WO2016154530A1 - Targeted therapeutic agents comprising multivalent protein-biopolymer fusions - Google Patents
Targeted therapeutic agents comprising multivalent protein-biopolymer fusions Download PDFInfo
- Publication number
- WO2016154530A1 WO2016154530A1 PCT/US2016/024202 US2016024202W WO2016154530A1 WO 2016154530 A1 WO2016154530 A1 WO 2016154530A1 US 2016024202 W US2016024202 W US 2016024202W WO 2016154530 A1 WO2016154530 A1 WO 2016154530A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- fusion protein
- subject
- disease
- polypeptide
- target
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/78—Connective tissue peptides, e.g. collagen, elastin, laminin, fibronectin, vitronectin or cold insoluble globulin [CIG]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/0012—Galenical forms characterised by the site of application
- A61K9/0019—Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/70—Fusion polypeptide containing domain for protein-protein interaction
- C07K2319/74—Fusion polypeptide containing domain for protein-protein interaction containing a fusion for binding to a cell surface receptor
Definitions
- the disclosure relates to antibody mimetics and, more particularly, to fusions of unstructured polypeptides and multivalent proteins that specifically bind a target.
- the multivalent proteins can bind a target such as a cell surface receptor, for example, and thereby affect cellular physiology.
- the unstructured polypeptide component can render the fusion protein environmentally responsive, and thereby expand the scope of drug delivery options.
- Proteins can be powerful therapeutic agents when engineered for affinity, specificity, and selectivity for a clinical target. Their complexity, versatility, tolerability, and diversity often make them superior alternatives to small molecule drugs, and the long half-life, specificity, and selectivity of some proteins make them attractive for some therapies. Biotechnological advances have enabled the engineering of proteins with specific properties and the manipulation of existing proteins for maximum therapeutic potential. Although protein engineering allows for the development of potent therapeutics targeted toward a protein or receptor of interest, the body has many mechanisms with which to clear such protein therapies. Thus, delivery is a critical issue for effectively translating a protein therapeutic to the clinic. There is a need for reliable and broadly applicable protein delivery solutions.
- the fusion protein may include at least one binding polypeptide and at least one unstructured polypeptide. In some embodiments, the fusion protein comprises a plurality of unstructured polypeptides. In some embodiments, the fusion protein comprises a plurality of binding polypeptides. In some embodiments, the fusion protein further includes a linker positioned between at least two adjacent binding polypeptides. In some embodiments, the fusion protein further includes a linker positioned between at least two adjacent unstructured polypeptides. In some embodiments, the linker comprises at least one glycine and at least one serine.
- the linker comprises an amino acid sequence consisting of SEQ ID NO: 3 ((Gly4Ser)3). In some embodiments, the linker comprises an amino acid sequence consisting of SEQ ID NO: 4. In some embodiments, the plurality of binding polypeptides forms an oligomer. In some embodiments, the binding polypeptide binds a target. In some embodiments, the fusion protein binds more than one target. In some embodiments, the at least one binding polypeptide comprises a Fibronectin type III (Fnlll) domain. In some embodiments, the Fnlll domain binds TNF-related apoptosis- inducing ligand receptor 2 (TRAILR-2).
- Fnlll Fibronectin type III
- the at least one binding polypeptide comprises at least one amino acid sequence of consisting of SEQ ID NO: 17 (RGDS). In some embodiments, the at least one binding polypeptide comprises a plurality of amino acid sequences consisting of SEQ ID NO: 17 (RGDS). In some embodiments, the at least one unstructured polypeptide comprises at least one PG motif comprising an amino acid sequence selected from PG, P(X) n G (SEQ ID NO: 18), and (U) m P(X) n G(Z) p (SEQ ID NO: 20), or a combination thereof, wherein m, n, and p are independently an integer from 1 to 15, and wherein U, X, and Z are independently any amino acid.
- the at least one unstructured polypeptide includes a thermally responsive polypeptide.
- the thermally responsive polypeptide comprises an elastin-like polypeptide (ELP).
- the at least one unstructured polypeptide includes an amino acid sequence consisting of (VPGXG) n (SEQ ID NO: 19), wherein X is any amino acid except proline and n is an integer greater than or equal to 1. In some embodiments, n is 60, 120, or 180. In some embodiments, X is valine.
- the fusion protein further includes at least one linker positioned between the at least one binding polypeptide and the at least one unstructured polypeptide.
- the fusion protein includes a plurality of linkers between the at least one binding polypeptide and the at least one unstructured polypeptide.
- the at least one binding polypeptide is positioned N- terminal to the at least one unstructured polypeptide.
- the at least one binding polypeptide is positioned C-terminal to the at least one unstructured polypeptide.
- the at least one unstructured polypeptide has a LCST between about 0°C and about 100°C.
- the at least one unstructured polypeptide has a UCST between about 0°C and about 100°C
- the method may include administering to the subject an effective amount of the fusion protein as described herein.
- the fusion protein is administered in a controlled release formulation.
- the fusion protein forms a depot upon administration to the subject.
- the fusion protein is administered intravenously, intraarterially, or intraperitoneally to the subject.
- the disease includes cancer.
- the fusion protein is administered intratumorally.
- the cancer is colorectal adenocarcinoma.
- the at least one binding polypeptide includes an Fnlll domain or a plurality of Fnlll domains, and the disease is a disease associated with TRAILR-2. In some embodiments, the disease is a disease associated with a target of the at least one binding polypeptide.
- the multivalent fusion protein may include at least one Fibronectin type III (Fnlll) domain and at least one elastin-like polypeptide (ELP).
- Fnlll domain binds TNF-related apoptosis-inducing ligand receptor 2 (TRAILR-2).
- the at least one ELP includes an amino acid sequence consisting of (VPGXG) n (SEQ ID NO: 19), wherein X is any amino acid except proline and n is an integer greater than or equal to 1.
- n is 60, 120, or 180.
- X is valine.
- the at least one Fnlll domain includes an amino acid sequence consisting of SEQ ID NO: 1.
- the multivalent fusion protein includes a plurality of Fnlll domains. In some embodiments, the multivalent fusion protein includes 2, 4, or 6 Fnlll domains. In some embodiments, the multivalent fusion protein further includes a linker positioned between at least two adjacent Fnlll domains. In some embodiments, the linker includes at least one glycine and at least one serine. In some embodiments, the linker includes an amino acid sequence consisting of SEQ ID NO: 3 ((Gly4Ser)3). In some embodiments, the linker includes an amino acid sequence consisting of SEQ ID NO: 4.
- the methods may include administering to the subject an effective amount of the multivalent fusion protein as detailed herein.
- the disease includes cancer.
- the cancer includes colorectal adenocarcinoma.
- the multivalent fusion protein is administered intravenously, intraarterially, or intraperitoneally to the subject.
- the multivalent fusion protein is administered intratumorally.
- the multivalent fusion protein forms a depot upon administration to the subject.
- the multivalent fusion protein is administered in a controlled release formulation.
- kits for diagnosing a disease in a subject may include contacting a sample from the subject with a fusion protein as detailed herein, and detecting binding of the fusion protein to a target to determine presence of the target in the sample, wherein the presence of the target in the sample indicates the disease in the subject.
- the disease is selected from cancer, metabolic disease, autoimmune disease, cardiovascular disease, and orthopedic disorder.
- the method may include contacting the sample with a fusion protein as detailed herein under conditions to allow a complex to form between the fusion protein and the target in the sample, and detecting the presence of the complex, wherein presence of the complex is indicative of the target in the sample.
- the sample is obtained from a subject and the method further includes diagnosing a disease, prognosticating, or assessing the efficacy of a treatment of the subject.
- the method further includes assessing the efficacy of a treatment of the subject, and the method further includes modifying the treatment of the subject as needed to improve efficacy.
- the method may include contacting a sample from the subject with a fusion protein as described herein under conditions to allow a complex to form between the fusion protein and a target in the sample, determining the level of the complex in the sample, wherein the level of the complex is indicative of the level of the target in the sample, and comparing the level of the target in the sample to a control level of the target, wherein if the level of the target is different from the control level, then the treatment is determined to be effective or ineffective in treating the disease.
- the method further includes modifying the treatment or administering a different treatment to the subject when the treatment is determined to be ineffective in treating the disease.
- kits for diagnosing a disease in a subject may include contacting a sample from the subject with a fusion protein as described herein, determining the level of a target in the sample, and comparing the level of the target in the sample to a control level of the target, wherein a level of the target different from the control level indicates disease in the subject.
- control level corresponds to the level in the subject at a time point before or during the period when the subject has begun treatment, and the sample is taken from the subject at a later time point.
- sample is taken from the subject at a time point during the period when the subject is undergoing treatment, and the control level corresponds to a disease-free level or to the level at a time point before the period when the subject has begun treatment.
- the fusion protein is labeled with a reporter.
- the disease is selected from cancer, metabolic disease, autoimmune disease, cardiovascular disease, and orthopedic disorder.
- FIG. 1 is a schematic illustrating the architecture of the protein biopolymer fusions.
- the multivalent protein drugs can act as agonists to amplify receptor signaling or as antagonists to inhibit ligand binding and prevent receptor signaling.
- FIG. 2 is a schematic of the multivalent TRAILR-2 agonist-ELP constructs.
- the Tn3- ELP fusions were constructed to express ELPs at the N-terminus (shown) or C-terminus (not shown).
- Each Tn3 unit had a molecular weight of approximately 10 kDa, and the molecular weight of the ELPs varied.
- FIG. 3 shows SDS-PAGE analysis of the ELP-TRAILR-2 agonist fusion protein at various steps in the purification process.
- Samples in lanes 1-6 contained reducing agent; lane 7 did not.
- TRAILR-2-ELPa-(Tn3)4 fusions inhibited cell viability of Colo205 human colorectal adenocarcinoma cells and outperformed TRAIL.
- Hexavalent TRAILR-2-ELPa-(Tn3)5 fusions exhibited potent activation of apoptosis as well.
- FIG. 5 is a graph showing the transition temperatures.
- the transition temperature of the 6 repeat agonist ELP fusion was 29.2°C, and the transition temperature of the 4 repeat agonist ELP fusion was 27.9°C. This range was appropriate for s.c./intratumoral injections in mouse Colo205 xenograft models.
- FIG. 6 is a graph showing the changes in tumor volume in Colo205 colorectal cancer xenograft models in response to multivalent TRAILR-2 specific ELP fusions. Tumors in mice treated with depot-forming ELPa-(Tn3)5 fusions underwent partial regression and delayed growth.
- compositions and methods for delivering protein therapeutics to a subject include a fusion protein.
- the fusion protein may include a binding polypeptide fused to an unstructured polypeptide.
- the unstructured polypeptide may include a thermally responsive protein polymer, which may facilitate slow release from a gel-like depot.
- the compositions and methods detailed herein may overcome these limitations and facilitate the use of protein therapeutics for clinical use.
- the fusion proteins may allow for the treatment of disease by effectively delivering binding polypeptides so they may associate with their target to treat the disease.
- the fusion proteins may also be used to detect a target, detect or diagnose disease, and/or determine the efficacy of a treatment.
- each intervening number there between with the same degree of precision is explicitly contemplated.
- the numbers 7 and 8 are contemplated in addition to 6 and 9, and for the range 6.0-7.0, the number 6.0, 6.1 , 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8, 6.9, and 7.0 are explicitly contemplated.
- the term "about” as used herein as applied to one or more values of interest refers to a value that is similar to a stated reference value. In certain aspects, the term “about” refers to a range of values that fall within 20%, 19%, 18%, 17%, 16%, 15%, 14%, 13%, 12%, 1 1 %, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1 %, or less in either direction (greater than or less than) of the stated reference value unless otherwise stated or otherwise evident from the context (except where such number would exceed 100% of a possible value).
- Affinity refers to the binding strength of a binding polypeptide to its target (i.e., binding partner).
- Amino acids refers to naturally occurring and non-natural synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function in a manner similar to the naturally occurring amino acids. Naturally occurring amino acids are those encoded by the genetic code. Amino acids can be referred to herein by either their commonly known three-letter symbols or by the one-letter symbols recommended by the lUPAC-IUB Biochemical Nomenclature Commission. Amino acids include the side chain and polypeptide backbone portions.
- biomarker refers to a naturally occurring biological molecule present in a subject at varying concentrations that is useful in identifying and/or classifying a disease or a condition.
- the biomarker can include genes, proteins, polynucleotides, nucleic acids, ribonucleic acids, polypeptides, or other biological molecules used as an indicator or marker for disease.
- the biomarker comprises a disease marker.
- the biomarker can be a gene that is upregulated or downregulated in a subject that has a disease.
- the biomarker can be a polypeptide whose level is increased or decreased in a subject that has a disease or risk of developing a disease.
- the biomarker comprises a small molecule.
- the biomarker comprises a polypeptide.
- the terms "control,” “reference level,” and “reference” are used herein interchangeably.
- the reference level may be a predetermined value or range, which is employed as a benchmark against which to assess the measured result.
- Control group refers to a group of control subjects.
- the predetermined level may be a cutoff value from a control group.
- the predetermined level may be an average from a control group. Cutoff values (or predetermined cutoff values) may be determined by Adaptive Index Model (AIM) methodology. Cutoff values (or predetermined cutoff values) may be determined by a receiver operating curve (ROC) analysis from biological samples of the patient group.
- AIM Adaptive Index Model
- ROC analysis is a determination of the ability of a test to discriminate one condition from another, e.g., to determine the performance of each marker in identifying a patient having CRC.
- a description of ROC analysis is provided in P.J. Heagerty et al. (Biometrics 2000, 56, 337-44), the disclosure of which is hereby incorporated by reference in its entirety.
- cutoff values may be determined by a quartile analysis of biological samples of a patient group.
- a cutoff value may be determined by selecting a value that corresponds to any value in the 25th-75th percentile range, preferably a value that corresponds to the 25th percentile, the 50th percentile or the 75th percentile, and more preferably the 75th percentile.
- Such statistical analyses may be performed using any method known in the art and can be implemented through any number of commercially available software packages (e.g., from Analyse-it Software Ltd., Leeds, UK; StataCorp LP, College Station, TX; SAS Institute Inc., Cary, NC).
- the healthy or normal levels or ranges for a target or for a protein activity may be defined in accordance with standard practice.
- expression vector indicates a plasmid, a virus or another medium, known in the art, into which a nucleic acid sequence for encoding a desired protein can be inserted or introduced.
- host cell is a cell that is susceptible to transformation, transfection, transduction, conjugation, and the like with a nucleic acid construct or expression vector.
- Host cells can be derived from plants, bacteria, yeast, fungi, insects, animals, etc.
- the host cell includes Escherichia coli.
- Polymer as used herein is intended to encompass a homopolymer, heteropolymer, block polymer, co-polymer, ter-polymer, etc., and blends, combinations and mixtures thereof.
- polymers include, but are not limited to, functionalized polymers, such as a polymer comprising 5-vinyltetrazole monomer units and having a molecular weight distribution less than 2.0.
- the polymer may be or contain one or more of a star block copolymer, a linear polymer, a branched polymer, a hyperbranched polymer, a dendritic polymer, a comb polymer, a graft polymer, a brush polymer, a bottle-brush copolymer and a crosslinked structure, such as a block copolymer comprising a block of 5-vinyltetrazole monomer units.
- Polymers include, without limitation, polyesters, poly(meth)acrylamides, poly(meth)acrylates, polyethers, polystyrenes, polynorbornenes and monomers that have unsaturated bonds. For example, amphiphilic comb polymers are described in U.S.
- amphiphilic comb-type polymers may be present in the form of copolymers, containing a backbone formed of a hydrophobic, water- insoluble polymer and side chains formed of short, hydrophilic non-cell binding polymers.
- polyalkylenes such as polyethylene and polypropylene; polychloroprene; polyvinyl ethers; such as polyvinyl acetate); polyvinyl halides such as polyvinyl chloride); polysiloxanes; polystyrenes; polyurethanes; polyacrylates; such as poly(methyl (meth)acrylate), poly(ethyl (meth)acrylate), poly(n-butyl(meth)acrylate), poly(isobutyl (meth)acrylate), poly(tert-butyl (meth)acrylate), poly(hexyl(meth)acrylate), poly(isodecyl (meth)acrylate), poly(lauryl (meth)acrylate), poly(phenyl (meth)acrylate), poly(methyl acrylate), poly(isopropyl acrylate), poly(isobutyl acrylate), and poly(octadecyl
- polymers may include useful derivatives, including polymers having substitutions, additions of chemical groups, for example, alkyl groups, alkylene groups, hydroxylations, oxidations, and other modifications routinely made by those skilled in the art.
- the polymers may include zwitterionic polymers such as, for example, polyphosphorycholine, polycarboxybetaine, and polysulfobetaine.
- the polymers may have side chains of betaine, carboxybetaine, sulfobetaine, oligoethylene glycol (OEG), sarcosine or polyethyleneglycol (PEG).
- poly(oligoethyleneglycol methacrylate) poly(OEGMA)
- Poly(OEGMA) may be hydrophilic, water-soluble, non-fouling, non-toxic and non-immunogenic due to the OEG side chains.
- Polynucleotide as used herein can be single stranded or double stranded, or can contain portions of both double stranded and single stranded sequence.
- the polynucleotide can be nucleic acid, natural or synthetic, DNA, genomic DNA, cDNA, RNA, or a hybrid, where the polynucleotide can contain combinations of deoxyribo- and ribo-nucleotides, and combinations of bases including uracil, adenine, thymine, cytosine, guanine, inosine, xanthine hypoxanthine, isocytosine, and isoguanine.
- Polynucleotides can be obtained by chemical synthesis methods or by recombinant methods.
- a "peptide” or “polypeptide” is a linked sequence of two or more amino acids linked by peptide bonds.
- the polypeptide can be natural, synthetic, or a modification or combination of natural and synthetic.
- Peptides and polypeptides include proteins such as binding proteins, receptors, and antibodies.
- the terms "polypeptide”, “protein,” and “peptide” are used interchangeably herein.
- Primary structure refers to the amino acid sequence of a particular peptide.
- “Secondary structure” refers to locally ordered, three dimensional structures within a polypeptide.
- Domains are portions of a polypeptide that form a compact unit of the polypeptide and are typically 15 to 350 amino acids long. Exemplary domains include domains with enzymatic activity or ligand binding activity. Typical domains are made up of sections of lesser organization such as stretches of beta-sheet and alpha-helices.
- “Tertiary structure” refers to the complete three dimensional structure of a polypeptide monomer.
- Quaternary structure refers to the three dimensional structure formed by the noncovalent association of independent tertiary units.
- reporter capable of generating a detectable signal.
- the label can produce a signal that is detectable by visual or instrumental means.
- reporter groups can be used, differing in the physical nature of signal transduction (e.g., fluorescence, electrochemical, nuclear magnetic resonance (NMR), and electron paramagnetic resonance (EPR)) and in the chemical nature of the reporter group.
- Various reporters include signal-producing substances, such as chromagens, fluorescent compounds, chemiluminescent compounds, radioactive compounds, and the like.
- the reporter comprises a radiolabel.
- Reporters may include moieties that produce light, e.g., acridinium compounds, and moieties that produce fluorescence, e.g., fluorescein.
- the signal from the reporter is a fluorescent signal.
- the reporter may comprise a fluorophore.
- fluorophores examples include, but are not limited to, acrylodan (6-acryloy 1-2-dimethylaminonaphthalene), badan (6- bromo-acetyl-2-dimethylamino-naphthalene), rhodamine, naphthalene, danzyl aziridine, 4-[N- [(2-iodoacetoxy)ethyl]-N-methylamino]-7-nitrobenz-2-oxa-1 ,3-diazole ester (IANBDE), 4-[N-[(2- iodoacetoxy)ethyl]-N-methylamino-7-nitrobenz-2-oxa-1 ,3-diazole (IANBDA), fluorescein, dipyrrometheneboron difluoride (BODIPY), 4-nitrobenzo[c][1 ,2,5]oxadiazole (NBD), Alexa fluorescent dyes, and derivatives thereof.
- acrylodan 6-acryl
- Fluorescein derivatives may include, for example, 5- fluorescein, 6-carboxyfluorescein, 3'6-carboxyfluorescein, 5(6)-carboxyfluorescein, 6- hexachlorofluorescein, 6-tetrachlorofluorescein, fluorescein, and isothiocyanate.
- Sample or “test sample” as used herein can mean any sample in which the presence and/or level of a target is to be detected or determined. Samples may include liquids, solutions, emulsions, or suspensions. Samples may include a medical sample.
- Samples may include any biological fluid or tissue, such as blood, whole blood, fractions of blood such as plasma and serum, muscle, interstitial fluid, sweat, saliva, urine, tears, synovial fluid, bone marrow, cerebrospinal fluid, nasal secretions, sputum, amniotic fluid, bronchoalveolar lavage fluid, gastric lavage, emesis, fecal matter, lung tissue, peripheral blood mononuclear cells, total white blood cells, lymph node cells, spleen cells, tonsil cells, cancer cells, tumor cells, bile, digestive fluid, skin, or combinations thereof.
- the sample comprises an aliquot.
- the sample comprises a biological fluid. Samples can be obtained by any means known in the art.
- the sample can be used directly as obtained from a patient or can be pre-treated, such as by filtration, distillation, extraction, concentration, centrifugation, inactivation of interfering components, addition of reagents, and the like, to modify the character of the sample in some manner as discussed herein or otherwise as is known in the art.
- sensitivity refers to the number of true positives divided by the number of true positives plus the number of false negatives, where sensitivity ("sens") may be within the range of 0 ⁇ sens ⁇ 1.
- method embodiments herein have the number of false negatives equaling zero or close to equaling zero, so that no subject is wrongly identified as not having a disease when they indeed have the disease.
- an assessment often is made of the ability of a prediction algorithm to classify negatives correctly, a complementary measurement to sensitivity.
- the term "specificity" as used herein refers to the number of true negatives divided by the number of true negatives plus the number of false positives, where specificity ("spec") may be within the range of 0 ⁇ spec ⁇ 1. Ideally, the methods described herein have the number of false positives equaling zero or close to equaling zero, so that no subject is wrongly identified as having a disease when they do not in fact have disease. Hence, a method that has both sensitivity and specificity equaling one, or 100%, is preferred.
- polypeptide binds to a target when it binds to that target more readily than it would bind to a random, unrelated target.
- Subject as used herein can mean a mammal that wants or is in need of the herein described fusion proteins.
- the subject may be a human or a non-human animal.
- the subject may be a mammal.
- the mammal may be a primate or a non-primate.
- the mammal can be a primate such as a human; a non-primate such as, for example, dog, cat, horse, cow, pig, mouse, rat, camel, llama, goat, rabbit, sheep, hamster, and guinea pig; or non-human primate such as, for example, monkey, chimpanzee, gorilla, orangutan, and gibbon.
- the subject may be of any age or stage of development, such as, for example, an adult, an adolescent, or an infant.
- Transition or “phase transition” refers to the aggregation of the thermally responsive polypeptides. Phase transition occurs sharply and reversibly at a specific temperature called the lower critical solution temperature (LCST) or the inverse transition temperature T ⁇ . Below the transition temperature, the thermally responsive polypeptide (or a polypeptide comprising a thermally responsive polypeptide) is highly soluble. Upon heating past the transition temperature, the thermally responsive polypeptides hydrophobically collapse and aggregate, forming a separate, gel-like phase.
- “Inverse transition cycling” refers to a protein purification method for thermally responsive polypeptides (or a polypeptide comprising a thermally responsive polypeptide). The protein purification method may involve the use of thermally responsive polypeptide's reversible phase transition behavior to cycle the solution through soluble and insoluble phases, thereby removing contaminants.
- Treatment when referring to protection of a subject from a disease, means preventing, suppressing, repressing, ameliorating, or completely eliminating the disease.
- Preventing the disease involves administering a composition of the present invention to a subject prior to onset of the disease.
- Suppressing the disease involves administering a composition of the present invention to a subject after induction of the disease but before its clinical appearance.
- Repressing or ameliorating the disease involves administering a composition of the present invention to a subject after clinical appearance of the disease.
- substantially identical can mean that a first and second amino acid sequence are at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% over a region of 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 , 22, 23, 24, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1100 amino acids.
- Value refers to the potential binding units or binding sites.
- multivalent refers to multiple potential binding units.
- multimeric and “multivalent” are used interchangeably herein.
- Variant used herein with respect to a polynucleotide means (i) a portion or fragment of a referenced nucleotide sequence; (ii) the complement of a referenced nucleotide sequence or portion thereof; (iii) a polynucleotide that is substantially identical to a referenced polynucleotide or the complement thereof; or (iv) a polynucleotide that hybridizes under stringent conditions to the referenced polynucleotide, complement thereof, or a sequences substantially identical thereto.
- a “variant” can further be defined as a peptide or polypeptide that differs in amino acid sequence by the insertion, deletion, or conservative substitution of amino acids, but retain at least one biological activity.
- biological activity include the ability to be bound by a specific antibody or polypeptide or to promote an immune response.
- Variant can mean a substantially identical sequence.
- Variant can mean a functional fragment thereof.
- Variant can also mean multiple copies of a polypeptide. The multiple copies can be in tandem or separated by a linker.
- Variant can also mean a polypeptide with an amino acid sequence that is substantially identical to a referenced polypeptide with an amino acid sequence that retains at least one biological activity.
- a conservative substitution of an amino acid i.e., replacing an amino acid with a different amino acid of similar properties (e.g., hydrophilicity, degree and distribution of charged regions) is recognized in the art as typically involving a minor change. These minor changes can be identified, in part, by considering the hydropathic index of amino acids. See Kyte et al., J. Mol. Biol. 1982, 757, 105-132. The hydropathic index of an amino acid is based on a consideration of its hydrophobicity and charge. It is known in the art that amino acids of similar hydropathic indexes can be substituted and still retain protein function. In one aspect, amino acids having hydropathic indices of ⁇ 2 are substituted.
- hydrophobicity of amino acids can also be used to reveal substitutions that would result in polypeptides retaining biological function.
- a consideration of the hydrophilicity of amino acids in the context of a polypeptide permits calculation of the greatest local average hydrophilicity of that polypeptide, a useful measure that has been reported to correlate well with antigenicity and immunogenicity, as discussed in U.S. Patent No. 4,554,101 , which is fully incorporated herein by reference.
- Substitution of amino acids having similar hydrophilicity values can result in polypeptides retaining biological activity, for example immunogenicity, as is understood in the art.
- Substitutions can be performed with amino acids having hydrophilicity values within ⁇ 2 of each other.
- hydrophobicity index and the hydrophilicity value of amino acids are influenced by the particular side chain of that amino acid. Consistent with that observation, amino acid substitutions that are compatible with biological function are understood to depend on the relative similarity of the amino acids, and particularly the side chains of those amino acids, as revealed by the hydrophobicity, hydrophilicity, charge, size, and other properties.
- a variant can be a polynucleotide sequence that is substantially identical over the full length of the full gene sequence or a fragment thereof.
- the polynucleotide sequence can be 80%, 81 %, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical over the full length of the gene sequence or a fragment thereof.
- a variant can be an amino acid sequence that is substantially identical over the full length of the amino acid sequence or fragment thereof.
- the amino acid sequence can be 80%, 81 %, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical over the full length of the amino acid sequence or a fragment thereof.
- the fusion protein includes at least one binding polypeptide and at least one unstructured polypeptide.
- the fusion protein may further include at least one linker.
- the fusion protein includes more than one binding polypeptide.
- the fusion protein may include at least 1 , at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 1 1 , at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, or at least 20 binding polypeptides.
- the fusion protein may include less than 30, less than 25, or less than 20 binding polypeptides.
- the fusion protein may include between 1 and 30, between 1 and 20, or between 1 and 10 binding polypeptides.
- the binding polypeptides may be the same or different from one another.
- the fusion protein includes more than one binding polypeptide positioned in tandem to one another. In some embodiments, the fusion protein includes 2 to 6 binding polypeptides. In some embodiments, the fusion protein includes two binding polypeptides. In some embodiments, the fusion protein includes three binding polypeptides. In some embodiments, the fusion protein includes four binding polypeptides. In some embodiments, the fusion protein includes five binding polypeptides. In some embodiments, the fusion protein includes six binding polypeptides.
- the fusion protein includes more than one unstructured polypeptide.
- the fusion protein may include at least 1 , at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 1 1 , at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, or at least 20 unstructured polypeptides.
- the fusion protein may include less than 30, less than 25, or less than 20 unstructured polypeptides.
- the fusion protein may include between 1 and 30, between 1 and 20, or between 1 and 10 unstructured polypeptides.
- the unstructured polypeptides may be the same or different from one another.
- the fusion protein includes more than one unstructured polypeptide positioned in tandem to one another.
- the fusion protein may be arranged as a modular linear polypeptide.
- the modular linear polypeptide may be arranged in one of the following structures: [binding polypeptide] m — [linker] ⁇ — [unstructured polypeptide]; [unstructured polypeptide]— [linker] ⁇ — [binding polypeptide] m ; [binding polypeptide] m — [linker] ⁇ —
- [binding polypeptide] m in which k and m are each independently an integer greater than or equal to 1. In some embodiments, m is an integer less than or equal to 20. In some embodiments, m is an integer equal to 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, 15, 16, 17, 18, 19, or 20. In some embodiments, k is an integer less than or equal to 10. In some embodiments, k is an integer equal to 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 10. In some embodiments, the at least one binding polypeptide is positioned N-terminal to the at least one unstructured polypeptide. In some embodiments, the at least one binding polypeptide is positioned C- terminal to the at least one unstructured polypeptide.
- the fusion protein may be expressed recombinantly in a host cell according to one of skill in the art.
- the fusion protein may be purified by any means known to one of skill in the art.
- the fusion protein may be purified using chromatography, such as liquid chromatography, size exclusion chromatography, or affinity chromatography, or a combination thereof.
- the fusion protein is purified without chromatography.
- the fusion protein is purified using inverse transition cycling.
- the fusion protein comprises a plurality of binding polypeptides comprising Tn3 domains (SEQ ID NO: 1 or 2), linked to one another with flexible glycine serine linkers (SEQ ID NO: 3), and an unstructured polypeptide comprising elastin-like polypeptide (FIG. 1).
- binding polypeptides comprising Tn3 domains (SEQ ID NO: 1 or 2), linked to one another with flexible glycine serine linkers (SEQ ID NO: 3), and an unstructured polypeptide comprising elastin-like polypeptide (FIG. 1).
- the binding polypeptide may comprise any polypeptide that is capable of binding at least one target.
- the binding polypeptide may bind at least one target.
- Target may be an entity capable of being bound by the binding polypeptide.
- Targets may include, for example, another polypeptide, a cell surface receptor, a carbohydrate, an antibody, a small molecule, or a combination thereof.
- the target may be a biomarker.
- the target may be activated through agonism or blocked through antagonism.
- the binding polypeptide may specifically bind the target.
- the binding polypeptide may act as a targeting moiety, an agonist, an antagonist, or a combination thereof.
- the binding polypeptide domain binds TRAILR-2.
- TRAIL receptor 2 or “TRAILR-2” refers to the TNF-Related Apoptosis- Inducing Ligand (TRAIL) Receptor 2 protein. Upon binding TRAIL or other agonists, TRAILR-2 activates apoptosis, or programmed cell death, in tumor cells. In some embodiments, the binding polypeptide domain binds epidermal growth factor receptor (EGFR). Upon binding epidermal growth factor (EGF) and other growth factor ligands, EGFR activates signal transduction pathways that promote cell proliferation.
- EGFR epidermal growth factor receptor
- the binding polypeptide may be a monomer that binds to a target.
- the monomer may bind one or more targets.
- the binding polypeptide may form an oligomer.
- the binding polypeptide may form an oligomer with the same or different binding polypeptides.
- the oligomer may bind to a target.
- the oligomer may bind one or more targets.
- One or more monomers within an oligomer may bind one or more targets.
- the fusion protein is multivalent.
- the fusion protein binds multiple targets.
- the activity of the binding polypeptide alone is the same as the activity of the binding protein when part of a fusion protein.
- the binding polypeptide comprises an amino acid sequence consisting of Arg-Gly-Asp-Ser (RGDS; SEQ ID NO: 17). In some embodiments, the binding polypeptide comprises a plurality of amino acid sequences consisting of SEQ ID NO: 17. The amino acid sequence of SEQ ID NO: 17 may be present anywhere within the binding polypeptide. In some embodiments, the amino acid sequence of SEQ ID NO: 17 may be repeated in tandem within the binding polypeptide.
- the binding polypeptide comprises one or more scaffold proteins.
- scaffold protein refers to one or more polypeptide domains with relatively stable and defined three-dimensional structures. Scaffold proteins may further have the capacity for affinity engineering.
- the scaffold protein has been engineered to bind a particular target.
- the scaffold proteins may be the same or different.
- the scaffold protein comprises a fibronectin domain.
- Fibronectin is a high-molecular weight glycoprotein of the extracellular matrix that binds to membrane-spanning receptor proteins called integrins. Fibronectin binds extracellular matrix components such as collagen, fibrin, and heparan sulfate proteoglycans.
- Human fibronectin exists as a protein dimer, comprising two nearly identical polypeptide chains linked by a pair of C-terminal disulfide bonds. Each human fibronectin subunit contains three domains: type I, II, and III. Fibronectin type III (Fnlll) refers to the third of the three types of internal repeats in human fibronectin.
- the fibronectin domain comprises Tn3.
- Tn3 or "Tn3 scaffold” refers to an Fnlll domain from human tenascin C.
- Tn3 may comprise an amino acid sequence consisting of SEQ ID NO: 1 or 2.
- Tn3 binds TRAIL receptor 2.
- the binding polypeptide may comprise one or more scaffold proteins further selected from, for example, alphahelical Z domain of protein A, anti- EGFR binding protein, DARPINS, knottins, and scFvs. b. Unstructured Polypeptide
- the unstructured polypeptide may comprise any polypeptide that has minimal or no secondary structure as observed by CD, being soluble at a temperature below its lower critical solution temperature (LCST) and/or at a temperature above its upper critical solution temperature (UCST), and comprising a repeated amino acid sequence.
- LCST is the temperature below which the polypeptide is miscible.
- UCST is the temperature above which the polypeptide is miscible.
- the unstructured polypeptide has only UCST behavior.
- the unstructured polypeptide has only LCST behavior.
- the unstructured polypeptide has both UCST and LCST behavior.
- the unstructured polypeptide may comprise a repeated sequence of amino acids.
- the unstructured polypeptide may have a LCST between about 0°C and about 100°C, between about 10°C and about 50°C, or between about 20°C and about 42°C.
- the unstructured polypeptide may have a UCST between about 0°C and about 100°C, between about 10°C and about 50°C, or between about 20°C and about 42°C.
- the unstructured polypeptide has a transition temperature between room temperature (about 25°C) and body temperature (about 37°C).
- a fusion protein comprising one or more thermally responsive polypeptides has a transition temperature between room temperature (about 25°C) and body temperature (about 37°C).
- the unstructured polypeptide has no LCST or UCST behavior.
- the unstructured polypeptide may have its LCST or UCST below body temperature or above body temperature at the concentration at which the fusion protein is administered to a subject.
- the unstructured polypeptide comprises an amino acid sequence that is rich in proline and glycine. In some embodiments, the unstructured polypeptide comprises a PG motif. In some embodiments, the unstructured polypeptide comprises a plurality of or repeated PG motifs.
- a PG motif comprises an amino acid sequence selected from PG, P(X) n G (SEQ ID NO: 18), and (U) m P(X) n G(Z) p (SEQ ID NO: 20), or a combination thereof, wherein m, n, and p are independently an integer from 1 to 15, and wherein U, X, and Z are independently any amino acid.
- P(X) n G may include PXG, PXXG,
- the unstructured polypeptide may further include additional amino acids at the C-terminal and/or N-terminal end of the PG motif. These amino acids surrounding the PG motif may also be part of the overall repeated motif. The amino acids that surround the PG motif may balance the overall hydrophobicity and/or charge so as to control the LCST or UCST behavior of the unstructured polypeptide.
- the unstructured polypeptide comprises one or more thermally responsive polypeptides.
- Thermally responsive polypeptides may include, for example, elastin-like polypeptides (ELP).
- ELP refers to a polypeptide comprising the pentapeptide repeat sequence (VPGXG) n , wherein X is any amino acid except proline and n is an integer greater than or equal to 1 (SEQ ID NO: 19).
- the unstructured polypeptide may comprise an amino acid sequence consisting of (VPGXG) n . In some embodiments, X is not proline.
- n is 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 260, 270, 280, 290, or 300.
- n may be less than 500, less than 400, less than 300, less than 200, or less than 100.
- n may be between 1 and 500, between 1 and 400, between 1 and 300, or between 1 and 200.
- n is 60, 120, or 180. ELP may be expressed recombinantly.
- Thermally responsive polypeptides may have a phase transition.
- the thermally responsive polypeptide may impart a phase transition characteristic to the unstructured polypeptide and/or fusion protein.
- Phase transition or “transition” may refer to the aggregation of the thermally responsive polypeptide, which occurs sharply and reversibly at a specific temperature called the lower critical solution temperature (LCST) or the inverse transition temperature (Tt). Below the transition temperature (LCST or Tt), the thermally responsive polypeptides (or polypeptides comprising a thermally responsive polypeptide) may be highly soluble.
- thermally responsive polypeptides Upon heating above the transition temperature, thermally responsive polypeptides hydrophobically may collapse and aggregate, forming a separate, gel-like phase.
- the thermally responsive polypeptide comprises a resilin-like polypeptide (RLP).
- RLPs are derived from Rec1-resilin. Rec1-resilin is environmentally responsive and exhibits a dual phase transition behavior.
- the thermally responsive RLPs can have LCST and UCST (Li et. al, Macromol. Rapid Commun. 2015, 36, 90-95.) Additional examples of suitable thermally responsive polypeptides are described in U.S. Patent Application Publication Nos. US2012/0121709, filed May 17, 2012, and US2015/0112022, filed April 23, 2015, each of which is incorporated herein by reference.
- thermally responsive polypeptides can phase transition at a variety of temperatures and concentrations.
- Thermally responsive polypeptides for example, ELP, may not affect the binding or potency of the binding polypeptides.
- Thermally responsive polypeptides may allow the fusion protein to be tuned by a user to any number of desired transition temperatures, molecular weights, and formats.
- Thermally responsive polypeptides may exhibit inverse phase transition behavior and thus, the fusion protein comprising the thermally responsive polypeptide may exhibit inverse phase transition behavior.
- Inverse phase transition behavior may be used to form drug depots within a tissue of a subject for controlled (slow) release of the fusion protein. Inverse phase transition behavior may also enable purification of the fusion protein using inverse transition cycling, thereby eliminating the need for chromatography.
- Linker
- the fusion protein further includes at least one linker.
- the fusion protein includes more than one linker.
- the linkers may be the same or different from one another.
- the fusion protein may include at least 1 , at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 1 1 , at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, at least 20, at least 25, at least 30, at least 35, at least 40, at least 45, at least 50, at least 55, at least 60, at least 65, at least 70, at least 75, at least 80, at least 85, at least 90, at least 95, or at least 100 linkers.
- the fusion protein may include less than 500, less than 400, less than 300, or less than 200 linkers.
- the fusion protein may include between 1 and 1000, between 10 and 900, between 10 and 800, or between 5 and 500 linkers.
- the linker may be positioned in between a binding polypeptide and an unstructured polypeptide, in between binding polypeptides, in between unstructured polypeptides, or a combination thereof. Multiple linkers may be positioned adjacent to one another. Multiple linkers may be positioned adjacent to one another and in between the binding polypeptide and the unstructured polypeptide.
- the linker may be a polypeptide of any amino acid sequence and length.
- the linker may act as a spacer peptide.
- the linker may occur between polypeptide domains.
- the linker may sufficiently separate the binding domains of the binding polypeptide while preserving the activity of the binding domains.
- the linker comprises charged amino acids.
- the linker is flexible.
- the linker comprises at least one glycine and at least one serine.
- the linker comprises an amino acid sequence consisting of (Gly4Ser)3 (SEQ ID NO: 3).
- the linker comprises at least one proline.
- the linker comprises an amino acid sequence consisting of SEQ ID NO: 4.
- a vector may include the polynucleotide encoding the fusion proteins detailed herein.
- a vector may include the polynucleotide encoding the fusion proteins detailed herein.
- To obtain expression of a polypeptide one typically subclones the polynucleotide encoding the polypeptide into an expression vector that contains a promoter to direct transcription, a transcription/translation terminator, and if for a nucleic acid encoding a protein, a ribosome binding site for translational initiation.
- An example of a vector is pet24 (SEQ ID NO: 12). Suitable bacterial promoters are well known in the art.
- a host cell transformed or transfected with an expression vector comprising a polynucleotide encoding a fusion protein as detailed herein.
- Bacterial expression systems for expressing the protein are available in, e.g., E. coli, Bacillus sp., and Salmonella (Paiva et al., Gene 1983, 22, 229-235; Mosbach et al., Nature 1983, 302, 543-545). Kits for such expression systems are commercially available.
- Eukaryotic expression systems for mammalian cells, yeast, and insect cells are well known in the art and are also commercially available. Retroviral expression systems can be used in the present invention.
- the fusion protein comprises a polypeptide comprising an amino acid sequence of any one of SEQ ID NOs: 1-11 and 17-19. In some embodiments, the fusion protein comprises a polypeptide encoded by a polynucleotide sequence of any one of SEQ ID NOs: 13-14. 4. Administration
- fusion proteins as detailed above can be formulated in accordance with standard techniques well known to those skilled in the pharmaceutical art. Such compositions comprising a fusion protein can be administered in dosages and by techniques well known to those skilled in the medical arts taking into consideration such factors as the age, sex, weight, and condition of the particular subject, and the route of administration.
- the fusion protein can be administered prophylactically or therapeutically.
- the fusion protein can be administered in an amount sufficient to induce a response.
- the fusion proteins are administered to a subject in need thereof in an amount sufficient to elicit a therapeutic effect.
- An amount adequate to accomplish this is defined as "therapeutically effective dose.” Amounts effective for this use will depend on, e.g., the particular composition of the fusion protein regimen administered, the manner of administration, the stage and severity of the disease, the general state of health of the patient, and the judgment of the prescribing physician.
- the fusion protein can be administered by methods well known in the art as described in Donnelly et al. ⁇ Ann. Rev. Immunol. 1997, 75, 617-648); Feigner et al. (U.S. Patent No. 5,580,859, issued Dec. 3, 1996); Feigner (U.S. Patent No. 5,703,055, issued Dec. 30, 1997); and Carson et al. (U.S. Patent No. 5,679,647, issued Oct. 21 , 1997), the contents of all of which are incorporated herein by reference in their entirety.
- the fusion protein can be complexed to particles or beads that can be administered to an individual, for example, using a vaccine gun.
- a pharmaceutically acceptable carrier including a physiologically acceptable compound, depends, for example, on the route of administration.
- the fusion proteins can be delivered via a variety of routes. Typical delivery routes include parenteral administration, e.g., intradermal, intramuscular or subcutaneous delivery. Other routes include oral administration, intranasal, intravaginal, transdermal, intravenous, intraarterial, intratumoral, intraperitoneal, and epidermal routes. In some embodiments, the fusion protein is administered intravenously, intraarterially, or intraperitoneally to the subject.
- the fusion protein can be a liquid preparation such as a suspension, syrup, or elixir.
- the fusion protein can be incorporated into liposomes, microspheres, or other polymer matrices (such as by a method described in Feigner et al., U.S. Patent No. 5,703,055; Gregoriadis, Liposome Technology, Vols. I to III (2nd ed. 1993), the contents of which are incorporated herein by reference in their entirety).
- Liposomes can consist of phospholipids or other lipids, and can be nontoxic, physiologically acceptable and metabolizable carriers that are relatively simple to make and administer.
- the fusion protein may be used as a vaccine.
- the vaccine can be administered via electroporation, such as by a method described in U.S. Patent No. 7,664,545, the contents of which are incorporated herein by reference.
- the electroporation can be by a method and/or apparatus described in U.S. Patent Nos. 6,302,874; 5,676,646; 6,241 ,701 ; 6,233,482; 6,216,034; 6,208,893; 6, 192,270; 6, 181 ,964; 6, 150, 148; 6, 120,493; 6,096,020; 6,068,650; and 5,702,359, the contents of which are incorporated herein by reference in their entirety.
- the electroporation can be carried out via a minimally invasive device.
- the fusion protein is administered in a controlled release formulation.
- the fusion protein comprises one or more thermally responsive polypeptides, the thermally responsive polypeptide having a transition temperature such that the fusion protein remains soluble prior to administration and such that the fusion protein transitions upon administration to a gel-like depot in the subject.
- the fusion protein comprises one or more thermally responsive polypeptides, the thermally responsive polypeptide having a transition temperature such that the fusion protein remains soluble at room temperature and such that the fusion protein transitions upon administration to a gel-like depot in the subject.
- the fusion protein comprises one or more thermally responsive polypeptides, the thermally responsive polypeptide having a transition temperature between room temperature (about 25°C) and body temperature (about 37°C), whereby the fusion protein can be administered to form a depot.
- depot refers to a gel-like composition comprising a fusion protein that releases the fusion protein over time.
- the fusion protein can be injected subcutaneously or intratumorally to form a depot (coacervate).
- the depot may provide controlled (slow) release of the fusion protein.
- the depot may provide slow release of the fusion protein into the circulation or the tumor, for example.
- the fusion protein may be released from the depot over a period of at least about 1 day, at least about 2 days, at least about 3 days, at least about 4 days, at least about 5 days, at least about 6 days, at least about 7 days, at least about 1 week, at least about 1.5 weeks, at least about 2 weeks, at least about 2.5 weeks, at least about 3.5 weeks, at least about 4 weeks, or at least about 1 month. 5. Detection
- the term “detect” or “determine the presence of” refers to the qualitative measurement of undetectable, low, normal, or high concentrations of one or more fusion proteins, targets, or fusion proteins bound to target. Detection may include in vitro, ex vivo, or in vivo detection. Detection may include detecting the presence of one or more fusion proteins or targets versus the absence of the one or more fusion proteins or targets. Detection may also include quantification of the level of one or more fusion proteins or targets. The term “quantify” or “quantification” may be used interchangeably, and may refer to a process of determining the quantity or abundance of a substance (e.g., fusion protein or target), whether relative or absolute.
- a substance e.g., fusion protein or target
- the fusion protein comprises a reporter attached thereto for detection.
- the fusion protein is labeled with a reporter.
- detection of fusion protein bound to target may be determined by methods including but not limited to, band intensity on a Western blot, flow cytometry, radiolabel imaging, cell binding assays, activity assays, SPR, immunoassay, or by various other methods known in the art.
- any immunoassay may be utilized.
- the immunoassay may be an enzyme-linked immunoassay (ELISA), radioimmunoassay (RIA), a competitive inhibition assay, such as forward or reverse competitive inhibition assays, a fluorescence polarization assay, or a competitive binding assay, for example.
- the ELISA may be a sandwich ELISA. Specific immunological binding of the fusion protein to the target can be detected via direct labels, attached to the fusion protein or via indirect labels, such as alkaline phosphatase or horseradish peroxidase.
- the use of immobilized fusion proteins may be incorporated into the immunoassay.
- the fusion proteins may be immobilized onto a variety of supports, such as magnetic or chromatographic matrix particles, the surface of an assay plate (such as microtiter wells), pieces of a solid substrate material, and the like.
- An assay strip can be prepared by coating the fusion protein or plurality of fusion proteins in an array on a solid support. This strip can then be dipped into the test biological sample and then processed quickly through washes and detection steps to generate a measurable signal, such as a colored spot. 6.
- the present invention is directed to a method of treating a disease in a subject in need thereof.
- the method may comprise administering to the subject an effective amount of the fusion protein as described herein.
- the disease may be selected from cancer, metabolic disease, autoimmune disease, cardiovascular disease, and orthopedic disorders.
- the disease is a disease associated with a target of the at least one binding polypeptide.
- Metabolic disease may occur when abnormal chemical reactions in the body alter the normal metabolic process. Metabolic diseases may include, for example, insulin resistance, non-alcoholic fatty liver diseases, type 2 diabetes, insulin resistance diseases, cardiovascular diseases, arteriosclerosis, lipid-related metabolic disorders, hyperglycemia, hyperinsulinemia, hyperlipidemia, and glucose metabolic disorders.
- Autoimmune diseases arise from an abnormal immune response of the body against substances and tissues normally present in the body.
- Autoimmune diseases may include, but are not limited to, lupus, rheumatoid arthritis, multiple sclerosis, insulin dependent diabetes mellitis, myasthenia gravis, Grave's disease, autoimmune hemolytic anemia, autoimmune thrombocytopenia purpura, Goodpasture's syndrome, pemphigus vulgaris, acute rheumatic fever, post-streptococcal glomerulonephritis, polyarteritis nodosa, myocarditis, psoriasis, Celiac disease, Crohn's disease, ulcerative colitis, and fibromyalgia.
- Cardiovascular disease is a class of diseases that involve the heart or blood vessels.
- Cardiovascular diseases may include, for example, coronary artery diseases (CAD) such as angina and myocardial infarction (heart attack), stroke, hypertensive heart disease, rheumatic heart disease, cardiomyopathy, heart arrhythmia, congenital heart disease, valvular heart disease, carditis, aortic aneurysms, peripheral artery disease, and venous thrombosis.
- CAD coronary artery diseases
- Orthopedic disorders or musculoskeletal disorders are injuries or pain in the body's joints, ligaments, muscles, nerves, tendons, and structures that support limbs, neck, and back.
- Orthopedic disorders may include degenerative diseases and inflammatory conditions that cause pain and impair normal activities.
- Orthopedic disorders may include, for example, carpal tunnel syndrome, epicondylitis, and tendinitis.
- Cancers may include, but are not limited to, breast cancer, colorectal cancer, colon cancer, lung cancer, prostate cancer, testicular cancer, brain cancer, skin cancer, rectal cancer, gastric cancer, esophageal cancer, sarcomas, tracheal cancer, head and neck cancer, pancreatic cancer, liver cancer, ovarian cancer, lymphoid cancer, cervical cancer, vulvar cancer, melanoma, mesothelioma, renal cancer, bladder cancer, thyroid cancer, bone cancers, carcinomas, sarcomas, and soft tissue cancers.
- the cancer is colorectal cancer.
- the cancer is colorectal adenocarcinoma.
- the present invention provides a method for using scaffold proteins in developing antibody mimetics for oncological targets of interest.
- scaffold protein engineering come the possibilities for designing potent protein drugs that are unhindered by steric and architectural limitations. Although potent protein drugs can be invaluable for diagnostics or treatments, successful delivery to the target region can pose a great challenge.
- TNF-related apoptosis-inducing ligand receptor 2 (TRAILR-2, also called R5) activates the extrinsic death pathway in a range of human cancer cells (Walczak, et al. Cold Spring Harb. Perspect. Biol., 2013, 5, a008698).
- TRAILR-2 may be targeted using its natural ligand, TNF-related apoptosis-inducing ligand (TRAIL, also called Apo2L), and other agonists.
- TRAIL is a homotrimer.
- TRAIL and other TRAILR-2 agonists may trigger programmed cell death (apoptosis).
- TRAIL and other TRAILR-2 agonists may have significant anti-tumor activity.
- TRAIL and other TRAILR-2 agonists have not been developed as a clinically efficacious treatment.
- a possible shortcoming of current TRAIL and other TRAILR-2 agonist therapies may be related to their limited valency. Upon binding of TRAILR-2 to homotrimeric TRAIL, the TRAILR-2 receptor trimerizes and subsequently initiates apoptotic cell death.
- current anti-TRAILR-2 mAbs are only bivalent. Indeed, higher order antibody crosslinking may be required for effective receptor engagement, clustering, and a robust antitumor response. Fusion proteins, as detailed herein, that bind multiple TRAILR-2 receptors may provide multivalent agonists capable of forming higher order complexes to treat cancer.
- Fnlll domain has been engineered to have high affinity binding to TRAILR-2.
- Fusion proteins as detailed herein, comprising Fnlll domains flexible peptide linkers may be used as pro-apoptotic anti-cancer therapeutics.
- the increased molecular weight and controlled release of the fusion proteins, relative to a binding polypeptide alone, along with the unperturbed potency of the binding polypeptide, may provide a clinically viable option for patients with tumors expressing functional target protein (e.g. TRAILR-2).
- TRAILR-2 TNF- related apoptosis-inducing ligand receptor 2
- the methods may include administering to the subject a fusion protein as described herein, and detecting binding of the fusion protein to a target to determine presence of the target in the subject.
- the presence of the target may indicate the disease in the subject.
- the methods may include contacting a sample from the subject with a fusion protein as described herein, determining the level of a target in the sample, and comparing the level of the target in the sample to a control level of the target, wherein a level of the target different from the control level indicates disease in the subject.
- the disease is selected from cancer, metabolic disease, autoimmune disease, cardiovascular disease, and orthopedic disorders, as detailed above.
- the target comprises a disease marker or biomarker.
- the fusion protein may act as an antibody mimic for binding and/or detecting a target.
- the methods may include contacting the sample with a fusion protein as described herein under conditions to allow a complex to form between the fusion protein and the target in the sample, and detecting the presence of the complex. Presence of the complex may be indicative of the target in the sample.
- the fusion protein is labeled with a reporter for detection.
- the sample is obtained from a subject and the method further includes diagnosing, prognosticating, or assessing the efficacy of a treatment of the subject.
- the method may further include modifying the treatment of the subject as needed to improve efficacy.
- the methods may include contacting a sample from the subject with a fusion protein as detailed herein under conditions to allow a complex to form between the fusion protein and a target in the sample, determining the level of the complex in the sample, wherein the level of the complex is indicative of the level of the target in the sample, and comparing the level of the target in the sample to a control level of the target, wherein if the level of the target is different from the control level, then the treatment is determined to be effective or ineffective in treating the disease.
- Time points may include prior to onset of disease, prior to administration of a therapy, various time points during administration of a therapy, and after a therapy has concluded, or a combination thereof.
- the fusion protein may bind a target, wherein the presence of the target indicates the presence of the disease in the subject at the various time points.
- the target comprises a disease marker or biomarker.
- the fusion protein may act as an antibody mimic for binding and/or detecting a target. Comparison of the binding of the fusion protein to the target at various time points may indicate whether the disease has progressed, whether the diseased has advanced, whether a therapy is working to treat or prevent the disease, or a combination thereof.
- control level corresponds to the level in the subject at a time point before or during the period when the subject has begun treatment, and the sample is taken from the subject at a later time point.
- sample is taken from the subject at a time point during the period when the subject is undergoing treatment, and the control level corresponds to a disease-free level or to the level at a time point before the period when the subject has begun treatment.
- the method further includes modifying the treatment or administering a different treatment to the subject when the treatment is determined to be ineffective in treating the disease. 7. Examples
- the fusion proteins included two parts (FIG. 1): (i) a multivalent targeting component (e.g., TRAILR-2 agonist or EGFR antagonist) protein in which one or more scaffold protein units (e.g., SEQ ID NO: 1 and 2 or 5) are linked by glycine-serine flexible (e.g., SEQ ID NO: 3) or structured proline-containing linkers (e.g., SEQ ID NO: 4); and (ii) an elastin-like-polypeptide connected to the multivalent protein (e.g., SEQ ID NO: 7-9).
- a multivalent targeting component e.g., TRAILR-2 agonist or EGFR antagonist
- scaffold protein units e.g., SEQ ID NO: 1 and 2 or 5
- glycine-serine flexible e.g., SEQ ID NO: 3
- structured proline-containing linkers e.g., SEQ ID NO: 4
- the DNA encoding the TRAILR-2-specific Tn3 unit (SEQ ID NO: 13; Swers et al., Mol. Cancer Ther., 2013, 12, 1235-1244) and the EGFR-specific domain (SEQ ID NO: 14; Friedman, et al., J. Mol. Biol. 2008, 376, 1388-1402) were purchased as double-stranded DNA "G-blocks" from Integrated DNA Technologies (Coralville, IA).
- the Tn3 G-block (SEQ ID NO: 13) was amplified using primers "Tn3For” and "Tn3Rev” primers (SEQ ID NO: 15 and 16, respectively).
- the gene was purchased with a (Gly4Ser)3 linker (SEQ ID NO: 3) at the C- terminus and designed with restriction sites compatible with recursive directional (RDL) ligation for seamless cloning of oligomeric genes.
- the EGFR-binding G-block (SEQ ID NO: 5) was purchased such that it could be inserted into the vector (SEQ ID NO: 12) using Gibson Assembly.
- the G-block contained 40-50 nucleic acid bases identical to those in the vector.
- Enzymes used were from New England Biolabs (Ipswich, MA)
- the amplified Tn3 domain PCR product was purified using the Qiagen (Germantown, MD) PCR cleanup kit and digested with BseRI for insertion into a BseRI/CIP digested pET-24(+) vector modified for RDL (McDaniel et al. Biomacromolecules, 2010, 11 , 944-952).
- the insert and vector were agarose gel-purified and ligated with QuickLigase to clone the single unit construct.
- the gene for ELP was recombinantly fused to the (Tn3)5 using RDL.
- the RDL ligation method for this particular vector called for digestion of the oligomerized Tn3 in modified pET24(+) (SEQ ID NO: 12) with Acul and Bgll, and digestion of ELP (SEQ ID NO: 7-9) in pET24(+) with BseRI and Bgll.
- the digested fragments of DNA were separated using agarose gel electrophoresis, and the DNA bands at the appropriate molecular weights were excised and gel-purified.
- the resulting fragments were ligated using QuickLigase and successful clones were obtained.
- the restriction digest scheme mentioned refers to fusion of ELP to the C-terminus of the multivalent agonist, but in some embodiments, the scheme was flipped if N-terminal fusion was desired. In other embodiments, ELP(s) were interspersed between Tn3 repeats with this cloning method. In still other embodiments, an eight-repeat histidine tag (SEQ ID NO: 6) was recombinantly included at the C-terminus for purification and/or analysis purposes. All gene sequences were verified by direct DNA sequencing (Eton Bioscience Inc., Durham, NC) prior to expression.
- the multivalent ELP-(Tn3) 6 fusion constructs (SEQ ID NO: 10 and 11 ; FIG. 2) were transformed into BL21 (DE3) cells (EMD/Novagen, Gibbstown, NJ) for expression. Transformants were grown in Terrific Broth (TB) containing 45 ⁇ g/mL kanamycin and incubated overnight at 37°C with shaking. Overnight cultures were diluted 1 to 40 into TB containing 45 ⁇ g/mL kanamycin and incubated at 37°C with shaking for 5-8 hours. Protein expression was then induced by addition of IPTG to 1 mM, and incubation was resumed at 37°C with shaking.
- the Tn3-ELP fusion proteins were purified from the cell lysate using inverse transition cycling (ITC) as previously described (Christensen et al., Protein Science 2009, 78, 1377-1387; Hassouneh et al., Methods Enzymol. 2012, 502, 215-37).
- ITC inverse transition cycling
- C-terminally Hiss-tagged ELP-Tn3 fusion proteins were purified from the periplasmic extract using immobilized metal affinity chromatography (IMAC; e.g., HisPur Ni-NTA resin from ThermoFisher Scientific, Pierce, Rockford, IL).
- IMAC immobilized metal affinity chromatography
- the cell viability assay was carried out as follows.
- the Colo205 cells were plated in 96 well plates at a density of 10,000 cells/well in 90 ⁇ _ of complete media (RPMI 1640+10% FBS+5% HEPES+5%Sodium Pyruvate+P/S) and incubated for 5-4 hours at 37°C with 5% CO2.
- the cells were then treated with 10 ⁇ _ 20 mM Tris 300 mM L-arginine pH 7 containing a serial dilution of a specific multivalent Tn3-ELP fusion protein or the vehicle control. The treatments were done in triplicate to account for technical variability.
- the Promega CellTiter 96 Aqueous One Solution Reagent G3581 kit was used according to manufacturer's instructions to assay the number of viable cells using a colorimetric formazan assay method.
- the inhibition of cell viability was determined using measurements of the absorbance at 490, which is the maximum absorbance wavelength of the formazan product.
- the dose response curves were generated by plotting inhibition versus compound concentration. The dose response curve was approximated from the scatter plot using a four-parameter logistic model calculation in GraphPad Prism (La Jolla, CA), and EC50 was calculated as the concentration of
- Tn3-ELP required to kill 50% of the Colo205 cells. Fusion of ELPs to the multivalent TRAILR-2 specific Tn3 did not impact their potency (TABLE 1). TABLE 1. EC50 values for various fusion proteins.
- the optical density of the protein solution was monitored at 350 nm (OD350) as a function of temperature.
- the solution (10-100 ⁇ in 20 mM Tris 300 mM L-arginine, pH 7) was heated at a rate of 1 °C/minute using the Cary 300 UV- visible spectrophotometer equipped with a multicell thermoelectric temperature controller (Varian Instruments, Walnut Creek, CA). A sharp transition was indicated by the sudden increase in absorbance, and the inflection point of the absorbance versus temperature curve was used to calculate the Tt.
- the derivative of the absorbance at 350 nm was calculated with respect to temperature, and the Tt (temperature at maximal turbidity gradient) was obtained.
- An example set of curves is provided in FIG. 5.
- the most potent fusions were the 6-repeat Tn3 domain-ELP (SEQ ID NO: 10 and 11 , respectively) were chosen for testing in vivo.
- the hydrophilic ELPb (SEQ ID NO: 8) had a Tt much higher than body temperature; this biopolymer was chosen for fusion to the bioactive protein as a size control.
- the hydrophobic ELPa transitioned at 28°C (see FIG. 5) and formed a gel-like depot upon injection into the mouse.
- tumors had grown to a volume of approximately 150 mm 3 , at which a point a single intratumoral injection of 20 mM Tris 300 mM L-arginine pH 7 (vehicle), TRAIL (not shown), depot-forming ELPa-(Tn3)5 fusion, soluble ELPb-
- mice were monitored for overall health and activity in accordance with the Duke University Institutional Animal Care & Use Committee. The mice in all treatment groups were dosed at 3.7 ⁇ g/mm 3 of protein drug and tumor volume was monitored with a digital caliper using the formula:
- the depot-forming ELPa-(Tn3)5 fusion led to partial tumor regression and slower tumor growth when compared to all other groups.
- This depot approach may be extended to improve the drug delivery of protein- drug conjugates.
- additional combinations of bioactive multispecific protein-biopolymer fusions can be developed using the methods described herein.
- the protein architecture, flexibility of the design, and potent therapeutic efficacy make these modular fusions a potential platform for protein delivery.
- a fusion protein comprising at least one binding polypeptide and at least one unstructured polypeptide.
- Clause 8 The fusion protein of any one of clauses 4-5, wherein the linker comprises an amino acid sequence consisting of SEQ ID NO: 4 .
- Clause 9. The fusion protein of any one of clauses 3-8, wherein the plurality of binding polypeptides forms an oligomer.
- Clause 10 The fusion protein of any one of clauses 3-9, wherein the binding polypeptide binds a target, and wherein the fusion protein binds more than one target.
- Clause 13 The fusion protein of any one of the preceding clauses, wherein the at least one binding polypeptide comprises at least one amino acid sequence of consisting of SEQ ID NO: 17 (RGDS).
- Clause 14 The fusion protein of clause 13, wherein the at least one binding polypeptide comprises a plurality of amino acid sequences consisting of SEQ ID NO: 17 (RGDS).
- Clause 15 The fusion protein of any one of the preceding clauses, wherein the at least one unstructured polypeptide comprises at least one PG motif comprising an amino acid sequence selected from PG, P(X) n G (SEQ ID NO: 18), and (U) m P(X) n G(Z) p (SEQ ID NO: 20), or a combination thereof, wherein m, n, and p are independently an integer from 1 to 15, and wherein U, X, and Z are independently any amino acid.
- Clause 16 The fusion protein of any one of the preceding clauses, wherein the at least one unstructured polypeptide comprises a thermally responsive polypeptide.
- Clause 21 The fusion protein of any one of the preceding clauses, further comprising at least one linker positioned between the at least one binding polypeptide and the at least one unstructured polypeptide.
- Clause 22 The fusion protein of clause 21 , wherein the fusion protein comprises a plurality of linkers between the at least one binding polypeptide and the at least one unstructured polypeptide.
- Clause 23 The fusion protein of any one of the preceding clauses, wherein the at least one binding polypeptide is positioned N-terminal to the at least one unstructured polypeptide.
- Clause 24 The fusion protein of any one of clauses 1-23 wherein the at least one binding polypeptide is positioned C-terminal to the at least one unstructured polypeptide.
- Clause 25 The fusion protein of any one of the preceding clauses, wherein the at least one unstructured polypeptide has a LCST between about 0°C and about 100°C.
- Clause 26 The fusion protein of any one of the preceding clauses, wherein the at least one unstructured polypeptide has a UCST between about 0°C and about 100°C
- Clause 27 A method for treating a disease in a subject in need thereof, the method comprising administering to the subject an effective amount of the fusion protein according to any one of the preceding clauses.
- Clause 28 The method of clause 27, wherein the fusion protein is administered in a controlled release formulation.
- Clause 30 The method of any one of clauses 27-28, wherein the fusion protein is administered intravenously, intraarterially, or intraperitoneally to the subject.
- Clause 31 The method of any one of clauses 27-30, wherein the disease comprises cancer.
- Clause 32 The method of clause 31 , wherein the fusion protein is administered intratumorally.
- Clause 33 The method of any one of clauses 27-32, wherein the cancer is colorectal adenocarcinoma.
- Clause 34 The method of any one of clauses 27-33, wherein the at least one binding polypeptide comprises an Fnlll domain or a plurality of Fnlll domains, and wherein the disease is a disease associated with TRAILR-2.
- Clause 35 The method of any one of clauses 27-34, wherein the disease is a disease associated with a target of the at least one binding polypeptide.
- a multivalent fusion protein comprising at least one Fibronectin type III (Fnlll) domain and at least one elastin-like polypeptide (ELP), wherein the Fnlll domain binds TNF-related apoptosis-inducing ligand receptor 2 (TRAILR-2).
- Fnlll Fibronectin type III
- ELP elastin-like polypeptide
- Clause 37 The multivalent fusion protein of clause 36, wherein the at least one ELP comprises an amino acid sequence consisting of (VPGXG) n (SEQ ID NO: 19), wherein X is any amino acid except proline and n is an integer greater than or equal to 1.
- Clause 40 The multivalent fusion protein of any one of clauses 36-39, wherein the at least one Fnlll domain comprises an amino acid sequence consisting of SEQ ID NO: 1.
- Clause 42 The multivalent fusion protein of clause 41 , wherein the multivalent fusion protein comprises 2, 4, or 6 Fnlll domains.
- Clause 43 The multivalent fusion protein of clause 41 or 42, wherein the multivalent fusion protein further comprises a linker positioned between at least two adjacent Fnlll domains.
- Clause 47 A method for treating a disease associated with TNF-related apoptosis- inducing ligand receptor 2 (TRAILR-2) in a subject in need thereof, the method comprising administering to the subject an effective amount of the multivalent fusion protein of any one of clauses 36-46.
- TRAILR-2 TNF-related apoptosis- inducing ligand receptor 2
- Clause 48 The method of clause 47, wherein the disease comprises cancer.
- Clause 52 The method of any one of clauses 47-51 , wherein the multivalent fusion protein forms a depot upon administration to the subject.
- Clause 53 The method of any one of clauses 47-51 , wherein the multivalent fusion protein is administered in a controlled release formulation.
- Clause 54 A method of diagnosing a disease in a subject, the method comprising contacting a sample from the subject with the fusion protein according to any one of clauses 1- 26; and detecting binding of the fusion protein to a target to determine presence of the target in the sample, wherein the presence of the target in the sample indicates the disease in the subject.
- Clause 55 The method of clause 54, wherein the disease is selected from cancer, metabolic disease, autoimmune disease, cardiovascular disease, and orthopedic disorder.
- Clause 56 A method of determining the presence of a target in a sample, the method comprising contacting the sample with the fusion protein of any one of clauses 1-26 under conditions to allow a complex to form between the fusion protein and the target in the sample; and detecting the presence of the complex, wherein presence of the complex is indicative of the target in the sample.
- Clause 57 The method of clause 56, wherein the sample is obtained from a subject and the method further comprises diagnosing a disease, prognosticating, or assessing the efficacy of a treatment of the subject.
- Clause 58 The method of clause 57, wherein when the method further comprises assessing the efficacy of a treatment of the subject, then the method further comprises modifying the treatment of the subject as needed to improve efficacy.
- a method of determining the effectiveness of a treatment for a disease in a subject in need thereof comprising contacting a sample from the subject with the fusion protein of any one of clauses 1-26 under conditions to allow a complex to form between the fusion protein and a target in the sample; determining the level of the complex in the sample, wherein the level of the complex is indicative of the level of the target in the sample; and comparing the level of the target in the sample to a control level of the target, wherein if the level of the target is different from the control level, then the treatment is determined to be effective or ineffective in treating the disease.
- Clause 60 A method of diagnosing a disease in a subject, the method comprising: contacting a sample from the subject with the fusion protein of any one of clauses 1-26; determining the level of a target in the sample; and comparing the level of the target in the sample to a control level of the target, wherein a level of the target different from the control level indicates disease in the subject.
- Clause 61 The method of clause 59 or 60, wherein the control level corresponds to the level in the subject at a time point before or during the period when the subject has begun treatment, and wherein the sample is taken from the subject at a later time point.
- Clause 62 The method of clause 59 or 60, wherein the sample is taken from the subject at a time point during the period when the subject is undergoing treatment, and wherein the control level corresponds to a disease-free level or to the level at a time point before the period when the subject has begun treatment.
- Clause 63 The method of any one of clauses 59 and 61-62, the method further comprising modifying the treatment or administering a different treatment to the subject when the treatment is determined to be ineffective in treating the disease.
- Clause 64 The method of any one of clauses 54-63, wherein the fusion protein is labeled with a reporter.
- Clause 65 The method of any one of clauses 54-64, wherein the disease is selected from cancer, metabolic disease, autoimmune disease, cardiovascular disease, and orthopedic disorder.
- ELP repeat polypeptide, wherein X is any amino acid except proline and n is an integer greater than or equal to 1
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Genetics & Genomics (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Molecular Biology (AREA)
- Gastroenterology & Hepatology (AREA)
- Zoology (AREA)
- Toxicology (AREA)
- Dermatology (AREA)
- Epidemiology (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Abstract
Provided herein are fusion proteins including at least one binding polypeptide and at least one unstructured polypeptide. The fusion protein may further include at least one linker. Further provided are methods for determining the presence of a target in a sample, methods of treating a disease, methods of diagnosing a disease in a subject, and methods of determining the effectiveness of a treatment for a disease in a subject. The methods may include administering to the subject an effective amount of the fusion protein.
Description
TARGETED THERAPEUTIC AGENTS COMPRISING MULTIVALENT
PROTEIN-BIOPOLYMER FUSIONS
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application claims priority to U.S. Provisional Patent Application No. 62/138,847, filed March 26, 2015, which is incorporated herein by reference in its entirety.
STATEMENT REGARDING FEDERALLY SPONSORED RESEARCH
[0002] This invention was made with government support under grant R01 EB007205, 2032358, and 2032363 awarded by the National Institutes of Health. The government has certain rights in the invention.
FIELD
[0003] The disclosure relates to antibody mimetics and, more particularly, to fusions of unstructured polypeptides and multivalent proteins that specifically bind a target. The multivalent proteins can bind a target such as a cell surface receptor, for example, and thereby affect cellular physiology. The unstructured polypeptide component can render the fusion protein environmentally responsive, and thereby expand the scope of drug delivery options.
INTRODUCTION
[0004] Proteins can be powerful therapeutic agents when engineered for affinity, specificity, and selectivity for a clinical target. Their complexity, versatility, tolerability, and diversity often make them superior alternatives to small molecule drugs, and the long half-life, specificity, and selectivity of some proteins make them attractive for some therapies. Biotechnological advances have enabled the engineering of proteins with specific properties and the manipulation of existing proteins for maximum therapeutic potential. Although protein engineering allows for the development of potent therapeutics targeted toward a protein or receptor of interest, the body has many mechanisms with which to clear such protein therapies. Thus, delivery is a critical issue for effectively translating a protein therapeutic to the clinic. There is a need for reliable and broadly applicable protein delivery solutions.
SUMMARY
[0005] In an aspect, provided herein are fusion proteins. The fusion protein may include at least one binding polypeptide and at least one unstructured polypeptide. In some embodiments, the fusion protein comprises a plurality of unstructured polypeptides. In some embodiments, the fusion protein comprises a plurality of binding polypeptides. In some embodiments, the fusion protein further includes a linker positioned between at least two adjacent binding polypeptides. In some embodiments, the fusion protein further includes a linker positioned between at least two adjacent unstructured polypeptides. In some embodiments, the linker comprises at least one glycine and at least one serine. In some embodiments, the linker comprises an amino acid sequence consisting of SEQ ID NO: 3 ((Gly4Ser)3). In some embodiments, the linker comprises an amino acid sequence consisting of SEQ ID NO: 4. In some embodiments, the plurality of binding polypeptides forms an oligomer. In some embodiments, the binding polypeptide binds a target. In some embodiments, the fusion protein binds more than one target. In some embodiments, the at least one binding polypeptide comprises a Fibronectin type III (Fnlll) domain. In some embodiments, the Fnlll domain binds TNF-related apoptosis- inducing ligand receptor 2 (TRAILR-2). In some embodiments, the at least one binding polypeptide comprises at least one amino acid sequence of consisting of SEQ ID NO: 17 (RGDS). In some embodiments, the at least one binding polypeptide comprises a plurality of amino acid sequences consisting of SEQ ID NO: 17 (RGDS). In some embodiments, the at least one unstructured polypeptide comprises at least one PG motif comprising an amino acid sequence selected from PG, P(X)nG (SEQ ID NO: 18), and (U)mP(X)nG(Z)p (SEQ ID NO: 20), or a combination thereof, wherein m, n, and p are independently an integer from 1 to 15, and wherein U, X, and Z are independently any amino acid. In some embodiments, the at least one unstructured polypeptide includes a thermally responsive polypeptide. In some embodiments, the thermally responsive polypeptide comprises an elastin-like polypeptide (ELP). In some embodiments, the at least one unstructured polypeptide includes an amino acid sequence consisting of (VPGXG)n (SEQ ID NO: 19), wherein X is any amino acid except proline and n is an integer greater than or equal to 1. In some embodiments, n is 60, 120, or 180. In some embodiments, X is valine. In some embodiments, the fusion protein further includes at least one linker positioned between the at least one binding polypeptide and the at least one unstructured polypeptide. In some embodiments, the fusion protein includes a plurality of linkers between the at least one binding polypeptide and the at least one unstructured polypeptide. In some embodiments, the at least one binding polypeptide is positioned N-
terminal to the at least one unstructured polypeptide. In some embodiments, the at least one binding polypeptide is positioned C-terminal to the at least one unstructured polypeptide. In some embodiments, the at least one unstructured polypeptide has a LCST between about 0°C and about 100°C. In some embodiments, the at least one unstructured polypeptide has a UCST between about 0°C and about 100°C
[0006] In another aspect, provided herein are methods for treating a disease in a subject in need thereof. The method may include administering to the subject an effective amount of the fusion protein as described herein. In some embodiments, the fusion protein is administered in a controlled release formulation. In some embodiments, the fusion protein forms a depot upon administration to the subject. In some embodiments, the fusion protein is administered intravenously, intraarterially, or intraperitoneally to the subject. In some embodiments, the disease includes cancer. In some embodiments, the fusion protein is administered intratumorally. In some embodiments, the cancer is colorectal adenocarcinoma. In some embodiments, the at least one binding polypeptide includes an Fnlll domain or a plurality of Fnlll domains, and the disease is a disease associated with TRAILR-2. In some embodiments, the disease is a disease associated with a target of the at least one binding polypeptide.
[0007] In another aspect, provided herein are multivalent fusion proteins. The multivalent fusion protein may include at least one Fibronectin type III (Fnlll) domain and at least one elastin-like polypeptide (ELP). In some embodiments, the Fnlll domain binds TNF-related apoptosis-inducing ligand receptor 2 (TRAILR-2). In some embodiments, the at least one ELP includes an amino acid sequence consisting of (VPGXG)n (SEQ ID NO: 19), wherein X is any amino acid except proline and n is an integer greater than or equal to 1. In some embodiments, n is 60, 120, or 180. In some embodiments, X is valine. In some embodiments, the at least one Fnlll domain includes an amino acid sequence consisting of SEQ ID NO: 1. In some embodiments, the multivalent fusion protein includes a plurality of Fnlll domains. In some embodiments, the multivalent fusion protein includes 2, 4, or 6 Fnlll domains. In some embodiments, the multivalent fusion protein further includes a linker positioned between at least two adjacent Fnlll domains. In some embodiments, the linker includes at least one glycine and at least one serine. In some embodiments, the linker includes an amino acid sequence consisting of SEQ ID NO: 3 ((Gly4Ser)3). In some embodiments, the linker includes an amino acid sequence consisting of SEQ ID NO: 4.
[0008] In another aspect, provided herein are methods for treating a disease associated with TNF-related apoptosis-inducing ligand receptor 2 (TRAILR-2) in a subject in need thereof. The methods may include administering to the subject an effective amount of the multivalent fusion protein as detailed herein. In some embodiments, the disease includes cancer. In some embodiments, the cancer includes colorectal adenocarcinoma. In some embodiments, the multivalent fusion protein is administered intravenously, intraarterially, or intraperitoneally to the subject. In some embodiments, the multivalent fusion protein is administered intratumorally. In some embodiments, the multivalent fusion protein forms a depot upon administration to the subject. In some embodiments, the multivalent fusion protein is administered in a controlled release formulation.
[0009] In another aspect, provided herein are methods of diagnosing a disease in a subject. The method may include contacting a sample from the subject with a fusion protein as detailed herein, and detecting binding of the fusion protein to a target to determine presence of the target in the sample, wherein the presence of the target in the sample indicates the disease in the subject. In some embodiments, the disease is selected from cancer, metabolic disease, autoimmune disease, cardiovascular disease, and orthopedic disorder.
[0010] In another aspect, provided herein are methods of determining the presence of a target in a sample. The method may include contacting the sample with a fusion protein as detailed herein under conditions to allow a complex to form between the fusion protein and the target in the sample, and detecting the presence of the complex, wherein presence of the complex is indicative of the target in the sample. In some embodiments, the sample is obtained from a subject and the method further includes diagnosing a disease, prognosticating, or assessing the efficacy of a treatment of the subject. In some embodiments, the method further includes assessing the efficacy of a treatment of the subject, and the method further includes modifying the treatment of the subject as needed to improve efficacy.
[0011] In another aspect, provided herein are methods of determining the effectiveness of a treatment for a disease in a subject in need thereof. The method may include contacting a sample from the subject with a fusion protein as described herein under conditions to allow a complex to form between the fusion protein and a target in the sample, determining the level of the complex in the sample, wherein the level of the complex is indicative of the level of the target in the sample, and comparing the level of the target in the sample to a control level of the target, wherein if the level of the target is different from the control level, then the treatment is
determined to be effective or ineffective in treating the disease. In some embodiments, the method further includes modifying the treatment or administering a different treatment to the subject when the treatment is determined to be ineffective in treating the disease.
[0012] In another aspect, provided herein are methods of diagnosing a disease in a subject. The method may include contacting a sample from the subject with a fusion protein as described herein, determining the level of a target in the sample, and comparing the level of the target in the sample to a control level of the target, wherein a level of the target different from the control level indicates disease in the subject.
[0013] In some embodiments, the control level corresponds to the level in the subject at a time point before or during the period when the subject has begun treatment, and the sample is taken from the subject at a later time point. In some embodiments, the sample is taken from the subject at a time point during the period when the subject is undergoing treatment, and the control level corresponds to a disease-free level or to the level at a time point before the period when the subject has begun treatment.
[0014] In some embodiments, the fusion protein is labeled with a reporter. In some embodiments, the disease is selected from cancer, metabolic disease, autoimmune disease, cardiovascular disease, and orthopedic disorder.
BRIEF DESCRIPTION OF THE DRAWINGS
[0015] FIG. 1 is a schematic illustrating the architecture of the protein biopolymer fusions. The multivalent protein drugs can act as agonists to amplify receptor signaling or as antagonists to inhibit ligand binding and prevent receptor signaling.
[0016] FIG. 2 is a schematic of the multivalent TRAILR-2 agonist-ELP constructs. The Tn3- ELP fusions were constructed to express ELPs at the N-terminus (shown) or C-terminus (not shown). Each Tn3 unit had a molecular weight of approximately 10 kDa, and the molecular weight of the ELPs varied.
[0017] FIG. 3 shows SDS-PAGE analysis of the ELP-TRAILR-2 agonist fusion protein at various steps in the purification process. Lanes: 1 : Cell lysate; 2: hot spin 1 supernatant; 3: hot spin 1 pellet; 4: cold spin 2 supernatant; 5: hot spin 2 pellet; 6: purified product (cold spin 3 supernatant); 7: purified product (cold spin 3 supernatant). Samples in lanes 1-6 contained reducing agent; lane 7 did not.
[0018] FIG. 4 is a graph showing that tetravalent TRAILR-2-ELPa-(Tn3)4 fusions inhibited cell viability of Colo205 human colorectal adenocarcinoma cells and outperformed TRAIL. Hexavalent TRAILR-2-ELPa-(Tn3)5 fusions exhibited potent activation of apoptosis as well.
Presence of ELP did not affect the potency of the drug.
[0019] FIG. 5 is a graph showing the transition temperatures. The transition temperature of the 6 repeat agonist ELP fusion was 29.2°C, and the transition temperature of the 4 repeat agonist ELP fusion was 27.9°C. This range was appropriate for s.c./intratumoral injections in mouse Colo205 xenograft models.
[0020] FIG. 6 is a graph showing the changes in tumor volume in Colo205 colorectal cancer xenograft models in response to multivalent TRAILR-2 specific ELP fusions. Tumors in mice treated with depot-forming ELPa-(Tn3)5 fusions underwent partial regression and delayed growth.
DETAILED DESCRIPTION
[0021] Provided herein are compositions and methods for delivering protein therapeutics to a subject. The compositions and methods include a fusion protein. The fusion protein may include a binding polypeptide fused to an unstructured polypeptide. In some embodiments, the unstructured polypeptide may include a thermally responsive protein polymer, which may facilitate slow release from a gel-like depot. The use of protein drugs, particularly antibodies, has led to many successful treatments. The long half-life, specificity, and selectivity of engineered antibodies make them excellent for some therapies. The limitations of architecture, valency, potency, aggregation, and manufacturing cost of antibodies can be major hindrances in translation to the clinic. The compositions and methods detailed herein may overcome these limitations and facilitate the use of protein therapeutics for clinical use. The fusion proteins may allow for the treatment of disease by effectively delivering binding polypeptides so they may associate with their target to treat the disease. The fusion proteins may also be used to detect a target, detect or diagnose disease, and/or determine the efficacy of a treatment.
1. Definitions
[0022] The terms "comprise(s)," "include(s)," "having," "has," "can," "contain(s)," and variants thereof, as used herein, are intended to be open-ended transitional phrases, terms, or words that do not preclude the possibility of additional acts or structures. The singular forms
"a," "and," and "the" include plural references unless the context clearly dictates otherwise. The present disclosure also contemplates other embodiments "comprising," "consisting of," and "consisting essentially of," the embodiments or elements presented herein, whether explicitly set forth or not.
[0023] For the recitation of numeric ranges herein, each intervening number there between with the same degree of precision is explicitly contemplated. For example, for the range of 6-9, the numbers 7 and 8 are contemplated in addition to 6 and 9, and for the range 6.0-7.0, the number 6.0, 6.1 , 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8, 6.9, and 7.0 are explicitly contemplated.
[0024] Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art. In case of conflict, the present document, including definitions, will control. Preferred methods and materials are described below, although methods and materials similar or equivalent to those described herein can be used in practice or testing of the present invention. All publications, patent applications, patents and other references mentioned herein are incorporated by reference in their entirety. The materials, methods, and examples disclosed herein are illustrative only and not intended to be limiting.
[0025] The term "about" as used herein as applied to one or more values of interest, refers to a value that is similar to a stated reference value. In certain aspects, the term "about" refers to a range of values that fall within 20%, 19%, 18%, 17%, 16%, 15%, 14%, 13%, 12%, 1 1 %, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1 %, or less in either direction (greater than or less than) of the stated reference value unless otherwise stated or otherwise evident from the context (except where such number would exceed 100% of a possible value).
[0026] "Affinity" refers to the binding strength of a binding polypeptide to its target (i.e., binding partner).
[0027] "Agonist" refers to an entity that binds to a receptor and activates the receptor to produce a biological response. An "antagonist" blocks or inhibits the action or signaling of the agonist. An "inverse agonist" causes an action opposite to that of the agonist. The activities of agonists, antagonists, and inverse agonists may be determined in vitro, in situ, in vivo, or a combination thereof.
[0028] "Amino acid" as used herein refers to naturally occurring and non-natural synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function in a manner similar to the naturally occurring amino acids. Naturally occurring amino acids are those encoded by the genetic code. Amino acids can be referred to herein by either their commonly known three-letter symbols or by the one-letter symbols recommended by the lUPAC-IUB Biochemical Nomenclature Commission. Amino acids include the side chain and polypeptide backbone portions.
[0029] As used herein, the term "biomarker" refers to a naturally occurring biological molecule present in a subject at varying concentrations that is useful in identifying and/or classifying a disease or a condition. The biomarker can include genes, proteins, polynucleotides, nucleic acids, ribonucleic acids, polypeptides, or other biological molecules used as an indicator or marker for disease. In some embodiments, the biomarker comprises a disease marker. For example, the biomarker can be a gene that is upregulated or downregulated in a subject that has a disease. As another example, the biomarker can be a polypeptide whose level is increased or decreased in a subject that has a disease or risk of developing a disease. In some embodiments, the biomarker comprises a small molecule. In some embodiments, the biomarker comprises a polypeptide.
[0030] The terms "control," "reference level," and "reference" are used herein interchangeably. The reference level may be a predetermined value or range, which is employed as a benchmark against which to assess the measured result. "Control group" as used herein refers to a group of control subjects. The predetermined level may be a cutoff value from a control group. The predetermined level may be an average from a control group. Cutoff values (or predetermined cutoff values) may be determined by Adaptive Index Model (AIM) methodology. Cutoff values (or predetermined cutoff values) may be determined by a receiver operating curve (ROC) analysis from biological samples of the patient group. ROC analysis, as generally known in the biological arts, is a determination of the ability of a test to discriminate one condition from another, e.g., to determine the performance of each marker in identifying a patient having CRC. A description of ROC analysis is provided in P.J. Heagerty et al. (Biometrics 2000, 56, 337-44), the disclosure of which is hereby incorporated by reference in its entirety. Alternatively, cutoff values may be determined by a quartile analysis of biological samples of a patient group. For example, a cutoff value may be determined by selecting a value that corresponds to any value in the 25th-75th percentile range, preferably a value that corresponds to the 25th percentile, the 50th percentile or the 75th percentile, and more
preferably the 75th percentile. Such statistical analyses may be performed using any method known in the art and can be implemented through any number of commercially available software packages (e.g., from Analyse-it Software Ltd., Leeds, UK; StataCorp LP, College Station, TX; SAS Institute Inc., Cary, NC). The healthy or normal levels or ranges for a target or for a protein activity may be defined in accordance with standard practice.
[0031] The term "expression vector" indicates a plasmid, a virus or another medium, known in the art, into which a nucleic acid sequence for encoding a desired protein can be inserted or introduced.
[0032] The term "host cell" is a cell that is susceptible to transformation, transfection, transduction, conjugation, and the like with a nucleic acid construct or expression vector. Host cells can be derived from plants, bacteria, yeast, fungi, insects, animals, etc. In some embodiments, the host cell includes Escherichia coli.
[0033] "Polymer" as used herein is intended to encompass a homopolymer, heteropolymer, block polymer, co-polymer, ter-polymer, etc., and blends, combinations and mixtures thereof. Examples of polymers include, but are not limited to, functionalized polymers, such as a polymer comprising 5-vinyltetrazole monomer units and having a molecular weight distribution less than 2.0. The polymer may be or contain one or more of a star block copolymer, a linear polymer, a branched polymer, a hyperbranched polymer, a dendritic polymer, a comb polymer, a graft polymer, a brush polymer, a bottle-brush copolymer and a crosslinked structure, such as a block copolymer comprising a block of 5-vinyltetrazole monomer units. Polymers include, without limitation, polyesters, poly(meth)acrylamides, poly(meth)acrylates, polyethers, polystyrenes, polynorbornenes and monomers that have unsaturated bonds. For example, amphiphilic comb polymers are described in U.S. Patent Application Publication No. 2007/0087114 and in U.S. Patent No. 6,207,749 to Mayes et al., the disclosure of each of which is herein incorporated by reference in its entirety. The amphiphilic comb-type polymers may be present in the form of copolymers, containing a backbone formed of a hydrophobic, water- insoluble polymer and side chains formed of short, hydrophilic non-cell binding polymers. Examples of other polymers include, but are not limited to, polyalkylenes such as polyethylene and polypropylene; polychloroprene; polyvinyl ethers; such as polyvinyl acetate); polyvinyl halides such as polyvinyl chloride); polysiloxanes; polystyrenes; polyurethanes; polyacrylates; such as poly(methyl (meth)acrylate), poly(ethyl (meth)acrylate), poly(n-butyl(meth)acrylate), poly(isobutyl (meth)acrylate), poly(tert-butyl (meth)acrylate), poly(hexyl(meth)acrylate),
poly(isodecyl (meth)acrylate), poly(lauryl (meth)acrylate), poly(phenyl (meth)acrylate), poly(methyl acrylate), poly(isopropyl acrylate), poly(isobutyl acrylate), and poly(octadecyl acrylate); polyacrylamides such as poly(acrylamide), poly(methacrylamide), poly(ethyl acrylamide), poly(ethyl methacrylamide), poly(N-isopropyl acrylamide), poly(n, iso, and tert-butyl acrylamide); and copolymers and mixtures thereof. These polymers may include useful derivatives, including polymers having substitutions, additions of chemical groups, for example, alkyl groups, alkylene groups, hydroxylations, oxidations, and other modifications routinely made by those skilled in the art. The polymers may include zwitterionic polymers such as, for example, polyphosphorycholine, polycarboxybetaine, and polysulfobetaine. The polymers may have side chains of betaine, carboxybetaine, sulfobetaine, oligoethylene glycol (OEG), sarcosine or polyethyleneglycol (PEG). For example, poly(oligoethyleneglycol methacrylate) (poly(OEGMA)) may be used. Poly(OEGMA) may be hydrophilic, water-soluble, non-fouling, non-toxic and non-immunogenic due to the OEG side chains.
[0034] "Polynucleotide" as used herein can be single stranded or double stranded, or can contain portions of both double stranded and single stranded sequence. The polynucleotide can be nucleic acid, natural or synthetic, DNA, genomic DNA, cDNA, RNA, or a hybrid, where the polynucleotide can contain combinations of deoxyribo- and ribo-nucleotides, and combinations of bases including uracil, adenine, thymine, cytosine, guanine, inosine, xanthine hypoxanthine, isocytosine, and isoguanine. Polynucleotides can be obtained by chemical synthesis methods or by recombinant methods.
[0035] A "peptide" or "polypeptide" is a linked sequence of two or more amino acids linked by peptide bonds. The polypeptide can be natural, synthetic, or a modification or combination of natural and synthetic. Peptides and polypeptides include proteins such as binding proteins, receptors, and antibodies. The terms "polypeptide", "protein," and "peptide" are used interchangeably herein. "Primary structure" refers to the amino acid sequence of a particular peptide. "Secondary structure" refers to locally ordered, three dimensional structures within a polypeptide. These structures are commonly known as domains, e.g., enzymatic domains, extracellular domains, transmembrane domains, pore domains, and cytoplasmic tail domains. Domains are portions of a polypeptide that form a compact unit of the polypeptide and are typically 15 to 350 amino acids long. Exemplary domains include domains with enzymatic activity or ligand binding activity. Typical domains are made up of sections of lesser organization such as stretches of beta-sheet and alpha-helices. "Tertiary structure" refers to the complete
three dimensional structure of a polypeptide monomer. "Quaternary structure" refers to the three dimensional structure formed by the noncovalent association of independent tertiary units.
[0036] "Reporter," "reporter group," "label," and "detectable label" are used interchangeably herein. The reporter is capable of generating a detectable signal. The label can produce a signal that is detectable by visual or instrumental means. A variety of reporter groups can be used, differing in the physical nature of signal transduction (e.g., fluorescence, electrochemical, nuclear magnetic resonance (NMR), and electron paramagnetic resonance (EPR)) and in the chemical nature of the reporter group. Various reporters include signal-producing substances, such as chromagens, fluorescent compounds, chemiluminescent compounds, radioactive compounds, and the like. In some embodiments, the reporter comprises a radiolabel. Reporters may include moieties that produce light, e.g., acridinium compounds, and moieties that produce fluorescence, e.g., fluorescein. In some embodiments, the signal from the reporter is a fluorescent signal. The reporter may comprise a fluorophore. Examples of fluorophores include, but are not limited to, acrylodan (6-acryloy 1-2-dimethylaminonaphthalene), badan (6- bromo-acetyl-2-dimethylamino-naphthalene), rhodamine, naphthalene, danzyl aziridine, 4-[N- [(2-iodoacetoxy)ethyl]-N-methylamino]-7-nitrobenz-2-oxa-1 ,3-diazole ester (IANBDE), 4-[N-[(2- iodoacetoxy)ethyl]-N-methylamino-7-nitrobenz-2-oxa-1 ,3-diazole (IANBDA), fluorescein, dipyrrometheneboron difluoride (BODIPY), 4-nitrobenzo[c][1 ,2,5]oxadiazole (NBD), Alexa fluorescent dyes, and derivatives thereof. Fluorescein derivatives may include, for example, 5- fluorescein, 6-carboxyfluorescein, 3'6-carboxyfluorescein, 5(6)-carboxyfluorescein, 6- hexachlorofluorescein, 6-tetrachlorofluorescein, fluorescein, and isothiocyanate.
[0037] "Sample" or "test sample" as used herein can mean any sample in which the presence and/or level of a target is to be detected or determined. Samples may include liquids, solutions, emulsions, or suspensions. Samples may include a medical sample. Samples may include any biological fluid or tissue, such as blood, whole blood, fractions of blood such as plasma and serum, muscle, interstitial fluid, sweat, saliva, urine, tears, synovial fluid, bone marrow, cerebrospinal fluid, nasal secretions, sputum, amniotic fluid, bronchoalveolar lavage fluid, gastric lavage, emesis, fecal matter, lung tissue, peripheral blood mononuclear cells, total white blood cells, lymph node cells, spleen cells, tonsil cells, cancer cells, tumor cells, bile, digestive fluid, skin, or combinations thereof. In some embodiments, the sample comprises an aliquot. In other embodiments, the sample comprises a biological fluid. Samples can be obtained by any means known in the art. The sample can be used directly as obtained from a patient or can be pre-treated, such as by filtration, distillation, extraction, concentration,
centrifugation, inactivation of interfering components, addition of reagents, and the like, to modify the character of the sample in some manner as discussed herein or otherwise as is known in the art.
[0038] The term "sensitivity" as used herein refers to the number of true positives divided by the number of true positives plus the number of false negatives, where sensitivity ("sens") may be within the range of 0<sens<1. Ideally, method embodiments herein have the number of false negatives equaling zero or close to equaling zero, so that no subject is wrongly identified as not having a disease when they indeed have the disease. Conversely, an assessment often is made of the ability of a prediction algorithm to classify negatives correctly, a complementary measurement to sensitivity.
[0039] The term "specificity" as used herein refers to the number of true negatives divided by the number of true negatives plus the number of false positives, where specificity ("spec") may be within the range of 0<spec<1. Ideally, the methods described herein have the number of false positives equaling zero or close to equaling zero, so that no subject is wrongly identified as having a disease when they do not in fact have disease. Hence, a method that has both sensitivity and specificity equaling one, or 100%, is preferred.
[0040] By "specifically binds," it is generally meant that a polypeptide binds to a target when it binds to that target more readily than it would bind to a random, unrelated target.
[0041] "Subject" as used herein can mean a mammal that wants or is in need of the herein described fusion proteins. The subject may be a human or a non-human animal. The subject may be a mammal. The mammal may be a primate or a non-primate. The mammal can be a primate such as a human; a non-primate such as, for example, dog, cat, horse, cow, pig, mouse, rat, camel, llama, goat, rabbit, sheep, hamster, and guinea pig; or non-human primate such as, for example, monkey, chimpanzee, gorilla, orangutan, and gibbon. The subject may be of any age or stage of development, such as, for example, an adult, an adolescent, or an infant.
[0042] "Transition" or "phase transition" refers to the aggregation of the thermally responsive polypeptides. Phase transition occurs sharply and reversibly at a specific temperature called the lower critical solution temperature (LCST) or the inverse transition temperature T^. Below the transition temperature, the thermally responsive polypeptide (or a polypeptide comprising a thermally responsive polypeptide) is highly soluble. Upon heating past the transition
temperature, the thermally responsive polypeptides hydrophobically collapse and aggregate, forming a separate, gel-like phase. "Inverse transition cycling" refers to a protein purification method for thermally responsive polypeptides (or a polypeptide comprising a thermally responsive polypeptide). The protein purification method may involve the use of thermally responsive polypeptide's reversible phase transition behavior to cycle the solution through soluble and insoluble phases, thereby removing contaminants.
[0043] "Treatment" or "treating," when referring to protection of a subject from a disease, means preventing, suppressing, repressing, ameliorating, or completely eliminating the disease. Preventing the disease involves administering a composition of the present invention to a subject prior to onset of the disease. Suppressing the disease involves administering a composition of the present invention to a subject after induction of the disease but before its clinical appearance. Repressing or ameliorating the disease involves administering a composition of the present invention to a subject after clinical appearance of the disease.
[0044] "Substantially identical" can mean that a first and second amino acid sequence are at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% over a region of 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 , 22, 23, 24, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1100 amino acids.
[0045] "Valency" as used herein refers to the potential binding units or binding sites. The term "multivalent" refers to multiple potential binding units. The terms "multimeric" and "multivalent" are used interchangeably herein.
[0046] "Variant" used herein with respect to a polynucleotide means (i) a portion or fragment of a referenced nucleotide sequence; (ii) the complement of a referenced nucleotide sequence or portion thereof; (iii) a polynucleotide that is substantially identical to a referenced polynucleotide or the complement thereof; or (iv) a polynucleotide that hybridizes under stringent conditions to the referenced polynucleotide, complement thereof, or a sequences substantially identical thereto.
[0047] A "variant" can further be defined as a peptide or polypeptide that differs in amino acid sequence by the insertion, deletion, or conservative substitution of amino acids, but retain at least one biological activity. Representative examples of "biological activity" include the ability to be bound by a specific antibody or polypeptide or to promote an immune response.
Variant can mean a substantially identical sequence. Variant can mean a functional fragment thereof. Variant can also mean multiple copies of a polypeptide. The multiple copies can be in tandem or separated by a linker. Variant can also mean a polypeptide with an amino acid sequence that is substantially identical to a referenced polypeptide with an amino acid sequence that retains at least one biological activity. A conservative substitution of an amino acid, i.e., replacing an amino acid with a different amino acid of similar properties (e.g., hydrophilicity, degree and distribution of charged regions) is recognized in the art as typically involving a minor change. These minor changes can be identified, in part, by considering the hydropathic index of amino acids. See Kyte et al., J. Mol. Biol. 1982, 757, 105-132. The hydropathic index of an amino acid is based on a consideration of its hydrophobicity and charge. It is known in the art that amino acids of similar hydropathic indexes can be substituted and still retain protein function. In one aspect, amino acids having hydropathic indices of ±2 are substituted. The hydrophobicity of amino acids can also be used to reveal substitutions that would result in polypeptides retaining biological function. A consideration of the hydrophilicity of amino acids in the context of a polypeptide permits calculation of the greatest local average hydrophilicity of that polypeptide, a useful measure that has been reported to correlate well with antigenicity and immunogenicity, as discussed in U.S. Patent No. 4,554,101 , which is fully incorporated herein by reference. Substitution of amino acids having similar hydrophilicity values can result in polypeptides retaining biological activity, for example immunogenicity, as is understood in the art. Substitutions can be performed with amino acids having hydrophilicity values within ±2 of each other. Both the hydrophobicity index and the hydrophilicity value of amino acids are influenced by the particular side chain of that amino acid. Consistent with that observation, amino acid substitutions that are compatible with biological function are understood to depend on the relative similarity of the amino acids, and particularly the side chains of those amino acids, as revealed by the hydrophobicity, hydrophilicity, charge, size, and other properties.
[0048] A variant can be a polynucleotide sequence that is substantially identical over the full length of the full gene sequence or a fragment thereof. The polynucleotide sequence can be 80%, 81 %, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical over the full length of the gene sequence or a fragment thereof. A variant can be an amino acid sequence that is substantially identical over the full length of the amino acid sequence or fragment thereof. The amino acid sequence can be 80%, 81 %, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%,
97%, 98%, 99%, or 100% identical over the full length of the amino acid sequence or a fragment thereof.
2. Fusion Protein
[0049] The fusion protein includes at least one binding polypeptide and at least one unstructured polypeptide. The fusion protein may further include at least one linker.
[0050] In some embodiments, the fusion protein includes more than one binding polypeptide. The fusion protein may include at least 1 , at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 1 1 , at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, or at least 20 binding polypeptides. The fusion protein may include less than 30, less than 25, or less than 20 binding polypeptides. The fusion protein may include between 1 and 30, between 1 and 20, or between 1 and 10 binding polypeptides. In such embodiments, the binding polypeptides may be the same or different from one another. In some embodiments, the fusion protein includes more than one binding polypeptide positioned in tandem to one another. In some embodiments, the fusion protein includes 2 to 6 binding polypeptides. In some embodiments, the fusion protein includes two binding polypeptides. In some embodiments, the fusion protein includes three binding polypeptides. In some embodiments, the fusion protein includes four binding polypeptides. In some embodiments, the fusion protein includes five binding polypeptides. In some embodiments, the fusion protein includes six binding polypeptides.
[0051] In some embodiments, the fusion protein includes more than one unstructured polypeptide. The fusion protein may include at least 1 , at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 1 1 , at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, or at least 20 unstructured polypeptides. The fusion protein may include less than 30, less than 25, or less than 20 unstructured polypeptides. The fusion protein may include between 1 and 30, between 1 and 20, or between 1 and 10 unstructured polypeptides. In such embodiments, the unstructured polypeptides may be the same or different from one another. In some embodiments, the fusion protein includes more than one unstructured polypeptide positioned in tandem to one another.
[0052] In some embodiments, the fusion protein may be arranged as a modular linear polypeptide. For example, the modular linear polypeptide may be arranged in one of the following structures: [binding polypeptide]m— [linker]^— [unstructured polypeptide]; [unstructured
polypeptide]— [linker]^— [binding polypeptide]m; [binding polypeptide]m— [linker]^—
[unstructured polypeptide]— [binding polypeptide]m— [linker]^— [unstructured polypeptide]; or
[unstructured polypeptide]— [binding polypeptide]m— [linker]^— [unstructured polypeptide]—
[binding polypeptide]m, in which k and m are each independently an integer greater than or equal to 1. In some embodiments, m is an integer less than or equal to 20. In some embodiments, m is an integer equal to 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, 15, 16, 17, 18, 19, or 20. In some embodiments, k is an integer less than or equal to 10. In some embodiments, k is an integer equal to 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 10. In some embodiments, the at least one binding polypeptide is positioned N-terminal to the at least one unstructured polypeptide. In some embodiments, the at least one binding polypeptide is positioned C- terminal to the at least one unstructured polypeptide.
[0053] The fusion protein may be expressed recombinantly in a host cell according to one of skill in the art. The fusion protein may be purified by any means known to one of skill in the art. For example, the fusion protein may be purified using chromatography, such as liquid chromatography, size exclusion chromatography, or affinity chromatography, or a combination thereof. In some embodiments, the fusion protein is purified without chromatography. In some embodiments, the fusion protein is purified using inverse transition cycling.
[0054] In some embodiments, the fusion protein comprises a plurality of binding polypeptides comprising Tn3 domains (SEQ ID NO: 1 or 2), linked to one another with flexible glycine serine linkers (SEQ ID NO: 3), and an unstructured polypeptide comprising elastin-like polypeptide (FIG. 1). a. Binding Polypeptide
[0055] The binding polypeptide may comprise any polypeptide that is capable of binding at least one target. The binding polypeptide may bind at least one target. "Target" may be an entity capable of being bound by the binding polypeptide. Targets may include, for example, another polypeptide, a cell surface receptor, a carbohydrate, an antibody, a small molecule, or a combination thereof. The target may be a biomarker. The target may be activated through agonism or blocked through antagonism. The binding polypeptide may specifically bind the target. By binding target, the binding polypeptide may act as a targeting moiety, an agonist, an antagonist, or a combination thereof. In some embodiments, the binding polypeptide domain binds TRAILR-2. "TRAIL receptor 2" or "TRAILR-2" refers to the TNF-Related Apoptosis-
Inducing Ligand (TRAIL) Receptor 2 protein. Upon binding TRAIL or other agonists, TRAILR-2 activates apoptosis, or programmed cell death, in tumor cells. In some embodiments, the binding polypeptide domain binds epidermal growth factor receptor (EGFR). Upon binding epidermal growth factor (EGF) and other growth factor ligands, EGFR activates signal transduction pathways that promote cell proliferation.
[0056] The binding polypeptide may be a monomer that binds to a target. The monomer may bind one or more targets. The binding polypeptide may form an oligomer. The binding polypeptide may form an oligomer with the same or different binding polypeptides. The oligomer may bind to a target. The oligomer may bind one or more targets. One or more monomers within an oligomer may bind one or more targets. In some embodiments, the fusion protein is multivalent. In some embodiments, the fusion protein binds multiple targets. In some embodiments, the activity of the binding polypeptide alone is the same as the activity of the binding protein when part of a fusion protein.
[0057] In some embodiments, the binding polypeptide comprises an amino acid sequence consisting of Arg-Gly-Asp-Ser (RGDS; SEQ ID NO: 17). In some embodiments, the binding polypeptide comprises a plurality of amino acid sequences consisting of SEQ ID NO: 17. The amino acid sequence of SEQ ID NO: 17 may be present anywhere within the binding polypeptide. In some embodiments, the amino acid sequence of SEQ ID NO: 17 may be repeated in tandem within the binding polypeptide.
[0058] In some embodiments, the binding polypeptide comprises one or more scaffold proteins. As used herein, "scaffold protein" refers to one or more polypeptide domains with relatively stable and defined three-dimensional structures. Scaffold proteins may further have the capacity for affinity engineering. In some embodiments, the scaffold protein has been engineered to bind a particular target. The scaffold proteins may be the same or different.
[0059] In some embodiments, the scaffold protein comprises a fibronectin domain. Fibronectin is a high-molecular weight glycoprotein of the extracellular matrix that binds to membrane-spanning receptor proteins called integrins. Fibronectin binds extracellular matrix components such as collagen, fibrin, and heparan sulfate proteoglycans. Human fibronectin exists as a protein dimer, comprising two nearly identical polypeptide chains linked by a pair of C-terminal disulfide bonds. Each human fibronectin subunit contains three domains: type I, II, and III. Fibronectin type III (Fnlll) refers to the third of the three types of internal repeats in
human fibronectin. This domain is often referred to as a scaffold protein because it contains three CDR-like (complementarity determining region) loops that can be engineered to bind a protein of interest using molecular biology techniques. In some embodiments, the fibronectin domain comprises Tn3. "Tn3" or "Tn3 scaffold" refers to an Fnlll domain from human tenascin C. Tn3 may comprise an amino acid sequence consisting of SEQ ID NO: 1 or 2. In some embodiments, Tn3 binds TRAIL receptor 2. The binding polypeptide may comprise one or more scaffold proteins further selected from, for example, alphahelical Z domain of protein A, anti- EGFR binding protein, DARPINS, knottins, and scFvs. b. Unstructured Polypeptide
[0060] The unstructured polypeptide may comprise any polypeptide that has minimal or no secondary structure as observed by CD, being soluble at a temperature below its lower critical solution temperature (LCST) and/or at a temperature above its upper critical solution temperature (UCST), and comprising a repeated amino acid sequence. LCST is the temperature below which the polypeptide is miscible. UCST is the temperature above which the polypeptide is miscible. In some embodiments, the unstructured polypeptide has only UCST behavior. In some embodiments, the unstructured polypeptide has only LCST behavior. In some embodiments, the unstructured polypeptide has both UCST and LCST behavior. The unstructured polypeptide may comprise a repeated sequence of amino acids. The unstructured polypeptide may have a LCST between about 0°C and about 100°C, between about 10°C and about 50°C, or between about 20°C and about 42°C. The unstructured polypeptide may have a UCST between about 0°C and about 100°C, between about 10°C and about 50°C, or between about 20°C and about 42°C. In some embodiments, the unstructured polypeptide has a transition temperature between room temperature (about 25°C) and body temperature (about 37°C). In some embodiments, a fusion protein comprising one or more thermally responsive polypeptides has a transition temperature between room temperature (about 25°C) and body temperature (about 37°C). In some embodiments, the unstructured polypeptide has no LCST or UCST behavior. The unstructured polypeptide may have its LCST or UCST below body temperature or above body temperature at the concentration at which the fusion protein is administered to a subject.
[0061] In some embodiments, the unstructured polypeptide comprises an amino acid sequence that is rich in proline and glycine. In some embodiments, the unstructured polypeptide comprises a PG motif. In some embodiments, the unstructured polypeptide
comprises a plurality of or repeated PG motifs. A PG motif comprises an amino acid sequence selected from PG, P(X)nG (SEQ ID NO: 18), and (U)mP(X)nG(Z)p (SEQ ID NO: 20), or a combination thereof, wherein m, n, and p are independently an integer from 1 to 15, and wherein U, X, and Z are independently any amino acid. P(X)nG may include PXG, PXXG,
PXXXG, PXXXXG, PXXXXXG, PXXXXXXG, PXXXXXXXG, PXXXXXXXXG, PXXXXXXXXXG, PXXXXXXXXXXG, PXXXXXXXXXXXG, PXXXXXXXXXXXXG, PXXXXXXXXXXXXXG, PXXXXXXXXXXXXXXG, and/or PXXXXXXXXXXXXXXXG. The unstructured polypeptide may further include additional amino acids at the C-terminal and/or N-terminal end of the PG motif. These amino acids surrounding the PG motif may also be part of the overall repeated motif. The amino acids that surround the PG motif may balance the overall hydrophobicity and/or charge so as to control the LCST or UCST behavior of the unstructured polypeptide.
[0062] In some embodiments, the unstructured polypeptide comprises one or more thermally responsive polypeptides. Thermally responsive polypeptides may include, for example, elastin-like polypeptides (ELP). "ELP" refers to a polypeptide comprising the pentapeptide repeat sequence (VPGXG)n, wherein X is any amino acid except proline and n is an integer greater than or equal to 1 (SEQ ID NO: 19). The unstructured polypeptide may comprise an amino acid sequence consisting of (VPGXG)n. In some embodiments, X is not proline. In some embodiments, n is 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 260, 270, 280, 290, or 300. In some embodiments, n may be less than 500, less than 400, less than 300, less than 200, or less than 100. In some embodiments, n may be between 1 and 500, between 1 and 400, between 1 and 300, or between 1 and 200. In some embodiments, n is 60, 120, or 180. ELP may be expressed recombinantly.
[0063] Thermally responsive polypeptides, for example, ELP, may have a phase transition. The thermally responsive polypeptide may impart a phase transition characteristic to the unstructured polypeptide and/or fusion protein. "Phase transition" or "transition" may refer to the aggregation of the thermally responsive polypeptide, which occurs sharply and reversibly at a specific temperature called the lower critical solution temperature (LCST) or the inverse transition temperature (Tt). Below the transition temperature (LCST or Tt), the thermally responsive polypeptides (or polypeptides comprising a thermally responsive polypeptide) may be highly soluble. Upon heating above the transition temperature, thermally responsive polypeptides hydrophobically may collapse and aggregate, forming a separate, gel-like phase.
[0064] In other embodiments, the thermally responsive polypeptide comprises a resilin-like polypeptide (RLP). RLPs are derived from Rec1-resilin. Rec1-resilin is environmentally responsive and exhibits a dual phase transition behavior. The thermally responsive RLPs can have LCST and UCST (Li et. al, Macromol. Rapid Commun. 2015, 36, 90-95.) Additional examples of suitable thermally responsive polypeptides are described in U.S. Patent Application Publication Nos. US2012/0121709, filed May 17, 2012, and US2015/0112022, filed April 23, 2015, each of which is incorporated herein by reference.
[0065] The thermally responsive polypeptides can phase transition at a variety of temperatures and concentrations. Thermally responsive polypeptides, for example, ELP, may not affect the binding or potency of the binding polypeptides. Thermally responsive polypeptides may allow the fusion protein to be tuned by a user to any number of desired transition temperatures, molecular weights, and formats.
[0066] Thermally responsive polypeptides may exhibit inverse phase transition behavior and thus, the fusion protein comprising the thermally responsive polypeptide may exhibit inverse phase transition behavior. Inverse phase transition behavior may be used to form drug depots within a tissue of a subject for controlled (slow) release of the fusion protein. Inverse phase transition behavior may also enable purification of the fusion protein using inverse transition cycling, thereby eliminating the need for chromatography. c. Linker
[0067] In some embodiments, the fusion protein further includes at least one linker. In some embodiments, the fusion protein includes more than one linker. In such embodiments, the linkers may be the same or different from one another. The fusion protein may include at least 1 , at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 1 1 , at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, at least 20, at least 25, at least 30, at least 35, at least 40, at least 45, at least 50, at least 55, at least 60, at least 65, at least 70, at least 75, at least 80, at least 85, at least 90, at least 95, or at least 100 linkers. The fusion protein may include less than 500, less than 400, less than 300, or less than 200 linkers. The fusion protein may include between 1 and 1000, between 10 and 900, between 10 and 800, or between 5 and 500 linkers.
[0068] The linker may be positioned in between a binding polypeptide and an unstructured polypeptide, in between binding polypeptides, in between unstructured polypeptides, or a
combination thereof. Multiple linkers may be positioned adjacent to one another. Multiple linkers may be positioned adjacent to one another and in between the binding polypeptide and the unstructured polypeptide.
[0069] The linker may be a polypeptide of any amino acid sequence and length. The linker may act as a spacer peptide. The linker may occur between polypeptide domains. The linker may sufficiently separate the binding domains of the binding polypeptide while preserving the activity of the binding domains. In some embodiments, the linker comprises charged amino acids. In some embodiments, the linker is flexible. In some embodiments, the linker comprises at least one glycine and at least one serine. In some embodiments, the linker comprises an amino acid sequence consisting of (Gly4Ser)3 (SEQ ID NO: 3). In some embodiments, the linker comprises at least one proline. In some embodiments, the linker comprises an amino acid sequence consisting of SEQ ID NO: 4.
3. Polynucleotides
[0070] Further provided are polynucleotides encoding the fusion proteins detailed herein. A vector may include the polynucleotide encoding the fusion proteins detailed herein. To obtain expression of a polypeptide, one typically subclones the polynucleotide encoding the polypeptide into an expression vector that contains a promoter to direct transcription, a transcription/translation terminator, and if for a nucleic acid encoding a protein, a ribosome binding site for translational initiation. An example of a vector is pet24 (SEQ ID NO: 12). Suitable bacterial promoters are well known in the art. Further provided is a host cell transformed or transfected with an expression vector comprising a polynucleotide encoding a fusion protein as detailed herein. Bacterial expression systems for expressing the protein are available in, e.g., E. coli, Bacillus sp., and Salmonella (Paiva et al., Gene 1983, 22, 229-235; Mosbach et al., Nature 1983, 302, 543-545). Kits for such expression systems are commercially available. Eukaryotic expression systems for mammalian cells, yeast, and insect cells are well known in the art and are also commercially available. Retroviral expression systems can be used in the present invention. In some embodiments, the fusion protein comprises a polypeptide comprising an amino acid sequence of any one of SEQ ID NOs: 1-11 and 17-19. In some embodiments, the fusion protein comprises a polypeptide encoded by a polynucleotide sequence of any one of SEQ ID NOs: 13-14.
4. Administration
[0071] The fusion proteins as detailed above can be formulated in accordance with standard techniques well known to those skilled in the pharmaceutical art. Such compositions comprising a fusion protein can be administered in dosages and by techniques well known to those skilled in the medical arts taking into consideration such factors as the age, sex, weight, and condition of the particular subject, and the route of administration.
[0072] The fusion protein can be administered prophylactically or therapeutically. In prophylactic administration, the fusion protein can be administered in an amount sufficient to induce a response. In therapeutic applications, the fusion proteins are administered to a subject in need thereof in an amount sufficient to elicit a therapeutic effect. An amount adequate to accomplish this is defined as "therapeutically effective dose." Amounts effective for this use will depend on, e.g., the particular composition of the fusion protein regimen administered, the manner of administration, the stage and severity of the disease, the general state of health of the patient, and the judgment of the prescribing physician.
[0073] The fusion protein can be administered by methods well known in the art as described in Donnelly et al. {Ann. Rev. Immunol. 1997, 75, 617-648); Feigner et al. (U.S. Patent No. 5,580,859, issued Dec. 3, 1996); Feigner (U.S. Patent No. 5,703,055, issued Dec. 30, 1997); and Carson et al. (U.S. Patent No. 5,679,647, issued Oct. 21 , 1997), the contents of all of which are incorporated herein by reference in their entirety. The fusion protein can be complexed to particles or beads that can be administered to an individual, for example, using a vaccine gun. One skilled in the art would know that the choice of a pharmaceutically acceptable carrier, including a physiologically acceptable compound, depends, for example, on the route of administration.
[0074] The fusion proteins can be delivered via a variety of routes. Typical delivery routes include parenteral administration, e.g., intradermal, intramuscular or subcutaneous delivery. Other routes include oral administration, intranasal, intravaginal, transdermal, intravenous, intraarterial, intratumoral, intraperitoneal, and epidermal routes. In some embodiments, the fusion protein is administered intravenously, intraarterially, or intraperitoneally to the subject.
[0075] The fusion protein can be a liquid preparation such as a suspension, syrup, or elixir. The fusion protein can be incorporated into liposomes, microspheres, or other polymer matrices (such as by a method described in Feigner et al., U.S. Patent No. 5,703,055; Gregoriadis,
Liposome Technology, Vols. I to III (2nd ed. 1993), the contents of which are incorporated herein by reference in their entirety). Liposomes can consist of phospholipids or other lipids, and can be nontoxic, physiologically acceptable and metabolizable carriers that are relatively simple to make and administer.
[0076] The fusion protein may be used as a vaccine. The vaccine can be administered via electroporation, such as by a method described in U.S. Patent No. 7,664,545, the contents of which are incorporated herein by reference. The electroporation can be by a method and/or apparatus described in U.S. Patent Nos. 6,302,874; 5,676,646; 6,241 ,701 ; 6,233,482; 6,216,034; 6,208,893; 6, 192,270; 6, 181 ,964; 6, 150, 148; 6, 120,493; 6,096,020; 6,068,650; and 5,702,359, the contents of which are incorporated herein by reference in their entirety. The electroporation can be carried out via a minimally invasive device.
[0077] In some embodiments, the fusion protein is administered in a controlled release formulation. In some embodiments, the fusion protein comprises one or more thermally responsive polypeptides, the thermally responsive polypeptide having a transition temperature such that the fusion protein remains soluble prior to administration and such that the fusion protein transitions upon administration to a gel-like depot in the subject. In some embodiments, the fusion protein comprises one or more thermally responsive polypeptides, the thermally responsive polypeptide having a transition temperature such that the fusion protein remains soluble at room temperature and such that the fusion protein transitions upon administration to a gel-like depot in the subject. For example, in some embodiments, the fusion protein comprises one or more thermally responsive polypeptides, the thermally responsive polypeptide having a transition temperature between room temperature (about 25°C) and body temperature (about 37°C), whereby the fusion protein can be administered to form a depot. As used herein, "depot" refers to a gel-like composition comprising a fusion protein that releases the fusion protein over time. In some embodiments, the fusion protein can be injected subcutaneously or intratumorally to form a depot (coacervate). The depot may provide controlled (slow) release of the fusion protein. The depot may provide slow release of the fusion protein into the circulation or the tumor, for example. In some embodiments, the fusion protein may be released from the depot over a period of at least about 1 day, at least about 2 days, at least about 3 days, at least about 4 days, at least about 5 days, at least about 6 days, at least about 7 days, at least about 1 week, at least about 1.5 weeks, at least about 2 weeks, at least about 2.5 weeks, at least about 3.5 weeks, at least about 4 weeks, or at least about 1 month.
5. Detection
[0078] As used herein, the term "detect" or "determine the presence of" refers to the qualitative measurement of undetectable, low, normal, or high concentrations of one or more fusion proteins, targets, or fusion proteins bound to target. Detection may include in vitro, ex vivo, or in vivo detection. Detection may include detecting the presence of one or more fusion proteins or targets versus the absence of the one or more fusion proteins or targets. Detection may also include quantification of the level of one or more fusion proteins or targets. The term "quantify" or "quantification" may be used interchangeably, and may refer to a process of determining the quantity or abundance of a substance (e.g., fusion protein or target), whether relative or absolute. Any suitable method of detection falls within the general scope of the present disclosure. In some embodiments, the fusion protein comprises a reporter attached thereto for detection. In some embodiments, the fusion protein is labeled with a reporter. In some embodiments, detection of fusion protein bound to target may be determined by methods including but not limited to, band intensity on a Western blot, flow cytometry, radiolabel imaging, cell binding assays, activity assays, SPR, immunoassay, or by various other methods known in the art.
[0079] In some embodiments, including those wherein the fusion protein is an antibody mimic for binding and/or detecting a target, any immunoassay may be utilized. The immunoassay may be an enzyme-linked immunoassay (ELISA), radioimmunoassay (RIA), a competitive inhibition assay, such as forward or reverse competitive inhibition assays, a fluorescence polarization assay, or a competitive binding assay, for example. The ELISA may be a sandwich ELISA. Specific immunological binding of the fusion protein to the target can be detected via direct labels, attached to the fusion protein or via indirect labels, such as alkaline phosphatase or horseradish peroxidase. The use of immobilized fusion proteins may be incorporated into the immunoassay. The fusion proteins may be immobilized onto a variety of supports, such as magnetic or chromatographic matrix particles, the surface of an assay plate (such as microtiter wells), pieces of a solid substrate material, and the like. An assay strip can be prepared by coating the fusion protein or plurality of fusion proteins in an array on a solid support. This strip can then be dipped into the test biological sample and then processed quickly through washes and detection steps to generate a measurable signal, such as a colored spot.
6. Methods a. Methods of Treating a Disease
[0080] The present invention is directed to a method of treating a disease in a subject in need thereof. The method may comprise administering to the subject an effective amount of the fusion protein as described herein. The disease may be selected from cancer, metabolic disease, autoimmune disease, cardiovascular disease, and orthopedic disorders. In some embodiments, the disease is a disease associated with a target of the at least one binding polypeptide.
[0081] Metabolic disease may occur when abnormal chemical reactions in the body alter the normal metabolic process. Metabolic diseases may include, for example, insulin resistance, non-alcoholic fatty liver diseases, type 2 diabetes, insulin resistance diseases, cardiovascular diseases, arteriosclerosis, lipid-related metabolic disorders, hyperglycemia, hyperinsulinemia, hyperlipidemia, and glucose metabolic disorders.
[0082] Autoimmune diseases arise from an abnormal immune response of the body against substances and tissues normally present in the body. Autoimmune diseases may include, but are not limited to, lupus, rheumatoid arthritis, multiple sclerosis, insulin dependent diabetes mellitis, myasthenia gravis, Grave's disease, autoimmune hemolytic anemia, autoimmune thrombocytopenia purpura, Goodpasture's syndrome, pemphigus vulgaris, acute rheumatic fever, post-streptococcal glomerulonephritis, polyarteritis nodosa, myocarditis, psoriasis, Celiac disease, Crohn's disease, ulcerative colitis, and fibromyalgia.
[0083] Cardiovascular disease is a class of diseases that involve the heart or blood vessels. Cardiovascular diseases may include, for example, coronary artery diseases (CAD) such as angina and myocardial infarction (heart attack), stroke, hypertensive heart disease, rheumatic heart disease, cardiomyopathy, heart arrhythmia, congenital heart disease, valvular heart disease, carditis, aortic aneurysms, peripheral artery disease, and venous thrombosis.
[0084] Orthopedic disorders or musculoskeletal disorders are injuries or pain in the body's joints, ligaments, muscles, nerves, tendons, and structures that support limbs, neck, and back. Orthopedic disorders may include degenerative diseases and inflammatory conditions that cause pain and impair normal activities. Orthopedic disorders may include, for example, carpal tunnel syndrome, epicondylitis, and tendinitis.
[0085] Cancers may include, but are not limited to, breast cancer, colorectal cancer, colon cancer, lung cancer, prostate cancer, testicular cancer, brain cancer, skin cancer, rectal cancer, gastric cancer, esophageal cancer, sarcomas, tracheal cancer, head and neck cancer, pancreatic cancer, liver cancer, ovarian cancer, lymphoid cancer, cervical cancer, vulvar cancer, melanoma, mesothelioma, renal cancer, bladder cancer, thyroid cancer, bone cancers, carcinomas, sarcomas, and soft tissue cancers. In some embodiments, the cancer is colorectal cancer. In some embodiments, the cancer is colorectal adenocarcinoma.
[0086] One application of protein therapeutics is cancer treatment. In specific embodiments, the present invention provides a method for using scaffold proteins in developing antibody mimetics for oncological targets of interest. With the emergence of scaffold protein engineering come the possibilities for designing potent protein drugs that are unhindered by steric and architectural limitations. Although potent protein drugs can be invaluable for diagnostics or treatments, successful delivery to the target region can pose a great challenge.
[0087] TNF-related apoptosis-inducing ligand receptor 2 (TRAILR-2, also called R5) activates the extrinsic death pathway in a range of human cancer cells (Walczak, et al. Cold Spring Harb. Perspect. Biol., 2013, 5, a008698). TRAILR-2 may be targeted using its natural ligand, TNF-related apoptosis-inducing ligand (TRAIL, also called Apo2L), and other agonists. TRAIL is a homotrimer. TRAIL and other TRAILR-2 agonists may trigger programmed cell death (apoptosis). TRAIL and other TRAILR-2 agonists may have significant anti-tumor activity. However, TRAIL and other TRAILR-2 agonists have not been developed as a clinically efficacious treatment. A possible shortcoming of current TRAIL and other TRAILR-2 agonist therapies may be related to their limited valency. Upon binding of TRAILR-2 to homotrimeric TRAIL, the TRAILR-2 receptor trimerizes and subsequently initiates apoptotic cell death. However, current anti-TRAILR-2 mAbs are only bivalent. Indeed, higher order antibody crosslinking may be required for effective receptor engagement, clustering, and a robust antitumor response. Fusion proteins, as detailed herein, that bind multiple TRAILR-2 receptors may provide multivalent agonists capable of forming higher order complexes to treat cancer. Fnlll domain has been engineered to have high affinity binding to TRAILR-2. Fusion proteins, as detailed herein, comprising Fnlll domains flexible peptide linkers may be used as pro-apoptotic anti-cancer therapeutics. The increased molecular weight and controlled release of the fusion proteins, relative to a binding polypeptide alone, along with the unperturbed potency of the binding polypeptide, may provide a clinically viable option for patients with tumors expressing functional target protein (e.g. TRAILR-2).
[0088] In other aspects, provided are methods for treating a disease associated with TNF- related apoptosis-inducing ligand receptor 2 (TRAILR-2) in a subject in need thereof. The method may include administering to the subject an effective amount of a fusion protein as described herein. b. Methods of Diagnosing a Disease
[0089] Provided herein are methods of diagnosing a disease. The methods may include administering to the subject a fusion protein as described herein, and detecting binding of the fusion protein to a target to determine presence of the target in the subject. The presence of the target may indicate the disease in the subject. In other embodiments, the methods may include contacting a sample from the subject with a fusion protein as described herein, determining the level of a target in the sample, and comparing the level of the target in the sample to a control level of the target, wherein a level of the target different from the control level indicates disease in the subject. In some embodiments, the disease is selected from cancer, metabolic disease, autoimmune disease, cardiovascular disease, and orthopedic disorders, as detailed above. In some embodiments, the target comprises a disease marker or biomarker. In some embodiments, the fusion protein may act as an antibody mimic for binding and/or detecting a target. c. Methods of Determining the Presences of a Target
[0090] Provided herein are methods of determining the presence of a target in a sample. The methods may include contacting the sample with a fusion protein as described herein under conditions to allow a complex to form between the fusion protein and the target in the sample, and detecting the presence of the complex. Presence of the complex may be indicative of the target in the sample. In some embodiments, the fusion protein is labeled with a reporter for detection.
[0091] In some embodiments, the sample is obtained from a subject and the method further includes diagnosing, prognosticating, or assessing the efficacy of a treatment of the subject. When the method includes assessing the efficacy of a treatment of the subject, then the method may further include modifying the treatment of the subject as needed to improve efficacy.
d. Methods of Determining the Effectiveness of a Treatment
[0092] Provided herein are methods of determining the effectiveness of a treatment for a disease in a subject in need thereof. The methods may include contacting a sample from the subject with a fusion protein as detailed herein under conditions to allow a complex to form between the fusion protein and a target in the sample, determining the level of the complex in the sample, wherein the level of the complex is indicative of the level of the target in the sample, and comparing the level of the target in the sample to a control level of the target, wherein if the level of the target is different from the control level, then the treatment is determined to be effective or ineffective in treating the disease.
[0093] Time points may include prior to onset of disease, prior to administration of a therapy, various time points during administration of a therapy, and after a therapy has concluded, or a combination thereof. Upon administration of the fusion protein to the subject, the fusion protein may bind a target, wherein the presence of the target indicates the presence of the disease in the subject at the various time points. In some embodiments, the target comprises a disease marker or biomarker. In some embodiments, the fusion protein may act as an antibody mimic for binding and/or detecting a target. Comparison of the binding of the fusion protein to the target at various time points may indicate whether the disease has progressed, whether the diseased has advanced, whether a therapy is working to treat or prevent the disease, or a combination thereof.
[0094] In some embodiments, the control level corresponds to the level in the subject at a time point before or during the period when the subject has begun treatment, and the sample is taken from the subject at a later time point. In some embodiments, the sample is taken from the subject at a time point during the period when the subject is undergoing treatment, and the control level corresponds to a disease-free level or to the level at a time point before the period when the subject has begun treatment. In some embodiments, the method further includes modifying the treatment or administering a different treatment to the subject when the treatment is determined to be ineffective in treating the disease.
7. Examples
Example 1
Design of Multivalent Protein-ELP Fusions
[0095] The fusion proteins included two parts (FIG. 1): (i) a multivalent targeting component (e.g., TRAILR-2 agonist or EGFR antagonist) protein in which one or more scaffold protein units (e.g., SEQ ID NO: 1 and 2 or 5) are linked by glycine-serine flexible (e.g., SEQ ID NO: 3) or structured proline-containing linkers (e.g., SEQ ID NO: 4); and (ii) an elastin-like-polypeptide connected to the multivalent protein (e.g., SEQ ID NO: 7-9).
[0096] The fusion of (i) to (ii) was at the N- or C-terminus or (ii) was interspersed among (i).
Example 2
Design and Preparation of Multivalent Protein-ELP Expression Constructs
[0097] The DNA encoding the TRAILR-2-specific Tn3 unit (SEQ ID NO: 13; Swers et al., Mol. Cancer Ther., 2013, 12, 1235-1244) and the EGFR-specific domain (SEQ ID NO: 14; Friedman, et al., J. Mol. Biol. 2008, 376, 1388-1402) were purchased as double-stranded DNA "G-blocks" from Integrated DNA Technologies (Coralville, IA). The Tn3 G-block (SEQ ID NO: 13) was amplified using primers "Tn3For" and "Tn3Rev" primers (SEQ ID NO: 15 and 16, respectively). The gene was purchased with a (Gly4Ser)3 linker (SEQ ID NO: 3) at the C- terminus and designed with restriction sites compatible with recursive directional (RDL) ligation for seamless cloning of oligomeric genes. The EGFR-binding G-block (SEQ ID NO: 5) was purchased such that it could be inserted into the vector (SEQ ID NO: 12) using Gibson Assembly. The G-block contained 40-50 nucleic acid bases identical to those in the vector.
[0098] Enzymes used were from New England Biolabs (Ipswich, MA) The amplified Tn3 domain PCR product was purified using the Qiagen (Germantown, MD) PCR cleanup kit and digested with BseRI for insertion into a BseRI/CIP digested pET-24(+) vector modified for RDL (McDaniel et al. Biomacromolecules, 2010, 11 , 944-952). The insert and vector were agarose gel-purified and ligated with QuickLigase to clone the single unit construct. This was followed by digestion of the single unit construct (Tn3 in pET24(+)) with BseRI/CIP and ligation with BseRI-digested insert (Tn3 unit) to clone 2, 4, and 6 Tn3 repeats (written as (Tn3)2, (Tn3)4,
(Tn3)5) in the pET-24(+) vector. For cloning the Fnlll domain, the G-block was inserted into the
BseRI digested/CIP treated pET-24(+) RDL vector using the Gibson Assembly Master Mix (New England Biolabs; Ipswich, MA). Subcloning efficiency EB5a cells from EdgeBio (Gaithersburg, MD) were used for cloning steps.
[0099] Once the multivalent Tn3 genes were obtained, the gene for ELP was recombinantly fused to the (Tn3)5 using RDL. The RDL ligation method for this particular vector called for digestion of the oligomerized Tn3 in modified pET24(+) (SEQ ID NO: 12) with Acul and Bgll, and digestion of ELP (SEQ ID NO: 7-9) in pET24(+) with BseRI and Bgll. The digested fragments of DNA were separated using agarose gel electrophoresis, and the DNA bands at the appropriate molecular weights were excised and gel-purified. The resulting fragments were ligated using QuickLigase and successful clones were obtained. The restriction digest scheme mentioned refers to fusion of ELP to the C-terminus of the multivalent agonist, but in some embodiments, the scheme was flipped if N-terminal fusion was desired. In other embodiments, ELP(s) were interspersed between Tn3 repeats with this cloning method. In still other embodiments, an eight-repeat histidine tag (SEQ ID NO: 6) was recombinantly included at the C-terminus for purification and/or analysis purposes. All gene sequences were verified by direct DNA sequencing (Eton Bioscience Inc., Durham, NC) prior to expression.
Example 3
Expression and Purification of Multivalent TRAILR-2 agonist-ELP Fusion Proteins
[00100] The multivalent ELP-(Tn3)6 fusion constructs (SEQ ID NO: 10 and 11 ; FIG. 2) were transformed into BL21 (DE3) cells (EMD/Novagen, Gibbstown, NJ) for expression. Transformants were grown in Terrific Broth (TB) containing 45 μg/mL kanamycin and incubated overnight at 37°C with shaking. Overnight cultures were diluted 1 to 40 into TB containing 45 μg/mL kanamycin and incubated at 37°C with shaking for 5-8 hours. Protein expression was then induced by addition of IPTG to 1 mM, and incubation was resumed at 37°C with shaking. In a specific embodiment, the Tn3-ELP fusion proteins were purified from the cell lysate using inverse transition cycling (ITC) as previously described (Christensen et al., Protein Science 2009, 78, 1377-1387; Hassouneh et al., Methods Enzymol. 2012, 502, 215-37). In another embodiments, C-terminally Hiss-tagged ELP-Tn3 fusion proteins were purified from the periplasmic extract using immobilized metal affinity chromatography (IMAC; e.g., HisPur Ni-NTA resin from ThermoFisher Scientific, Pierce, Rockford, IL).
[00101] All purified proteins were analyzed by SDS-PAGE on Biorad Mini-PROTEAN TGX Tris-HCI Stain-Free (FIG. 3) or Biorad 4-20% ReadyGel Tris-HCI protein gels for correct molecular weight bands. The protein bands on the latter gel type were visualized with EZBlue Coomassie Brilliant Blue G-250 colloidal protein stain (Sigma Aldrich). Endotoxin was removed from purified protein usingan Acrodisc unit with a Mustang E membrane (Pall Corporation, Port Washington, N.Y.).
Example 4
In Vitro Testing of Fusion Protein Activity
[00102] To demonstrate that the multivalent ELP-(Tn3)5 fusion proteins (SEQ ID NO: 10 and
11) could kill cancer cell lines with the same potency as the non-ELP agonists, the fusions were tested on Colo205 colorectal adenocarcinoma cells. A cell viability assay was performed to calculate an EC50 for the various multivalent fusion proteins (FIG. 4). The EC50 values were comparable to those reported by others for the multivalent agonists.
[00103] The cell viability assay was carried out as follows. The Colo205 cells were plated in 96 well plates at a density of 10,000 cells/well in 90 μΙ_ of complete media (RPMI 1640+10% FBS+5% HEPES+5%Sodium Pyruvate+P/S) and incubated for 5-4 hours at 37°C with 5% CO2.
The cells were then treated with 10 μΙ_ 20 mM Tris 300 mM L-arginine pH 7 containing a serial dilution of a specific multivalent Tn3-ELP fusion protein or the vehicle control. The treatments were done in triplicate to account for technical variability. After 24-48 hours, the Promega CellTiter 96 Aqueous One Solution Reagent G3581 kit was used according to manufacturer's instructions to assay the number of viable cells using a colorimetric formazan assay method. The inhibition of cell viability was determined using measurements of the absorbance at 490, which is the maximum absorbance wavelength of the formazan product. The dose response curves were generated by plotting inhibition versus compound concentration. The dose response curve was approximated from the scatter plot using a four-parameter logistic model calculation in GraphPad Prism (La Jolla, CA), and EC50 was calculated as the concentration of
Tn3-ELP required to kill 50% of the Colo205 cells. Fusion of ELPs to the multivalent TRAILR-2 specific Tn3 did not impact their potency (TABLE 1).
TABLE 1. EC50 values for various fusion proteins.
Example 5
Spectrophotometry for Analysis of Fusion Protein Inverse Transition Temperature (Tt)
[00104] To evaluate the Tt of the fusion proteins, the optical density of the protein solution was monitored at 350 nm (OD350) as a function of temperature. The solution (10-100 μΜ in 20 mM Tris 300 mM L-arginine, pH 7) was heated at a rate of 1 °C/minute using the Cary 300 UV- visible spectrophotometer equipped with a multicell thermoelectric temperature controller (Varian Instruments, Walnut Creek, CA). A sharp transition was indicated by the sudden increase in absorbance, and the inflection point of the absorbance versus temperature curve was used to calculate the Tt.
[00105] The derivative of the absorbance at 350 nm was calculated with respect to temperature, and the Tt (temperature at maximal turbidity gradient) was obtained. An example set of curves is provided in FIG. 5. The most potent fusions were the 6-repeat Tn3 domain-ELP (SEQ ID NO: 10 and 11 , respectively) were chosen for testing in vivo. The hydrophilic ELPb (SEQ ID NO: 8) had a Tt much higher than body temperature; this biopolymer was chosen for fusion to the bioactive protein as a size control. The hydrophobic ELPa (SEQ ID NO: 7) transitioned at 28°C (see FIG. 5) and formed a gel-like depot upon injection into the mouse.
Example 6
Determination of Therapeutic Efficacy in vivo
[00106] Having successfully produced multivalent TRAILR-2 specific ELP-(Tn3)6 fusions that transition to form gel-like depots between room temperature and body temperature, we tested their therapeutic efficacy in a Colo205 colorectal adenocarcinoma mouse xenograft model. One million Colo205 cells (expressing TRAILR-2) were injected subcutaneously into the right flanks of five cohorts of female athymic nude mice. After two weeks, tumors had grown to a volume of approximately 150 mm3, at which a point a single intratumoral injection of 20 mM Tris 300 mM L-arginine pH 7 (vehicle), TRAIL (not shown), depot-forming ELPa-(Tn3)5 fusion, soluble ELPb-
(Tn3)5 fusion, or soluble (Τη3) was administered. Throughout the experiment, mice were monitored for overall health and activity in accordance with the Duke University Institutional Animal Care & Use Committee. The mice in all treatment groups were dosed at 3.7 μg/mm3 of protein drug and tumor volume was monitored with a digital caliper using the formula:
Volume = 0.5 x Length x (Width)2
[00107] As shown in FIG. 6, the depot-forming ELPa-(Tn3)5 fusion led to partial tumor regression and slower tumor growth when compared to all other groups. There is a therapeutic advantage of using the depot to release the protein-biopolymer fusion slowly over a longer period of time. This depot approach may be extended to improve the drug delivery of protein- drug conjugates. Also, additional combinations of bioactive multispecific protein-biopolymer fusions can be developed using the methods described herein. The protein architecture, flexibility of the design, and potent therapeutic efficacy make these modular fusions a potential platform for protein delivery.
[00108] The foregoing description of the specific aspects will so fully reveal the general nature of the invention that others can, by applying knowledge within the skill of the art, readily modify and/or adapt for various applications such specific aspects, without undue experimentation, without departing from the general concept of the present disclosure. Therefore, such adaptations and modifications are intended to be within the meaning and range of equivalents of the disclosed aspects, based on the teaching and guidance presented herein. It is to be understood that the phraseology or terminology herein is for the purpose of description
and not of limitation, such that the terminology or phraseology of the present specification is to be interpreted by the skilled artisan in light of the teachings and guidance.
[00109] The breadth and scope of the present disclosure should not be limited by any of the above-described exemplary aspects, but should be defined only in accordance with the following claims and their equivalents.
[00110] All publications, patents, patent applications, and/or other documents cited in this application are incorporated by reference in their entirety for all purposes to the same extent as if each individual publication, patent, patent application, and/or other document were individually indicated to be incorporated by reference for all purposes.
[00111] For reasons of completeness, various aspects of the invention are set out in the following numbered clauses:
[00112] Clause 1. A fusion protein comprising at least one binding polypeptide and at least one unstructured polypeptide.
[00113] Clause 2. The fusion protein of clause 1 , wherein the fusion protein comprises a plurality of unstructured polypeptides.
[00114] Clause 3. The fusion protein of any one of the preceding clauses, wherein the fusion protein comprises a plurality of binding polypeptides.
[00115] Clause 4. The fusion protein of clause 3, further comprising a linker positioned between at least two adjacent binding polypeptides.
[00116] Clause 5. The fusion protein of clause 2, further comprising a linker positioned between at least two adjacent unstructured polypeptides.
[00117] Clause 6. The fusion protein of any one of clauses 4-5, wherein the linker comprises at least one glycine and at least one serine.
[00118] Clause 7. The fusion protein of clause 6, wherein the linker comprises an amino acid sequence consisting of SEQ ID NO: 3 ((Gly4Ser)3).
[00119] Clause 8. The fusion protein of any one of clauses 4-5, wherein the linker comprises an amino acid sequence consisting of SEQ ID NO: 4.
[00120] Clause 9. The fusion protein of any one of clauses 3-8, wherein the plurality of binding polypeptides forms an oligomer.
[00121] Clause 10. The fusion protein of any one of clauses 3-9, wherein the binding polypeptide binds a target, and wherein the fusion protein binds more than one target.
[00122] Clause 11. The fusion protein of any one of the preceding clauses, wherein the at least one binding polypeptide comprises a Fibronectin type III (Fnlll) domain.
[00123] Clause 12. The fusion protein of clause 11 , wherein the Fnlll domain binds TNF- related apoptosis-inducing ligand receptor 2 (TRAILR-2).
[00124] Clause 13. The fusion protein of any one of the preceding clauses, wherein the at least one binding polypeptide comprises at least one amino acid sequence of consisting of SEQ ID NO: 17 (RGDS).
[00125] Clause 14. The fusion protein of clause 13, wherein the at least one binding polypeptide comprises a plurality of amino acid sequences consisting of SEQ ID NO: 17 (RGDS).
[00126] Clause 15. The fusion protein of any one of the preceding clauses, wherein the at least one unstructured polypeptide comprises at least one PG motif comprising an amino acid sequence selected from PG, P(X)nG (SEQ ID NO: 18), and (U)mP(X)nG(Z)p (SEQ ID NO: 20), or a combination thereof, wherein m, n, and p are independently an integer from 1 to 15, and wherein U, X, and Z are independently any amino acid.
[00127] Clause 16. The fusion protein of any one of the preceding clauses, wherein the at least one unstructured polypeptide comprises a thermally responsive polypeptide.
[00128] Clause 17. The fusion protein of clause 16, wherein the thermally responsive polypeptide comprises an elastin-like polypeptide (ELP).
[00129] Clause 18. The fusion protein of any one of the preceding clauses, wherein the at least one unstructured polypeptide comprises an amino acid sequence consisting of (VPGXG)n
(SEQ ID NO: 19), wherein X is any amino acid except proline and n is an integer greater than or equal to 1.
[00130] Clause 19. The fusion protein of clause 18, wherein n is 60, 120, or 180.
[00131] Clause 20. The fusion protein of clause 18, wherein X is valine.
[00132] Clause 21. The fusion protein of any one of the preceding clauses, further comprising at least one linker positioned between the at least one binding polypeptide and the at least one unstructured polypeptide.
[00133] Clause 22. The fusion protein of clause 21 , wherein the fusion protein comprises a plurality of linkers between the at least one binding polypeptide and the at least one unstructured polypeptide.
[00134] Clause 23. The fusion protein of any one of the preceding clauses, wherein the at least one binding polypeptide is positioned N-terminal to the at least one unstructured polypeptide.
[00135] Clause 24. The fusion protein of any one of clauses 1-23 wherein the at least one binding polypeptide is positioned C-terminal to the at least one unstructured polypeptide.
[00136] Clause 25. The fusion protein of any one of the preceding clauses, wherein the at least one unstructured polypeptide has a LCST between about 0°C and about 100°C.
[00137] Clause 26. The fusion protein of any one of the preceding clauses, wherein the at least one unstructured polypeptide has a UCST between about 0°C and about 100°C
[00138] Clause 27. A method for treating a disease in a subject in need thereof, the method comprising administering to the subject an effective amount of the fusion protein according to any one of the preceding clauses.
[00139] Clause 28. The method of clause 27, wherein the fusion protein is administered in a controlled release formulation.
[00140] Clause 29. The method of clause 27, wherein the fusion protein forms a depot upon administration to the subject.
[00141] Clause 30. The method of any one of clauses 27-28, wherein the fusion protein is administered intravenously, intraarterially, or intraperitoneally to the subject.
[00142] Clause 31. The method of any one of clauses 27-30, wherein the disease comprises cancer.
[00143] Clause 32. The method of clause 31 , wherein the fusion protein is administered intratumorally.
[00144] Clause 33. The method of any one of clauses 27-32, wherein the cancer is colorectal adenocarcinoma.
[00145] Clause 34. The method of any one of clauses 27-33, wherein the at least one binding polypeptide comprises an Fnlll domain or a plurality of Fnlll domains, and wherein the disease is a disease associated with TRAILR-2.
[00146] Clause 35. The method of any one of clauses 27-34, wherein the disease is a disease associated with a target of the at least one binding polypeptide.
[00147] Clause 36. A multivalent fusion protein comprising at least one Fibronectin type III (Fnlll) domain and at least one elastin-like polypeptide (ELP), wherein the Fnlll domain binds TNF-related apoptosis-inducing ligand receptor 2 (TRAILR-2).
[00148] Clause 37. The multivalent fusion protein of clause 36, wherein the at least one ELP comprises an amino acid sequence consisting of (VPGXG)n (SEQ ID NO: 19), wherein X is any amino acid except proline and n is an integer greater than or equal to 1.
[00149] Clause 38. The multivalent fusion protein of clause 37, wherein n is 60, 120, or 180.
[00150] Clause 39. The multivalent fusion protein of clause 37, wherein X is valine.
[00151] Clause 40. The multivalent fusion protein of any one of clauses 36-39, wherein the at least one Fnlll domain comprises an amino acid sequence consisting of SEQ ID NO: 1.
[00152] Clause 41. The multivalent fusion protein of any one of clauses 36-40, wherein the multivalent fusion protein comprises a plurality of Fnlll domains.
[00153] Clause 42. The multivalent fusion protein of clause 41 , wherein the multivalent fusion protein comprises 2, 4, or 6 Fnlll domains.
[00154] Clause 43. The multivalent fusion protein of clause 41 or 42, wherein the multivalent fusion protein further comprises a linker positioned between at least two adjacent Fnlll domains.
[00155] Clause 44. The multivalent fusion protein of clause 43, wherein the linker comprises at least one glycine and at least one serine.
[00156] Clause 45. The multivalent fusion protein of clause 44, wherein the linker comprises an amino acid sequence consisting of SEQ ID NO: 3 ((Gly4Ser)3).
[00157] Clause 46. The multivalent fusion protein of clause 43, wherein the linker comprises an amino acid sequence consisting of SEQ ID NO: 4.
[00158] Clause 47. A method for treating a disease associated with TNF-related apoptosis- inducing ligand receptor 2 (TRAILR-2) in a subject in need thereof, the method comprising administering to the subject an effective amount of the multivalent fusion protein of any one of clauses 36-46.
[00159] Clause 48. The method of clause 47, wherein the disease comprises cancer.
[00160] Clause 49. The method of clause 48, wherein the cancer comprises colorectal adenocarcinoma.
[00161] Clause 50. The method of any one of clauses 47-49, wherein the multivalent fusion protein is administered intravenously, intraarterially, or intraperitoneally to the subject.
[00162] Clause 51. The method of any one of clauses 48-49, wherein the multivalent fusion protein is administered intratumorally.
[00163] Clause 52. The method of any one of clauses 47-51 , wherein the multivalent fusion protein forms a depot upon administration to the subject.
[00164] Clause 53. The method of any one of clauses 47-51 , wherein the multivalent fusion protein is administered in a controlled release formulation.
[00165] Clause 54. A method of diagnosing a disease in a subject, the method comprising contacting a sample from the subject with the fusion protein according to any one of clauses 1- 26; and detecting binding of the fusion protein to a target to determine presence of the target in
the sample, wherein the presence of the target in the sample indicates the disease in the subject.
[00166] Clause 55. The method of clause 54, wherein the disease is selected from cancer, metabolic disease, autoimmune disease, cardiovascular disease, and orthopedic disorder.
[00167] Clause 56. A method of determining the presence of a target in a sample, the method comprising contacting the sample with the fusion protein of any one of clauses 1-26 under conditions to allow a complex to form between the fusion protein and the target in the sample; and detecting the presence of the complex, wherein presence of the complex is indicative of the target in the sample.
[00168] Clause 57. The method of clause 56, wherein the sample is obtained from a subject and the method further comprises diagnosing a disease, prognosticating, or assessing the efficacy of a treatment of the subject.
[00169] Clause 58. The method of clause 57, wherein when the method further comprises assessing the efficacy of a treatment of the subject, then the method further comprises modifying the treatment of the subject as needed to improve efficacy.
[00170] Clause 59. A method of determining the effectiveness of a treatment for a disease in a subject in need thereof, the method comprising contacting a sample from the subject with the fusion protein of any one of clauses 1-26 under conditions to allow a complex to form between the fusion protein and a target in the sample; determining the level of the complex in the sample, wherein the level of the complex is indicative of the level of the target in the sample; and comparing the level of the target in the sample to a control level of the target, wherein if the level of the target is different from the control level, then the treatment is determined to be effective or ineffective in treating the disease.
[00171] Clause 60. A method of diagnosing a disease in a subject, the method comprising: contacting a sample from the subject with the fusion protein of any one of clauses 1-26; determining the level of a target in the sample; and comparing the level of the target in the sample to a control level of the target, wherein a level of the target different from the control level indicates disease in the subject.
[00172] Clause 61. The method of clause 59 or 60, wherein the control level corresponds to the level in the subject at a time point before or during the period when the subject has begun treatment, and wherein the sample is taken from the subject at a later time point.
[00173] Clause 62. The method of clause 59 or 60, wherein the sample is taken from the subject at a time point during the period when the subject is undergoing treatment, and wherein the control level corresponds to a disease-free level or to the level at a time point before the period when the subject has begun treatment.
[00174] Clause 63. The method of any one of clauses 59 and 61-62, the method further comprising modifying the treatment or administering a different treatment to the subject when the treatment is determined to be ineffective in treating the disease.
[00175] Clause 64. The method of any one of clauses 54-63, wherein the fusion protein is labeled with a reporter.
[00176] Clause 65. The method of any one of clauses 54-64, wherein the disease is selected from cancer, metabolic disease, autoimmune disease, cardiovascular disease, and orthopedic disorder.
SEQUENCES
SEQ ID NO: 1
TRAILR2-Specific Tn3, polypeptide
GAIEVKDVTDTTALITWAKPWVDPPPLWGCELTYGIKDVPGDRTTIDLQQKHTAYSIGNLKPDT EYE VS LI C F D PYGM RS KPA KETFTT
SEQ ID NO: 2
TRAILR2-Specific Tn3 Sequence without Cysteines, polypeptide
GAIEVKDVTDTTALITWAKPWVDPPPLWGIELTYGIKDVPGDRTTIDLQQKHTAYSIGNLKPDTE YEVSLISFDPYGMRSKPAKETFTT
SEQ ID NO: 3
Flexible GlySer Linker, polypeptide
GGGGSGGGGSGGGGS
SEQ ID NO: 4
Proline-Containing Linker, polypeptide
PQPQPKPQPKPEPEPQPQG
SEQ ID NO: 5
EGFR-Binding Domain, polypeptide
GVDNKFNKEMWAAWEEIRNLPNLNGWQMTAFIASLVDDPSQSANLLAEAKKLNDAQAPKG
SEQ ID NO: 6
His-8 Tag, polypeptide
HHHHHHHH
SEQ ID NO: 7
ELP A, polypeptide
VGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVP GVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGV PGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVG VPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGV GVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPG VGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVP GVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGV PGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVG VPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGV GVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPG VGVPGVGVPG
SEQ ID NO: 8
ELP B, polypeptide
VPGGGVPGAGVPGGGVPGAGVPGGGVPGAGVPGGGVPGAGVPGGGVPGAGVPGGGVPG AGVPGGGVPGAGVPGGGVPGAGVPGGGVPGAGVPGGGVPGAGVPGGGVPGAGVPGGGV PGAGVPGGGVPGAGVPGGGVPGAGVPGGGVPGAGVPGGGVPGAGVPGGGVPGAGVPGG GVPGAGVPGGGVPGAGVPGGGVPGAGVPGGGVPGAGVPGGGVPGAGVPGGGVPGAGVP GGGVPGAGVPGGGVPGAGVPGGGVPGAGVPGGGVPGAGVPGGGVPGAGVPGGGVPGAG VPGGGVPGAGVPGGGVPGAGVPGGGVPGAGVPGGGVPGAGVPGGGVPGAGVPGGGVPG
AGVPGGGVPGAGVPGGGVPGAGVPGGGVPGAGVPGGGVPGAGVPGGGVPGAGVPGGGV PGAGVPGGGVPGAGVPGGGVPGAGVPGGGVPGAGVPGGGVPGAGVPGGGVPGAGVPGG GVPGAGVPGGGVPGAGVPGGGVPGAGVPGGGVPGAGVPGGGVPGAGVPGGGVPGAGVP GGGVPGAGVPGGGVPGAGVPGGGVPGAGVPGGGVPGAGVPGGGVPGAGVPGGGVPGAG VPGGGVPGAGVPGGGVPGAG
SEQ ID NO: 9
ELP C, polypeptide
VGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVP GVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGV PGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVG VPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGV GVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPG VGVPG
SEQ ID NO: 10
ELPa-(Tn3)5, polypeptide
VGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVP
GVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGV
PGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVG
VPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGV
GVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPG
VGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVP
GVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGV
PGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVG
VPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGV
GVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPG
VGVPGVGVPGAI EVKDVTDTTALITWAKPWVDPPPLWGCELTYGI KDVPGDRTTI DLQQKHTA
YSIGNLKPDTEYEVSLICFDPYGMRSKPAKETFTTGGGGSGGGGSGGGGSGAIEVKDVTDTTA
LITWAKPWVDPPPLWGCELTYGI KDVPGDRTTI DLQQKHTA YSIGNLKPDTEYEVSLICFDPYG
MRSKPAKETFTTGGGGSGGGGSGGGGSGAIEVKDVTDTTALITWAKPWVDPPPLWGCELTY
GIKDVPGDRTTI DLQQKHTA YSIGNLKPDTEYEVSLICFDPYGMRSKPAKETFTTGGGGSGGG
GSGGGGSGAIEVKDVTDTTALITWAKPWVDPPPLWGCELTYGIKDVPGDRTTIDLQQKHTAYSI
GNLKPDTEYEVSLICFDPYGMRSKPAKETFTTGGGGSGGGGSGGGGSGAIEVKDVTDTTALIT
WAKPWVDPPPLWGCELTYGIKDVPGDRTTIDLQQKHTAYSIGNLKPDTEYEVSLICFDPYGMR SKPAKETFTTGGGGSGGGGSGGGGSGAI EVKDVTDTTALITWAKPWVDPPPLWGCELTYGI K DVPGDRTTIDLQQKHTAYSIGNLKPDTEYEVSLICFDPYGMRSKPAKETFTTGGGGSGGGGSG GGGS
SEQ ID NO: 1 1
ELPb-(Tn3)5, polypeptide
VPGGGVPGAGVPGGGVPGAGVPGGGVPGAGVPGGGVPGAGVPGGGVPGAGVPGGGVPG
AGVPGGGVPGAGVPGGGVPGAGVPGGGVPGAGVPGGGVPGAGVPGGGVPGAGVPGGGV
PGAGVPGGGVPGAGVPGGGVPGAGVPGGGVPGAGVPGGGVPGAGVPGGGVPGAGVPGG
GVPGAGVPGGGVPGAGVPGGGVPGAGVPGGGVPGAGVPGGGVPGAGVPGGGVPGAGVP
GGGVPGAGVPGGGVPGAGVPGGGVPGAGVPGGGVPGAGVPGGGVPGAGVPGGGVPGAG
VPGGGVPGAGVPGGGVPGAGVPGGGVPGAGVPGGGVPGAGVPGGGVPGAGVPGGGVPG
AGVPGGGVPGAGVPGGGVPGAGVPGGGVPGAGVPGGGVPGAGVPGGGVPGAGVPGGGV
PGAGVPGGGVPGAGVPGGGVPGAGVPGGGVPGAGVPGGGVPGAGVPGGGVPGAGVPGG
GVPGAGVPGGGVPGAGVPGGGVPGAGVPGGGVPGAGVPGGGVPGAGVPGGGVPGAGVP
GGGVPGAGVPGGGVPGAGVPGGGVPGAGVPGGGVPGAGVPGGGVPGAGVPGGGVPGAG
VPGGGVPGAGVPGGGVPGAGAI EVKDVTDTTALITWAKPWVDPPPLWGCELTYGI KDVPGDR
TTIDLQQKHTAYSIGNLKPDTEYEVSLICFDPYGMRSKPAKETFTTGGGGSGGGGSGGGGSGA
IEVKDVTDTTALITWAKPWVDPPPLWGCELTYGIKDVPGDRTTIDLQQKHTAYSIGNLKPDTEYE
VSLICFDPYGMRSKPAKETFTTGGGGSGGGGSGGGGSGAIEVKDVTDTTALITWAKPWVDPP
PLWGCELTYGIKDVPGDRTTIDLQQKHTAYSIGNLKPDTEYEVSLICFDPYGMRSKPAKETFTT
GGGGSGGGGSGGGGSGAIEVKDVTDTTALITWAKPWVDPPPLWGCELTYGIKDVPGDRTTID
LQQKHTAYSIGNLKPDTEYEVSLICFDPYGMRSKPAKETFTTGGGGSGGGGSGGGGSGAIEVK
DVTDTTALITWAKPWVDPPPLWGCELTYGIKDVPGDRTTIDLQQKHTAYSIGNLKPDTEYEVSLI
CFDPYGMRSKPAKETFTTGGGGSGGGGSGGGGSGAIEVKDVTDTTALITWAKPWVDPPPLW
GCELTYGIKDVPGDRTTIDLQQKHTAYSIGNLKPDTEYEVSLICFDPYGMRSKPAKETFTTGGG
GSGGGGSGGGGS
SEQ ID NO: 12
pet24 Vector, polynucleotide
TGGCGAATGGGACGCGCCCTGTAGCGGCGCATTAAGCGCGGCGGGTGTGGTGGTTACGC
GCAGCGTGACCGCTACACTTGCCAGCGCCCTAGCGCCCGCTCCTTTCGCTTTCTTCCCTT
CCTTTCTCGCCACGTTCGCCGGCTTTCCCCGTCAAGCTCTAAATCGGGGGCTCCCTTTAG
GGTTCCGATTTAGTGCTTTACGGCACCTCGACCCCAAAAAACTTGATTAGGGTGATGGTTC
ACGTAGTGGGCCATCGCCCTGATAGACGGTTTTTCGCCCTTTGACGTTGGAGTCCACGTTC
TTTAATAGTGGACTCTTGTTCCAAACTGGAACAACACTCAACCCTATCTCGGTCTATTCTTTT
GATTTATAAGGGATTTTGCCGATTTCGGCCTATTGGTTAAAAAATGAGCTGATTTAACAAAA
ATTTAACGCGAATTTTAACAAAATATTAACGTTTACAATTTCAGGTGGCACTTTTCGGGGAA
ATGTGCGCGGAACCCCTATTTGTTTATTTTTCTAAATACATTCAAATATGTATCCGCTCATGA
ATTAATTCTTAGAAAAACTCATCGAGCATCAAATGAAACTGCAATTTATTCATATCAGGATTA
TCAATACCATATTTTTGAAAAAGCCGTTTCTGTAATGAAGGAGAAAACTCACCGAGGCAGTT
CCATAGGATGGCAAGATCCTGGTATCGGTCTGCGATTCCGACTCGTCCAACATCAATACAA
CCTATTAATTTCCCCTCGTCAAAAATAAGGTTATCAAGTGAGAAATCACCATGAGTGACGAC
TGAATCCGGTGAGAATGGCAAAAGTTTATGCATTTCTTTCCAGACTTGTTCAACAGGCCAG
CCATTACGCTCGTCATCAAAATCACTCGCATCAACCAAACCGTTATTCATTCGTGATTGCGC
CTGAGCGAGACGAAATACGCGATCGCTGTTAAAAGGACAATTACAAACAGGAATCGAATGC
AACCGGCGCAGGAACACTGCCAGCGCATCAACAATATTTTCACCTGAATCAGGATATTCTT
CTAATACCTGGAATGCTGTTTTCCCGGGGATCGCAGTGGTGAGTAACCATGCATCATCAGG
AGTACGGATAAAATGCTTGATGGTCGGAAGAGGCATAAATTCCGTCAGCCAGTTTAGTCTG
ACCATCTCATCTGTAACATCATTGGCAACGCTACCTTTGCCATGTTTCAGAAACAACTCTGG
CGCATCGGGCTTCCCATACAATCGATAGATTGTCGCACCTGATTGCCCGACATTATCGCGA
GCCCATTTATACCCATATAAATCAGCATCCATGTTGGAATTTAATCGCGGCCTAGAGCAAGA
CGTTTCCCGTTGAATATGGCTCATAACACCCCTTGTATTACTGTTTATGTAAGCAGACAGTT
TTATTGTTCATGACCAAAATCCCTTAACGTGAGTTTTCGTTCCACTGAGCGTCAGACCCCGT
AGAAAAGATCAAAGGATCTTCTTGAGATCCTTTTTTTCTGCGCGTAATCTGCTGCTTGCAAA
CAAAAAAACCACCGCTACCAGCGGTGGTTTGTTTGCCGGATCAAGAGCTACCAACTCTTTT
TCCGAAGGTAACTGGCTTCAGCAGAGCGCAGATACCAAATACTGTCCTTCTAGTGTAGCCG
TAGTTAGGCCACCACTTCAAGAACTCTGTAGCACCGCCTACATACCTCGCTCTGCTAATCC
TGTTACCAGTGGCTGCTGCCAGTGGCGATAAGTCGTGTCTTACCGGGTTGGACTCAAGAC
GATAGTTACCGGATAAGGCGCAGCGGTCGGGCTGAACGGGGGGTTCGTGCACACAGCCC
AGCTTGGAGCGAACGACCTACACCGAACTGAGATACCTACAGCGTGAGCTATGAGAAAGC
GCCACGCTTCCCGAAGGGAGAAAGGCGGACAGGTATCCGGTAAGCGGCAGGGTCGGAAC
AGGAGAGCGCACGAGGGAGCTTCCAGGGGGAAACGCCTGGTATCTTTATAGTCCTGTCGG
GTTTCGCCACCTCTGACTTGAGCGTCGATTTTTGTGATGCTCGTCAGGGGGGCGGAGCCT
ATGGAAAAACGCCAGCAACGCGGCCTTTTTACGGTTCCTGGCCTTTTGCTGGCCTTTTGCT
CACATGTTCTTTCCTGCGTTATCCCCTGATTCTGTGGATAACCGTATTACCGCCTTTGAGTG
AGCTGATACCGCTCGCCGCAGCCGAACGACCGAGCGCAGCGAGTCAGTGAGCGAGGAAG
CGGAAGAGCGCCTGATGCGGTATTTTCTCCTTACGCATCTGTGCGGTATTTCACACCGCAT
ATATGGTGCACTCTCAGTACAATCTGCTCTGATGCCGCATAGTTAAGCCAGTATACACTCC
GCTATCGCTACGTGACTGGGTCATGGCTGCGCCCCGACACCCGCCAACACCCGCTGACG
CGCCCTGACGGGCTTGTCTGCTCCCGGCATCCGCTTACAGACAAGCTGTGACCGTCTCCG
GGAGCTGCATGTGTCAGAGGTTTTCACCGTCATCACCGAAACGCGCGAGGCAGCTGCGGT
AAAGCTCATCAGCGTGGTCGTGAAGCGATTCACAGATGTCTGCCTGTTCATCCGCGTCCA
GCTCGTTGAGTTTCTCCAGAAGCGTTAATGTCTGGCTTCTGATAAAGCGGGCCATGTTAAG
GGCGGTTTTTTCCTGTTTGGTCACTGATGCCTCCGTGTAAGGGGGATTTCTGTTCATGGGG
GTAATGATACCGATGAAACGAGAGAGGATGCTCACGATACGGGTTACTGATGATGAACATG
CCCGGTTACTGGAACGTTGTGAGGGTAAACAACTGGCGGTATGGATGCGGCGGGACCAG
AGAAAAATCACTCAGGGTCAATGCCAGCGCTTCGTTAATACAGATGTAGGTGTTCCACAGG
GTAGCCAGCAGCATCCTGCGATGCAGATCCGGAACATAATGGTGCAGGGCGCTGACTTCC
GCGTTTCCAGACTTTACGAAACACGGAAACCGAAGACCATTCATGTTGTTGCTCAGGTCGC
AGACGTTTTGCAGCAGCAGTCGCTTCACGTTCGCTCGCGTATCGGTGATTCATTCTGCTAA
CCAGTAAGGCAACCCCGCCAGCCTAGCCGGGTCCTCAACGACAGGAGCACGATCATGCG
CACCCGTGGGGCCGCCATGCCGGCGATAATGGCCTGCTTCTCGCCGAAACGTTTGGTGG
CGGGACCAGTGACGAAGGCTTGAGCGAGGGCGTGCAAGATTCCGAATACCGCAAGCGAC
AGGCCGATCATCGTCGCGCTCCAGCGAAAGCGGTCCTCGCCGAAAATGACCCAGAGCGC
TGCCGGCACCTGTCCTACGAGTTGCATGATAAAGAAGACAGTCATAAGTGCGGCGACGAT
AGTCATGCCCCGCGCCCACCGGAAGGAGCTGACTGGGTTGAAGGCTCTCAAGGGCATCG
GTCGAGATCCCGGTGCCTAATGAGTGAGCTAACTTACATTAATTGCGTTGCGCTCACTGCC
CGCTTTCCAGTCGGGAAACCTGTCGTGCCAGCTGCATTAATGAATCGGCCAACGCGCGGG
GAGAGGCGGTTTGCGTATTGGGCGCCAGGGTGGTTTTTCTTTTCACCAGTGAGACGGGCA
ACAGCTGATTGCCCTTCACCGCCTGGCCCTGAGAGAGTTGCAGCAAGCGGTCCACGCTGG
TTTGCCCCAGCAGGCGAAAATCCTGTTTGATGGTGGTTAACGGCGGGATATAACATGAGCT
GTCTTCGGTATCGTCGTATCCCACTACCGAGATATCCGCACCAACGCGCAGCCCGGACTC
GGTAATGGCGCGCATTGCGCCCAGCGCCATCTGATCGTTGGCAACCAGCATCGCAGTGG
GAACGATGCCCTCATTCAGCATTTGCATGGTTTGTTGAAAACCGGACATGGCACTCCAGTC
GCCTTCCCGTTCCGCTATCGGCTGAATTTGATTGCGAGTGAGATATTTATGCCAGCCAGCC
AGACGCAGACGCGCCGAGACAGAACTTAATGGGCCCGCTAACAGCGCGATTTGCTGGTGA
CCCAATGCGACCAGATGCTCCACGCCCAGTCGCGTACCGTCTTCATGGGAGAAAATAATA
CTGTTGATGGGTGTCTGGTCAGAGACATCAAGAAATAACGCCGGAACATTAGTGCAGGCA
GCTTCCACAGCAATGGCATCCTGGTCATCCAGCGGATAGTTAATGATCAGCCCACTGACG
CGTTGCGCGAGAAGATTGTGCACCGCCGCTTTACAGGCTTCGACGCCGCTTCGTTCTACC
ATCGACACCACCACGCTGGCACCCAGTTGATCGGCGCGAGATTTAATCGCCGCGACAATT
TGCGACGGCGCGTGCAGGGCCAGACTGGAGGTGGCAACGCCAATCAGCAACGACTGTTT
GCCCGCCAGTTGTTGTGCCACGCGGTTGGGAATGTAATTCAGCTCCGCCATCGCCGCTTC
CACTTTTTCCCGCGTTTTCGCAGAAACGTGGCTGGCCTGGTTCACCACGCGGGAAACGGT
CTGATAAGAGACACCGGCATACTCTGCGACATCGTATAACGTTACTGGTTTCACATTCACC
ACCCTGAATTGACTCTCTTCCGGGCGCTATCATGCCATACCGCGAAAGGTTTTGCGCCATT
CGATGGTGTCCGGGATCTCGACGCTCTCCCTTATGCGACTCCTGCATTAGGAAGCAGCCC
AGTAGTAGGTTGAGGCCGTTGAGCACCGCCGCCGCAAGGAATGGTGCATGCAAGGAGAT
GGCGCCCAACAGTCCCCCGGCCACGGGGCCTGCCACCATACCCACGCCGAAACAAGCGC
TCATGAGCCCGAAGTGGCGAGCCCGATCTTCCCCATCGGTGATGTCGGCGATATAGGCGC
CAGCAACCGCACCTGTGGCGCCGGTGATGCCGGCCACGATGCGTCCGGCGTAGAGGATC
GAGATCTCGATCCCGCGAAATTAATACGACTCACTATAGGGGAATTGTGAGCGGATAACAA
TTCCCCTCTAGAAATAATTTTGTTTAACTTTAAGAAGGAGGAGTACATATGGGCTGATGATA
ATGATCTTCAGGATCCGAATTCGAGCTCCGTCGACAAGCTTGCGGCCGCACTCGAGCACC
ACCACCACCACCACTGAGATCCGGCTGCTAACAAAGCCCGAAAGGAAGCTGAGTTGGCTG
CTGCCACCGCTGAGCAATAACTAGCATAACCCCTTGGGGCCTCTAAACGGGTCTTGAGGG
GTTTTTTGCTGAAAGGAGGAACTATATCCGGAT
SEQ ID NO: 13
Tn3 G-block, polynucleotide
TAAGAAGGAGGAGTACATATGGGCGCTATCGAAGTTAAAGACGTTACCGACACCACCGCT CTGATCACCTGGGCTAAACCGTGGGTTGACCCGCCGCCGCTGTGGGGTTGCGAACTGAC CTACGGTATCAAAGACGTTCCGGGTGACCGTACCACCATCGACCTGCAGCAGAAACACAC CGCTTACTCTATCGGTAACCTGAAACCGGACACCGAATACGAAGTTTCTCTGATCTGCTTC GACCCGTACGGTATGCGTTCTAAACCGGCTAAAGAAACCTTCACCACCGGTGGTGGTGGT TCTGGTGGTGGTGGTTCTGGTGGTGGTGGTTCTGGCATATGTACTCCTCCTTA
SEQ ID NO: 14
EGFR Binding Domain G-block, polynucleotide
AGAAATAATTTTGTTTAACTTTAAGAAGGAGGAGTACATATGGGCGTTGATAACAAATTCAA TAAAGAAATGTGGGCAGCCTGGGAAGAAATTCGTAACCTGCCGAACCTGAATGGTTGGCA AATGACCGCCTTCATTGCGAGCCTGGTGGATGATCCGAGCCAAAGCGCTAATCTGCTGGC GGAAGCGAAAAAACTGAACGACGCCCAAGCCCCGAAAGGCTGATAATAATGATCTTCAGG ATCCGAATTCGAGCTCCGTC
SEQ ID NO: 15
Tn3 Forward Amplification Primer, polynucleotide
TAAGAAGGAGGAGTACATATGGGCGC
SEQ ID NO: 16
Tn3 Reverse Amplification Primer, polynucleotide
TAAGGAGGAGTACATATGCCAGAACCAC
SEQ ID NO: 17
Linker, polypeptide
RGDS
SEQ ID NO: 18
A PG motif, polypeptide, wherein X is any amino acid and n is an integer from 1 to 15
P(X)nG
SEQ ID NO: 19
ELP repeat, polypeptide, wherein X is any amino acid except proline and n is an integer greater than or equal to 1
(VPGXG)n
SEQ ID NO: 20
A PG motif, polypeptide, wherein U, X, and Z are independently any amino acid and m, n, and p are independently an integer from 1 to 15
(U)mP(X)nG(Z)p
Claims
1. A fusion protein comprising at least one binding polypeptide and at least one unstructured polypeptide.
2. The fusion protein of claim 1 , wherein the fusion protein comprises a plurality of unstructured polypeptides.
3. The fusion protein of any one of the preceding claims, wherein the fusion protein comprises a plurality of binding polypeptides.
4. The fusion protein of claim 3, further comprising a linker positioned between at least two adjacent binding polypeptides.
5. The fusion protein of claim 2, further comprising a linker positioned between at least two adjacent unstructured polypeptides.
6. The fusion protein of any one of claims 4-5, wherein the linker comprises at least one glycine and at least one serine.
7. The fusion protein of claim 6, wherein the linker comprises an amino acid sequence consisting of SEQ ID NO: 3 ((Gly4Ser)3).
8. The fusion protein of any one of claims 4-5, wherein the linker comprises an amino acid sequence consisting of SEQ ID NO: 4.
9. The fusion protein of any one of claims 3-8, wherein the plurality of binding polypeptides forms an oligomer.
10. The fusion protein of any one of claims 3-9, wherein the binding polypeptide binds a target, and wherein the fusion protein binds more than one target.
11. The fusion protein of any one of the preceding claims, wherein the at least one binding polypeptide comprises a Fibronectin type III (Fnlll) domain.
12. The fusion protein of claim 11 , wherein the Fnlll domain binds TNF-related apoptosis- inducing ligand receptor 2 (TRAILR-2).
13. The fusion protein of any one of the preceding claims, wherein the at least one binding polypeptide comprises at least one amino acid sequence of consisting of SEQ ID NO: 17 (RGDS).
14. The fusion protein of claim 13, wherein the at least one binding polypeptide comprises a plurality of amino acid sequences consisting of SEQ ID NO: 17 (RGDS).
15. The fusion protein of any one of the preceding claims, wherein the at least one unstructured polypeptide comprises at least one PG motif comprising an amino acid sequence selected from PG, P(X)nG (SEQ ID NO: 18), and (U)mP(X)nG(Z)p (SEQ ID NO: 20), or a combination thereof, wherein m, n, and p are independently an integer from 1 to 15, and wherein U, X, and Z are independently any amino acid.
16. The fusion protein of any one of the preceding claims, wherein the at least one unstructured polypeptide comprises a thermally responsive polypeptide.
17. The fusion protein of claim 16, wherein the thermally responsive polypeptide comprises an elastin-like polypeptide (ELP).
18. The fusion protein of any one of the preceding claims, wherein the at least one unstructured polypeptide comprises an amino acid sequence consisting of (VPGXG)n (SEQ ID
NO: 19), wherein X is any amino acid except proline and n is an integer greater than or equal to 1.
19. The fusion protein of claim 18, wherein n is 60, 120, or 180.
20. The fusion protein of claim 18, wherein X is valine.
21. The fusion protein of any one of the preceding claims, further comprising at least one linker positioned between the at least one binding polypeptide and the at least one unstructured polypeptide.
22. The fusion protein of claim 21 , wherein the fusion protein comprises a plurality of linkers between the at least one binding polypeptide and the at least one unstructured polypeptide.
23. The fusion protein of any one of the preceding claims, wherein the at least one binding polypeptide is positioned N-terminal to the at least one unstructured polypeptide.
24. The fusion protein of any one of claims 1-23 wherein the at least one binding polypeptide is positioned C-terminal to the at least one unstructured polypeptide.
25. The fusion protein of any one of the preceding claims, wherein the at least one unstructured polypeptide has a LCST between about 0°C and about 100°C.
26. The fusion protein of any one of the preceding claims, wherein the at least one unstructured polypeptide has a UCST between about 0°C and about 100°C
27. A method for treating a disease in a subject in need thereof, the method comprising administering to the subject an effective amount of the fusion protein according to any one of the preceding claims.
28. The method of claim 27, wherein the fusion protein is administered in a controlled release formulation.
29. The method of claim 27, wherein the fusion protein forms a depot upon administration to the subject.
30. The method of any one of claims 27-28, wherein the fusion protein is administered intravenously, intraarterially, or intraperitoneally to the subject.
31. The method of any one of claims 27-30, wherein the disease comprises cancer.
32. The method of claim 31 , wherein the fusion protein is administered intratumorally.
33. The method of any one of claims 27-32, wherein the cancer is colorectal
adenocarcinoma.
34. The method of any one of claims 27-33, wherein the at least one binding polypeptide comprises an Fnlll domain or a plurality of Fnlll domains, and wherein the disease is a disease associated with TRAILR-2.
35. The method of any one of claims 27-34, wherein the disease is a disease associated with a target of the at least one binding polypeptide.
36. A multivalent fusion protein comprising at least one Fibronectin type III (Fnlll) domain and at least one elastin-like polypeptide (ELP), wherein the Fnlll domain binds TNF-related apoptosis-inducing ligand receptor 2 (TRAILR-2).
37. The multivalent fusion protein of claim 36, wherein the at least one ELP comprises an amino acid sequence consisting of (VPGXG)n (SEQ ID NO: 19), wherein X is any amino acid except proline and n is an integer greater than or equal to 1.
38. The multivalent fusion protein of claim 37, wherein n is 60, 120, or 180.
39. The multivalent fusion protein of claim 37, wherein X is valine.
40. The multivalent fusion protein of any one of claims 36-39, wherein the at least one Fnlll domain comprises an amino acid sequence consisting of SEQ ID NO: 1.
41. The multivalent fusion protein of any one of claims 36-40, wherein the multivalent fusion protein comprises a plurality of Fnlll domains.
42. The multivalent fusion protein of claim 41 , wherein the multivalent fusion protein comprises 2, 4, or 6 Fnlll domains.
43. The multivalent fusion protein of claim 41 or 42, wherein the multivalent fusion protein further comprises a linker positioned between at least two adjacent Fnlll domains.
44. The multivalent fusion protein of claim 43, wherein the linker comprises at least one glycine and at least one serine.
45. The multivalent fusion protein of claim 44, wherein the linker comprises an amino acid sequence consisting of SEQ ID NO: 3 ((Gly4Ser)3).
46. The multivalent fusion protein of claim 43, wherein the linker comprises an amino acid sequence consisting of SEQ ID NO: 4.
47. A method for treating a disease associated with TNF-related apoptosis-inducing ligand receptor 2 (TRAILR-2) in a subject in need thereof, the method comprising administering to the subject an effective amount of the multivalent fusion protein of any one of claims 36-46.
48. The method of claim 47, wherein the disease comprises cancer.
49. The method of claim 48, wherein the cancer comprises colorectal adenocarcinoma.
50. The method of any one of claims 47-49, wherein the multivalent fusion protein is administered intravenously, intraarterially, or intraperitoneally to the subject.
51. The method of any one of claims 48-49, wherein the multivalent fusion protein is administered intratumorally.
52. The method of any one of claims 47-51 , wherein the multivalent fusion protein forms a depot upon administration to the subject.
53. The method of any one of claims 47-51 , wherein the multivalent fusion protein is administered in a controlled release formulation.
54. A method of diagnosing a disease in a subject, the method comprising:
contacting a sample from the subject with the fusion protein according to any one of claims 1-26; and
detecting binding of the fusion protein to a target to determine presence of the target in the sample, wherein the presence of the target in the sample indicates the disease in the subject.
55. The method of claim 54, wherein the disease is selected from cancer, metabolic disease, autoimmune disease, cardiovascular disease, and orthopedic disorder.
56. A method of determining the presence of a target in a sample, the method comprising: contacting the sample with the fusion protein of any one of claims 1-26 under conditions to allow a complex to form between the fusion protein and the target in the sample; and
detecting the presence of the complex, wherein presence of the complex is indicative of the target in the sample.
57. The method of claim 56, wherein the sample is obtained from a subject and the method further comprises diagnosing a disease, prognosticating, or assessing the efficacy of a treatment of the subject.
58. The method of claim 57, wherein when the method further comprises assessing the efficacy of a treatment of the subject, then the method further comprises modifying the treatment of the subject as needed to improve efficacy.
59. A method of determining the effectiveness of a treatment for a disease in a subject in need thereof, the method comprising:
contacting a sample from the subject with the fusion protein of any one of claims 1-26 under conditions to allow a complex to form between the fusion protein and a target in the sample;
determining the level of the complex in the sample, wherein the level of the complex is indicative of the level of the target in the sample; and
comparing the level of the target in the sample to a control level of the target, wherein if the level of the target is different from the control level, then the treatment is determined to be effective or ineffective in treating the disease.
60. A method of diagnosing a disease in a subject, the method comprising:
contacting a sample from the subject with the fusion protein of any one of claims 1-26; determining the level of a target in the sample; and
comparing the level of the target in the sample to a control level of the target, wherein a level of the target different from the control level indicates disease in the subject.
61. The method of claim 59 or 60, wherein the control level corresponds to the level in the subject at a time point before or during the period when the subject has begun treatment, and wherein the sample is taken from the subject at a later time point.
62. The method of claim 59 or 60, wherein the sample is taken from the subject at a time point during the period when the subject is undergoing treatment, and wherein the control level corresponds to a disease-free level or to the level at a time point before the period when the subject has begun treatment.
63. The method of any one of claims 59 and 61-62, the method further comprising modifying the treatment or administering a different treatment to the subject when the treatment is determined to be ineffective in treating the disease.
64. The method of any one of claims 54-63, wherein the fusion protein is labeled with a reporter.
65. The method of any one of claims 54-64, wherein the disease is selected from cancer, metabolic disease, autoimmune disease, cardiovascular disease, and orthopedic disorder.
Priority Applications (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US15/561,799 US10385115B2 (en) | 2015-03-26 | 2016-03-25 | Fibronectin type III domain-based fusion proteins |
| US16/525,374 US20190345228A1 (en) | 2015-03-26 | 2019-07-29 | Targeted therapeutic agents comprising multivalent protein-biopolymer fusions |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201562138847P | 2015-03-26 | 2015-03-26 | |
| US62/138,847 | 2015-03-26 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US15/561,799 A-371-Of-International US10385115B2 (en) | 2015-03-26 | 2016-03-25 | Fibronectin type III domain-based fusion proteins |
| US16/525,374 Continuation US20190345228A1 (en) | 2015-03-26 | 2019-07-29 | Targeted therapeutic agents comprising multivalent protein-biopolymer fusions |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2016154530A1 true WO2016154530A1 (en) | 2016-09-29 |
Family
ID=56977795
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2016/024202 Ceased WO2016154530A1 (en) | 2015-03-26 | 2016-03-25 | Targeted therapeutic agents comprising multivalent protein-biopolymer fusions |
Country Status (2)
| Country | Link |
|---|---|
| US (2) | US10385115B2 (en) |
| WO (1) | WO2016154530A1 (en) |
Cited By (22)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10364451B2 (en) | 2013-05-30 | 2019-07-30 | Duke University | Polymer conjugates having reduced antigenicity and methods of using the same |
| US10385115B2 (en) | 2015-03-26 | 2019-08-20 | Duke University | Fibronectin type III domain-based fusion proteins |
| US10392611B2 (en) | 2013-05-30 | 2019-08-27 | Duke University | Polymer conjugates having reduced antigenicity and methods of using the same |
| WO2019183476A1 (en) * | 2018-03-23 | 2019-09-26 | Duke University | Sustained-release biopolymer-immunotoxin conjugates and methods of using same |
| WO2020037100A1 (en) * | 2018-08-16 | 2020-02-20 | Isolere Bio, Inc. | Genetically encoded polypeptide for affinity capture and purification of biologics |
| EP3515928A4 (en) * | 2016-09-23 | 2020-04-01 | Duke University | NON-REPETITIVE UNSTRUCTURED POLYPEPTIDES HAVING LCST BEHAVIOR |
| WO2021062033A1 (en) * | 2019-09-24 | 2021-04-01 | Providence Health & Services - Oregon | Fusion polypeptides binding antibody fc domains and integrin and methods of use |
| US11135301B2 (en) | 2016-09-14 | 2021-10-05 | Duke University | Triblock polypeptide-based nanoparticles for the delivery of hydrophilic drugs |
| US11458205B2 (en) | 2015-08-04 | 2022-10-04 | Duke University | Genetically encoded intrinsically disordered stealth polymers for delivery and methods of using same |
| US11467156B2 (en) | 2016-06-01 | 2022-10-11 | Duke University | Nonfouling biosensors |
| US11491206B1 (en) | 2018-02-13 | 2022-11-08 | Duke University | Compositions and methods for the treatment of trail-resistant cancer |
| US11512314B2 (en) | 2019-07-12 | 2022-11-29 | Duke University | Amphiphilic polynucleotides |
| US11554097B2 (en) | 2017-05-15 | 2023-01-17 | Duke University | Recombinant production of hybrid lipid-biopolymer materials that self-assemble and encapsulate agents |
| US11591576B2 (en) | 2020-02-19 | 2023-02-28 | Isolere Bio, Inc. | Protein-based purification matrices and methods of using the same |
| US11648200B2 (en) | 2017-01-12 | 2023-05-16 | Duke University | Genetically encoded lipid-polypeptide hybrid biomaterials that exhibit temperature triggered hierarchical self-assembly |
| US11649275B2 (en) | 2018-08-02 | 2023-05-16 | Duke University | Dual agonist fusion proteins |
| US11680083B2 (en) | 2017-06-30 | 2023-06-20 | Duke University | Order and disorder as a design principle for stimuli-responsive biopolymer networks |
| US11752213B2 (en) | 2015-12-21 | 2023-09-12 | Duke University | Surfaces having reduced non-specific binding and antigenicity |
| US12257308B2 (en) | 2018-04-30 | 2025-03-25 | Duke University | Stimuli-responsive PEG-like polymer-based drug delivery platform |
| US12296018B2 (en) | 2018-01-26 | 2025-05-13 | Duke University | Albumin binding peptide-drug (AlBiPeD) conjugates and methods of making and using same |
| US12594347B2 (en) | 2018-09-07 | 2026-04-07 | Duke University | Nanoparticulate drug delivery systems |
| US12630590B2 (en) | 2023-04-19 | 2026-05-19 | Duke University | Order and disorder as a design principle for stimuli-responsive biopolymer networks |
Families Citing this family (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2021178481A1 (en) * | 2020-03-04 | 2021-09-10 | Duke University | Protein nanoparticle design and application |
| CN113817071B (en) * | 2021-09-16 | 2023-06-02 | 聊城大学 | EGFR-targeted TRAIL fusion protein and preparation method and application thereof |
Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20130016589A1 (en) * | 2010-03-26 | 2013-01-17 | Citizen Watch Co Ltd | Radio-controlled timepiece |
| US20130079277A1 (en) * | 2008-06-27 | 2013-03-28 | Duke University | Therapeutic agents comprising elastin-like peptides |
| US20130079280A1 (en) * | 2010-04-13 | 2013-03-28 | Medlmmune, Llc | Fibronectin type iii domain-based multimeric scaffolds |
Family Cites Families (84)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4554101A (en) | 1981-01-09 | 1985-11-19 | New York Blood Center, Inc. | Identification and preparation of epitopes on antigens and allergens on the basis of hydrophilicity |
| US4976734A (en) | 1985-10-31 | 1990-12-11 | Uab Research Foundation | Stimulation of chemotaxis by chemotactic peptides |
| US5336256A (en) | 1986-04-17 | 1994-08-09 | Uab Research Foundation | Elastomeric polypeptides as vascular prosthetic materials |
| US5250516A (en) | 1986-04-17 | 1993-10-05 | Uab Research Foundation | Bioelastomeric materials suitable for the protection of burn areas or the protection of wound repair sites from the occurrence of adhesions |
| US5120643A (en) | 1987-07-13 | 1992-06-09 | Abbott Laboratories | Process for immunochromatography with colloidal particles |
| US5703055A (en) | 1989-03-21 | 1997-12-30 | Wisconsin Alumni Research Foundation | Generation of antibodies through lipid mediated DNA delivery |
| US5362623A (en) | 1991-06-14 | 1994-11-08 | The John Hopkins University | Sequence specific DNA binding by p53 |
| US5545130A (en) | 1992-04-08 | 1996-08-13 | Genetronics, Inc. | Flow through electroporation method |
| US5702359A (en) | 1995-06-06 | 1997-12-30 | Genetronics, Inc. | Needle electrodes for mediated delivery of drugs and genes |
| US5679647A (en) | 1993-08-26 | 1997-10-21 | The Regents Of The University Of California | Methods and devices for immunizing a host against tumor-associated antigens through administration of naked polynucleotides which encode tumor-associated antigenic peptides |
| US5919455A (en) | 1993-10-27 | 1999-07-06 | Enzon, Inc. | Non-antigenic branched polymer conjugates |
| US6933366B2 (en) | 1996-12-27 | 2005-08-23 | Tripep Ab | Specificity exchangers that redirect antibodies to bacterial adhesion receptors |
| US5869326A (en) | 1996-09-09 | 1999-02-09 | Genetronics, Inc. | Electroporation employing user-configured pulsing scheme |
| JP2001511162A (en) | 1997-02-06 | 2001-08-07 | ノボ ノルディスク アクティーゼルスカブ | Polypeptide-polymer conjugates with attached and / or removed attachment groups |
| US6216034B1 (en) | 1997-08-01 | 2001-04-10 | Genetronics, Inc. | Method of programming an array of needle electrodes for electroporation therapy of tissue |
| US6241701B1 (en) | 1997-08-01 | 2001-06-05 | Genetronics, Inc. | Apparatus for electroporation mediated delivery of drugs and genes |
| US6055453A (en) | 1997-08-01 | 2000-04-25 | Genetronics, Inc. | Apparatus for addressing needle array electrodes for electroporation therapy |
| US6208893B1 (en) | 1998-01-27 | 2001-03-27 | Genetronics, Inc. | Electroporation apparatus with connective electrode template |
| US6120493A (en) | 1998-01-27 | 2000-09-19 | Genetronics, Inc. | Method for the introduction of therapeutic agents utilizing an electroporation apparatus |
| US7087244B2 (en) | 2000-09-28 | 2006-08-08 | Battelle Memorial Institute | Thermogelling oligopeptide polymers |
| US6841617B2 (en) | 2000-09-28 | 2005-01-11 | Battelle Memorial Institute | Thermogelling biodegradable aqueous polymer solution |
| US6296831B1 (en) | 1998-04-10 | 2001-10-02 | Battelle Memorial Institute | Stimulus sensitive gel with radioisotope and methods of making |
| AU752942B2 (en) | 1998-04-13 | 2002-10-03 | Massachusetts Institute Of Technology | Comb copolymers for regulating cell-surface interactions |
| US6153655A (en) | 1998-04-17 | 2000-11-28 | Enzon, Inc. | Terminally-branched polymeric linkers and polymeric conjugates containing the same |
| WO2000002620A1 (en) | 1998-07-13 | 2000-01-20 | Genetronics, Inc. | Method and apparatus for electrically assisted topical delivery of agents for cosmetic applications |
| US6192270B1 (en) | 1998-08-14 | 2001-02-20 | Genetronics, Inc. | Apparatus and method for the delivery of drugs and genes into tissue |
| US6150148A (en) | 1998-10-21 | 2000-11-21 | Genetronics, Inc. | Electroporation apparatus for control of temperature during the process |
| AU3867400A (en) | 1999-03-19 | 2000-10-09 | Duke University | Methods of using bioelastomers |
| US7163712B2 (en) | 2000-03-03 | 2007-01-16 | Duke University | Microstamping activated polymer surfaces |
| US20050255554A1 (en) | 2000-03-20 | 2005-11-17 | Ashutosh Chilkoti | Fusion peptides isolatable by phase transition |
| US6852834B2 (en) | 2000-03-20 | 2005-02-08 | Ashutosh Chilkoti | Fusion peptides isolatable by phase transition |
| US6660247B1 (en) | 2000-06-23 | 2003-12-09 | Battelle Memorial Institute | Multiple stimulus reversible hydrogels |
| CA2425648A1 (en) | 2000-10-19 | 2002-04-19 | Epimmune Inc. | Hla class i and ii binding peptides and their uses |
| US7320793B2 (en) | 2001-01-19 | 2008-01-22 | Cytos Biotechnology Ag | Molecular antigen array |
| US6528287B2 (en) | 2001-02-13 | 2003-03-04 | Nestor D. Tomycz | Recombinant human serum transferrins containing peptides for inducing apoptosis in HIV-1 infected cells |
| EP1423514A2 (en) | 2001-09-05 | 2004-06-02 | WHATMAN plc | Stable storage of proteins |
| US7314974B2 (en) | 2002-02-21 | 2008-01-01 | Monsanto Technology, Llc | Expression of microbial proteins in plants for production of plants with improved properties |
| US7245963B2 (en) | 2002-03-07 | 2007-07-17 | Advisys, Inc. | Electrode assembly for constant-current electroporation and use |
| US20040101852A1 (en) | 2002-11-21 | 2004-05-27 | Isis Pharmaceuticals Inc. | Modulation of CGG triplet repeat binding protein 1 expression |
| AU2003221582A1 (en) | 2002-05-03 | 2003-11-17 | Millenium Biologix Inc. | Connective tissue stimulating peptides |
| WO2004000915A2 (en) | 2002-06-24 | 2003-12-31 | Tufts University | Silk biomaterials and methods of use thereof |
| US8129330B2 (en) | 2002-09-30 | 2012-03-06 | Mountain View Pharmaceuticals, Inc. | Polymer conjugates with decreased antigenicity, methods of preparation and uses thereof |
| WO2006004778A2 (en) | 2004-06-30 | 2006-01-12 | Dentsply International Inc. | Implant with a biofunctionalized surface and method for its production |
| US7884185B2 (en) | 2004-07-28 | 2011-02-08 | University Of Delaware | Hydrogels and uses thereof |
| CA2583700A1 (en) | 2004-08-11 | 2006-02-23 | Arqule, Inc. | Quinone prodrug compositions and methods of use |
| EP1924654B1 (en) | 2005-08-25 | 2020-05-06 | University of Washington | Super-low fouling sulfobetaine and carboxybetaine materials and related methods |
| US20130172274A1 (en) | 2005-12-20 | 2013-07-04 | Duke University | Methods and compositions for delivering active agents with enhanced pharmacological properties |
| JP2009525946A (en) | 2005-12-20 | 2009-07-16 | デューク・ユニヴァーシティ | Methods and compositions for delivering active agents with enhanced pharmacological properties |
| WO2007108013A2 (en) | 2006-03-22 | 2007-09-27 | National Institute Of Immunology | Novel bioconjugates as therapeutic agent and synthesis thereof |
| WO2007134245A2 (en) | 2006-05-12 | 2007-11-22 | Wisconsin Alumni Research Foundation | Elastin-like polymer delivery vehicles |
| ATE533785T1 (en) | 2006-06-13 | 2011-12-15 | Helix Biomedix Inc | PEPTIDE FRAGMENTS FOR INDUCING THE SYNTHESIS OF EXTRACELLULAR MATRIX PROTEINS |
| US8846624B2 (en) | 2006-09-11 | 2014-09-30 | Emory University | Modified protein polymers |
| CA2664033A1 (en) | 2006-11-08 | 2008-05-15 | Basf Se | Use of natural, recombinant and synthetic resilins in cosmetics |
| US20080276935A1 (en) | 2006-11-20 | 2008-11-13 | Lixiao Wang | Treatment of asthma and chronic obstructive pulmonary disease with anti-proliferate and anti-inflammatory drugs |
| WO2009026233A2 (en) | 2007-08-17 | 2009-02-26 | Northwestern University | Self assembling peptide systems and methods |
| US8366652B2 (en) | 2007-08-17 | 2013-02-05 | The Invention Science Fund I, Llc | Systems, devices, and methods including infection-fighting and monitoring shunts |
| ES2319061B1 (en) | 2007-09-11 | 2010-02-10 | Biomedal, S.L. | METHOD OF CONSERVATION OF PEPTIDES OR PROTEINS. |
| WO2009067584A1 (en) | 2007-11-20 | 2009-05-28 | Duke University | Methods and compositions for modulating drug-polymer architecture, pharmacokinetics and biodistribution |
| DE102007057802B3 (en) | 2007-11-30 | 2009-06-10 | Geneart Ag | Steganographic embedding of information in coding genes |
| CA2708751A1 (en) | 2007-12-14 | 2009-06-25 | Minitube Of America, Inc. | Gender-specific separation of sperm cells and embryos |
| US7964846B2 (en) | 2008-08-01 | 2011-06-21 | Gatan, Inc. | Retractable lens-coupled electron microscope camera with image sensor in electron microscope vacuum chamber |
| GB0913775D0 (en) | 2009-08-06 | 2009-09-16 | Medical Res Council | Multispecific peptides |
| WO2010096422A1 (en) | 2009-02-17 | 2010-08-26 | Duke University | Biomolecule polymer conjugates and methods for making the same |
| USPP21973P3 (en) | 2009-06-23 | 2011-06-14 | Cellfor Inc. | Loblolly pine tree named ‘CF LP1-7696’ |
| WO2011119484A1 (en) | 2010-03-23 | 2011-09-29 | Iogenetics, Llc | Bioinformatic processes for determination of peptide binding |
| US8557961B2 (en) | 2010-04-02 | 2013-10-15 | Amunix Operating Inc. | Alpha 1-antitrypsin compositions and methods of making and using same |
| EP4450523A3 (en) | 2010-04-02 | 2025-03-12 | Amunix Pharmaceuticals, Inc. | Binding fusion proteins, binding fusion protein-drug conjugates, xten-drug conjugates and methods of making and using same |
| EP2571421B1 (en) | 2010-05-17 | 2017-08-02 | Sentilus Holdco, LLC | Detection devices and related methods of use |
| EP2418284A1 (en) | 2010-08-13 | 2012-02-15 | ERA Biotech, S.A. | Protein body-inducing polypeptide sequences |
| US8470967B2 (en) | 2010-09-24 | 2013-06-25 | Duke University | Phase transition biopolymers and methods of use |
| EP2635308A2 (en) | 2010-11-01 | 2013-09-11 | Peptimed, Inc. | Compositions of a peptide targeting system for treating cancer |
| US9775803B2 (en) | 2011-10-19 | 2017-10-03 | Samsung Electronics Co., Ltd. | Liposome comprising elastin-like polypeptide and tumor cell targeting material and use thereof |
| WO2013065009A1 (en) | 2011-11-01 | 2013-05-10 | National Institute Of Immunology | A sortase-click reaction suite for synthesis of multivalent dendrimeric protein assembly |
| KR102109188B1 (en) | 2013-04-01 | 2020-05-11 | 삼성전자주식회사 | Temperature sensitive liposome comprising cationic lipid and use thereof |
| WO2014194244A1 (en) | 2013-05-30 | 2014-12-04 | Duke University | Enzyme-catalyzed synthesis of site-specific and stoichiometric biomolecule-polymer conjugates |
| US10449267B2 (en) | 2013-11-13 | 2019-10-22 | Massachusetts Institute Of Technology | Self-assembling underwater adhesives |
| US10501734B2 (en) | 2014-02-06 | 2019-12-10 | Yale University | Compositions and methods of use thereof for making polypeptides with many instances of nonstandard amino acids |
| WO2015130846A2 (en) | 2014-02-25 | 2015-09-03 | Duke University | Compositions and methods for the site-specific modification of polypeptides |
| US11053504B2 (en) | 2014-10-24 | 2021-07-06 | The University Of Chicago | Heat-inducible self-assembling protein domains |
| US9956300B2 (en) | 2015-03-18 | 2018-05-01 | Duke Univerity | Hydrogels formed from polypeptide micelles and methods of use thereof |
| WO2016154530A1 (en) | 2015-03-26 | 2016-09-29 | Duke University | Targeted therapeutic agents comprising multivalent protein-biopolymer fusions |
| WO2017015132A1 (en) | 2015-07-20 | 2017-01-26 | Sentilus Holdco, Llc | Chips, detectors, and methods of making and using the same |
| WO2017024182A1 (en) | 2015-08-04 | 2017-02-09 | Duke University | Genetically encoded intrinsically disordered stealth polymers for delivery and methods of using same |
| US20190015520A1 (en) | 2015-12-21 | 2019-01-17 | Duke University | Polymer conjugates having reduced antigenicity and methods of using the same |
-
2016
- 2016-03-25 WO PCT/US2016/024202 patent/WO2016154530A1/en not_active Ceased
- 2016-03-25 US US15/561,799 patent/US10385115B2/en active Active
-
2019
- 2019-07-29 US US16/525,374 patent/US20190345228A1/en not_active Abandoned
Patent Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20130079277A1 (en) * | 2008-06-27 | 2013-03-28 | Duke University | Therapeutic agents comprising elastin-like peptides |
| US20130016589A1 (en) * | 2010-03-26 | 2013-01-17 | Citizen Watch Co Ltd | Radio-controlled timepiece |
| US20130079280A1 (en) * | 2010-04-13 | 2013-03-28 | Medlmmune, Llc | Fibronectin type iii domain-based multimeric scaffolds |
| US20130096058A1 (en) * | 2010-04-13 | 2013-04-18 | Medimmune, Llc | Trail r2-specific multimeric scaffolds |
Non-Patent Citations (2)
| Title |
|---|
| HASSOUNEH, W ET AL.: "Unexpected Multivalent Display of Proteins by Temperature Triggered Self-assembly of Elastin-like Polypeptide Block Copolymers.", BIOMACROMOLECULES, vol. 13, 14 May 2012 (2012-05-14), pages 1598 - 1605, XP055317225 * |
| MURALIDHARAN, V ET AL.: "Protein Ligation: an Enabling Technology for the Biophysical Analysis of Proteins.", NATURE METHODS, vol. 3, no. 6, June 2006 (2006-06-01), pages 429 - 438, XP055317238 * |
Cited By (30)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10364451B2 (en) | 2013-05-30 | 2019-07-30 | Duke University | Polymer conjugates having reduced antigenicity and methods of using the same |
| US10392611B2 (en) | 2013-05-30 | 2019-08-27 | Duke University | Polymer conjugates having reduced antigenicity and methods of using the same |
| US10385115B2 (en) | 2015-03-26 | 2019-08-20 | Duke University | Fibronectin type III domain-based fusion proteins |
| US11458205B2 (en) | 2015-08-04 | 2022-10-04 | Duke University | Genetically encoded intrinsically disordered stealth polymers for delivery and methods of using same |
| US11752213B2 (en) | 2015-12-21 | 2023-09-12 | Duke University | Surfaces having reduced non-specific binding and antigenicity |
| US11467156B2 (en) | 2016-06-01 | 2022-10-11 | Duke University | Nonfouling biosensors |
| US11135301B2 (en) | 2016-09-14 | 2021-10-05 | Duke University | Triblock polypeptide-based nanoparticles for the delivery of hydrophilic drugs |
| US11155584B2 (en) | 2016-09-23 | 2021-10-26 | Duke University | Unstructured non-repetitive polypeptides having LCST behavior |
| EP3515928A4 (en) * | 2016-09-23 | 2020-04-01 | Duke University | NON-REPETITIVE UNSTRUCTURED POLYPEPTIDES HAVING LCST BEHAVIOR |
| US12084480B2 (en) | 2016-09-23 | 2024-09-10 | Duke University | Unstructured non-repetitive polypeptides having lcst behavior |
| US11648200B2 (en) | 2017-01-12 | 2023-05-16 | Duke University | Genetically encoded lipid-polypeptide hybrid biomaterials that exhibit temperature triggered hierarchical self-assembly |
| US11554097B2 (en) | 2017-05-15 | 2023-01-17 | Duke University | Recombinant production of hybrid lipid-biopolymer materials that self-assemble and encapsulate agents |
| US11680083B2 (en) | 2017-06-30 | 2023-06-20 | Duke University | Order and disorder as a design principle for stimuli-responsive biopolymer networks |
| US12296018B2 (en) | 2018-01-26 | 2025-05-13 | Duke University | Albumin binding peptide-drug (AlBiPeD) conjugates and methods of making and using same |
| US11491206B1 (en) | 2018-02-13 | 2022-11-08 | Duke University | Compositions and methods for the treatment of trail-resistant cancer |
| WO2019183476A1 (en) * | 2018-03-23 | 2019-09-26 | Duke University | Sustained-release biopolymer-immunotoxin conjugates and methods of using same |
| US12257308B2 (en) | 2018-04-30 | 2025-03-25 | Duke University | Stimuli-responsive PEG-like polymer-based drug delivery platform |
| US11649275B2 (en) | 2018-08-02 | 2023-05-16 | Duke University | Dual agonist fusion proteins |
| US20210261626A1 (en) * | 2018-08-16 | 2021-08-26 | Isolere Bio, Inc. | Genetically encoded polypeptide for affinity capture and purification of biologics |
| US11739126B2 (en) | 2018-08-16 | 2023-08-29 | Donaldson Company, Inc. | Genetically encoded polypeptide for affinity capture and purification of biologics |
| US12162908B2 (en) | 2018-08-16 | 2024-12-10 | Donaldson Company, Inc. | Genetically encoded polypeptide for affinity capture and purification of biologics |
| US12269847B2 (en) | 2018-08-16 | 2025-04-08 | Donaldson Company, Inc. | Genetically encoded polypeptide for affinity capture and purification of biologics |
| WO2020037100A1 (en) * | 2018-08-16 | 2020-02-20 | Isolere Bio, Inc. | Genetically encoded polypeptide for affinity capture and purification of biologics |
| US12594347B2 (en) | 2018-09-07 | 2026-04-07 | Duke University | Nanoparticulate drug delivery systems |
| US11965164B2 (en) | 2019-07-12 | 2024-04-23 | Duke University | Amphiphilic polynucleotides |
| US11512314B2 (en) | 2019-07-12 | 2022-11-29 | Duke University | Amphiphilic polynucleotides |
| WO2021062033A1 (en) * | 2019-09-24 | 2021-04-01 | Providence Health & Services - Oregon | Fusion polypeptides binding antibody fc domains and integrin and methods of use |
| US12486314B2 (en) | 2019-09-24 | 2025-12-02 | Providence Health & Services—Oregon | Fusion polypeptides binding antibody Fc domains and integrin and methods of use |
| US11591576B2 (en) | 2020-02-19 | 2023-02-28 | Isolere Bio, Inc. | Protein-based purification matrices and methods of using the same |
| US12630590B2 (en) | 2023-04-19 | 2026-05-19 | Duke University | Order and disorder as a design principle for stimuli-responsive biopolymer networks |
Also Published As
| Publication number | Publication date |
|---|---|
| US10385115B2 (en) | 2019-08-20 |
| US20190345228A1 (en) | 2019-11-14 |
| US20180258157A1 (en) | 2018-09-13 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US10385115B2 (en) | Fibronectin type III domain-based fusion proteins | |
| CN108463244B (en) | Gene-encoded intrinsically disordered stealth polymers for delivery and methods of use thereof | |
| US12084480B2 (en) | Unstructured non-repetitive polypeptides having lcst behavior | |
| AU2019210662B2 (en) | Modified AXL peptides and their use in inhibition of AXL signaling in anti-metastatic therapy | |
| CN107787327A (en) | Muteins of human lipocalin 2 having affinity for glypican-3 (GPC3) | |
| US20230093708A1 (en) | Protein nanoparticle design and application | |
| WO2021178483A2 (en) | Proteins with predictable liquid-liquid phase separation | |
| AU2008296927C1 (en) | Methods for diagnosing and treating cancers | |
| WO2025132770A1 (en) | Affitins for the treatment of cancer | |
| JP2025503924A (en) | Anti-B7-H3 compounds and methods of use | |
| Heveker et al. | An Engineered GM-CSF-CCL2 Fusokine Is |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 16769764 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 15561799 Country of ref document: US |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 16769764 Country of ref document: EP Kind code of ref document: A1 |
