(MRT) = (( ^g/kg)/( ^g*h/l))/h = l/kg] AUC: area under curve
AUC0-t: area under the plasma concentration-time curve from time zero to the last measurable 15 concentration
CLP: clearance from plasma
MRT: mean residence time; represents the average time a molecule stays in the body n.f.: no fit
*harmonic mean
Table 12 and Figure 3B illustrate the results of the MBMM1 study over 21 days. Table 12: Serum Concentration (µg/mL) of MBMM1 After 5 mg/kg IV Dose in CD-1 5 Mice
* mnae rom cacua ons ue o proa e .
**Not enough samples for calculations.
NS: no sample
N/A: not applicable
10 BQL: below quantifiable levels Table 13 shows the serum concentration of MBMM1. Table 13: Serum Concentration (µg/mL) of MBMM1 After 5 mg/kg IV Dose in CD-1 15 Mice
*harmonic mean
Four animals displayed probable ADA. Animal #3 died prior to the 96hr sampling.
Tables 10-13 and Figures 3A and 3B demonstrate that the trivalent binding molecules that were bivalent for IL-17 and monovalent for TNF had a significantly longer half-life than the trivalent molecules that were bivalent for TNF and monovalent for IL-17. The averaged 5 data are presented in Figure 3C and Table 14. Table 14: PK Parameters of Anti-TNF ^/IL-17 MBMM Molecules After 5 mg/kg IV Dosing in CD-1 Mice
NC: not calculable
Anti-TNF/IL-17 molecule PR-1621611 (MBMM2) displayed a long half-life (14.7 days), low clearance (0.13 mL/h/kg), and small volume of distribution (64 mL/kg). PK 15 calculations were based on 2 out of 5 mice. Animals in the PR-1621615 (MBMM1) group displayed short half-life and probable ADA, interfering in PK calculations. The MBMM molecules were designed to test the impacts of binding geometries and molecular valency on the effects of ADA as seen in mouse PK models with regard to anti- 20 TNF biologics. TNF ^ antigen is a trimer, consisting of 3 potential binding sites, which poses interesting dynamics when it is targeted and bound by a bivalent antibody. In the presence of a high concentration of TNF ^, such as is seen in inflammation, a bivalent therapeutic can and will cross link TNF ^ antigen, and if in a high enough concentration, form a lattice of mAB- antigen complex that is easily recognizable by immune cells. It is postulated that this 25 complex can contribute to and exacerbate the immunogenicity of a biologic. The molecules described herein contain either a bivalent anti-TNF ^ in-tandem paired with a monovalent anti-IL17 (MBMM1, PR-1621615), or a bivalent in-tandem anti-IL17 paired with a monovalent D2E7 (MBMM2, PR-1621611). The PK results of these molecules 30 show a striking difference in molecular half-life (Figure 3C), whereby the MBMM1
molecules are exhibiting a significant reduction in half-life and a probable ADA response by mice; MBMM2 exhibits a significant increase in PK and no probable ADA response. Example 3: Pharmacokinetic Parameters of Monospecific Tetravalent and Monospecific 5 Bivalent Anti-TNFα Molecules After 5 mg/kg IV Dosing in CD-1 Mice Three tetravalent anti-TNF molecules named TV-GS (PR-1580725 or PR-1603912) or TV-LS (PR-1580724) (Figure 2a) and one bivalent anti-TNF molecule named JMB-GS (PR-1603136) (Figure 2b) were prepared by standard methods known in the art and their 10 pharmacokinetic parameters tested.
Table 15 and Figure 4 illustrate the results of the PR-1580725 study over 21 days Table 15: Serum Concentration (µg/mL) of TV-GS Molecule (PR-1580725) After 5 mg/kg IV Dose in CD-1 Mice
15 BQL: below quantifiable levels Table 16 shows the serum concentrations of PR-1580725. Table 16: Serum Concentration (µg/mL) of TV-GS Molecule (PR-1580725) After 5 20 m 4
. . . 4
a e an gure ustrate te resuts o te - stuy over ays. 5
Table 17: Serum Concentration (µg/mL) of Ambromab Molecule (PR-1603912) After 5 mg/kg IV Dose in CD-1 Mice
BQL: below quantifiable levels 10 Table 18 shows the serum concentrations of PR-1603912. Table 18: Serum Concentration (µg/mL) of Ambromab Molecule (PR-1603912) After 5 m 5 5
. . . . 0
5 Table 19: Serum Concentration (µg/mL) of TV-LS Molecule (PR-1580724) After 5 mg/kg IV Dose in CD-1 Mice
B : eow quant a e eves Table 20 shows the serum concentrations of PR-1580724.
10
Table 20: Serum Concentration (µg/mL) of TV-LS (PR-1580724) Molecule After 5 m/k IV Dose in CD-1 Mice
9
*harmonic mean
15 Table 21 and Figure 7 illustrate the results of the PR-1603136 study over 21 days.
Table 21: Serum Concentration (µg/mL) of JMB-GS Tandem (PR-1603136) Molecule After 5 mg/kg IV Dose in CD-1 Mice
Time Animal 1 Animal 2 Animal 3 Animal 4 Animal Avera e SD
B
5 Table 22 shows the serum concentrations of PR-1603136. Table 22: Serum Concentration (µg/mL) of JMB-GS Tandem (PR-1603136) Molecule After 5 mg/kg IV Dose in CD-1 Mice
*harmonic mean
10
Table 23: PK Parameters of Monospecific Tetravalent and Monospecific Bivalent Anti- TNFα Molecules After 5 mg/kg IV Dosing in CD-1 Mice
PR-1603912 Ambromab 10.2 0.18 65 4
- - antibody levels out to 21 days. This animal displayed a long half-life and low CL (10.2 days 5 and 0.18 mL/h/kg). All other animals within this group and all other dose groups displayed probable ADA at 168 hours or 240 hours. The short half-lives for PR-1603136, PR-1580725, and PR-1580724 prior to the onset of ADA could be due to a number or mechanisms including renal clearance and in vivo stability.
When comparing the MBMM2 PK results of Example 2 to the above PK results of in-10 tandem, bivalent, monospecific anti-TNF ^ molecule (PR-1603136) and tetravalent, anti- TNF ^ molecules (PR-1580725, PR-1580724), the contrasts in valency again reveal an improved PK for MBMM2 which features a monovalent anti-TNF ^ ^binder. Figure 8 features PK results from a monovalent anti-TNF ^ molecule (PR-1603912) versus tetravalent (PR- 1580725, PR-1580724) and in-tandem, bivalent anti-TNF ^ ^ ^PR ^ ^ ^ ^ ^ ^ ^ ^ ^ molecules; and15 the same extended PK is seen with the monovalent format when compared to the bivalent, in- tandem and tetravalent molecules, which again exhibit low half-lives and probable ADA responses in mice. The molecules tested herein provide evidence of an improved half-life and mitigated 20 ADA response in mice, while remaining bivalent and exhibiting full potency in its binding to a second antigen. MBMM2 is advantageous in that it can modify potential ADA responses from an anti-TNF ^ ^targeting molecule while retaining full affinity and activity for an additional target and allow for the production of a disease-specific, fit-for-purpose bispecific molecule.
25
Equivalents
The disclosure may be embodied in other specific forms without departing from the spirit or essential characteristics thereof. The foregoing embodiments are therefore to be considered in all respects illustrative rather than limiting of the disclosure. Scope of the
disclosure is thus indicated by the appended claims rather than by the foregoing description, and all changes that come within the meaning and range of equivalency of the claims are therefore intended to be embraced herein.
Claims
We claim: 1. A binding protein comprising first, second, third and fourth polypeptide chains, wherein said first polypeptide chain comprises VD1-(X1)n-VD2-C-(X2)n,
wherein VD1 is a first heavy chain variable domain,
5 VD2 is a second heavy chain variable domain,
C is a CH1 domain,
X1 is a linker with the proviso that it is not a constant domain,
n is 0 or 1, and
X2 is an Fc region;
10 wherein said second polypeptide chain comprises VD1-(X1)n-VD2-C,
wherein VD1 is a first light chain variable domain,
VD2 is a second light chain variable domain,
C is a CL domain,
X1 is a linker with the proviso that it is not a constant domain,
15 and n is 0 or 1;
wherein the VD1 of the heavy chain and the VD1 of the light chain form a functional binding site and wherein the VD2 of the heavy chain and the VD2 of the light chain form a functional binding site; and
wherein the VD1 and VD2 functional binding sites bind to the same non-TNFα antigen; and 20 wherein said third polypeptide chain comprises VD3-C-(X1)n,
wherein VD3 is a third heavy chain variable domain,
C is a CH1 domain,
X1 is an Fc region, and
n is 0 or 1;
25 wherein said fourth polypeptide chain comprises VD3-C,
wherein VD3 is a first light chain variable domain; and
C is a CL domain;
wherein the VD3 of the heavy chain and the VD3 of the light chain form a functional binding site for TNFα. 30 2. The binding protein of claim 1, wherein the TNFα is human TNFα.
3. The binding protein of claim 2, wherein the VD3 heavy chain variable domain and the VD3 light chain variable domain are a heavy chain variable domain and a light chain variable domain from infliximab, adalimumab, certolizumab pegol, or golimumab. 4. The binding protein of any one of claims 1 to 3, wherein the Fc region of the first and 5 third polypeptide chains each comprises a mutation, wherein said mutations on the two Fc regions enhance heterodimerization of the first and third polypeptide chains. 5. The binding protein of claim 4, wherein the Fc region of one of the first polypeptide and the second polypeptide comprises the sequence of SEQ ID NO: 121 and the Fc region of the other of the first polypeptide and the second polypeptide comprises the sequence of SEQ 10 ID NO: 137. 6. The binding protein of any one of claims 1 to 5, wherein monovalent binding of the binding protein to cell surface TNFα on antigen presenting cells provides a halflife greater than a molecule that is bivalent or tetravalent for TNFα. 7. The binding protein of any one of claims 1 to 6, wherein monovalent binding of the 15 binding protein to cell surface TNFα on antigen presenting cells generates less anti-drug antibodies (ADA) than a molecule that is bivalent or tetravalent for TNFα. 8. The binding protein of any one of claims 1 to 7, wherein the non-TNFα antigen is a soluble ligand. 9. The binding protein of claim 8, wherein the non-TNFα antigen is IL-17. 20 10. The binding protein of claim 9, wherein the non-TNFα antigen is human IL-17. 11. The binding protein of any one of claims 1 to 10, wherein VD1 of the first polypeptide comprises CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 114-116, VD2 of the first polypeptide comprises the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 118-120, VD1 of the second polypeptide comprises the CDR1, CDR2, and CDR3 sequences 25 of SEQ ID NOs: 124-126, VD2 of the second polypeptide comprises the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 128-130, VD3 of the third polypeptide comprises the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 134-136, and VD3 of the fourth polypeptide comprises the CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 140-142.
12. The binding protein of any one of claims 1 to 11, wherein VD1-(X1)n-VD2 of the first polypeptide comprise the sequence of SEQ ID NO: 113, VD1-(X1)n-VD2 of the second polypeptide comprise the sequence of SEQ ID NO: 123, VD3 of the third polypeptide comprises the sequence of SEQ ID NO: 133, and VD3 of the fourth polypeptide comprises 5 the sequence of SEQ ID NO: 139. 13. The binding protein of any one of claims 1 to 12, wherein the first polypeptide comprises the sequence of SEQ ID NO: 112, the second polypeptide comprises the sequence of SEQ ID NO: 122, the third polypeptide comprises the sequence of SEQ ID NO: 132 and the fourth polypeptide comprises the sequence of SEQ ID NO: 138. 10 14. A method of treating a TNF-associated disorder in a subject in need thereof,
comprising administering to the subject an effective amount of the binding protein of any one of claims 1 to 13. 15. A nucleic acid encoding the binding protein of any one of claims 1 to 13. 16. A vector expressing the nucleic acid of claim 15. 15 17. A host cell comprising the vector of claim 16. 18. A method of producing a binding protein, comprising culturing a host cell of claim 17 in culture medium under conditions sufficient to produce the binding protein. 19. A protein produced according to the method of claim 18. 20. A pharmaceutical composition comprising the binding protein any one of claims 1 to 20 13, and a pharmaceutically acceptable carrier. 21. A binding protein comprising first, second, third and fourth polypeptide chains, wherein said first polypeptide chain comprises VD1-(X1)n-VD2-C-(X2)n,
wherein VD1 is a first heavy chain variable domain,
VD2 is a second heavy chain variable domain,
25 C is a CH1 domain,
X1 is a linker with the proviso that it is not a constant domain,
n is 0 or 1, and
X2 is an Fc region;
wherein said second polypeptide chain comprises VD1-(X1)n-VD2-C,
wherein VD1 is a first light chain variable domain,
VD2 is a second light chain variable domain,
C is a CL domain,
5 X1 is a linker with the proviso that it is not a constant domain,
and n is 0 or 1;
wherein the VD1 of the heavy chain and the VD1 of the light chain form a functional binding site and wherein the VD2 of the heavy chain and the VD2 of the light chain form a functional binding site; and
10 wherein the VD1 and VD2 functional binding sites bind TNFα; and
wherein said third polypeptide chain comprises VD3-C-(X1)n,
wherein VD3 is a third heavy chain variable domain,
C is a CH1 domain,
X1 is an Fc region, and
15 n is 0 or 1;
wherein said fourth polypeptide chain comprises VD3-C,
wherein VD3 is a first light chain variable domain; and
C is a CL domain;
wherein the VD3 of the heavy chain and the VD3 of the light chain form a functional binding 20 site for a non-TNFα antigen. 22. The binding protein of claim 21, wherein the TNFα.is human TNFα. 23. The binding protein of claim 22, wherein the VD1 and VD2 heavy chain variable domains and light chain variable domains are heavy chain variable domains and light chain variable domains from infliximab, adalimumab, certolizumab pegol, or golimumab. 25 24. The binding protein of any one of claims 21 to 23, wherein the Fc region of the first and third polypeptide chains each comprises a mutation, wherein said mutations on the two Fc regions enhance heterodimerization of the first and third polypeptide chains. 25. The binding protein of claim 24, wherein the Fc region of one of the first polypeptide and the second polypeptide comprises the sequence of SEQ ID NO: 153 and the Fc region of 30 the other of the first polypeptide and the second polypeptide comprises the sequence of SEQ ID NO: 169.
26. The binding protein of any one of claims 21 to 25, wherein the non-TNFα antigen is a soluble ligand. 27. The binding protein of claim 26, wherein the non-TNFα antigen is IL-17. 28. The binding protein of claim 27, wherein the non-TNFα antigen is human IL-17. 5 29. The binding protein of claim 21, wherein binding protein comprises one or more of the sequences in Table 6. 30. The binding protein of claim 21, wherein the first polypeptide comprises the sequence of SEQ ID NO: 144, the second polypeptide comprises the sequence of SEQ ID NO:154 the third polypeptide comprises the sequence of SEQ ID NO: 164 and the fourth polypeptide 10 comprises the sequence of SEQ ID NO: 170. 31. A method of treating a TNF-associated disorder in a subject in need thereof, comprising administering to the subject an effective amount of the binding protein of any one of claims 21 to 30. 32. A nucleic acid encoding the binding protein of any one of claims 21 to 30. 15 33. A vector expressing the nucleic acid of claim 32. 34. A host cell comprising the vector of claim 33. 35. A method of producing a binding protein, comprising culturing a host cell of claim 34 in culture medium under conditions sufficient to produce the binding protein. 36. A protein produced according to the method of claim 35. 20 37. A pharmaceutical composition comprising the binding protein any one of claims 21 to 30, and a pharmaceutically acceptable carrier.
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201562140155P | 2015-03-30 | 2015-03-30 | |
| US62/140,155 | 2015-03-30 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2016160976A2 true WO2016160976A2 (en) | 2016-10-06 |
| WO2016160976A3 WO2016160976A3 (en) | 2016-11-10 |
Family
ID=56842994
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2016/024992 Ceased WO2016160976A2 (en) | 2015-03-30 | 2016-03-30 | Monovalent tnf binding proteins |
Country Status (1)
| Country | Link |
|---|---|
| WO (1) | WO2016160976A2 (en) |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11299751B2 (en) | 2016-04-29 | 2022-04-12 | Voyager Therapeutics, Inc. | Compositions for the treatment of disease |
| US11326182B2 (en) | 2016-04-29 | 2022-05-10 | Voyager Therapeutics, Inc. | Compositions for the treatment of disease |
| WO2023092048A1 (en) * | 2021-11-18 | 2023-05-25 | Adafre Biosciences, Llc | Anti-tnf-alpha antibodies and compositions |
Citations (30)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP0230574A2 (en) | 1986-01-31 | 1987-08-05 | Yale University | Pharmaceutical compositions against infections caused by LAV/HTLV III virus and the use thereof |
| EP0374510A1 (en) | 1988-12-19 | 1990-06-27 | American Cyanamid Company | Products for the treatment of endotoxic shock in a mammal |
| WO1991004054A1 (en) | 1989-09-19 | 1991-04-04 | Millar Ann Brigid | Treatment of ards |
| US5006309A (en) | 1988-04-22 | 1991-04-09 | Abbott Laboratories | Immunoassay device with liquid transfer between wells by washing |
| EP0453898A2 (en) | 1990-04-25 | 1991-10-30 | Bayer Ag | Use of TNF-specific antibodies as a drug for treatment of ischemias and of their consequences |
| US5063081A (en) | 1988-11-14 | 1991-11-05 | I-Stat Corporation | Method of manufacturing a plurality of uniform microfabricated sensing devices having an immobilized ligand receptor |
| US5089424A (en) | 1988-06-14 | 1992-02-18 | Abbott Laboratories | Method and apparatus for heterogeneous chemiluminescence assay |
| WO1992016221A1 (en) | 1991-03-15 | 1992-10-01 | Synergen, Inc. | Pegylation of polypeptides |
| WO1992017583A1 (en) | 1991-03-29 | 1992-10-15 | Immunex Corporation | Isolated viral protein cytokine antagonists |
| WO1993011793A1 (en) | 1991-12-17 | 1993-06-24 | Schering Corporation | Use of the combination of anti-tumor necrosis factor plus interleukin-6 to treat septic shock |
| WO1993019751A1 (en) | 1992-04-02 | 1993-10-14 | Smithkline Beecham Corporation | Compounds useful for treating inflammatory diseases and inhibiting production of tumor necrosis factor |
| EP0585705A1 (en) | 1992-08-28 | 1994-03-09 | Bayer Corporation | Use of anti-TNF to treat bacterial meningitis |
| US5294404A (en) | 1991-06-03 | 1994-03-15 | Abbott Laboratories | Reagent pack for immunoassays |
| WO1994020139A1 (en) | 1993-03-10 | 1994-09-15 | Knoll Aktiengesellschaft | Use of anti-tnf antibodies as medicament for the therapy of heart insufficiency (weakness of the heart muscle) |
| WO1995020978A1 (en) | 1994-02-07 | 1995-08-10 | Knoll Aktiengesellschaft | Use of anti-tnf antibodies as drugs in treating diseases involving elevated interleukin-6 serum levels |
| US5624821A (en) | 1987-03-18 | 1997-04-29 | Scotgen Biopharmaceuticals Incorporated | Antibodies with altered effector functions |
| US5714350A (en) | 1992-03-09 | 1998-02-03 | Protein Design Labs, Inc. | Increasing antibody affinity by altering glycosylation in the immunoglobulin variable region |
| WO1999054342A1 (en) | 1998-04-20 | 1999-10-28 | Pablo Umana | Glycosylation engineering of antibodies for improving antibody-dependent cellular cytotoxicity |
| EP1176195A1 (en) | 1999-04-09 | 2002-01-30 | Kyowa Hakko Kogyo Co., Ltd. | Method for controlling the activity of immunologically functional molecule |
| WO2003016466A2 (en) | 2001-08-17 | 2003-02-27 | Eli Lilly And Company | ANTI-Aβ ANTIBODIES |
| WO2003035835A2 (en) | 2001-10-25 | 2003-05-01 | Genentech, Inc. | Glycoprotein compositions |
| US20040018577A1 (en) | 2002-07-29 | 2004-01-29 | Emerson Campbell John Lewis | Multiple hybrid immunoassay |
| WO2005100584A2 (en) | 2004-04-15 | 2005-10-27 | Glycofi, Inc. | Production of galactosylated glycoproteins in lower eukaryotes |
| US7029872B2 (en) | 2000-06-28 | 2006-04-18 | Glycofi, Inc | Methods for producing modified glycoproteins |
| US7419821B2 (en) | 2002-03-05 | 2008-09-02 | I-Stat Corporation | Apparatus and methods for analyte measurement and immunoassay |
| US7449308B2 (en) | 2000-06-28 | 2008-11-11 | Glycofi, Inc. | Combinatorial DNA library for producing modified N-glycans in lower eukaryotes |
| US20090311253A1 (en) | 2008-06-03 | 2009-12-17 | Abbott Laboratories | Dual Variable Domain Immunoglobulins and Uses Thereof |
| US7682833B2 (en) | 2003-09-10 | 2010-03-23 | Abbott Point Of Care Inc. | Immunoassay device with improved sample closure |
| US7723099B2 (en) | 2003-09-10 | 2010-05-25 | Abbott Point Of Care Inc. | Immunoassay device with immuno-reference electrode |
| US8835610B2 (en) | 2009-03-05 | 2014-09-16 | Abbvie Inc. | IL-17 binding proteins |
Family Cites Families (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2014089209A2 (en) * | 2012-12-04 | 2014-06-12 | Abbvie, Inc. | Blood-brain barrier (bbb) penetrating dual specific binding proteins |
| EP3027649B1 (en) * | 2013-08-01 | 2020-04-01 | F.Hoffmann-La Roche Ag | Tnfa-il-17 bispecific antibodies |
-
2016
- 2016-03-30 WO PCT/US2016/024992 patent/WO2016160976A2/en not_active Ceased
Patent Citations (33)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP0230574A2 (en) | 1986-01-31 | 1987-08-05 | Yale University | Pharmaceutical compositions against infections caused by LAV/HTLV III virus and the use thereof |
| US5624821A (en) | 1987-03-18 | 1997-04-29 | Scotgen Biopharmaceuticals Incorporated | Antibodies with altered effector functions |
| US5648260A (en) | 1987-03-18 | 1997-07-15 | Scotgen Biopharmaceuticals Incorporated | DNA encoding antibodies with altered effector functions |
| US5006309A (en) | 1988-04-22 | 1991-04-09 | Abbott Laboratories | Immunoassay device with liquid transfer between wells by washing |
| US5089424A (en) | 1988-06-14 | 1992-02-18 | Abbott Laboratories | Method and apparatus for heterogeneous chemiluminescence assay |
| US5063081A (en) | 1988-11-14 | 1991-11-05 | I-Stat Corporation | Method of manufacturing a plurality of uniform microfabricated sensing devices having an immobilized ligand receptor |
| EP0374510A1 (en) | 1988-12-19 | 1990-06-27 | American Cyanamid Company | Products for the treatment of endotoxic shock in a mammal |
| WO1991004054A1 (en) | 1989-09-19 | 1991-04-04 | Millar Ann Brigid | Treatment of ards |
| EP0453898A2 (en) | 1990-04-25 | 1991-10-30 | Bayer Ag | Use of TNF-specific antibodies as a drug for treatment of ischemias and of their consequences |
| WO1992016221A1 (en) | 1991-03-15 | 1992-10-01 | Synergen, Inc. | Pegylation of polypeptides |
| WO1992017583A1 (en) | 1991-03-29 | 1992-10-15 | Immunex Corporation | Isolated viral protein cytokine antagonists |
| US5294404A (en) | 1991-06-03 | 1994-03-15 | Abbott Laboratories | Reagent pack for immunoassays |
| WO1993011793A1 (en) | 1991-12-17 | 1993-06-24 | Schering Corporation | Use of the combination of anti-tumor necrosis factor plus interleukin-6 to treat septic shock |
| US5714350A (en) | 1992-03-09 | 1998-02-03 | Protein Design Labs, Inc. | Increasing antibody affinity by altering glycosylation in the immunoglobulin variable region |
| US6350861B1 (en) | 1992-03-09 | 2002-02-26 | Protein Design Labs, Inc. | Antibodies with increased binding affinity |
| WO1993019751A1 (en) | 1992-04-02 | 1993-10-14 | Smithkline Beecham Corporation | Compounds useful for treating inflammatory diseases and inhibiting production of tumor necrosis factor |
| EP0585705A1 (en) | 1992-08-28 | 1994-03-09 | Bayer Corporation | Use of anti-TNF to treat bacterial meningitis |
| WO1994020139A1 (en) | 1993-03-10 | 1994-09-15 | Knoll Aktiengesellschaft | Use of anti-tnf antibodies as medicament for the therapy of heart insufficiency (weakness of the heart muscle) |
| WO1995020978A1 (en) | 1994-02-07 | 1995-08-10 | Knoll Aktiengesellschaft | Use of anti-tnf antibodies as drugs in treating diseases involving elevated interleukin-6 serum levels |
| WO1999054342A1 (en) | 1998-04-20 | 1999-10-28 | Pablo Umana | Glycosylation engineering of antibodies for improving antibody-dependent cellular cytotoxicity |
| EP1176195A1 (en) | 1999-04-09 | 2002-01-30 | Kyowa Hakko Kogyo Co., Ltd. | Method for controlling the activity of immunologically functional molecule |
| US7029872B2 (en) | 2000-06-28 | 2006-04-18 | Glycofi, Inc | Methods for producing modified glycoproteins |
| US7449308B2 (en) | 2000-06-28 | 2008-11-11 | Glycofi, Inc. | Combinatorial DNA library for producing modified N-glycans in lower eukaryotes |
| WO2003016466A2 (en) | 2001-08-17 | 2003-02-27 | Eli Lilly And Company | ANTI-Aβ ANTIBODIES |
| WO2003035835A2 (en) | 2001-10-25 | 2003-05-01 | Genentech, Inc. | Glycoprotein compositions |
| US7419821B2 (en) | 2002-03-05 | 2008-09-02 | I-Stat Corporation | Apparatus and methods for analyte measurement and immunoassay |
| US20040018577A1 (en) | 2002-07-29 | 2004-01-29 | Emerson Campbell John Lewis | Multiple hybrid immunoassay |
| US7682833B2 (en) | 2003-09-10 | 2010-03-23 | Abbott Point Of Care Inc. | Immunoassay device with improved sample closure |
| US7723099B2 (en) | 2003-09-10 | 2010-05-25 | Abbott Point Of Care Inc. | Immunoassay device with immuno-reference electrode |
| WO2005100584A2 (en) | 2004-04-15 | 2005-10-27 | Glycofi, Inc. | Production of galactosylated glycoproteins in lower eukaryotes |
| US20090311253A1 (en) | 2008-06-03 | 2009-12-17 | Abbott Laboratories | Dual Variable Domain Immunoglobulins and Uses Thereof |
| US9035027B2 (en) | 2008-06-03 | 2015-05-19 | Abbvie Inc. | Dual variable domain immunoglobulins and uses thereof |
| US8835610B2 (en) | 2009-03-05 | 2014-09-16 | Abbvie Inc. | IL-17 binding proteins |
Non-Patent Citations (16)
| Title |
|---|
| CHOTHIA ET AL., J. MOL. BIOL., vol. 196, 1987, pages 901 - 917 |
| DAVIS ET AL., BIOCHEM, vol. 26, 1987, pages 1322 - 1326 |
| FIETZE ET AL., TRANSPLANTATION, vol. 58, 1994, pages 675 - 680 |
| HOLLIGER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 6444 - 6448 |
| HUBER ET AL., NATURE, vol. 264, 1976, pages 415 - 20 |
| JONES ET AL., NATURE, vol. 338, 1989, pages 225 - 228 |
| KABAT ET AL., J. BIOL. CHEM., vol. 252, 1977, pages 6609 - 6616 |
| KAUFMAN; SHARP, MOL. BIOL., vol. 159, 1982, pages 601 - 621 |
| KONTERMANN AND DUBEL: "Antibody Engineering", 2001, SPRINGER-VERLAG, ISBN: 3-540-41354-5, pages: 790 |
| MACCALLUM ET AL., J. MOL. BIOL., vol. 262, 1996, pages 732 - 745 |
| PENNICA ET AL., NATURE, vol. 312, 1984, pages 724 - 729 |
| POLJAK ET AL., STRUCTURE, vol. 2, 1994, pages 1121 - 1123 |
| SHIELDS ET AL., J. BIOL. CHEM., vol. 277, 2002, pages 26733 - 26740 |
| THIES ET AL., J. MOL. BIOL., vol. 293, 1999, pages 67 - 79 |
| UMANA ET AL., NAT. BIOTECH, vol. 17, 1999, pages 176 - 1 |
| URLAUB; CHASIN, PROC. NATL. ACAD. SCI. USA, vol. 77, 1980, pages 4216 - 4220 |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11299751B2 (en) | 2016-04-29 | 2022-04-12 | Voyager Therapeutics, Inc. | Compositions for the treatment of disease |
| US11326182B2 (en) | 2016-04-29 | 2022-05-10 | Voyager Therapeutics, Inc. | Compositions for the treatment of disease |
| WO2023092048A1 (en) * | 2021-11-18 | 2023-05-25 | Adafre Biosciences, Llc | Anti-tnf-alpha antibodies and compositions |
Also Published As
| Publication number | Publication date |
|---|---|
| WO2016160976A3 (en) | 2016-11-10 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US10899842B2 (en) | 4-1BB binding proteins and uses thereof | |
| US20180194861A1 (en) | IgM- or IgE-Modified Binding Proteins and Uses Thereof | |
| JP6647208B2 (en) | Anti-IL-17 antibodies, methods for their production and use | |
| US20080227704A1 (en) | CXCL13 binding proteins | |
| WO2014144280A2 (en) | DUAL SPECIFIC BINDING PROTEINS DIRECTED AGAINST IL-1β AND / OR IL-17 | |
| EP2970457A2 (en) | Dual specific binding proteins directed against tnf | |
| CA2728909A1 (en) | Prostaglandin e2 binding proteins and uses thereof | |
| SG184473A1 (en) | Tnf-alpha binding proteins | |
| RU2011127198A (en) | IMMUNOGLOBULINS WITH DOUBLE VARIABLE DOMAINS AND THEIR APPLICATION | |
| WO2011163478A4 (en) | Dual variable domain immunoglobulins and uses thereof | |
| WO2013102042A2 (en) | Dual specific binding proteins directed against il-13 and/or il-17 | |
| US20140294813A1 (en) | TNF Binding Proteins | |
| WO2016160976A2 (en) | Monovalent tnf binding proteins | |
| TW202136299A (en) | Bispecific anti-ccl2 antibodies | |
| US12570738B2 (en) | Multi-specific antibody with binding specificity for human IL-13 and IL-17 | |
| US20230084464A1 (en) | Antibody with binding specificity for human il-13 | |
| CN118852428A (en) | Method for producing anti-EGFR antibody, method for improving affinity for FcγRIIIa, and anti-EGFR antibody | |
| AU2014202979A1 (en) | Prostaglandin E2 binding proteins and uses thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 16757987 Country of ref document: EP Kind code of ref document: A2 |



































