WO2016153839A1 - Combination of a pd-1 antagonist and vorinostat for treating cancer - Google Patents
Combination of a pd-1 antagonist and vorinostat for treating cancer Download PDFInfo
- Publication number
- WO2016153839A1 WO2016153839A1 PCT/US2016/022402 US2016022402W WO2016153839A1 WO 2016153839 A1 WO2016153839 A1 WO 2016153839A1 US 2016022402 W US2016022402 W US 2016022402W WO 2016153839 A1 WO2016153839 A1 WO 2016153839A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- cancer
- human
- medicament
- saha
- antagonist
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2818—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/16—Amides, e.g. hydroxamic acids
- A61K31/165—Amides, e.g. hydroxamic acids having aromatic rings, e.g. colchicine, atenolol, progabide
- A61K31/167—Amides, e.g. hydroxamic acids having aromatic rings, e.g. colchicine, atenolol, progabide having the nitrogen of a carboxamide group directly attached to the aromatic ring, e.g. lidocaine, paracetamol
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/3955—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
Definitions
- the present invention relates to combination therapies useful for the treatment of cancer.
- the invention relates to a combination therapy which comprises an antagonist of a Programmed Death 1 protein (PD-1) and vorinostat, which is a histone deactylase (HDAC) inhibitor.
- PD-1 Programmed Death 1 protein
- HDAC histone deactylase
- PD-1 is recognized as an important player in immune regulation and the maintenance of peripheral tolerance. PD-1 is moderately expressed on naive T, B and NKT cells and up-regulated by T/B cell receptor signaling on lymphocytes, monocytes and myeloid cells
- PD-Ll Two known ligands for PD-1, PD-Ll (B7-H1) and PD-L2 (B7-DC), are expressed in human cancers arising in various tissues.
- PD-Ll expression correlated with poor prognosis and reduced overall survival irrespective of subsequent treatment (2-13).
- PD-1 expression on tumor infiltrating lymphocytes was found to mark dysfunctional T cells in breast cancer and melanoma (14-15) and to correlate with poor prognosis in renal cancer (16).
- PD-Ll expressing tumor cells interact with PD-1 expressing T cells to attenuate T cell activation and evasion of immune surveillance, thereby contributing to an impaired immune response against the tumor.
- Vorinostat also known as suberoylanilide hydroxamide acid (SAHA) belongs to a class of agents, histone deacetylase (HDAC) inhibitors, that have the ability to induce tumor cell growth arrest, differentiation and/or apoptosis (Richon, V.M., Webb, Y., Merger, R., et al. (1996) PNAS 93 :5705-8). These compounds are targeted towards mechanisms inherent to the ability of a neoplastic cell to become malignant, as they do not appear to have toxicity in doses effective for inhibition of tumor growth in animals (Cohen, L.A., Amin, S., Marks, P.
- HDAC histone deacetylase
- Histones H2A, H2B, H3 and H4 are found in the nucleosomes and HI is a linker located between nucleosomes.
- Each nucleosome contains two of each histone type within its core, except for HI, which is present singly in the outer portion of the nucleosome structure. It is believed that when the histone proteins are hypoacetylated, there is a greater affinity of the histone to the DNA phosphate backbone. This affinity causes DNA to be tightly bound to the histone and renders the DNA inaccessible to transcriptional regulatory elements and machinery.
- HAT histone acetyl transferase
- HDAC histone deacetylase
- the invention provides a method for treating cancer in an individual comprising administering to the individual a combination therapy which comprises a PD-1 antagonist and an HDAC inhibitor, wherein the HDAC inhibitor is SAHA or a pharmaceutically acceptable salt thereof.
- the invention provides a medicament comprising a PD-1 antagonist for use in combination with an HDAC inhibitor for treating cancer, wherein the HDAC inhibitor is SAHA or a pharmaceutically acceptable salt thereof.
- the invention provides a medicament comprising an HDAC inhibitor for use in combination with a PD-1 antagonist for treating cancer, wherein the HDAC inhibitor is SAHA or a pharmaceutically acceptable salt thereof.
- a PD-1 antagonist in the manufacture of a medicament for treating cancer in an individual when administered in combination with an HDAC inhibitor and use of an HDAC inhibitor in the manufacture of a medicament for treating cancer in an individual when administered in combination with a PD-1 antagonist.
- the HDAC inhibitor is SAHA or a pharmaceutically acceptable salt thereof.
- the invention provides use of a PD-1 antagonist and an HDAC inhibitor in the manufacture of medicaments for treating cancer in an individual, wherein the HDAC inhibitor is SAHA or a pharmaceutically acceptable salt thereof.
- the medicaments comprise a kit, and the kit also comprises a package insert comprising instructions for using the PD-1 antagonist in combination with the HDAC inhibitor to treat cancer in an individual.
- the PD-1 antagonist inhibits the binding of PD-L1 to PD-1, and preferably also inhibits the binding of PD-L2 to PD- 1.
- the PD-1 antagonist is a monoclonal antibody, or an antigen binding fragment thereof, which specifically binds to PD-1 or to PD-L1 and blocks the binding of PD-L1 to PD-1.
- the PD-1 antagonist is an anti-PD-1 antibody which comprises a heavy chain and a light chain, and wherein the heavy and light chains comprise the amino acid sequences shown in Figure 6 (SEQ ID NO:21 and SEQ ID NO:22).
- SAHA suberoylanilide hydroxamic acid
- SAHA or the pharmaceutically acceptable salt can be in crystalline or amorphous form, or a hydrate or solvate. Examples of the crystalline forms of SAHA are described in U.S. Patent 7,851,509. SAHA or the pharmaceutically acceptable salt particles may be micronized, or may be agglomerated, particulate granules, powders, oils, oily suspensions or any other form of solid.
- the individual is a human and the cancer is a solid tumor and in some embodiments, the solid tumor is bladder cancer, breast cancer, clear cell kidney cancer, squamous cell carcinoma of head and neck, lung squamous cell carcinoma, malignant melanoma, non-small-cell lung cancer (NSCLC), ovarian cancer, pancreatic cancer, prostate cancer, renal cell cancer (RCC), small-cell lung cancer (SCLC) or triple negative breast cancer.
- the cancer is NSCLC, endometrial cancer, urothelial cancer, squamous cell carcinoma of head and neck or melanoma.
- the individual is a human and the cancer is a heme malignancy and in some embodiments, the heme malignancy is acute lymphoblastic leukemia (ALL), acute myeloid leukemia (AML), chronic lymphocytic leukemia (CLL), chronic myeloid leukemia (CML), diffuse large B-cell lymphoma (DLBCL), EBV-positive DLBCL, primary mediastinal large B- cell lymphoma, T-cell/histiocyte-rich large B-cell lymphoma, follicular lymphoma, Hodgkin's lymphoma (HL), mantle cell lymphoma (MCL), multiple myeloma (MM), myeloid cell leukemia-1 protein (Mcl-1), myelodysplastic syndrome (MDS), cutaneous T- cell lymphoma, non-Hodgkin's lymphoma (NHL), or small lympho
- ALL acute lymphoblastic leukemia
- AML acute myeloid leuk
- the individual is a human
- the cancer tests positive for human PD-Ll is selected from the group consisting of NSCLC, endometrial cancer, urothelial cancer, squamous cell carcinoma of head and neck or melanoma.
- FIGURE 1 shows amino acid sequences of the light chain and heavy chain CDRs for an exemplary anti-PD-1 monoclonal antibody useful in the present invention (SEQ ID NOs: l- 6).
- FIGURE 2 shows amino acid sequences of the light chain and heavy chain CDRs for another exemplary anti-PD-1 monoclonal antibody useful in the present invention (SEQ ID NOs:7-12).
- FIGURE 3 shows amino acid sequences of the heavy chain variable region and full length heavy chain for an exemplary anti-PD-1 monoclonal antibody useful in the present invention (SEQ ID NO: 13 and SEQ ID NO: 14).
- FIGURE 4 shows amino acid sequences of alternative light chain variable regions for an exemplary anti-PD-1 monoclonal antibody useful in the present invention (SEQ ID NO: 1]
- FIGURE 5 shows amino acid sequences of alternative light chains for an exemplary anti-PD-1 monoclonal antibody useful in the present invention, with FIG. 5 A showing the amino acid sequences for the K09A-L-11 and K09A-L-16 light chains (SEQ ID NOs: 18 and 19, respectively) and FIG. 5B showing the amino acid sequence for the K09A-L-17 light chain (SEQ ID NO:20).
- FIGURE 6 shows amino acid sequences of the heavy and light chains for pembrolizumab (SEQ ID NOs. 21 and 22, respectively).
- FIGURE 7 shows amino acid sequences of the heavy and light chains for nivolumab (SEQ ID NOs. 23 and 24, respectively).
- FIGURE 8 (A) shows the mean tumor volume and demonstrates enhanced antitumor activity with concurrent administration of a PD-1 antagonist and Vorinostat compared to the monotherapy treatment arms in CT-26 tumor-bearing mice.
- Control Isotype + Vehicle, anti- PD-1 : a murine anti-mouse PD-1 mAb.
- CR complete regressions;
- PR partial regressions.
- FIGURE 9 shows the mean tumor volume and demonstrates enhanced antitumor activity with concurrent administration of a PD-1 antagonist and Vorinostat compared to the monotherapy treatment arms in RENCA tumor-bearing mice.
- Control Isotype + Vehicle, anti-PD-1 : a murine anti-mouse PD-1 mAb.
- CR complete regressions;
- PR partial regressions.
- Animal survival curves are shown.
- administering refers to contact of an exogenous pharmaceutical, therapeutic, diagnostic agent, or composition to the animal, human, subject, cell, tissue, organ, or biological fluid.
- Treatment of a cell encompasses contact of a reagent to the cell, as well as contact of a reagent to a fluid, where the fluid is in contact with the cell.
- administering and “treatment” also means in vitro and ex vivo treatments, e.g., of a cell, by a reagent, diagnostic, binding compound, or by another cell.
- subject includes any organism, preferably an animal, more preferably a mammal ⁇ e.g., rat, mouse, dog, cat, rabbit) and most preferably a human.
- the term "antibody” refers to any form of antibody that exhibits the desired biological or binding activity. Thus, it is used in the broadest sense and specifically covers, but is not limited to, monoclonal antibodies (including full length monoclonal antibodies), polyclonal antibodies, multispecific antibodies ⁇ e.g., bispecific antibodies), humanized, fully human antibodies, chimeric antibodies and camelized single domain antibodies.
- "Parental antibodies” are antibodies obtained by exposure of an immune system to an antigen prior to modification of the antibodies for an intended use, such as humanization of an antibody for use as a human therapeutic.
- the basic antibody structural unit comprises a tetramer.
- Each tetramer includes two identical pairs of polypeptide chains, each pair having one "light” (about 25 kDa) and one "heavy” chain (about 50-70 kDa).
- the amino-terminal portion of each chain includes a variable region of about 100 to 110 or more amino acids primarily responsible for antigen recognition.
- the carboxy-terminal portion of the heavy chain may define a constant region primarily responsible for effector function.
- human light chains are classified as kappa and lambda light chains.
- human heavy chains are typically classified as mu, delta, gamma, alpha, or epsilon, and define the antibody's isotype as IgM, IgD, IgG, IgA, and IgE, respectively.
- variable and constant regions are joined by a "J" region of about 12 or more amino acids, with the heavy chain also including a "D” region of about 10 more amino acids.
- variable regions of each light/heavy chain pair form the antibody binding site.
- an intact antibody has two binding sites. Except in bifunctional or bispecific antibodies, the two binding sites are, in general, the same.
- variable domains of both the heavy and light chains comprise three hypervariable regions, also called complementarity determining regions (CDRs), which are located within relatively conserved framework regions (FR).
- CDRs complementarity determining regions
- FR framework regions
- the CDRs are usually aligned by the framework regions, enabling binding to a specific epitope.
- both light and heavy chain variable domains comprise FR1, CDR1, FR2, CDR2, FR3, CDR3 and FR4.
- the assignment of amino acids to each domain is, generally, in accordance with the definitions of Sequences of Proteins of Immunological Interest Kabat, et al. National Institutes of Health, Bethesda, Md. ; 5 th ed.; NIH Publ. No.
- hypervariable region refers to the amino acid residues of an antibody that are responsible for antigen-binding.
- the hypervariable region comprises amino acid residues from a "complementarity determining region” or "CDR" (i.e. CDRLl, CDRL2 and CDRL3 in the light chain variable domain and CDRH1, CDRH2 and CDRH3 in the heavy chain variable domain).
- CDR complementarity determining region
- antibody fragment or “antigen binding fragment” refers to antigen binding fragments of antibodies, i.e. antibody fragments that retain the ability to bind specifically to the antigen bound by the full-length antibody, e.g. fragments that retain one or more CDR regions.
- antibody binding fragments include, but are not limited to, Fab, Fab', F(ab') 2 , and Fv fragments; diabodies; linear antibodies; single-chain antibody molecules, e.g., sc-Fv; nanobodies and multispecific antibodies formed from antibody fragments.
- An antibody that "specifically binds to" a specified target protein is an antibody that exhibits preferential binding to that target as compared to other proteins, but this specificity does not require absolute binding specificity.
- An antibody is considered “specific” for its intended target if its binding is determinative of the presence of the target protein in a sample, e.g. without producing undesired results such as false positives.
- Antibodies, or binding fragments thereof, useful in the present invention will bind to the target protein with an affinity that is at least two fold greater, preferably at least ten times greater, more preferably at least 20-times greater, and most preferably at least 100-times greater than the affinity with non-target proteins.
- an antibody is said to bind specifically to a polypeptide comprising a given amino acid sequence, e.g. the amino acid sequence of a mature human PD-1 or human PD-L1 molecule, if it binds to polypeptides comprising that sequence but does not bind to proteins lacking that sequence.
- Chimeric antibody refers to an antibody in which a portion of the heavy and/or light chain is identical with or homologous to corresponding sequences in an antibody derived from a particular species (e.g., human) or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is identical with or homologous to corresponding sequences in an antibody derived from another species (e.g., mouse) or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity.
- a particular species e.g., human
- another species e.g., mouse
- Human antibody refers to an antibody that comprises human immunoglobulin protein sequences only.
- a human antibody may contain murine carbohydrate chains if produced in a mouse, in a mouse cell, or in a hybridoma derived from a mouse cell.
- mouse antibody or “rat antibody” refer to an antibody that comprises only mouse or rat immunoglobulin sequences, respectively.
- Humanized antibody refers to forms of antibodies that contain sequences from non-human (e.g., murine) antibodies as well as human antibodies. Such antibodies contain minimal sequence derived from non-human immunoglobulin.
- the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable loops correspond to those of a non-human immunoglobulin and all or substantially all of the FR regions are those of a human immunoglobulin sequence.
- the humanized antibody optionally also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin.
- Fc immunoglobulin constant region
- the prefix "hum”, "hu” or “h” is added to antibody clone designations when necessary to distinguish humanized antibodies from parental rodent antibodies.
- the humanized forms of rodent antibodies will generally comprise the same CDR sequences of the parental rodent antibodies, although certain amino acid substitutions may be included to increase affinity, increase stability of the humanized antibody, or for other reasons.
- Anti-tumor response when referring to a cancer patient treated with a therapeutic regimen, such as a combination therapy described herein, means at least one positive therapeutic effect, such as for example, reduced number of cancer cells, reduced tumor size, reduced rate of cancer cell infiltration into peripheral organs, reduced rate of tumor metastasis or tumor growth, or progression free survival. Positive therapeutic effects in cancer can be measured in a number of ways (See, W. A. Weber, J. Null. Med. 50: 1 S-10S (2009); Eisenhauer et al., supra).
- an anti-tumor response to a combination therapy described herein is assessed using RECIST 1.1 criteria, bidimentional irRC or unidimensional irRC.
- an anti-tumor response is any of SD, PR, CR, PFS, or DFS.
- Bidimensional irRC refers to the set of criteria described in Wolchok JD, et al.
- Biotherapeutic agent means a biological molecule, such as an antibody or fusion protein, that blocks ligand / receptor signaling in any biological pathway that supports tumor maintenance and/or growth or suppresses the anti-tumor immune response.
- Classes of biotherapeutic agents include, but are not limited to, antibodies to VEGF, EGFR, Her2/neu, other growth factor receptors, CD20, CD40, CD-40L, CTLA-4, OX-40, 4-1BB, and ICOS.
- cancer "cancerous”, or “malignant” refer to or describe the physiological condition in mammals that is typically characterized by unregulated cell growth.
- cancer examples include but are not limited to: Cardiac: sarcoma (angiosarcoma, fibrosarcoma, rhabdomyosarcoma, liposarcoma), myxoma, rhabdomyoma, fibroma, lipoma and teratoma; Lung: bronchogenic carcinoma (squamous cell, undifferentiated small cell, undifferentiated large cell, adenocarcinoma), alveolar (bronchiolar) carcinoma, bronchial adenoma, sarcoma, lymphoma, chondromatous hamartoma, mesothelioma; Gastrointestinal: esophagus (squamous cell carcinoma, adenocarcinoma, leiomyosarcoma, lymphoma), stomach (carcinoma, lymphoma, leiomyosarcoma), pancreas (ductal adenocarcinoma, insulinoma
- the cancer is carcinoma, lymphoma, leukemia, blastoma, and sarcoma. More particular examples of such cancers include squamous cell carcinoma, myeloma, small-cell lung cancer, non-small cell lung cancer, glioma, hodgkin's lymphoma, non-hodgkin's lymphoma, acute myeloid leukemia (AML), multiple myeloma, gastrointestinal (tract) cancer, renal cancer, ovarian cancer, liver cancer, lymphoblastic leukemia, lymphocytic leukemia, colorectal cancer, endometrial cancer, kidney cancer, prostate cancer, thyroid cancer, melanoma, chondrosarcoma, neuroblastoma, pancreatic cancer, glioblastoma multiforme, cervical cancer, brain cancer, stomach cancer, bladder cancer, hepatoma, breast cancer, colon carcinoma, and head and neck cancer.
- CDR or “CDRs” as used herein means complementarity determining region(s) in a immunoglobulin variable region, defined using the Kabat numbering system, unless otherwise indicated.
- “Chemotherapeutic agent” is a chemical compound useful in the treatment of cancer.
- Classes of chemotherapeutic agents include, but are not limited to: alkylating agents, antimetabolites, kinase inhibitors, spindle poison plant alkaloids, cytoxic/anti tumor antibiotics, topisomerase inhibitors, photosensitizers, anti-estrogens and selective estrogen receptor modulators (SERMs), anti-progesterones, estrogen receptor down-regulators (ERDs), estrogen receptor antagonists, leutinizing hormone-releasing hormone agonists, anti-androgens, aromatase inhibitors, EGFR inhibitors, VEGF inhibitors, and anti-sense oligonucleotides that inhibit expression of genes implicated in abnormal cell proliferation or tumor growth.
- Chemotherapeutic agents useful in the treatment methods of the present invention include cytostatic and/or cytotoxic agents.
- Chothia as used herein means an antibody numbering system described in Al-
- Constantly modified variants or “conservative substitution” refers to substitutions of amino acids in a protein with other amino acids having similar characteristics (e.g. charge, side-chain size, hydrophobicity/hydrophilicity, backbone conformation and rigidity, etc.), such that the changes can frequently be made without altering the biological activity or other desired property of the protein, such as antigen affinity and/or specificity.
- Those of skill in this art recognize that, in general, single amino acid substitutions in non-essential regions of a polypeptide do not substantially alter biological activity (see, e.g., Watson et al. (1987) Molecular Biology of the Gene, The Benjamin/Cummings Pub. Co., p. 224 (4th Ed.)).
- substitutions of structurally or functionally similar amino acids are less likely to disrupt biological activity. Exemplary conservative substitutions are set forth in Table 1 below.
- a PD-1 antagonist that consists essentially of a recited amino acid sequence may also include one or more amino acids, including substitutions of one or more amino acid residues, which do not materially affect the properties of the binding compound.
- Diagnostic anti-PD-L monoclonal antibody means a mAb which specifically binds to the mature form of the designated PD-L (PD-Ll or PDL2) that is expressed on the surface of certain mammalian cells.
- a mature PD-L lacks the presecretory leader sequence, also referred to as leader peptide
- the terms "PD-L” and “mature PD-L” are used interchangeably herein, and shall be understood to mean the same molecule unless otherwise indicated or readily apparent from the context.
- a diagnostic anti-human PD-Ll mAb or an anti-hPD-Ll mAb refers to a monoclonal antibody that specifically binds to mature human PD-Ll .
- a mature human PD-Ll molecule consists of amino acids 19-290 of the following sequence:
- diagnostic anti-human PD-Ll mAbs useful as diagnostic mAbs for immunohistochemistry (IHC) detection of PD-Ll expression in formalin-fixed, paraffin-embedded (FFPE) tumor tissue sections are antibody 20C3 and antibody 22C3, which are described in WO2014/ 100079.
- Another anti-human PD-Ll mAb that has been reported to be useful for IHC detection of PD-Ll expression in FFPE tissue sections Choen, B.J. et al., Clin Cancer Res 19: 3462-3473 (2013)
- “Framework region” or "FR” as used herein means the immunoglobulin variable regions excluding the CDR regions.
- "Homology” refers to sequence similarity between two polypeptide sequences when they are optimally aligned. When a position in both of the two compared sequences is occupied by the same amino acid monomer subunit, e.g., if a position in a light chain CDR of two different Abs is occupied by alanine, then the two Abs are homologous at that position. The percent of homology is the number of homologous positions shared by the two sequences divided by the total number of positions compared x lOO.
- the two sequences are 80% homologous.
- the comparison is made when two sequences are aligned to give maximum percent homology.
- the comparison can be performed by a BLAST algorithm wherein the parameters of the algorithm are selected to give the largest match between the respective sequences over the entire length of the respective reference sequences.
- the following references relate to BLAST algorithms often used for sequence analysis: BLAST ALGORITHMS: Altschul, S.F., et al, (1990) J. Mol. Biol. 215:403-410; Gish, W., et al, (1993) Nature Genet.
- isolated antibody and “isolated antibody fragment” refers to the purification status and in such context means the named molecule is substantially free of other biological molecules such as nucleic acids, proteins, lipids, carbohydrates, or other material such as cellular debris and growth media. Generally, the term “isolated” is not intended to refer to a complete absence of such material or to an absence of water, buffers, or salts, unless they are present in amounts that substantially interfere with experimental or therapeutic use of the binding compound as described herein.
- Kabat as used herein means an immunoglobulin alignment and numbering system pioneered by Elvin A. Kabat ((1991) Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md.).
- conventional (polyclonal) antibody preparations typically include a multitude of different antibodies having different amino acid sequences in their variable domains, particularly their CDRs, which are often specific for different epitopes.
- the modifier “monoclonal” indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method.
- the monoclonal antibodies to be used in accordance with the present invention may be made by the hybridoma method first described by Kohler et al. (1975) Nature 256: 495, or may be made by recombinant DNA methods ⁇ see, e.g., U.S. Pat. No. 4,816,567).
- the "monoclonal antibodies” may also be isolated from phage antibody libraries using the techniques described in Clackson et al. (1991) Nature 352: 624-628 and Marks et al. (1991) J. Mol. Biol. 222: 581-597, for example. See also Presta (2005) J. Allergy Clin. Immunol. 116:731.
- Non-responder patient when referring to a specific anti-tumor response to treatment with a combination therapy described herein, means the patient did not exhibit the antitumor response.
- ORR or "objective response rate” refers in some embodiments to CR + PR
- ORR( W eek 24) refers to CR and PR measured using irRECIST in each patient in a cohort after 24 weeks of treatment with SAHA in combination with pembrolizumab.
- PD-1 antagonist means any chemical compound or biological molecule that blocks binding of PD-L1 expressed on a cancer cell to PD-1 expressed on an immune cell (T cell, B cell or NKT cell) and preferably also blocks binding of PD-L2 expressed on a cancer cell to the immune-cell expressed PD-1.
- PD-1 and its ligands include: PDCD1, PD1, CD279 and SLEB2 for PD-1; PDCD1L1, PDL1, B7H1, B7-4, CD274 and B7-H for PD-Ll; and PDCD1L2, PDL2, B7-DC, Btdc and CD273 for PD-L2.
- the PD-1 antagonist blocks binding of human PD-Ll to human PD-1, and preferably blocks binding of both human PD-Ll and PD-L2 to human PD-1.
- PD-1 antagonists useful in any of the treatment methods, medicaments and uses of the present invention include a monoclonal antibody (mAb), or antigen binding fragment thereof, which specifically binds to PD-1 or PD-Ll, and preferably specifically binds to human PD-1 or human PD-Ll .
- the mAb may be a human antibody, a humanized antibody or a chimeric antibody, and may include a human constant region.
- the human constant region is selected from the group consisting of IgGl, IgG2, IgG3 and IgG4 constant regions, and in preferred embodiments, the human constant region is an IgGl or IgG4 constant region.
- the antigen binding fragment is selected from the group consisting of Fab, Fab'-SH, F(ab') 2 , scFv and Fv fragments.
- Examples of mAbs that bind to human PD-1, and useful in the treatment method, medicaments and uses of the present invention, are described in US7488802, US7521051, US8008449, US8354509, US8168757, WO2004/004771, WO2004/072286, WO2004/056875, and US2011/0271358.
- Specific anti-human PD-1 mAbs useful as the PD-1 antagonist in the treatment method, medicaments and uses of the present invention include: pembrolizumab (also known as MK-3475), a humanized IgG4 mAb with the structure described in WHO Drug Information, Vol. 27, No.
- mAbs that bind to human PD-Ll are described in WO2013/019906, W02010/077634 Al and US8383796.
- Specific anti-human PD-Ll mAbs useful as the PD-1 antagonist in the treatment method, medicaments and uses of the present invention include MPDL3280A, BMS-936559, MEDI4736, MSB0010718C and an antibody which comprises the heavy chain and light chain variable regions of SEQ ID NO:24 and SEQ ID NO:21, respectively, of WO2013/019906.
- PD-1 antagonists useful in the treatment method, medicaments and uses of the present invention include an immunoadhesin that specifically binds to PD-1 or PD-L1, and preferably specifically binds to human PD-1 or human PD-L1, e.g., a fusion protein containing the extracellular or PD-1 binding portion of PD-L1 or PD-L2 fused to a constant region such as an Fc region of an immunoglobulin molecule.
- immunoadhesion molecules that specifically bind to PD-1 are described in WO2010/027827 and WO2011/066342.
- Specific fusion proteins useful as the PD-1 antagonist in the treatment method, medicaments and uses of the present invention include AMP-224 (also known as B7-DCIg), which is a PD-L2-FC fusion protein and binds to human PD-1.
- the PD-1 antagonist is a monoclonal antibody, or antigen binding fragment thereof, which comprises: (a) light chain CDRs SEQ ID NOs: 1, 2 and 3 and heavy chain CDRs SEQ ID NOs: 4, 5 and 6; or (b) light chain CDRs SEQ ID NOs: 7, 8 and 9 and heavy chain CDRs SEQ ID NOs: 10, 11 and 12.
- the PD-1 antagonist is a monoclonal antibody, or antigen binding fragment thereof, which specifically binds to human PD-1 and comprises (a) a heavy chain variable region comprising SEQ ID NO: 13 or a variant thereof, and (b) a light chain variable region comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 15 or a variant thereof; SEQ ID NO: 16 or a variant thereof; and SEQ ID NO: 17 or a variant thereof.
- a variant of a heavy chain variable region sequence is identical to the reference sequence except having up to 17 conservative amino acid substitutions in the framework region (i.e., outside of the CDRs), and preferably has less than ten, nine, eight, seven, six or five conservative amino acid substitutions in the framework region.
- a variant of a light chain variable region sequence is identical to the reference sequence except having up to five conservative amino acid substitutions in the framework region (i.e., outside of the CDRs), and preferably has less than four, three or two conservative amino acid substitution in the framework region.
- the PD-1 antagonist is a monoclonal antibody which specifically binds to human PD-1 and comprises (a) a heavy chain comprising SEQ ID NO: 14 and (b) a light chain comprising SEQ ID NO: 18, SEQ ID NO: 19 or SEQ ID NO:20.
- the PD-1 antagonist is a monoclonal antibody which specifically binds to human PD-1 and comprises (a) a heavy chain comprising SEQ ID NO: 14 and (b) a light chain comprising SEQ ID NO: 18.
- Table 2 below provides a list of the amino acid sequences of exemplary anti-PD-1 mAbs for use in the treatment method, medicaments and uses of the present invention, and the sequences are shown in Figures 1-5.
- PD-L1 or "PD-L2" expression as used herein means any detectable level of expression of the designated PD-L protein on the cell surface or of the designated PD-L mRNA within a cell or tissue.
- PD-L protein expression may be detected with a diagnostic PD-L antibody in an IHC assay of a tumor tissue section or by flow cytometry.
- PD-L protein expression by tumor cells may be detected by PET imaging, using a binding agent (e.g., antibody fragment, affibody and the like) that specifically binds to the desired PD-L target, e.g., PD-Ll or PD-L2.
- a binding agent e.g., antibody fragment, affibody and the like
- Techniques for detecting and measuring PD-L mRNA expression include RT- PCR and realtime quantitative RT-PCR.
- Ll expression with a positive result defined in terms of the percentage of tumor cells that exhibit histologic evidence of cell-surface membrane staining.
- a tumor tissue section is counted as positive for PD-Ll expression is at least 1%, and preferably 5% of total tumor cells.
- PD-Ll expression in the tumor tissue section is quantified in the tumor cells as well as in infiltrating immune cells, which predominantly comprise lymphocytes.
- the percentage of tumor cells and infiltrating immune cells that exhibit membrane staining are separately quantified as ⁇ 5%, 5 to 9%, and then in 10% increments up to 100%.
- PD-Ll expression is counted as negative if the score is ⁇ 5% score and positive if the score is > 5%.
- PD-Ll expression in the immune infiltrate is reported as a semi-quantitative measurement called the adjusted inflammation score (AIS), which is determined by multiplying the percent of membrane staining cells by the intensity of the infiltrate, which is graded as none (0), mild (score of 1, rare lymphocytes), moderate (score of 2, focal infiltration of tumor by lymphohistiocytic aggregates), or severe (score of 3, diffuse infiltration).
- AIS adjusted inflammation score
- the level of PD-L mRNA expression may be compared to the mRNA expression levels of one or more reference genes that are frequently used in quantitative RT-PCR, such as ubiquitin C.
- a level of PD-Ll expression (protein and/or mRNA) by malignant cells and/or by infiltrating immune cells within a tumor is determined to be "overexpressed” or “elevated” based on comparison with the level of PD-Ll expression (protein and/ or mRNA) by an appropriate control.
- a control PD-Ll protein or mRNA expression level may be the level quantified in nonmalignant cells of the same type or in a section from a matched normal tissue.
- PD-L1 expression in a tumor sample is determined to be elevated if PD-L1 protein (and/or PD-L1 mRNA) in the sample is at least 10%, 20%, or 30% greater than in the control.
- a "pembrolizumab biosimilar” means a biological product manufactured by an entity other than MSD and which is approved by a regulatory agency in any country for marketing as a pembrolizumab biosimilar.
- a pembrolizumab biosimilar comprises a pembrolizumab variant as the drug substance.
- a pembrolizumab biosimilar has the same amino acid sequence as pembrolizumab.
- a "pembrolizumab variant” means a monoclonal antibody which comprises heavy chain and light chain sequences that are identical to those in pembrolizumab, except for having three, two or one conservative amino acid substitutions at positions that are located outside of the light chain CDRs and six, five, four, three, two or one conservative amino acid substitutions that are located outside of the heavy chain CDRs, e.g, the variant positions are located in the FR regions or the constant region.
- pembrolizumab and a pembrolizumab variant comprise identical CDR sequences, but differ from each other due to having a conservative amino acid substitution at no more than three or six other positions in their full length light and heavy chain sequences, respectively.
- a pembrolizumab variant is substantially the same as pembrolizumab with respect to the following properties: binding affinity to PD-1 and ability to block the binding of each of PD-L1 and PD-L2 to PD-1.
- "RECIST 1.1 Response Criteria" as used herein means the definitions set forth in Eisenhauer et al., E.A. et al., Eur. J Cancer 45:228-247 (2009) for target lesions or nontarget lesions, as appropriate based on the context in which response is being measured.
- Responder patient when referring to a specific anti -tumor response to treatment with a combination therapy described herein, means the patient exhibited the anti-tumor response.
- sustained response means a sustained therapeutic effect after cessation of treatment with a therapeutic agent, or a combination therapy described herein.
- the sustained response has a duration that is at least the same as the treatment duration, or at least 1.5, 2.0, 2.5 or 3 times longer than the treatment duration.
- tissue Section refers to a single part or piece of a tissue sample, e.g., a thin slice of tissue cut from a sample of a normal tissue or of a tumor.
- Treat or “treating” cancer means to administer a combination therapy of a PD-1 antagonist and SAHA or a pharmaceutically acceptable salt thereof to a subject having cancer, or diagnosed with cancer, to achieve at least one positive therapeutic effect, such as for example, reduced number of cancer cells, reduced tumor size, reduced rate of cancer cell infiltration into peripheral organs, or reduced rate of tumor metastasis or tumor growth.
- Positive therapeutic effects in cancer can be measured in a number of ways (See, W. A. Weber, J. Nucl. Med. 50: 1 S-10S (2009)).
- a T/C ⁇ 42% is the minimum level of anti-tumor activity.
- response to a combination therapy described herein is assessed using RECIST 1.1 criteria or irRC (bidimensional or unidimensional) and the treatment achieved by a combination of the invention is any of PR, CR, OR, PFS, DFS and OS.
- PFS also referred to as "Time to Tumor Progression" indicates the length of time during and after treatment that the cancer does not grow, and includes the amount of time patients have experienced a CR or PR, as well as the amount of time patients have experienced SD.
- DFS refers to the length of time during and after treatment that the patient remains free of disease.
- OS refers to a prolongation in life expectancy as compared to naive or untreated individuals or patients.
- response to a combination of the invention is any of PR, CR, PFS, DFS, OR and OS that is assessed using RECIST 1.1 response criteria.
- the treatment regimen for a combination of the invention that is effective to treat a cancer patient may vary according to factors such as the disease state, age, and weight of the patient, and the ability of the therapy to elicit an anti-cancer response in the subject.
- any of the aspects of the invention may not be effective in achieving a positive therapeutic effect in every subject, it should do so in a statistically significant number of subjects as determined by any statistical test known in the art such as the Student's t-test, the chi 2 -test, the U-test according to Mann and Whitney, the Kruskal-Wallis test (H-test), Jonckheere-Terpstra- test and the Wilcoxon-test.
- any statistical test known in the art such as the Student's t-test, the chi 2 -test, the U-test according to Mann and Whitney, the Kruskal-Wallis test (H-test), Jonckheere-Terpstra- test and the Wilcoxon-test.
- treatment regimen used interchangeably to refer to the dose and timing of administration of each therapeutic agent in a combination of the invention.
- Tumor as it applies to a subject diagnosed with, or suspected of having, cancer refers to a malignant or potentially malignant neoplasm or tissue mass of any size, and includes primary tumors and secondary neoplasms.
- a solid tumor is an abnormal growth or mass of tissue that usually does not contain cysts or liquid areas. Different types of solid tumors are named for the type of cells that form them. Examples of solid tumors are sarcomas, carcinomas, and lymphomas. Leukemias (cancers of the blood) generally do not form solid tumors (National Cancer Institute, Dictionary of Cancer Terms).
- Tuor burden also referred to as “tumor load” refers to the total amount of tumor material distributed throughout the body.
- Tumor burden refers to the total number of cancer cells or the total size of tumor(s), throughout the body, including lymph nodes and bone marrow. Tumor burden can be determined by a variety of methods known in the art, such as, e.g. by measuring the dimensions of tumor(s) upon removal from the subject, e.g., using calipers, or while in the body using imaging techniques, e.g., ultrasound, bone scan, computed tomography (CT) or magnetic resonance imaging (MRI) scans.
- CT computed tomography
- MRI magnetic resonance imaging
- tumor size refers to the total size of the tumor which can be measured as the length and width of a tumor. Tumor size may be determined by a variety of methods known in the art, such as, e.g. by measuring the dimensions of tumor(s) upon removal from the subject, e.g., using calipers, or while in the body using imaging techniques, e.g., bone scan, ultrasound, CT or MRI scans.
- imaging techniques e.g., bone scan, ultrasound, CT or MRI scans.
- Variable regions or "V region” as used herein means the segment of IgG chains which is variable in sequence between different antibodies. It extends to Kabat residue 109 in the light chain and 113 in the heavy chain. II. METHODS, USES AND MEDICAMENTS
- the invention provides a method for treating cancer in an individual comprising administering to the individual a combination therapy which comprises a PD-1 antagonist and SAHA or a pharmaceutically acceptable salt thereof.
- the combination therapy may also comprise one or more additional therapeutic agents.
- the additional therapeutic agent may be, e.g., a chemotherapeutic other than SAHA, a biotherapeutic agent, an immunogenic agent (for example, attenuated cancerous cells, tumor antigens, antigen presenting cells such as dendritic cells pulsed with tumor derived antigen or nucleic acids, immune stimulating cytokines (for example, IL-2, IFNa2, GM-CSF), and cells transfected with genes encoding immune stimulating cytokines such as but not limited to GM- CSF).
- the specific dosage and dosage schedule of the additional therapeutic agent can further vary, and the optimal dose, dosing schedule and route of administration will be determined based upon the specific therapeutic agent that is being used.
- chemotherapeutic agents include alkylating agents such as thiotepa and cyclosphosphamide; alkyl sulfonates such as busulfan, improsulfan and piposulfan; aziridines such as benzodopa, carboquone, meturedopa, and uredopa; ethylenimines and methylamelamines including altretamine, triethylenemelamine, trietylenephosphoramide, triethylenethiophosphoramide and trimethylolomelamine; acetogenins (especially bullatacin and bullatacinone); a camptothecin (including the synthetic analogue topotecan); bryostatin; cally statin; CC-1065 (including its adozelesin, carzelesin and bizelesin synthetic analogues); cryptophycins (particularly cryptophycin 1 and cryptophycin 8); dolastatin; duocarmycin (
- calicheamicin especially calicheamicin gammall and calicheamicin phill, see, e.g., Agnew, Chem. Intl. Ed. Engl., 33 : 183-186 (1994); dynemicin, including dynemicin A; bisphosphonates, such as clodronate; an esperamicin; as well as neocarzinostatin chromophore and related chromoprotein enediyne antibiotic chromomophores), aclacinomysins, actinomycin, authramycin, azaserine, bleomycins, cactinomycin, carabicin, caminomycin, carzinophilin, chromomycins, dactinomycin, daunorubicin, detorubicin, 6-diazo-5-oxo-L-norleucine, doxorubicin (including morpholino- doxorubicin,
- paclitaxel and doxetaxel paclitaxel and doxetaxel; chlorambucil; gemcitabine; 6-thioguanine; mercaptopurine; methotrexate; platinum analogs such as cisplatin and carboplatin; vinblastine; platinum; etoposide (VP- 16); ifosfamide; mitoxantrone; vincristine; vinorelbine; novantrone; teniposide; edatrexate; daunomycin; aminopterin; xeloda; ibandronate; CPT-11; topoisomerase inhibitor RFS 2000; difluoromethylormthine (DMFO); retinoids such as retinoic acid; capecitabine; and pharmaceutically acceptable salts, acids or derivatives of any of the above.
- platinum analogs such as cisplatin and carboplatin
- vinblastine platinum
- anti-hormonal agents that act to regulate or inhibit hormone action on tumors
- SERMs selective estrogen receptor modulators
- aromatase inhibitors that inhibit the enzyme aromatase, which regulates estrogen production in the adrenal glands, such as, for example, 4(5)- imidazoles, aminoglutethimide, megestrol acetate, exemestane, formestane, fadrozole, vorozole, letrozole, and anastrozole
- anti-androgens such as flutamide, nilutamide, bicalutamide, leuprolide, and goserelin
- pharmaceutically acceptable salts, acids or derivatives of any of the above such as anti-estrogens and selective estrogen receptor modulators
- Each therapeutic agent in a combination therapy of the invention may be administered either alone or in a medicament (also referred to herein as a pharmaceutical composition) which comprises the therapeutic agent and one or more pharmaceutically acceptable carriers, excipients and diluents, according to standard pharmaceutical practice.
- Each therapeutic agent in a combination therapy of the invention may be administered simultaneously (i.e., in the same medicament), concurrently (i.e., in separate medicaments administered one right after the other in any order) or sequentially in any order.
- Sequential administration is particularly useful when the therapeutic agents in the combination therapy are in different dosage forms (one agent is a tablet or capsule and another agent is a sterile liquid) and/or are administered on different dosing schedules, e.g., a chemotherapeutic that is administered at least daily and a biotherapeutic that is administered less frequently, such as once weekly, once every two weeks, or once every three weeks.
- the SAHA or a pharmaceutically acceptable salt thereof is administered before administration of the PD-1 antagonist, while in other embodiments, the SAHA or a pharmaceutically acceptable salt thereof is administered after administration of the PD-1 antagonist. In one embodiment, the SAHA or a pharmaceutically acceptable salt thereof is administered for 2 cycles of 28 days, followed by the administration of the PD-1 antagonist. In another embodiment, the SAHA or a pharmaceutically acceptable salt thereof is administered concurrently with the PD-1 antagonist.
- the SAHA or a pharmaceutically acceptable salt thereof and azacitidine is administered before administration of the PD-1 antagonist, while in other embodiments, the SAHA or a pharmaceutically acceptable salt thereof and azacitidine is administered after administration of the PD-1 antagonist.
- the SAHA or a pharmaceutically acceptable salt thereof and azacitidine is first concurrently administered, followed by the administration of the PD-1 antagonist.
- the SAHA or a pharmaceutically acceptable salt thereof is administered after azacitidine, followed by the administration of the PD-1 antagonist.
- the SAHA or a pharmaceutically acceptable salt thereof and azacitidine is administered concurrently with the PD-1 antagonist.
- At least one of the therapeutic agents in the combination therapy is administered using the same dosage regimen (dose, frequency and duration of treatment) that is typically employed when the agent is used as monotherapy for treating the same cancer.
- the patient receives a lower total amount of at least one of the therapeutic agents in the combination therapy than when the agent is used as monotherapy, e.g., smaller doses, less frequent doses, and/or shorter treatment duration.
- Each small molecule therapeutic agent in a combination therapy of the invention can be administered orally or parenterally, including the intravenous, intramuscular, intraperitoneal, subcutaneous, rectal, topical, and transdermal routes of administration.
- a combination therapy of the invention may be used prior to or following surgery to remove a tumor and may be used prior to, during or after radiation therapy.
- a combination therapy of the invention is administered to a patient who has not been previously treated with a biotherapeutic or chemotherapeutic agent, i.e., is treatment-naive.
- the combination therapy is administered to a patient who failed to achieve a sustained response after prior therapy with a biotherapeutic or chemotherapeutic agent, i.e., is treatment-experienced.
- a combination therapy of the invention is typically used to treat a tumor that is large enough to be found by palpation or by imaging techniques well known in the art, such as MRI, ultrasound, or CAT scan.
- a combination therapy of the invention is preferably administered to a human patient who has a cancer that tests positive for PD-L1 expression.
- PD-L1 expression is detected using a diagnostic anti-human PD-L1 antibody, or antigen binding fragment thereof, in an IHC assay on an FFPE or frozen tissue section of a tumor sample removed from the patient.
- the patient's physician would order a diagnostic test to determine PD-L1 expression in a tumor tissue sample removed from the patient prior to initiation of treatment with the PD-1 antagonist and the SAHA or a pharmaceutically acceptable salt thereof, but it is envisioned that the physician could order the first or subsequent diagnostic tests at any time after initiation of treatment, such as for example after completion of a treatment cycle.
- a dosage regimen for a combination therapy of the invention depends on several factors, including the serum or tissue turnover rate of the entity, the level of symptoms, the immunogenicity of the entity, and the accessibility of the target cells, tissue or organ in the individual being treated.
- a dosage regimen maximizes the amount of each therapeutic agent delivered to the patient consistent with an acceptable level of side effects.
- the dose amount and dosing frequency of each biotherapeutic and chemotherapeutic agent in the combination depends in part on the particular therapeutic agent, the severity of the cancer being treated, and patient characteristics. Guidance in selecting appropriate doses of antibodies, cytokines, and small molecules are available.
- Determination of the appropriate dosage regimen may be made by the clinician, e.g., using parameters or factors known or suspected in the art to affect treatment or predicted to affect treatment, and will depend, for example, the patient's clinical history (e.g., previous therapy), the type and stage of the cancer to be treated and biomarkers of response to one or more of the therapeutic agents in the combination therapy.
- Biotherapeutic agents in a combination therapy of the invention may be administered by continuous infusion, or by doses at intervals of, e.g., daily, every other day, three times per week, or one time each week, two weeks, three weeks, monthly, bimonthly, etc.
- a total weekly dose is generally at least 0.05 ⁇ g/kg, 0.2 ⁇ g/kg, 0.5 ⁇ g/kg, 1 ⁇ g/kg, 10 ⁇ g/kg, 100 ⁇ g/kg, 0.2 mg/kg, 1.0 mg/kg, 2.0 mg/kg, 10 mg/kg, 25 mg/kg, 50 mg/kg body weight or more. See, e.g., Yang et al. (2003) New Engl. J. Med.
- the dosing regimen will comprise administering the anti-human PD-1 mAb at a dose of 1, 2, 3, 5 or lOmg/kg at intervals of about 14 days ( ⁇ 2 days) or about 21 days ( ⁇ 2 days) or about 30 days ( ⁇ 2 days) throughout the course of treatment.
- the dosing regimen will comprise administering the anti- human PD-1 mAb at a dose of from about 0.005 mg/kg to about 10 mg/kg, with intra-patient dose escalation.
- the interval between doses will be progressively shortened, e.g., about 30 days ( ⁇ 2 days) between the first and second dose, about 14 days ( ⁇ 2 days) between the second and third doses.
- the dosing interval will be about 14 days ( ⁇ 2 days), for doses subsequent to the second dose.
- a subject will be administered an intravenous (IV) infusion of a medicament comprising any of the PD-1 antagonists described herein.
- the PD-1 antagonist in the combination therapy is nivolumab, which is administered intravenously at a dose selected from the group consisting of: 1 mg/kg Q2W, 2 mg/kg Q2W, 3 mg/kg Q2W, 5 mg/kg Q2W, 10 mg Q2W, 1 mg/kg Q3W, 2 mg/kg Q3W, 3 mg/kg Q3W, 5 mg/kg Q3W, and 10 mg Q3W.
- the PD-1 antagonist in the combination therapy is pembrolizumab, a pembrolizumab variant or a pembrolizumab biosimilar, which is administered in a liquid medicament at a dose selected from the group consisting of 1 mg/kg Q2W, 2 mg/kg Q2W, 3 mg/kg Q2W, 5 mg/kg Q2W, 10 mg Q2W, 1 mg/kg Q3W, 2 mg/kg Q3W, 3 mg/kg Q3W, 5 mg/kg Q3W, 10 mg Q3W and flat-dose equivalents of any of these doses, i.e., such as 200 mg Q3W.
- pembrolizumab is provided as a liquid medicament which comprises 25 mg/ml pembrolizumab, 7% (w/v) sucrose, 0.02% (w/v) polysorbate 80 in 10 mM histidine buffer pH 5.5.
- the selected dose of pembrolizumab is administered by IV infusion. In one embodiment, the selected dose of pembrolizumab is administered by IV infusion over a time period of between 25 and 40 minutes, or about 30 minutes.
- the optimal dose for pembrolizumab in combination with SAHA or a pharmaceutically acceptable salt thereof may be identified by dose escalation or dose de- escalation of one or both of these agents.
- the combination therapy comprises a 21 day treatment cycle in which pembrolizumab is administered at 200 mg Q3W and SAHA is orally administered at 400 mg once daily, 300 mg once daily, 200 mg once daily or 100 mg once daily.
- a patient is treated with 200 mg of pembrolizumab Q3W and SAHA is orally administered at 300 mg twice daily, 200 mg twice daily or 100 mg twice daily.
- SAHA or a pharmaceutically acceptable salt thereof and azacitidine is administered for 2 cycles of 28 days, followed by administration of 200 mg pembrolizumab every two weeks or three weeks.
- SAHA is administered orally 400 mg once daily and azacitidine is administered 40 mg/m 2 subcutaneous days 1-6, 8-10 for 2 cycles of 28 days, followed by administration of 200 mg pembrolizumab every three weeks.
- azacitidine is administered subcutaneously once a day at 75 mg/m 2 /day on days 1-7 and SAHA is orally administed 200 mg or 300 mg 2-3 times daily on days 3-5, 3-9, 3-11 or 3-16, for 2 cycles of 28 days, followed by administration of 200 mg pembrolizumab every three weeks.
- azacitidine is subcutaneously administered 75 mg/m 2 /day daily for 5 days (Days 1 - 5)
- SAHA is administered 200 mg orally three times a day for 5 days (Days 1 - 5), for 2 cycles of 28 days, followed by administration of 200 mg pembrolizumab every three weeks.
- pembrolizumab is administered via IV infusion.
- the patient is treated with the combination therapy for at least 24 weeks, e.g., eight 3-week cycles. In some embodiments, treatment with the combination therapy continues until the patient exhibits evidence of PD or a CR.
- SAHA can be administered in accordance with any dose and dosing schedule that, together with the effect of the PD-1 antagonist, achieves a dose effective to treat cancer.
- SAHA can be administered in a total daily dose of up to 800 mg, preferably orally, once, twice or three times daily, continuously (every day) or intermittently (e.g., 3-5 days a week).
- SAHA is administered once daily at a dose of about 200-600 mg. In another embodiment, SAHA is administered twice daily at a dose of about 200-300 mg. In another embodiment, SAHA is administered twice daily at a dose of about 200-300 mg intermittently, for example three, four or five days per week. In one embodiment, the daily dose of SAHA is 200 mg which can be administered once-daily, twice-daily or three-times daily. In one embodiment, the daily dose of SAHA is 300 mg which can be administered once-daily, or twice-daily. In one embodiment, the daily dose of SAHA is 400 mg which can be administered once-daily. In other embodiments, SAHA is administered once daily at a dose of 200, 300 or 400 mg for 3, 4 or 5 days a week.
- the patient selected for treatment with the combination therapy of the invention if the patient has been diagnosed with NSCLC, RCC, endometrial cancer, urothelial cancer, squamous cell carcinoma of head and neck or melanoma.
- the present invention also provides a medicament which comprises a PD-1 antagonist as described above and a pharmaceutically acceptable excipient.
- the PD-1 antagonist is a biotherapeutic agent, e.g., a mAb
- the antagonist may be produced in CHO cells using conventional cell culture and recovery/purification technologies.
- a medicament comprising an anti-PD-1 antibody as the PD-1 antagonist may be provided as a liquid formulation or prepared by reconstituting a lyophilized powder with sterile water for injection prior to use.
- WO 2012/135408 describes the preparation of liquid and lyophilized medicaments comprising pembrolizumab that are suitable for use in the present invention.
- a medicament comprising pembrolizumab is provided in a glass vial which contains about 100 mg of pembrolizumab in 4 ml of solution.
- Each 1 mL of solution contains 25 mg of pembrolizumab and is formulated in: L-histidine (1.55 mg), polysorbate 80 (0.2 mg), sucrose (70 mg), and Water for Injection, USP.
- L-histidine 1.55 mg
- polysorbate 80 0.2 mg
- sucrose 70 mg
- Water for Injection USP.
- the solution requires dilution for IV infusion.
- the present invention also provides a medicament which comprises an HDAC inhibitor and a pharmaceutically acceptable excipient, wherein the HDAC inhibitor is SAHA or a pharmaceutically acceptable salt thereof.
- the medicaments described herein may be provided as a kit which comprises a first container and a second container and a package insert.
- the first container contains at least one dose of a medicament comprising a PD-1 antagonist
- the second container contains at least one dose of a medicament comprising SAHA
- the package insert, or label which comprises instructions for treating a patient for cancer using the medicaments.
- the first and second containers may be comprised of the same or different shape (e.g., vials, syringes and bottles) and/or material (e.g., plastic or glass).
- the kit may further comprise other materials that may be useful in administering the medicaments, such as diluents, filters, IV bags and lines, needles and syringes.
- the PD-1 antagonist is an anti-PD-1 antibody and the instructions state that the medicaments are intended for use in treating a patient having a cancer that tests positive for PD-L1 expression by an IHC assay.
- a method for treating cancer in an individual comprising administering to the individual a combination therapy which comprises a PD-1 antagonist and an HDAC inhibitor, wherein the HDAC inhibitor is SAHA or a pharmaceutically acceptable salt thereof.
- a medicament comprising a PD-1 antagonist for use in combination with an HDAC inhibitor for treating cancer in an individual, wherein the PD-1 antagonist is a monoclonal antibody, or an antigen binding fragment thereof and the HDAC inhibitor is SAHA or a pharmaceutically acceptable salt thereof.
- a medicament comprising an HDAC inhibitor for use in combination with a PD-1 antagonist for treating cancer in an individual, wherein the HDAC inhibitor is SAHA or a pharmaceutically acceptable salt thereof.
- a PD-1 antagonist in the manufacture of medicament for treating cancer in an individual when administered in combination with an HDAC inhibitor, wherein the HDAC inhibitor is SAHA or a pharmaceutically acceptable salt thereof.
- an HDAC inhibitor in the manufacture of a medicament for treating cancer in an individual when administered in combination with a PD-1 antagonist, wherein the HDAC inhibitor is SAHA or a pharmaceutically acceptable salt thereof.
- a PD-1 antagonist and an HDAC inhibitor in the manufacture of medicaments for treating cancer in an individual, wherein the HDAC inhibitor is SAHA or a pharmaceutically acceptable salt thereof.
- a kit which comprises a first container, a second container and a package insert, wherein the first container comprises at least one dose of a medicament comprising an anti-PD-1 antagonist, the second container comprises at least one dose of a medicament comprising an HDAC inhibitor, and the package insert comprises instructions for treating an individual for cancer using the medicaments, wherein the HDAC inhibitor is SAHA or a pharmaceutically acceptable salt thereof.
- IHC immunohistochemical
- the individual is a human and the PD-1 antagonist is a monoclonal antibody, or an antigen binding fragment thereof, which specifically binds to human PD-L1 and blocks the binding of human PD-L1 to human PD-1.
- the PD-1 antagonist is MPDL3280A, BMS-936559, MEDI4736, MSB0010718C or a monoclonal antibody which comprises the heavy chain and light chain variable regions of SEQ ID NO:24 and SEQ ID NO:21, respectively, of WO2013/019906.
- the monoclonal antibody, or antigen binding fragment thereof comprises: (a) light chain CDRs of SEQ ID NOs: 1, 2 and 3 and heavy chain CDRs of SEQ ID NOs: 4, 5 and 6; or (b) light chain CDRs of SEQ ID NOs: 7, 8 and 9 and heavy chain CDRs of SEQ ID NOs: 10, 11 and 12.
- the PD-1 antagonist is an anti-PD-1 monoclonal antibody which comprises a heavy chain and a light chain, and wherein the heavy chain comprises SEQ ID NO:21 and the light chain comprises SEQ ID NO:22.
- the PD-1 antagonist is an anti-PD-1 monoclonal antibody which comprises a heavy chain and a light chain, and wherein the heavy chain comprises SEQ ID NO:23 and the light chain comprises SEQ ID NO:24.
- the cancer is bladder cancer, breast cancer, clear cell kidney cancer, head/neck squamous cell carcinoma, lung squamous cell carcinoma, malignant melanoma, non-small-cell lung cancer (NSCLC), ovarian cancer, pancreatic cancer, prostate cancer, renal cell cancer, small-cell lung cancer (SCLC) or triple negative breast cancer.
- NSCLC non-small-cell lung cancer
- SCLC small-cell lung cancer
- ALL acute lymphoblastic leukemia
- AML acute myeloid leukemia
- CLL chronic lymphocytic leukemia
- CML chronic myeloid leukemia
- DLBCL diffuse large B-cell lymphoma
- follicular lymphoma Hodgkin's lymphoma (HL), mantle cell lymphoma (MCL), multiple myeloma (MM), myeloid cell leukemia- 1 protein (Mcl-1), myelodysplastic syndrome (MDS), non-Hodgkin's lymphoma (NHL), cutaneous T- cell lymphoma, or small lymphocytic lymphoma (SLL).
- ALL acute lymphoblastic leukemia
- AML acute myeloid leukemia
- CLL chronic lymphocytic leukemia
- CML chronic myeloid leukemia
- DLBCL diffuse large B-cell lymphoma
- follicular lymphoma Hodgkin's lymphoma
- PD-1 antagonist is pembrolizumab, a pembrolizumab variant, a pembrolizumab biosimilar or nivolumab.
- pembrolizumab is formulated as a liquid medicament which comprises 25 mg/ml pembrolizumab, 7% (w/v) sucrose, 0.02% (w/v) polysorbate 80 in 10 mM histidine buffer pH 5.5.
- a method for treating a human individual diagnosed with cancer comprising administering to the individual a combination therapy which comprises pembrolizumab and an HDAC inhibitor, wherein the HDAC inhibitor is SAHA or a pharmaceutically acceptable salt thereof, and wherein the HDAC inhibitor is orally administered at a dose of 400 mg once daily, and pembrolizumab is administered at 200 mg Q3W.
- a combination therapy which comprises pembrolizumab and an HDAC inhibitor, wherein the HDAC inhibitor is SAHA or a pharmaceutically acceptable salt thereof, and wherein the HDAC inhibitor is orally administered at a dose of 400 mg once daily, and pembrolizumab is administered at 200 mg Q3W.
- a medicament comprising pembrolizumab for use in combination with SAHA or a pharmaceutically acceptable salt thereof for treating cancer in a human individual by a method comprising administering to the individual SAHA or a pharmaceutically acceptable salt thereof at an oral dose of 400 mg once daily, and pembrolizumab at 200 mg Q3W.
- a medicament comprising SAHA or a pharmaceutically acceptable salt thereof for use in combination with pembrolizumab for treating cancer in a human individual by a method comprising administering to the individual SAHA or a pharmaceutically acceptable salt thereof, at an oral dose of 400 mg once daily, and pembrolizumab at 200 mg Q3W.
- Monoclonal, polyclonal, and humanized antibodies can be prepared (see, e.g., Sheperd and Dean (eds.) (2000) Monoclonal Antibodies, Oxford Univ. Press, New York, NY; Kontermann and Dubel (eds.) (2001) Antibody Engineering, Springer- Verlag, New York; Harlow and Lane (1988) Antibodies A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, pp. 139-243; Carpenter, et al. (2000) J. Immunol. 165:6205; He, et al. (1998) J. Immunol. 160: 1029; Tang et al. (1999) J. Biol. Chem.
- Antibodies can be conjugated, e.g., to small drug molecules, enzymes, liposomes, polyethylene glycol (PEG). Antibodies are useful for therapeutic, diagnostic, kit or other purposes, and include antibodies coupled, e.g., to dyes, radioisotopes, enzymes, or metals, e.g., colloidal gold (see, e.g., Le Doussal et al. (1991) J. Immunol. 146: 169-175; Gibellini et al. (1998) J. Immunol. 160:3891-3898; Hsing and Bishop (1999) J. Immunol. 162:2804-2811; Everts et al. (2002) J. Immunol. 168:883-889). [00163] Methods for flow cytometry, including fluorescence activated cell sorting
- FACS Fluorescence Activated Cell Sorting
- Fluorescent reagents suitable for modifying nucleic acids including nucleic acid primers and probes, polypeptides, and antibodies, for use, e.g., as diagnostic reagents, are available (Molecular Probesy (2003) Catalogue, Molecular Probes, Inc., Eugene, OR; Sigma- Aldrich (2003) Catalogue, St. Louis, MO).
- Table 3 provides a brief description of the sequences in the sequence listing.
- This experiment compared the anti-tumor response of tumor-bearing mice to treatment with one of three regimens: monotherapy with a murine anti-mouse PD-1 monoclonal antibody (anti-PD-1), monotherapy with Vorinostat and combination therapy with these two agents admini stered concurrently .
- monotherapy with a murine anti-mouse PD-1 monoclonal antibody (anti-PD-1) monotherapy with Vorinostat and combination therapy with these two agents admini stered concurrently .
- Tumor-bearing mice for this study were initiated by implanting 3 x 10 5 log-phase and sub-confluent CT-26 cells on the right lower dorsal flank of 7-8 week old female BALB/cAnN mice with an average body weight of 18 grams.
- the mean tumor volume in these mice reached - 100 cubic mm (60mm 3 -150 mm ) ( Figure 1(A))
- the tumor-bearing mice were randomized to 4 treatment groups of 12 mice per group: (1) Isotype control + Vehicle control group;(2) anti-PD-1 + Vehicle control; (3) Vorinostat + Isotype control and; (4) anti-PD-1 + Vorinostat.
- a monoclonal antibody of murine isotype IgGl against murine PD-1 and isotype control were obtained from internal sources.
- the isotype control was a mouse monoclonal antibody specific for adenoviral hexon 25 and was of the isotype IgGl .
- Formulations for each reagent were as follows: Isotype control :75mM NaCl, lOmM sodium phosphate, 3% sucrose, pH7.3; anti-PD-1 : 20mM sodium acetate, 7% sucrose, pH5.5; and Vorinostat: 0.5% HPC (hydroxypropylcellulose) with 0.002% SDS (sodium dodecyl sulfate) in sterile water.
- Anti-PD-1 was administered to treatment groups 2 and 4 at 10 mg/kg i.p. every 5 days for each of 5 cycles.
- Vorinostat was administered to treatment groups 3 and 4 at 150 mg/kg every day for 27 days.
- the anti- PD-1 monotherapy arm resulted in 17% CRs as measured through Day 29. No CRs were observed in the Vorinostat monotherapy treatment group.
- combination treatment demonstrated significantly enhanced survival (100%) at Day 30 as compared to anti-PD-1 (42%) and Vorinostat (10%) single agent treatment.
- This experiment compared the anti-tumor response of tumor-bearing mice to treatment with one of three regimens: monotherapy with a murine anti-mouse PD-1 monoclonal antibody (anti-PD-1), monotherapy with Vorinostat and combination therapy with these two agents administered concurrently.
- monotherapy with a murine anti-mouse PD-1 monoclonal antibody (anti-PD-1) monotherapy with Vorinostat and combination therapy with these two agents administered concurrently.
- Tumor-bearing mice for this study were initiated by implanting 1 x 10 6 log-phase andsub-confluent RENCA cells on the right lower dorsal flank of 7-8 week old female BALB/cmice with an average body weight of 19 grams.
- the mean tumor volume in these mice reached - 100 cubic mm (65mm 3 -140 mm ) ( Figure 9(A))
- the tumor-bearing mice were randomized to 4 treatment groups of 12 mice per group: (1) Isotype control + Vehicle control group;(2) Anti-PD-1 + Vehicle control; (3) Vorinostat + Isotype control and; (4) Anti-PD-1 + Vorinostat.
- a monoclonal antibody of murine isotype IgGl against murine PD-1 and isotype control were obtained from internal sources.
- the isotype control was a mouse monoclonal antibody specific for adenoviral hexon 25 and was of the isotype IgGl .
- the formulations for each reagent was as follows: Isotype control :75mM NaCl, lOmM sodium phosphate, 3% sucrose, pH7.3; anti-PD-1 : 20mM sodium acetate, 7% sucrose, pH5.5; and Vorinostat vehicle: 0.5% HPC (hydroxypropylcellulose) with 0.002% SDS (sodium dodecyl sulfate) in sterile water.
- Anti-PD-1 was administered to treatment groups 2 and 4 at 5 mg/kg i.p. every 5 days for each of 5 cycles.
- Vorinostat was administered to treatment groups 3 and 4 at 150 mg/kg every day for 29 days.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- Immunology (AREA)
- General Health & Medical Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Epidemiology (AREA)
- Organic Chemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Engineering & Computer Science (AREA)
- Molecular Biology (AREA)
- Microbiology (AREA)
- Genetics & Genomics (AREA)
- Pain & Pain Management (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Mycology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Endocrinology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
Abstract
The present disclosure describes combination therapies comprising an antagonist of Programmed Death 1 receptor (PD-1) and suberoylanilide hydroxamic acid (SAHA), and the use of the combination therapies for the treatment of cancer.
Description
COMBINATION OF A PD-1 ANTAGONIST AND VORINOSTAT FOR TREATING
CANCER
FIELD OF THE INVENTION
[0001] The present invention relates to combination therapies useful for the treatment of cancer. In particular, the invention relates to a combination therapy which comprises an antagonist of a Programmed Death 1 protein (PD-1) and vorinostat, which is a histone deactylase (HDAC) inhibitor.
BACKGROUND OF THE INVENTION
[0002] PD-1 is recognized as an important player in immune regulation and the maintenance of peripheral tolerance. PD-1 is moderately expressed on naive T, B and NKT cells and up-regulated by T/B cell receptor signaling on lymphocytes, monocytes and myeloid cells
(1).
[0003] Two known ligands for PD-1, PD-Ll (B7-H1) and PD-L2 (B7-DC), are expressed in human cancers arising in various tissues. In large sample sets of e.g. ovarian, renal, colorectal, pancreatic, liver cancers and melanoma, it was shown that PD-Ll expression correlated with poor prognosis and reduced overall survival irrespective of subsequent treatment (2-13). Similarly, PD-1 expression on tumor infiltrating lymphocytes was found to mark dysfunctional T cells in breast cancer and melanoma (14-15) and to correlate with poor prognosis in renal cancer (16). Thus, it has been proposed that PD-Ll expressing tumor cells interact with PD-1 expressing T cells to attenuate T cell activation and evasion of immune surveillance, thereby contributing to an impaired immune response against the tumor.
[0004] Several monoclonal antibodies that inhibit the interaction between PD-1 and one or both of its ligands PD-Ll and PD-L2 are in clinical development for treating cancer. It has been proposed that the efficacy of such antibodies might be enhanced if administered in combination with other approved or experimental cancer therapies, e.g., radiation, surgery, chemotherapeutic agents, targeted therapies, agents that inhibit other signaling pathways that are disregulated in tumors, and other immune enhancing agents.
[0005] Vorinostat, also known as suberoylanilide hydroxamide acid (SAHA), belongs to a class of agents, histone deacetylase (HDAC) inhibitors, that have the ability to induce tumor cell growth arrest, differentiation and/or apoptosis (Richon, V.M., Webb, Y., Merger, R., et al.
(1996) PNAS 93 :5705-8). These compounds are targeted towards mechanisms inherent to the ability of a neoplastic cell to become malignant, as they do not appear to have toxicity in doses effective for inhibition of tumor growth in animals (Cohen, L.A., Amin, S., Marks, P. A., Rifkind, R.A., Desai, D., and Richon, V.M. (1999) Anticancer Research 19:4999-5006). There are several lines of evidence that histone acetylation and deacetylation are mechanisms by which transcriptional regulation in a cell is achieved (Grunstein, M. (1997) Nature 389:349-52). These effects are thought to occur through changes in the structure of chromatin by altering the affinity of histone proteins for coiled DNA in the nucleosome. There are five types of histones that have been identified (designated HI, H2A, H2B, H3 and H4). Histones H2A, H2B, H3 and H4 are found in the nucleosomes and HI is a linker located between nucleosomes. Each nucleosome contains two of each histone type within its core, except for HI, which is present singly in the outer portion of the nucleosome structure. It is believed that when the histone proteins are hypoacetylated, there is a greater affinity of the histone to the DNA phosphate backbone. This affinity causes DNA to be tightly bound to the histone and renders the DNA inaccessible to transcriptional regulatory elements and machinery. The regulation of acetylated states occurs through the balance of activity between two enzyme complexes, histone acetyl transferase (HAT) and histone deacetylase (HDAC). The hypoacetylated state is thought to inhibit transcription of associated DNA. This hypoacetylated state is catalyzed by large multiprotein complexes that include HDAC enzymes. In particular, HDACs have been shown to catalyze the removal of acetyl groups from the chromatin core histones.
[0006] It has been shown in several instances that the disruption of HAT or HDAC activity is implicated in the development of a malignant phenotype. For instance, in acute promyelocytic leukemia, the oncoprotein produced by the fusion of PML and RAR alpha appears to suppress specific gene transcription through the recruitment of HDACs (Lin, R.J., Nagy, L., Inoue, S., et al. (1998) Nature 391 :811-14). In this manner, the neoplastic cell is unable to complete differentiation and leads to excess proliferation of the leukemic cell line. Zolinza® (Vorinostat, SAHA) was approved by the FDA in 2006 for the treatment of cutaneous T- cell lymphoma. SUMMARY OF THE INVENTION
[0007] In one embodiment, the invention provides a method for treating cancer in an individual comprising administering to the individual a combination therapy which comprises a PD-1 antagonist and an HDAC inhibitor, wherein the HDAC inhibitor is SAHA or a pharmaceutically acceptable salt thereof.
[0008] In another embodiment, the invention provides a medicament comprising a PD-1 antagonist for use in combination with an HDAC inhibitor for treating cancer, wherein the HDAC inhibitor is SAHA or a pharmaceutically acceptable salt thereof. In yet another embodiment, the invention provides a medicament comprising an HDAC inhibitor for use in combination with a PD-1 antagonist for treating cancer, wherein the HDAC inhibitor is SAHA or a pharmaceutically acceptable salt thereof.
[0009] Other embodiments provide use of a PD-1 antagonist in the manufacture of a medicament for treating cancer in an individual when administered in combination with an HDAC inhibitor and use of an HDAC inhibitor in the manufacture of a medicament for treating cancer in an individual when administered in combination with a PD-1 antagonist. In such embodiments, the HDAC inhibitor is SAHA or a pharmaceutically acceptable salt thereof.
[0010] In a still further embodiment, the invention provides use of a PD-1 antagonist and an HDAC inhibitor in the manufacture of medicaments for treating cancer in an individual, wherein the HDAC inhibitor is SAHA or a pharmaceutically acceptable salt thereof. In some embodiments, the medicaments comprise a kit, and the kit also comprises a package insert comprising instructions for using the PD-1 antagonist in combination with the HDAC inhibitor to treat cancer in an individual.
[0011] In all of the above treatment method, medicaments and uses, the PD-1 antagonist inhibits the binding of PD-L1 to PD-1, and preferably also inhibits the binding of PD-L2 to PD- 1. In some embodiments of the above treatment method, medicaments and uses, the PD-1 antagonist is a monoclonal antibody, or an antigen binding fragment thereof, which specifically binds to PD-1 or to PD-L1 and blocks the binding of PD-L1 to PD-1. In one embodiment, the PD-1 antagonist is an anti-PD-1 antibody which comprises a heavy chain and a light chain, and wherein the heavy and light chains comprise the amino acid sequences shown in Figure 6 (SEQ ID NO:21 and SEQ ID NO:22).
[0012] In some embodiments of the above treatment method, medicaments and uses, the
HDAC inhibitor is suberoylanilide hydroxamic acid (SAHA), which is represented by the following structural formula:
Pharmaceutically acceptable salts of SAHA with inorganic bases, for example, sodium, potassium, ammonium, calcium, or ferric hydroxides, and such organic bases as isopropylamine, trimethylamine, 2-ethylamino ethanol, histidine, procaine, and the like can also be used. SAHA or the pharmaceutically acceptable salt can be in crystalline or amorphous form, or a hydrate or solvate. Examples of the crystalline forms of SAHA are described in U.S. Patent 7,851,509. SAHA or the pharmaceutically acceptable salt particles may be micronized, or may be agglomerated, particulate granules, powders, oils, oily suspensions or any other form of solid.
[0013] In some embodiments of the above treatment method, medicaments and uses of the invention, the individual is a human and the cancer is a solid tumor and in some embodiments, the solid tumor is bladder cancer, breast cancer, clear cell kidney cancer, squamous cell carcinoma of head and neck, lung squamous cell carcinoma, malignant melanoma, non-small-cell lung cancer (NSCLC), ovarian cancer, pancreatic cancer, prostate cancer, renal cell cancer (RCC), small-cell lung cancer (SCLC) or triple negative breast cancer. In some embodiments, the cancer is NSCLC, endometrial cancer, urothelial cancer, squamous cell carcinoma of head and neck or melanoma.
[0014] In other embodiments of the above treatment method, medicaments and uses of the invention, the individual is a human and the cancer is a heme malignancy and in some embodiments, the heme malignancy is acute lymphoblastic leukemia (ALL), acute myeloid leukemia (AML), chronic lymphocytic leukemia (CLL), chronic myeloid leukemia (CML), diffuse large B-cell lymphoma (DLBCL), EBV-positive DLBCL, primary mediastinal large B- cell lymphoma, T-cell/histiocyte-rich large B-cell lymphoma, follicular lymphoma, Hodgkin's lymphoma (HL), mantle cell lymphoma (MCL), multiple myeloma (MM), myeloid cell leukemia-1 protein (Mcl-1), myelodysplastic syndrome (MDS), cutaneous T- cell lymphoma, non-Hodgkin's lymphoma (NHL), or small lymphocytic lymphoma (SLL). [0015] Also, in some embodiments of any of the above treatment method, medicaments and uses, the cancer tests positive for the expression of one or both of PD-Ll and PD-L2. In still other embodiments, the cancer has elevated PD-Ll expression.
[0016] In one embodiment of the above treatment method, medicaments and uses, the individual is a human, the cancer tests positive for human PD-Ll and is selected from the group consisting of NSCLC, endometrial cancer, urothelial cancer, squamous cell carcinoma of head and neck or melanoma.
BRIEF DESCRIPTION OF THE DRAWINGS
[0017] FIGURE 1 shows amino acid sequences of the light chain and heavy chain CDRs for an exemplary anti-PD-1 monoclonal antibody useful in the present invention (SEQ ID NOs: l- 6).
[0018] FIGURE 2 shows amino acid sequences of the light chain and heavy chain CDRs for another exemplary anti-PD-1 monoclonal antibody useful in the present invention (SEQ ID NOs:7-12).
[0019] FIGURE 3 shows amino acid sequences of the heavy chain variable region and full length heavy chain for an exemplary anti-PD-1 monoclonal antibody useful in the present invention (SEQ ID NO: 13 and SEQ ID NO: 14).
[0020] FIGURE 4 shows amino acid sequences of alternative light chain variable regions for an exemplary anti-PD-1 monoclonal antibody useful in the present invention (SEQ ID
NOs: 15-17).
[0021] FIGURE 5 shows amino acid sequences of alternative light chains for an exemplary anti-PD-1 monoclonal antibody useful in the present invention, with FIG. 5 A showing the amino acid sequences for the K09A-L-11 and K09A-L-16 light chains (SEQ ID NOs: 18 and 19, respectively) and FIG. 5B showing the amino acid sequence for the K09A-L-17 light chain (SEQ ID NO:20).
[0022] FIGURE 6 shows amino acid sequences of the heavy and light chains for pembrolizumab (SEQ ID NOs. 21 and 22, respectively).
[0023] FIGURE 7 shows amino acid sequences of the heavy and light chains for nivolumab (SEQ ID NOs. 23 and 24, respectively).
[0024] FIGURE 8 (A) shows the mean tumor volume and demonstrates enhanced antitumor activity with concurrent administration of a PD-1 antagonist and Vorinostat compared to the monotherapy treatment arms in CT-26 tumor-bearing mice. Control: Isotype + Vehicle, anti- PD-1 : a murine anti-mouse PD-1 mAb. CR = complete regressions; PR = partial regressions. (B) Animal survival curves are shown.
[0025] FIGURE 9 (A) shows the mean tumor volume and demonstrates enhanced antitumor activity with concurrent administration of a PD-1 antagonist and Vorinostat compared to the monotherapy treatment arms in RENCA tumor-bearing mice. Control: Isotype + Vehicle,
anti-PD-1 : a murine anti-mouse PD-1 mAb. CR = complete regressions; PR = partial regressions. (B) Animal survival curves are shown.
DETAILED DESCRIPTION Abbreviations. Throughout the detailed description and examples of the invention the following abbreviations will be used:
[0026] BOR Best overall response
[0027] BID One dose twice daily
[0028] CBR Clinical Benefit Rate
[0029] CDR Complementarity determining region
[0030] CHO Chinese hamster ovary
[0031] CR Complete Response
[0032] DCR Disease Control Rate
[0033] DFS Disease free survival
[0034] DLT Dose limiting toxicity
[0035] DOR Duration of Response
[0036] DSDR Durable Stable Disease Rate
[0037] FFPE Formalin-fixed, paraffin-embedded
[0038] FR Framework region
[0039] IgG Immunoglobulin G
[0040] IHC Immunohistochemistry or immunohistochemical
[0041] irRC Immune related response criteria
[0042] IV Intravenous
[0043] MTD Maximum tolerated dose
[0044] NCBI National Center for Biotechnology Information
[0045] NCI National Cancer Institute
[0046] ORR Objective response rate
[0047] OS Overall survival
[0048] PD Progressive disease
[0049] PD-1 Programmed Death 1
[0050] PD-L1 Programmed Cell Death 1 Ligand 1
[0051] PD-L2 Programmed Cell Death 1 Ligand 2
[0052] PFS Progression free survival
[0053] PR Partial response
[0054] Q2W One dose every two weeks
[0055] Q3W One dose every three weeks
[0056] QD One dose per day
[0057] RECIST Response Evaluation Criteria in Solid Tumors
[0058] SD Stable disease
[0059] VH Immunoglobulin heavy chain variable region
[0060] VK Immunoglobulin kappa light chain variable region
I. DEFINITIONS [0061] So that the invention may be more readily understood, certain technical and scientific terms are specifically defined below. Unless specifically defined elsewhere in this document, all other technical and scientific terms used herein have the meaning commonly understood by one of ordinary skill in the art to which this invention belongs.
[0062] As used herein, including the appended claims, the singular forms of words such as "a," "an," and "the," include their corresponding plural references unless the context clearly dictates otherwise.
[0063] "Administration" and "treatment," as it applies to an animal, human, experimental subject, cell, tissue, organ, or biological fluid, refers to contact of an exogenous pharmaceutical, therapeutic, diagnostic agent, or composition to the animal, human, subject, cell, tissue, organ, or biological fluid. Treatment of a cell encompasses contact of a reagent to the cell, as well as contact of a reagent to a fluid, where the fluid is in contact with the cell. "Administration" and "treatment" also means in vitro and ex vivo treatments, e.g., of a cell, by a reagent, diagnostic, binding compound, or by another cell. The term "subject" includes any organism, preferably an animal, more preferably a mammal {e.g., rat, mouse, dog, cat, rabbit) and most preferably a human.
[0064] As used herein, the term "antibody" refers to any form of antibody that exhibits the desired biological or binding activity. Thus, it is used in the broadest sense and specifically covers, but is not limited to, monoclonal antibodies (including full length monoclonal antibodies), polyclonal antibodies, multispecific antibodies {e.g., bispecific antibodies), humanized, fully human antibodies, chimeric antibodies and camelized single domain antibodies. "Parental antibodies" are antibodies obtained by exposure of an immune system to an antigen prior to modification of the antibodies for an intended use, such as humanization of an antibody for use as a human therapeutic.
[0065] In general, the basic antibody structural unit comprises a tetramer. Each tetramer includes two identical pairs of polypeptide chains, each pair having one "light" (about 25 kDa) and one "heavy" chain (about 50-70 kDa). The amino-terminal portion of each chain includes a variable region of about 100 to 110 or more amino acids primarily responsible for antigen recognition. The carboxy-terminal portion of the heavy chain may define a constant region primarily responsible for effector function. Typically, human light chains are classified as kappa and lambda light chains. Furthermore, human heavy chains are typically classified as mu, delta, gamma, alpha, or epsilon, and define the antibody's isotype as IgM, IgD, IgG, IgA, and IgE, respectively. Within light and heavy chains, the variable and constant regions are joined by a "J" region of about 12 or more amino acids, with the heavy chain also including a "D" region of about 10 more amino acids. See generally, Fundamental Immunology Ch. 7 (Paul, W., ed., 2nd ed. Raven Press, N.Y. (1989).
[0066] The variable regions of each light/heavy chain pair form the antibody binding site.
Thus, in general, an intact antibody has two binding sites. Except in bifunctional or bispecific antibodies, the two binding sites are, in general, the same.
[0067] Typically, the variable domains of both the heavy and light chains comprise three hypervariable regions, also called complementarity determining regions (CDRs), which are located within relatively conserved framework regions (FR). The CDRs are usually aligned by the framework regions, enabling binding to a specific epitope. In general, from N-terminal to C- terminal, both light and heavy chain variable domains comprise FR1, CDR1, FR2, CDR2, FR3, CDR3 and FR4. The assignment of amino acids to each domain is, generally, in accordance with the definitions of Sequences of Proteins of Immunological Interest Kabat, et al. National Institutes of Health, Bethesda, Md. ; 5th ed.; NIH Publ. No. 91-3242 (1991); Kabat (1978) Adv. Prot. Chem. 32: 1-75; Kabat, et a/., (1977) J. Biol. Chem. 252:6609-6616; Chothia, et a/., (1987) J Mol. Biol. 196:901-917 or Chothia, et al, (1989) Nature 342:878-883.
[0068] As used herein, the term "hypervariable region" refers to the amino acid residues of an antibody that are responsible for antigen-binding. The hypervariable region comprises amino acid residues from a "complementarity determining region" or "CDR" (i.e. CDRLl, CDRL2 and CDRL3 in the light chain variable domain and CDRH1, CDRH2 and CDRH3 in the heavy chain variable domain). See Kabat et al. (1991) Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (defining the CDR regions of an antibody by sequence); see also Chothia and Lesk (1987) J. Mol. Biol. 196: 901-917 (defining the CDR regions of an antibody by structure). As used herein, the term
"framework" or "FR" residues refers to those variable domain residues other than the hypervariable region residues defined herein as CDR residues.
[0069] As used herein, unless otherwise indicated, "antibody fragment" or "antigen binding fragment" refers to antigen binding fragments of antibodies, i.e. antibody fragments that retain the ability to bind specifically to the antigen bound by the full-length antibody, e.g. fragments that retain one or more CDR regions. Examples of antibody binding fragments include, but are not limited to, Fab, Fab', F(ab')2, and Fv fragments; diabodies; linear antibodies; single-chain antibody molecules, e.g., sc-Fv; nanobodies and multispecific antibodies formed from antibody fragments. [0070] An antibody that "specifically binds to" a specified target protein is an antibody that exhibits preferential binding to that target as compared to other proteins, but this specificity does not require absolute binding specificity. An antibody is considered "specific" for its intended target if its binding is determinative of the presence of the target protein in a sample, e.g. without producing undesired results such as false positives. Antibodies, or binding fragments thereof, useful in the present invention will bind to the target protein with an affinity that is at least two fold greater, preferably at least ten times greater, more preferably at least 20-times greater, and most preferably at least 100-times greater than the affinity with non-target proteins. As used herein, an antibody is said to bind specifically to a polypeptide comprising a given amino acid sequence, e.g. the amino acid sequence of a mature human PD-1 or human PD-L1 molecule, if it binds to polypeptides comprising that sequence but does not bind to proteins lacking that sequence.
[0071] "Chimeric antibody" refers to an antibody in which a portion of the heavy and/or light chain is identical with or homologous to corresponding sequences in an antibody derived from a particular species (e.g., human) or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is identical with or homologous to corresponding sequences in an antibody derived from another species (e.g., mouse) or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity.
[0072] "Human antibody" refers to an antibody that comprises human immunoglobulin protein sequences only. A human antibody may contain murine carbohydrate chains if produced in a mouse, in a mouse cell, or in a hybridoma derived from a mouse cell. Similarly, "mouse antibody" or "rat antibody" refer to an antibody that comprises only mouse or rat immunoglobulin sequences, respectively.
[0073] "Humanized antibody" refers to forms of antibodies that contain sequences from non-human (e.g., murine) antibodies as well as human antibodies. Such antibodies contain minimal sequence derived from non-human immunoglobulin. In general, the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable loops correspond to those of a non-human immunoglobulin and all or substantially all of the FR regions are those of a human immunoglobulin sequence. The humanized antibody optionally also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin. The prefix "hum", "hu" or "h" is added to antibody clone designations when necessary to distinguish humanized antibodies from parental rodent antibodies. The humanized forms of rodent antibodies will generally comprise the same CDR sequences of the parental rodent antibodies, although certain amino acid substitutions may be included to increase affinity, increase stability of the humanized antibody, or for other reasons.
[0074] "Anti-tumor response" when referring to a cancer patient treated with a therapeutic regimen, such as a combination therapy described herein, means at least one positive therapeutic effect, such as for example, reduced number of cancer cells, reduced tumor size, reduced rate of cancer cell infiltration into peripheral organs, reduced rate of tumor metastasis or tumor growth, or progression free survival. Positive therapeutic effects in cancer can be measured in a number of ways (See, W. A. Weber, J. Null. Med. 50: 1 S-10S (2009); Eisenhauer et al., supra). In some embodiments, an anti-tumor response to a combination therapy described herein is assessed using RECIST 1.1 criteria, bidimentional irRC or unidimensional irRC. In some embodiments, an anti-tumor response is any of SD, PR, CR, PFS, or DFS.
[0075] "Bidimensional irRC" refers to the set of criteria described in Wolchok JD, et al.
Guidelines for the evaluation of immune therapy activity in solid tumors: immune-related response criteria. Clin Cancer Res. 2009; 15(23):7412-7420. These criteria utilize bidimensional tumor measurements of target lesions, which are obtained by multiplying the longest diameter and the longest perpendicular diameter (cm2) of each lesion.
[0076] "Biotherapeutic agent" means a biological molecule, such as an antibody or fusion protein, that blocks ligand / receptor signaling in any biological pathway that supports tumor maintenance and/or growth or suppresses the anti-tumor immune response. Classes of biotherapeutic agents include, but are not limited to, antibodies to VEGF, EGFR, Her2/neu, other growth factor receptors, CD20, CD40, CD-40L, CTLA-4, OX-40, 4-1BB, and ICOS.
[0077] The terms "cancer", "cancerous", or "malignant" refer to or describe the physiological condition in mammals that is typically characterized by unregulated cell growth. Examples of cancer include but are not limited to: Cardiac: sarcoma (angiosarcoma, fibrosarcoma, rhabdomyosarcoma, liposarcoma), myxoma, rhabdomyoma, fibroma, lipoma and teratoma; Lung: bronchogenic carcinoma (squamous cell, undifferentiated small cell, undifferentiated large cell, adenocarcinoma), alveolar (bronchiolar) carcinoma, bronchial adenoma, sarcoma, lymphoma, chondromatous hamartoma, mesothelioma; Gastrointestinal: esophagus (squamous cell carcinoma, adenocarcinoma, leiomyosarcoma, lymphoma), stomach (carcinoma, lymphoma, leiomyosarcoma), pancreas (ductal adenocarcinoma, insulinoma, glucagonoma, gastrinoma, carcinoid tumors, vipoma), small bowel (adenocarcinoma, lymphoma, carcinoid tumors, Karposi's sarcoma, leiomyoma, hemangioma, lipoma, neurofibroma, fibroma), large bowel (adenocarcinoma, tubular adenoma, villous adenoma, hamartoma, leiomyoma) colorectal; Genitourinary tract: kidney (adenocarcinoma, Wilm's tumor [nephroblastoma], lymphoma, leukemia), bladder and urethra (squamous cell carcinoma, transitional cell carcinoma, adenocarcinoma), prostate (adenocarcinoma, sarcoma), testis (seminoma, teratoma, embryonal carcinoma, teratocarcinoma, choriocarcinoma, sarcoma, interstitial cell carcinoma, fibroma, fibroadenoma, adenomatoid tumors, lipoma); Liver: hepatoma (hepatocellular carcinoma), cholangiocarcinoma, hepatoblastoma, angiosarcoma, hepatocellular adenoma, hemangioma; Bone: osteogenic sarcoma (osteosarcoma), fibrosarcoma, malignant fibrous histiocytoma, chondrosarcoma, Ewing's sarcoma, malignant lymphoma (reticulum cell sarcoma), multiple myeloma, malignant giant cell tumor chordoma, osteochronfroma (osteocartilaginous exostoses), benign chondroma, chondroblastoma, chondromyxofibroma, osteoid osteoma and giant cell tumors; Nervous system: skull (osteoma, hemangioma, granuloma, xanthoma, osteitis deformans), meninges (meningioma, meningiosarcoma, gliomatosis), brain (astrocytoma, medulloblastoma, glioma, ependymoma, germinoma [pinealoma], glioblastoma multiform, oligodendroglioma, schwannoma, retinoblastoma, congenital tumors), spinal cord neurofibroma, meningioma, glioma, sarcoma); Gynecological: uterus (endometrial carcinoma), cervix (cervical carcinoma, pre tumor cervical dysplasia), ovaries (ovarian carcinoma [serous cystadenocarcinoma, mucinous cystadenocarcinoma, unclassified carcinoma], granulosa thecal cell tumors, Sertoli-Leydig cell tumors, dysgerminoma, malignant teratoma), vulva (squamous cell carcinoma, intraepithelial carcinoma, adenocarcinoma, fibrosarcoma, melanoma), vagina (clear cell carcinoma, squamous cell carcinoma, botryoid sarcoma (embryonal rhabdomyosarcoma), fallopian tubes (carcinoma), breast; Hematologic: blood (myeloid leukemia [acute and chronic], acute lymphoblastic leukemia, chronic lymphocytic leukemia,
myeloproliferative diseases, multiple myeloma, myelodysplastic syndrome), Hodgkin's disease, non Hodgkin's lymphoma [malignant lymphoma]; Skin: malignant melanoma, basal cell carcinoma, squamous cell carcinoma, Karposi's sarcoma, moles dysplastic nevi, lipoma, angioma, dermatofibroma, keloids, psoriasis; and Adrenal glands: neuroblastoma. In another embodiment, the cancer is carcinoma, lymphoma, leukemia, blastoma, and sarcoma. More particular examples of such cancers include squamous cell carcinoma, myeloma, small-cell lung cancer, non-small cell lung cancer, glioma, hodgkin's lymphoma, non-hodgkin's lymphoma, acute myeloid leukemia (AML), multiple myeloma, gastrointestinal (tract) cancer, renal cancer, ovarian cancer, liver cancer, lymphoblastic leukemia, lymphocytic leukemia, colorectal cancer, endometrial cancer, kidney cancer, prostate cancer, thyroid cancer, melanoma, chondrosarcoma, neuroblastoma, pancreatic cancer, glioblastoma multiforme, cervical cancer, brain cancer, stomach cancer, bladder cancer, hepatoma, breast cancer, colon carcinoma, and head and neck cancer. Another particular example of cancer includes renal cell carcinoma. Yet another particular example of cancer is non-hodgkin's lymphoma or cutaneous T- cell lymphoma. Yet another particular example of cancer is acute myeloid leukemia (AML) or myelodysplastic syndrome. Cancers that may be treated in accordance with the present invention include those characterized by elevated expression of one or both of PD-L1 and PD-L2 in tested tissue samples.
[0078] "CDR" or "CDRs" as used herein means complementarity determining region(s) in a immunoglobulin variable region, defined using the Kabat numbering system, unless otherwise indicated.
[0079] "Chemotherapeutic agent" is a chemical compound useful in the treatment of cancer. Classes of chemotherapeutic agents include, but are not limited to: alkylating agents, antimetabolites, kinase inhibitors, spindle poison plant alkaloids, cytoxic/anti tumor antibiotics, topisomerase inhibitors, photosensitizers, anti-estrogens and selective estrogen receptor modulators (SERMs), anti-progesterones, estrogen receptor down-regulators (ERDs), estrogen receptor antagonists, leutinizing hormone-releasing hormone agonists, anti-androgens, aromatase inhibitors, EGFR inhibitors, VEGF inhibitors, and anti-sense oligonucleotides that inhibit expression of genes implicated in abnormal cell proliferation or tumor growth. Chemotherapeutic agents useful in the treatment methods of the present invention include cytostatic and/or cytotoxic agents.
[0080] "Chothia" as used herein means an antibody numbering system described in Al-
Lazikani et al, JMB 273:927-948 (1997).
[0081] "Comprising" or variations such as "comprise", "comprises" or "comprised of are used throughout the specification and claims in an inclusive sense, i.e., to specify the presence of the stated features but not to preclude the presence or addition of further features that may materially enhance the operation or utility of any of the embodiments of the invention, unless the context requires otherwise due to express language or necessary implication.
[0082] "Conservatively modified variants" or "conservative substitution" refers to substitutions of amino acids in a protein with other amino acids having similar characteristics (e.g. charge, side-chain size, hydrophobicity/hydrophilicity, backbone conformation and rigidity, etc.), such that the changes can frequently be made without altering the biological activity or other desired property of the protein, such as antigen affinity and/or specificity. Those of skill in this art recognize that, in general, single amino acid substitutions in non-essential regions of a polypeptide do not substantially alter biological activity (see, e.g., Watson et al. (1987) Molecular Biology of the Gene, The Benjamin/Cummings Pub. Co., p. 224 (4th Ed.)). In addition, substitutions of structurally or functionally similar amino acids are less likely to disrupt biological activity. Exemplary conservative substitutions are set forth in Table 1 below.
[0083] TABLE 1. Exemplary Conservative Amino Acid Substitutions
[0084] "Consists essentially of," and variations such as "consist essentially of or
"consisting essentially of," as used throughout the specification and claims, indicate the inclusion
of any recited elements or group of elements, and the optional inclusion of other elements, of similar or different nature than the recited elements, that do not materially change the basic or novel properties of the specified dosage regimen, method, or composition. As a non-limiting example, a PD-1 antagonist that consists essentially of a recited amino acid sequence may also include one or more amino acids, including substitutions of one or more amino acid residues, which do not materially affect the properties of the binding compound.
[0085] "Diagnostic anti-PD-L monoclonal antibody" means a mAb which specifically binds to the mature form of the designated PD-L (PD-Ll or PDL2) that is expressed on the surface of certain mammalian cells. A mature PD-L lacks the presecretory leader sequence, also referred to as leader peptide The terms "PD-L" and "mature PD-L" are used interchangeably herein, and shall be understood to mean the same molecule unless otherwise indicated or readily apparent from the context.
[0086] As used herein, a diagnostic anti-human PD-Ll mAb or an anti-hPD-Ll mAb refers to a monoclonal antibody that specifically binds to mature human PD-Ll . A mature human PD-Ll molecule consists of amino acids 19-290 of the following sequence:
MRIFAVFIFMTYWHLLNAFTVTVPKDLYWEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNII QFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKV NAPYNKINQRILWDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTS TLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTHLVILGAILLCLGVALTFIFR LRKGRMMDVKKCGIQDTNSKKQSDTHLEET (SEQ ID NO:25).
[0087] Specific examples of diagnostic anti-human PD-Ll mAbs useful as diagnostic mAbs for immunohistochemistry (IHC) detection of PD-Ll expression in formalin-fixed, paraffin-embedded (FFPE) tumor tissue sections are antibody 20C3 and antibody 22C3, which are described in WO2014/ 100079. Another anti-human PD-Ll mAb that has been reported to be useful for IHC detection of PD-Ll expression in FFPE tissue sections (Chen, B.J. et al., Clin Cancer Res 19: 3462-3473 (2013)) is a rabbit anti-human PD-Ll mAb publicly available from Sino Biological, Inc. (Beijing, P.R. China; Catalog number 10084-R015).
[0088] "Framework region" or "FR" as used herein means the immunoglobulin variable regions excluding the CDR regions. [0089] "Homology" refers to sequence similarity between two polypeptide sequences when they are optimally aligned. When a position in both of the two compared sequences is occupied by the same amino acid monomer subunit, e.g., if a position in a light chain CDR of
two different Abs is occupied by alanine, then the two Abs are homologous at that position. The percent of homology is the number of homologous positions shared by the two sequences divided by the total number of positions compared x lOO. For example, if 8 of 10 of the positions in two sequences are matched or homologous when the sequences are optimally aligned then the two sequences are 80% homologous. Generally, the comparison is made when two sequences are aligned to give maximum percent homology. For example, the comparison can be performed by a BLAST algorithm wherein the parameters of the algorithm are selected to give the largest match between the respective sequences over the entire length of the respective reference sequences. [0090] The following references relate to BLAST algorithms often used for sequence analysis: BLAST ALGORITHMS: Altschul, S.F., et al, (1990) J. Mol. Biol. 215:403-410; Gish, W., et al, (1993) Nature Genet. 3 :266-272; Madden, T.L., et al, (1996) Meth. Enzymol. 266: 131-141; Altschul, S.F., et al, (1997) Nucleic Acids Res. 25:3389-3402; Zhang, J., et al, (1997) Genome Res. 7:649-656; Wootton, J.C., et al, (1993) Comput. Chem. 17: 149-163; Hancock, J.M. et al, (1994) Comput. Appl. Biosci. 10:67-70; ALIGNMENT SCORING SYSTEMS: Dayhoff, M.O., et al, "A model of evolutionary change in proteins." in Atlas of Protein Sequence and Structure, (1978) vol. 5, suppl. 3. M.O. Dayhoff (ed.), pp. 345-352, Natl. Biomed. Res. Found., Washington, DC; Schwartz, R.M., et al, "Matrices for detecting distant relationships." in Atlas of Protein Sequence and Structure, (1978) vol. 5, suppl. 3." M.O. Dayhoff (ed.), pp. 353-358, Natl. Biomed. Res. Found., Washington, DC; Altschul, S.F., (1991) J. Mol. Biol. 219:555-565; States, D.J., et al, (1991) Methods 3 :66-70; Henikoff, S., et al, (1992) Proc. Natl. Acad. Sci. USA 89: 10915-10919; Altschul, S.F., et al, (1993) J. Mol. Evol. 36:290-300; ALIGNMENT STATISTICS: Karlin, S., et al, (1990) Proc. Natl. Acad. Sci. USA 87:2264- 2268; Karlin, S., et al, (1993) Proc. Natl. Acad. Sci. USA 90:5873-5877; Dembo, A., et al, (1994) Ann. Prob. 22:2022-2039; and Altschul, S.F. "Evaluating the statistical significance of multiple distinct local alignments." in Theoretical and Computational Methods in Genome Research (S. Suhai, ed.), (1997) pp. 1-14, Plenum, New York.
[0091] "Isolated antibody" and "isolated antibody fragment" refers to the purification status and in such context means the named molecule is substantially free of other biological molecules such as nucleic acids, proteins, lipids, carbohydrates, or other material such as cellular debris and growth media. Generally, the term "isolated" is not intended to refer to a complete absence of such material or to an absence of water, buffers, or salts, unless they are present in
amounts that substantially interfere with experimental or therapeutic use of the binding compound as described herein.
[0092] "Kabat" as used herein means an immunoglobulin alignment and numbering system pioneered by Elvin A. Kabat ((1991) Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md.).
[0093] "Monoclonal antibody" or "mAb" or "Mab", as used herein, refers to a population of substantially homogeneous antibodies, i.e., the antibody molecules comprising the population are identical in amino acid sequence except for possible naturally occurring mutations that may be present in minor amounts. In contrast, conventional (polyclonal) antibody preparations typically include a multitude of different antibodies having different amino acid sequences in their variable domains, particularly their CDRs, which are often specific for different epitopes. The modifier "monoclonal" indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method. For example, the monoclonal antibodies to be used in accordance with the present invention may be made by the hybridoma method first described by Kohler et al. (1975) Nature 256: 495, or may be made by recombinant DNA methods {see, e.g., U.S. Pat. No. 4,816,567). The "monoclonal antibodies" may also be isolated from phage antibody libraries using the techniques described in Clackson et al. (1991) Nature 352: 624-628 and Marks et al. (1991) J. Mol. Biol. 222: 581-597, for example. See also Presta (2005) J. Allergy Clin. Immunol. 116:731.
[0094] "Non-responder patient", when referring to a specific anti-tumor response to treatment with a combination therapy described herein, means the patient did not exhibit the antitumor response.
[0095] "ORR" or "objective response rate" refers in some embodiments to CR + PR, and ORR(Week 24) refers to CR and PR measured using irRECIST in each patient in a cohort after 24 weeks of treatment with SAHA in combination with pembrolizumab.
[0096] "Patient" or "subject" refers to any single subject for which therapy is desired or that is participating in a clinical trial, epidemiological study or used as a control, including humans and mammalian veterinary patients such as cattle, horses, dogs, and cats. [0097] "PD-1 antagonist" means any chemical compound or biological molecule that blocks binding of PD-L1 expressed on a cancer cell to PD-1 expressed on an immune cell (T cell, B cell or NKT cell) and preferably also blocks binding of PD-L2 expressed on a cancer cell to
the immune-cell expressed PD-1. Alternative names or synonyms for PD-1 and its ligands include: PDCD1, PD1, CD279 and SLEB2 for PD-1; PDCD1L1, PDL1, B7H1, B7-4, CD274 and B7-H for PD-Ll; and PDCD1L2, PDL2, B7-DC, Btdc and CD273 for PD-L2. In any of the treatment method, medicaments and uses of the present invention in which a human individual is being treated, the PD-1 antagonist blocks binding of human PD-Ll to human PD-1, and preferably blocks binding of both human PD-Ll and PD-L2 to human PD-1. Human PD-1 amino acid sequences can be found in NCBI Locus No.: NP 005009. Human PD-Ll and PD-L2 amino acid sequences can be found in NCBI Locus No. : NP_054862 and NP_079515, respectively. [0098] PD-1 antagonists useful in any of the treatment methods, medicaments and uses of the present invention include a monoclonal antibody (mAb), or antigen binding fragment thereof, which specifically binds to PD-1 or PD-Ll, and preferably specifically binds to human PD-1 or human PD-Ll . The mAb may be a human antibody, a humanized antibody or a chimeric antibody, and may include a human constant region. In some embodiments the human constant region is selected from the group consisting of IgGl, IgG2, IgG3 and IgG4 constant regions, and in preferred embodiments, the human constant region is an IgGl or IgG4 constant region. In some embodiments, the antigen binding fragment is selected from the group consisting of Fab, Fab'-SH, F(ab')2, scFv and Fv fragments.
[0099] Examples of mAbs that bind to human PD-1, and useful in the treatment method, medicaments and uses of the present invention, are described in US7488802, US7521051, US8008449, US8354509, US8168757, WO2004/004771, WO2004/072286, WO2004/056875, and US2011/0271358. Specific anti-human PD-1 mAbs useful as the PD-1 antagonist in the treatment method, medicaments and uses of the present invention include: pembrolizumab (also known as MK-3475), a humanized IgG4 mAb with the structure described in WHO Drug Information, Vol. 27, No. 2, pages 161-162 (2013) and which comprises the heavy and light chain amino acid sequences shown in Figure 6; nivolumab (BMS-936558), a human IgG4 mAb with the structure described in WHO Drug Information, Vol. 27, No. 1, pages 68-69 (2013) and which comprises the heavy and light chain amino acid sequences shown in Figure 7; the humanized antibodies h409Al l, h409A16 and h409A17, which are described in WO2008/156712, and AMP-514, which is being developed by Medlmmune.
[00100] Examples of mAbs that bind to human PD-Ll, and useful in the treatment method, medicaments and uses of the present invention, are described in WO2013/019906, W02010/077634 Al and US8383796. Specific anti-human PD-Ll mAbs useful as the PD-1
antagonist in the treatment method, medicaments and uses of the present invention include MPDL3280A, BMS-936559, MEDI4736, MSB0010718C and an antibody which comprises the heavy chain and light chain variable regions of SEQ ID NO:24 and SEQ ID NO:21, respectively, of WO2013/019906. [00101] Other PD-1 antagonists useful in the treatment method, medicaments and uses of the present invention include an immunoadhesin that specifically binds to PD-1 or PD-L1, and preferably specifically binds to human PD-1 or human PD-L1, e.g., a fusion protein containing the extracellular or PD-1 binding portion of PD-L1 or PD-L2 fused to a constant region such as an Fc region of an immunoglobulin molecule. Examples of immunoadhesion molecules that specifically bind to PD-1 are described in WO2010/027827 and WO2011/066342. Specific fusion proteins useful as the PD-1 antagonist in the treatment method, medicaments and uses of the present invention include AMP-224 (also known as B7-DCIg), which is a PD-L2-FC fusion protein and binds to human PD-1.
[00102] In some preferred embodiments of the treatment method, medicaments and uses of the present invention, the PD-1 antagonist is a monoclonal antibody, or antigen binding fragment thereof, which comprises: (a) light chain CDRs SEQ ID NOs: 1, 2 and 3 and heavy chain CDRs SEQ ID NOs: 4, 5 and 6; or (b) light chain CDRs SEQ ID NOs: 7, 8 and 9 and heavy chain CDRs SEQ ID NOs: 10, 11 and 12.
[00103] In other preferred embodiments of the treatment method, medicaments and uses of the present invention, the PD-1 antagonist is a monoclonal antibody, or antigen binding fragment thereof, which specifically binds to human PD-1 and comprises (a) a heavy chain variable region comprising SEQ ID NO: 13 or a variant thereof, and (b) a light chain variable region comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 15 or a variant thereof; SEQ ID NO: 16 or a variant thereof; and SEQ ID NO: 17 or a variant thereof. A variant of a heavy chain variable region sequence is identical to the reference sequence except having up to 17 conservative amino acid substitutions in the framework region (i.e., outside of the CDRs), and preferably has less than ten, nine, eight, seven, six or five conservative amino acid substitutions in the framework region. A variant of a light chain variable region sequence is identical to the reference sequence except having up to five conservative amino acid substitutions in the framework region (i.e., outside of the CDRs), and preferably has less than four, three or two conservative amino acid substitution in the framework region.
[00104] In another preferred embodiment of the treatment method, medicaments and uses of the present invention, the PD-1 antagonist is a monoclonal antibody which specifically binds
to human PD-1 and comprises (a) a heavy chain comprising SEQ ID NO: 14 and (b) a light chain comprising SEQ ID NO: 18, SEQ ID NO: 19 or SEQ ID NO:20.
[00105] In yet another preferred embodiment of the treatment method, medicaments and uses of the present invention, the PD-1 antagonist is a monoclonal antibody which specifically binds to human PD-1 and comprises (a) a heavy chain comprising SEQ ID NO: 14 and (b) a light chain comprising SEQ ID NO: 18.
[00106] Table 2 below provides a list of the amino acid sequences of exemplary anti-PD-1 mAbs for use in the treatment method, medicaments and uses of the present invention, and the sequences are shown in Figures 1-5.
[00107] "PD-L1" or "PD-L2" expression as used herein means any detectable level of expression of the designated PD-L protein on the cell surface or of the designated PD-L mRNA within a cell or tissue. PD-L protein expression may be detected with a diagnostic PD-L antibody in an IHC assay of a tumor tissue section or by flow cytometry. Alternatively, PD-L
protein expression by tumor cells may be detected by PET imaging, using a binding agent (e.g., antibody fragment, affibody and the like) that specifically binds to the desired PD-L target, e.g., PD-Ll or PD-L2. Techniques for detecting and measuring PD-L mRNA expression include RT- PCR and realtime quantitative RT-PCR.
[00108] Several approaches have been described for quantifying PD-Ll protein expression in IHC assays of tumor tissue sections. See, e.g., Thompson, R. H., et al., PNAS 101 (49); 17174- 17179 (2004); Thompson, R. H. et al., Cancer Res. 66:3381-3385 (2006); Gadiot, J., et al., Cancer 117:2192-2201 (2011); Taube, J. M. et al., Sci Transl Med 4, 127ra37 (2012); and Toplian, S. L. et al., New Eng. J Med. 366 (26): 2443-2454 (2012). [00109] One approach employs a simple binary end-point of positive or negative for PD-
Ll expression, with a positive result defined in terms of the percentage of tumor cells that exhibit histologic evidence of cell-surface membrane staining. A tumor tissue section is counted as positive for PD-Ll expression is at least 1%, and preferably 5% of total tumor cells.
[00110] In another approach, PD-Ll expression in the tumor tissue section is quantified in the tumor cells as well as in infiltrating immune cells, which predominantly comprise lymphocytes. The percentage of tumor cells and infiltrating immune cells that exhibit membrane staining are separately quantified as < 5%, 5 to 9%, and then in 10% increments up to 100%. For tumor cells, PD-Ll expression is counted as negative if the score is < 5% score and positive if the score is > 5%. PD-Ll expression in the immune infiltrate is reported as a semi-quantitative measurement called the adjusted inflammation score (AIS), which is determined by multiplying the percent of membrane staining cells by the intensity of the infiltrate, which is graded as none (0), mild (score of 1, rare lymphocytes), moderate (score of 2, focal infiltration of tumor by lymphohistiocytic aggregates), or severe (score of 3, diffuse infiltration). A tumor tissue section is counted as positive for PD-Ll expression by immune infiltrates if the AIS is > 5.
[00111] The level of PD-L mRNA expression may be compared to the mRNA expression levels of one or more reference genes that are frequently used in quantitative RT-PCR, such as ubiquitin C.
[00112] In some embodiments, a level of PD-Ll expression (protein and/or mRNA) by malignant cells and/or by infiltrating immune cells within a tumor is determined to be "overexpressed" or "elevated" based on comparison with the level of PD-Ll expression (protein and/ or mRNA) by an appropriate control. For example, a control PD-Ll protein or mRNA expression level may be the level quantified in nonmalignant cells of the same type or in a
section from a matched normal tissue. In some preferred embodiments, PD-L1 expression in a tumor sample is determined to be elevated if PD-L1 protein (and/or PD-L1 mRNA) in the sample is at least 10%, 20%, or 30% greater than in the control.
[00113] A "pembrolizumab biosimilar" means a biological product manufactured by an entity other than MSD and which is approved by a regulatory agency in any country for marketing as a pembrolizumab biosimilar. In an embodiment, a pembrolizumab biosimilar comprises a pembrolizumab variant as the drug substance. In an embodiment, a pembrolizumab biosimilar has the same amino acid sequence as pembrolizumab.
[00114] As used herein, a "pembrolizumab variant" means a monoclonal antibody which comprises heavy chain and light chain sequences that are identical to those in pembrolizumab, except for having three, two or one conservative amino acid substitutions at positions that are located outside of the light chain CDRs and six, five, four, three, two or one conservative amino acid substitutions that are located outside of the heavy chain CDRs, e.g, the variant positions are located in the FR regions or the constant region. In other words, pembrolizumab and a pembrolizumab variant comprise identical CDR sequences, but differ from each other due to having a conservative amino acid substitution at no more than three or six other positions in their full length light and heavy chain sequences, respectively. A pembrolizumab variant is substantially the same as pembrolizumab with respect to the following properties: binding affinity to PD-1 and ability to block the binding of each of PD-L1 and PD-L2 to PD-1. [00115] "RECIST 1.1 Response Criteria" as used herein means the definitions set forth in Eisenhauer et al., E.A. et al., Eur. J Cancer 45:228-247 (2009) for target lesions or nontarget lesions, as appropriate based on the context in which response is being measured.
[00116] "Responder patient" when referring to a specific anti -tumor response to treatment with a combination therapy described herein, means the patient exhibited the anti-tumor response.
[00117] "Sustained response" means a sustained therapeutic effect after cessation of treatment with a therapeutic agent, or a combination therapy described herein. In some embodiments, the sustained response has a duration that is at least the same as the treatment duration, or at least 1.5, 2.0, 2.5 or 3 times longer than the treatment duration. [00118] "Tissue Section" refers to a single part or piece of a tissue sample, e.g., a thin slice of tissue cut from a sample of a normal tissue or of a tumor.
[00119] "Treat" or "treating" cancer as used herein means to administer a combination therapy of a PD-1 antagonist and SAHA or a pharmaceutically acceptable salt thereof to a subject having cancer, or diagnosed with cancer, to achieve at least one positive therapeutic effect, such as for example, reduced number of cancer cells, reduced tumor size, reduced rate of cancer cell infiltration into peripheral organs, or reduced rate of tumor metastasis or tumor growth. Positive therapeutic effects in cancer can be measured in a number of ways (See, W. A. Weber, J. Nucl. Med. 50: 1 S-10S (2009)). For example, with respect to tumor growth inhibition, according to NCI standards, a T/C≤42% is the minimum level of anti-tumor activity. A T/C < 10% is considered a high anti -tumor activity level, with T/C (%) = Median tumor volume of the treated/Median tumor volume of the control χ 100. In some embodiments, response to a combination therapy described herein is assessed using RECIST 1.1 criteria or irRC (bidimensional or unidimensional) and the treatment achieved by a combination of the invention is any of PR, CR, OR, PFS, DFS and OS. PFS, also referred to as "Time to Tumor Progression" indicates the length of time during and after treatment that the cancer does not grow, and includes the amount of time patients have experienced a CR or PR, as well as the amount of time patients have experienced SD. DFS refers to the length of time during and after treatment that the patient remains free of disease. OS refers to a prolongation in life expectancy as compared to naive or untreated individuals or patients. In some embodiments, response to a combination of the invention is any of PR, CR, PFS, DFS, OR and OS that is assessed using RECIST 1.1 response criteria. The treatment regimen for a combination of the invention that is effective to treat a cancer patient may vary according to factors such as the disease state, age, and weight of the patient, and the ability of the therapy to elicit an anti-cancer response in the subject. While an embodiment of any of the aspects of the invention may not be effective in achieving a positive therapeutic effect in every subject, it should do so in a statistically significant number of subjects as determined by any statistical test known in the art such as the Student's t-test, the chi2-test, the U-test according to Mann and Whitney, the Kruskal-Wallis test (H-test), Jonckheere-Terpstra- test and the Wilcoxon-test.
[00120] The terms "treatment regimen", "dosing protocol" and "dosing regimen" are used interchangeably to refer to the dose and timing of administration of each therapeutic agent in a combination of the invention.
[00121] "Tumor" as it applies to a subject diagnosed with, or suspected of having, cancer refers to a malignant or potentially malignant neoplasm or tissue mass of any size, and includes primary tumors and secondary neoplasms. A solid tumor is an abnormal growth or mass of tissue
that usually does not contain cysts or liquid areas. Different types of solid tumors are named for the type of cells that form them. Examples of solid tumors are sarcomas, carcinomas, and lymphomas. Leukemias (cancers of the blood) generally do not form solid tumors (National Cancer Institute, Dictionary of Cancer Terms). [00122] "Tumor burden" also referred to as "tumor load", refers to the total amount of tumor material distributed throughout the body. Tumor burden refers to the total number of cancer cells or the total size of tumor(s), throughout the body, including lymph nodes and bone marrow. Tumor burden can be determined by a variety of methods known in the art, such as, e.g. by measuring the dimensions of tumor(s) upon removal from the subject, e.g., using calipers, or while in the body using imaging techniques, e.g., ultrasound, bone scan, computed tomography (CT) or magnetic resonance imaging (MRI) scans.
[00123] The term "tumor size" refers to the total size of the tumor which can be measured as the length and width of a tumor. Tumor size may be determined by a variety of methods known in the art, such as, e.g. by measuring the dimensions of tumor(s) upon removal from the subject, e.g., using calipers, or while in the body using imaging techniques, e.g., bone scan, ultrasound, CT or MRI scans.
[00124] "Variable regions" or "V region" as used herein means the segment of IgG chains which is variable in sequence between different antibodies. It extends to Kabat residue 109 in the light chain and 113 in the heavy chain. II. METHODS, USES AND MEDICAMENTS
[00125] In one aspect of the invention, the invention provides a method for treating cancer in an individual comprising administering to the individual a combination therapy which comprises a PD-1 antagonist and SAHA or a pharmaceutically acceptable salt thereof.
[00126] The combination therapy may also comprise one or more additional therapeutic agents. The additional therapeutic agent may be, e.g., a chemotherapeutic other than SAHA, a biotherapeutic agent, an immunogenic agent (for example, attenuated cancerous cells, tumor antigens, antigen presenting cells such as dendritic cells pulsed with tumor derived antigen or nucleic acids, immune stimulating cytokines (for example, IL-2, IFNa2, GM-CSF), and cells transfected with genes encoding immune stimulating cytokines such as but not limited to GM- CSF). The specific dosage and dosage schedule of the additional therapeutic agent can further vary, and the optimal dose, dosing schedule and route of administration will be determined based upon the specific therapeutic agent that is being used.
[00127] Examples of chemotherapeutic agents include alkylating agents such as thiotepa and cyclosphosphamide; alkyl sulfonates such as busulfan, improsulfan and piposulfan; aziridines such as benzodopa, carboquone, meturedopa, and uredopa; ethylenimines and methylamelamines including altretamine, triethylenemelamine, trietylenephosphoramide, triethylenethiophosphoramide and trimethylolomelamine; acetogenins (especially bullatacin and bullatacinone); a camptothecin (including the synthetic analogue topotecan); bryostatin; cally statin; CC-1065 (including its adozelesin, carzelesin and bizelesin synthetic analogues); cryptophycins (particularly cryptophycin 1 and cryptophycin 8); dolastatin; duocarmycin (including the synthetic analogues, KW-2189 and CBI-TMI); eleutherobin; pancrati statin; a sarcodictyin; spongistatin; nitrogen mustards such as chlorambucil, chlornaphazine, cholophosphamide, estramustine, ifosfamide, mechlorethamine, mechlorethamine oxide hydrochloride, melphalan, novembichin, phenesterine, prednimustine, trofosfamide, uracil mustard; nitrosureas such as carmustine, chlorozotocin, fotemustine, lomustine, nimustine, ranimustine; antibiotics such as the enediyne antibiotics (e.g. calicheamicin, especially calicheamicin gammall and calicheamicin phill, see, e.g., Agnew, Chem. Intl. Ed. Engl., 33 : 183-186 (1994); dynemicin, including dynemicin A; bisphosphonates, such as clodronate; an esperamicin; as well as neocarzinostatin chromophore and related chromoprotein enediyne antibiotic chromomophores), aclacinomysins, actinomycin, authramycin, azaserine, bleomycins, cactinomycin, carabicin, caminomycin, carzinophilin, chromomycins, dactinomycin, daunorubicin, detorubicin, 6-diazo-5-oxo-L-norleucine, doxorubicin (including morpholino- doxorubicin, cyanomorpholino-doxorubicin, 2-pyrrolino-doxorubicin and deoxydoxorubicin), epirubicin, esorubicin, idarubicin, marcellomycin, mitomycins such as mitomycin C, mycophenolic acid, nogalamycin, olivomycins, peplomycin, potfiromycin, puromycin, quelamycin, rodorubicin, streptonigrin, streptozocin, tubercidin, ubenimex, zinostatin, zorubicin; anti-metabolites such as methotrexate and 5-fluorouracil (5-FU); folic acid analogues such as denopterin, methotrexate, pteropterin, trimetrexate; purine analogs such as fludarabine, 6- mercaptopurine, thiamiprine, thioguanine; pyrimidine analogs such as ancitabine, azacitidine, 6- azauridine, carmofur, cytarabine, dideoxyuridine, doxifluridine, enocitabine, floxuridine; androgens such as calusterone, dromostanolone propionate, epitiostanol, mepitiostane, testolactone; anti-adrenals such as aminoglutethimide, mitotane, trilostane; folic acid replenisher such as frolinic acid; aceglatone; aldophosphamide glycoside; aminolevulinic acid; eniluracil; amsacrine; bestrabucil; bisantrene; edatraxate; defofamine; demecolcine; diaziquone; elformithine; elliptinium acetate; an epothilone; etoglucid; gallium nitrate; hydroxyurea; lentinan; lonidamine; maytansinoids such as maytansine and ansamitocins; mitoguazone;
mitoxantrone; mopidamol; nitracrine; pentostatin; phenamet; pirarubicin; losoxantrone; podophyllinic acid; 2-ethylhydrazide; procarbazine; razoxane; rhizoxin; sizofuran; spirogermanium; tenuazonic acid; triaziquone; 2, 2',2"-trichlorotriethylamine; trichothecenes (especially T-2 toxin, verracurin A, roridin A and anguidine); urethan; vindesine; dacarbazine; mannomustine; mitobronitol; mitolactol; pipobroman; gacytosine; arabinoside ("Ara-C"); cyclophosphamide; thiotepa; taxoids, e.g. paclitaxel and doxetaxel; chlorambucil; gemcitabine; 6-thioguanine; mercaptopurine; methotrexate; platinum analogs such as cisplatin and carboplatin; vinblastine; platinum; etoposide (VP- 16); ifosfamide; mitoxantrone; vincristine; vinorelbine; novantrone; teniposide; edatrexate; daunomycin; aminopterin; xeloda; ibandronate; CPT-11; topoisomerase inhibitor RFS 2000; difluoromethylormthine (DMFO); retinoids such as retinoic acid; capecitabine; and pharmaceutically acceptable salts, acids or derivatives of any of the above. Also included are anti-hormonal agents that act to regulate or inhibit hormone action on tumors such as anti-estrogens and selective estrogen receptor modulators (SERMs), including, for example, tamoxifen, raloxifene, droloxifene, 4-hydroxytamoxifen, trioxifene, keoxifene, LYl 17018, onapristone, and toremifene (Fareston); aromatase inhibitors that inhibit the enzyme aromatase, which regulates estrogen production in the adrenal glands, such as, for example, 4(5)- imidazoles, aminoglutethimide, megestrol acetate, exemestane, formestane, fadrozole, vorozole, letrozole, and anastrozole; and anti-androgens such as flutamide, nilutamide, bicalutamide, leuprolide, and goserelin; and pharmaceutically acceptable salts, acids or derivatives of any of the above. In one embodiment the therapeutic agent is a pyrimidine analog, such as azacitidine.
[00128] Each therapeutic agent in a combination therapy of the invention may be administered either alone or in a medicament (also referred to herein as a pharmaceutical composition) which comprises the therapeutic agent and one or more pharmaceutically acceptable carriers, excipients and diluents, according to standard pharmaceutical practice.
[00129] Each therapeutic agent in a combination therapy of the invention may be administered simultaneously (i.e., in the same medicament), concurrently (i.e., in separate medicaments administered one right after the other in any order) or sequentially in any order. Sequential administration is particularly useful when the therapeutic agents in the combination therapy are in different dosage forms (one agent is a tablet or capsule and another agent is a sterile liquid) and/or are administered on different dosing schedules, e.g., a chemotherapeutic that is administered at least daily and a biotherapeutic that is administered less frequently, such as once weekly, once every two weeks, or once every three weeks.
[00130] In some embodiments, the SAHA or a pharmaceutically acceptable salt thereof is administered before administration of the PD-1 antagonist, while in other embodiments, the SAHA or a pharmaceutically acceptable salt thereof is administered after administration of the PD-1 antagonist. In one embodiment, the SAHA or a pharmaceutically acceptable salt thereof is administered for 2 cycles of 28 days, followed by the administration of the PD-1 antagonist. In another embodiment, the SAHA or a pharmaceutically acceptable salt thereof is administered concurrently with the PD-1 antagonist.
[00131] In other embodiments, the SAHA or a pharmaceutically acceptable salt thereof and azacitidine is administered before administration of the PD-1 antagonist, while in other embodiments, the SAHA or a pharmaceutically acceptable salt thereof and azacitidine is administered after administration of the PD-1 antagonist. In one embodiment, the SAHA or a pharmaceutically acceptable salt thereof and azacitidine is first concurrently administered, followed by the administration of the PD-1 antagonist. In another embodiment, the SAHA or a pharmaceutically acceptable salt thereof is administered after azacitidine, followed by the administration of the PD-1 antagonist. In another embodiment, the SAHA or a pharmaceutically acceptable salt thereof and azacitidine is administered concurrently with the PD-1 antagonist.
[00132] In some embodiments, at least one of the therapeutic agents in the combination therapy is administered using the same dosage regimen (dose, frequency and duration of treatment) that is typically employed when the agent is used as monotherapy for treating the same cancer. In other embodiments, the patient receives a lower total amount of at least one of the therapeutic agents in the combination therapy than when the agent is used as monotherapy, e.g., smaller doses, less frequent doses, and/or shorter treatment duration.
[00133] Each small molecule therapeutic agent in a combination therapy of the invention can be administered orally or parenterally, including the intravenous, intramuscular, intraperitoneal, subcutaneous, rectal, topical, and transdermal routes of administration.
[00134] A combination therapy of the invention may be used prior to or following surgery to remove a tumor and may be used prior to, during or after radiation therapy.
[00135] In some embodiments, a combination therapy of the invention is administered to a patient who has not been previously treated with a biotherapeutic or chemotherapeutic agent, i.e., is treatment-naive. In other embodiments, the combination therapy is administered to a patient who failed to achieve a sustained response after prior therapy with a biotherapeutic or chemotherapeutic agent, i.e., is treatment-experienced.
[00136] A combination therapy of the invention is typically used to treat a tumor that is large enough to be found by palpation or by imaging techniques well known in the art, such as MRI, ultrasound, or CAT scan.
[00137] A combination therapy of the invention is preferably administered to a human patient who has a cancer that tests positive for PD-L1 expression. In some preferred embodiments, PD-L1 expression is detected using a diagnostic anti-human PD-L1 antibody, or antigen binding fragment thereof, in an IHC assay on an FFPE or frozen tissue section of a tumor sample removed from the patient. Typically, the patient's physician would order a diagnostic test to determine PD-L1 expression in a tumor tissue sample removed from the patient prior to initiation of treatment with the PD-1 antagonist and the SAHA or a pharmaceutically acceptable salt thereof, but it is envisioned that the physician could order the first or subsequent diagnostic tests at any time after initiation of treatment, such as for example after completion of a treatment cycle.
[00138] Selecting a dosage regimen (also referred to herein as an administration regimen) for a combination therapy of the invention depends on several factors, including the serum or tissue turnover rate of the entity, the level of symptoms, the immunogenicity of the entity, and the accessibility of the target cells, tissue or organ in the individual being treated. Preferably, a dosage regimen maximizes the amount of each therapeutic agent delivered to the patient consistent with an acceptable level of side effects. Accordingly, the dose amount and dosing frequency of each biotherapeutic and chemotherapeutic agent in the combination depends in part on the particular therapeutic agent, the severity of the cancer being treated, and patient characteristics. Guidance in selecting appropriate doses of antibodies, cytokines, and small molecules are available. See, e.g., Wawrzynczak (1996) Antibody Therapy, Bios Scientific Pub. Ltd, Oxfordshire, UK; Kresina (ed.) (1991) Monoclonal Antibodies, Cytokines and Arthritis, Marcel Dekker, New York, NY; Bach (ed.) (1993) Monoclonal Antibodies and Peptide Therapy in Autoimmune Diseases, Marcel Dekker, New York, NY; Baert et al. (2003) New Engl. J. Med. 348:601-608; Milgrom et al. (1999) New Engl. J. Med. 341 : 1966-1973; Slamon et al. (2001) New Engl. J. Med. 344:783-792; Beniaminovitz et al. (2000) New Engl. J. Med. 342:613-619; Ghosh et al. (2003) New Engl. J. Med. 348:24-32; Lipsky et al. (2000) New Engl. J. Med. 343 : 1594-1602; Physicians' Desk Reference 2003 (Physicians' Desk Reference, 57th Ed); Medical Economics Company; ISBN: 1563634457; 57th edition (November 2002). Determination of the appropriate dosage regimen may be made by the clinician, e.g., using parameters or factors known or suspected in the art to affect treatment or predicted to affect
treatment, and will depend, for example, the patient's clinical history (e.g., previous therapy), the type and stage of the cancer to be treated and biomarkers of response to one or more of the therapeutic agents in the combination therapy.
[00139] Biotherapeutic agents in a combination therapy of the invention may be administered by continuous infusion, or by doses at intervals of, e.g., daily, every other day, three times per week, or one time each week, two weeks, three weeks, monthly, bimonthly, etc. A total weekly dose is generally at least 0.05 μg/kg, 0.2 μg/kg, 0.5 μg/kg, 1 μg/kg, 10 μg/kg, 100 μg/kg, 0.2 mg/kg, 1.0 mg/kg, 2.0 mg/kg, 10 mg/kg, 25 mg/kg, 50 mg/kg body weight or more. See, e.g., Yang et al. (2003) New Engl. J. Med. 349:427-434; Herold et al. (2002) New Engl. J. Med. 346: 1692-1698; Liu et al. (1999) J. Neurol. Neurosurg. Psych. 67:451-456; Portielji et al. (20003) Cancer Immunol. Immunother. 52: 133-144.
[00140] In some embodiments that employ an anti-human PD-1 mAb as the PD-1 antagonist in the combination therapy, the dosing regimen will comprise administering the anti- human PD-1 mAb at a dose of 1, 2, 3, 5 or lOmg/kg at intervals of about 14 days (± 2 days) or about 21 days (± 2 days) or about 30 days (± 2 days) throughout the course of treatment.
[00141] In other embodiments that employ an anti-human PD-1 mAb as the PD-1 antagonist in the combination therapy, the dosing regimen will comprise administering the anti- human PD-1 mAb at a dose of from about 0.005 mg/kg to about 10 mg/kg, with intra-patient dose escalation. In other escalating dose embodiments, the interval between doses will be progressively shortened, e.g., about 30 days (± 2 days) between the first and second dose, about 14 days (± 2 days) between the second and third doses. In certain embodiments, the dosing interval will be about 14 days (± 2 days), for doses subsequent to the second dose.
[00142] In certain embodiments, a subject will be administered an intravenous (IV) infusion of a medicament comprising any of the PD-1 antagonists described herein. [00143] In one preferred embodiment of the invention, the PD-1 antagonist in the combination therapy is nivolumab, which is administered intravenously at a dose selected from the group consisting of: 1 mg/kg Q2W, 2 mg/kg Q2W, 3 mg/kg Q2W, 5 mg/kg Q2W, 10 mg Q2W, 1 mg/kg Q3W, 2 mg/kg Q3W, 3 mg/kg Q3W, 5 mg/kg Q3W, and 10 mg Q3W.
[00144] In another preferred embodiment of the invention, the PD-1 antagonist in the combination therapy is pembrolizumab, a pembrolizumab variant or a pembrolizumab biosimilar, which is administered in a liquid medicament at a dose selected from the group consisting of 1 mg/kg Q2W, 2 mg/kg Q2W, 3 mg/kg Q2W, 5 mg/kg Q2W, 10 mg Q2W, 1 mg/kg Q3W, 2 mg/kg
Q3W, 3 mg/kg Q3W, 5 mg/kg Q3W, 10 mg Q3W and flat-dose equivalents of any of these doses, i.e., such as 200 mg Q3W. In some embodiments, pembrolizumab is provided as a liquid medicament which comprises 25 mg/ml pembrolizumab, 7% (w/v) sucrose, 0.02% (w/v) polysorbate 80 in 10 mM histidine buffer pH 5.5. [00145] In some embodiments, the selected dose of pembrolizumab is administered by IV infusion. In one embodiment, the selected dose of pembrolizumab is administered by IV infusion over a time period of between 25 and 40 minutes, or about 30 minutes.
[00146] The optimal dose for pembrolizumab in combination with SAHA or a pharmaceutically acceptable salt thereof may be identified by dose escalation or dose de- escalation of one or both of these agents. In an embodiment, the combination therapy comprises a 21 day treatment cycle in which pembrolizumab is administered at 200 mg Q3W and SAHA is orally administered at 400 mg once daily, 300 mg once daily, 200 mg once daily or 100 mg once daily. In an embodiment, a patient is treated with 200 mg of pembrolizumab Q3W and SAHA is orally administered at 300 mg twice daily, 200 mg twice daily or 100 mg twice daily. [00147] In another aspect of the invention, SAHA or a pharmaceutically acceptable salt thereof and azacitidine is administered for 2 cycles of 28 days, followed by administration of 200 mg pembrolizumab every two weeks or three weeks. In a further embodiment, SAHA is administered orally 400 mg once daily and azacitidine is administered 40 mg/m2 subcutaneous days 1-6, 8-10 for 2 cycles of 28 days, followed by administration of 200 mg pembrolizumab every three weeks. In one embodiment, azacitidine is administered subcutaneously once a day at 75 mg/m2/day on days 1-7 and SAHA is orally administed 200 mg or 300 mg 2-3 times daily on days 3-5, 3-9, 3-11 or 3-16, for 2 cycles of 28 days, followed by administration of 200 mg pembrolizumab every three weeks. In another embodiment, azacitidine is subcutaneously administered 75 mg/m2/day daily for 5 days (Days 1 - 5), SAHA is administered 200 mg orally three times a day for 5 days (Days 1 - 5), for 2 cycles of 28 days, followed by administration of 200 mg pembrolizumab every three weeks. In one example of the above embodiments, pembrolizumab is administered via IV infusion.
[00148] In some embodiments, the patient is treated with the combination therapy for at least 24 weeks, e.g., eight 3-week cycles. In some embodiments, treatment with the combination therapy continues until the patient exhibits evidence of PD or a CR.
[00149] SAHA can be administered in accordance with any dose and dosing schedule that, together with the effect of the PD-1 antagonist, achieves a dose effective to treat cancer. For example, SAHA can be administered in a total daily dose of up to 800 mg, preferably orally,
once, twice or three times daily, continuously (every day) or intermittently (e.g., 3-5 days a week).
[00150] In one embodiment, SAHA is administered once daily at a dose of about 200-600 mg. In another embodiment, SAHA is administered twice daily at a dose of about 200-300 mg. In another embodiment, SAHA is administered twice daily at a dose of about 200-300 mg intermittently, for example three, four or five days per week. In one embodiment, the daily dose of SAHA is 200 mg which can be administered once-daily, twice-daily or three-times daily. In one embodiment, the daily dose of SAHA is 300 mg which can be administered once-daily, or twice-daily. In one embodiment, the daily dose of SAHA is 400 mg which can be administered once-daily. In other embodiments, SAHA is administered once daily at a dose of 200, 300 or 400 mg for 3, 4 or 5 days a week.
[00151] In some embodiments, the patient selected for treatment with the combination therapy of the invention if the patient has been diagnosed with NSCLC, RCC, endometrial cancer, urothelial cancer, squamous cell carcinoma of head and neck or melanoma. [00152] The present invention also provides a medicament which comprises a PD-1 antagonist as described above and a pharmaceutically acceptable excipient. When the PD-1 antagonist is a biotherapeutic agent, e.g., a mAb, the antagonist may be produced in CHO cells using conventional cell culture and recovery/purification technologies.
[00153] In some embodiments, a medicament comprising an anti-PD-1 antibody as the PD-1 antagonist may be provided as a liquid formulation or prepared by reconstituting a lyophilized powder with sterile water for injection prior to use. WO 2012/135408 describes the preparation of liquid and lyophilized medicaments comprising pembrolizumab that are suitable for use in the present invention. In some embodiments, a medicament comprising pembrolizumab is provided in a glass vial which contains about 100 mg of pembrolizumab in 4 ml of solution. Each 1 mL of solution contains 25 mg of pembrolizumab and is formulated in: L-histidine (1.55 mg), polysorbate 80 (0.2 mg), sucrose (70 mg), and Water for Injection, USP. The solution requires dilution for IV infusion.
[00154] The present invention also provides a medicament which comprises an HDAC inhibitor and a pharmaceutically acceptable excipient, wherein the HDAC inhibitor is SAHA or a pharmaceutically acceptable salt thereof.
[00155] The medicaments described herein may be provided as a kit which comprises a first container and a second container and a package insert. The first container contains at least
one dose of a medicament comprising a PD-1 antagonist, the second container contains at least one dose of a medicament comprising SAHA, and the package insert, or label, which comprises instructions for treating a patient for cancer using the medicaments. The first and second containers may be comprised of the same or different shape (e.g., vials, syringes and bottles) and/or material (e.g., plastic or glass). The kit may further comprise other materials that may be useful in administering the medicaments, such as diluents, filters, IV bags and lines, needles and syringes. In some preferred embodiments of the kit, the PD-1 antagonist is an anti-PD-1 antibody and the instructions state that the medicaments are intended for use in treating a patient having a cancer that tests positive for PD-L1 expression by an IHC assay. [00156] These and other aspects of the invention, including the exemplary specific embodiments listed below, will be apparent from the teachings contained herein.
Exemplary Specific Embodiments of the Invention
1. A method for treating cancer in an individual comprising administering to the individual a combination therapy which comprises a PD-1 antagonist and an HDAC inhibitor, wherein the HDAC inhibitor is SAHA or a pharmaceutically acceptable salt thereof.
2. The method of embodiment 1, wherein the PD-1 antagonist is a monoclonal antibody, or an antigen binding fragment thereof.
3. A medicament comprising a PD-1 antagonist for use in combination with an HDAC inhibitor for treating cancer in an individual, wherein the PD-1 antagonist is a monoclonal antibody, or an antigen binding fragment thereof and the HDAC inhibitor is SAHA or a pharmaceutically acceptable salt thereof.
4. A medicament comprising an HDAC inhibitor for use in combination with a PD-1 antagonist for treating cancer in an individual, wherein the HDAC inhibitor is SAHA or a pharmaceutically acceptable salt thereof.
5. The medicament of embodiment 3 or 4, which further comprises a pharmaceutically acceptable excipient.
6. Use of a PD-1 antagonist in the manufacture of medicament for treating cancer in an individual when administered in combination with an HDAC inhibitor, wherein the HDAC inhibitor is SAHA or a pharmaceutically acceptable salt thereof.
7. Use of an HDAC inhibitor in the manufacture of a medicament for treating cancer in an individual when administered in combination with a PD-1 antagonist, wherein the HDAC inhibitor is SAHA or a pharmaceutically acceptable salt thereof.
8. Use of a PD-1 antagonist and an HDAC inhibitor in the manufacture of medicaments for treating cancer in an individual, wherein the HDAC inhibitor is SAHA or a pharmaceutically acceptable salt thereof.
9. A kit which comprises a first container, a second container and a package insert, wherein the first container comprises at least one dose of a medicament comprising an anti-PD-1 antagonist, the second container comprises at least one dose of a medicament comprising an HDAC inhibitor, and the package insert comprises instructions for treating an individual for cancer using the medicaments, wherein the HDAC inhibitor is SAHA or a pharmaceutically acceptable salt thereof.
10. The kit of embodiment 9, wherein the instructions state that the medicaments are intended for use in treating an individual having a cancer that tests positive for PD-L1 expression by an immunohistochemical (IHC) assay.
11. The method, medicament, use or kit of any of embodiments 1 to 10, wherein the individual is a human and the PD-1 antagonist is a monoclonal antibody, or an antigen binding fragment thereof, which specifically binds to human PD-L1 and blocks the binding of human PD-L1 to human PD-1. 12. The method, medicament, use or kit of embodiment 10, wherein the PD-1 antagonist is MPDL3280A, BMS-936559, MEDI4736, MSB0010718C or a monoclonal antibody which comprises the heavy chain and light chain variable regions of SEQ ID NO:24 and SEQ ID NO:21, respectively, of WO2013/019906.
13. The method, medicament, use or kit of any of embodiments 1 to 10, wherein the individual is a human, and the PD-1 antagonist is a monoclonal antibody, or an antigen binding fragment thereof, which specifically binds to human PD-1 and blocks the binding of human PD- Ll to human PD-1.
14. The method, medicament, use or kit of embodiment 11, wherein the PD-1 antagonist also blocks binding of human PD-L2 to human PD-1. 15. The method, medicament, use or kit of embodiment 13, wherein the monoclonal antibody, or antigen binding fragment thereof, comprises: (a) light chain CDRs of SEQ ID NOs:
1, 2 and 3 and heavy chain CDRs of SEQ ID NOs: 4, 5 and 6; or (b) light chain CDRs of SEQ ID NOs: 7, 8 and 9 and heavy chain CDRs of SEQ ID NOs: 10, 11 and 12.
16. The method, medicament, use or kit of embodiment 13, wherein the monoclonal antibody, or antigen binding fragment thereof, comprises light chain CDRs of SEQ ID NOs: 7, 8 and 9 and heavy chain CDRs of SEQ ID NOs: 10, 11 and 12.
17. The method, medicament, use or kit of embodiment 13, wherein the PD-1 antagonist is an anti-PD-1 monoclonal antibody which comprises a heavy chain and a light chain, and wherein the heavy chain comprises SEQ ID NO:21 and the light chain comprises SEQ ID NO:22.
18. The method, medicament, use or kit of embodiment 13, wherein the PD-1 antagonist is an anti-PD-1 monoclonal antibody which comprises a heavy chain and a light chain, and wherein the heavy chain comprises SEQ ID NO:23 and the light chain comprises SEQ ID NO:24.
19. The method, medicament, use or kit of any of embodiments 1-18, wherein the cancer is a solid tumor.
20. The method, medicament, use or kit of any of embodiments 1-18, wherein the cancer is bladder cancer, breast cancer, clear cell kidney cancer, head/neck squamous cell carcinoma, lung squamous cell carcinoma, malignant melanoma, non-small-cell lung cancer (NSCLC), ovarian cancer, pancreatic cancer, prostate cancer, renal cell cancer, small-cell lung cancer (SCLC) or triple negative breast cancer.
21. The method, medicament, use or kit of any of embodiments 1-18, wherein the cancer is NSCLC, RCC, endometrial cancer, urothelial cancer, squamous cell carcinoma of head and neck or melanoma.
22. The method, medicament, use or kit of any of embodiments 1-18, wherein the individual has not been previously treated for NSCLC, RCC, endometrial cancer, urothelial cancer, squamous cell carcinoma of head and neck or melanoma.
23. The method, medicament, use or kit of any of embodiments 1-18, wherein the cancer is acute lymphoblastic leukemia (ALL), acute myeloid leukemia (AML), chronic lymphocytic leukemia (CLL), chronic myeloid leukemia (CML), diffuse large B-cell lymphoma (DLBCL), follicular lymphoma, Hodgkin's lymphoma (HL), mantle cell lymphoma (MCL), multiple myeloma (MM), myeloid cell leukemia- 1 protein (Mcl-1), myelodysplastic syndrome (MDS), non-Hodgkin's lymphoma (NHL), cutaneous T- cell lymphoma, or small lymphocytic lymphoma (SLL).
24. The method, medicament, use or kit of any of embodiments 1-23, wherein the cancer tests positive for human PD-L1.
25. The method, medicament, use or kit of embodiment 24, wherein the human PD-L1 expression is elevated.
26. The method, medicament, use or kit of embodiment 24, wherein the PD-1 antagonist is pembrolizumab, a pembrolizumab variant, a pembrolizumab biosimilar or nivolumab.
27. The method, medicament, use or kit of embodiment 26, wherein pembrolizumab is formulated as a liquid medicament which comprises 25 mg/ml pembrolizumab, 7% (w/v) sucrose, 0.02% (w/v) polysorbate 80 in 10 mM histidine buffer pH 5.5.
28. A method for treating a human individual diagnosed with cancer, comprising administering to the individual a combination therapy which comprises pembrolizumab and an HDAC inhibitor, wherein the HDAC inhibitor is SAHA or a pharmaceutically acceptable salt thereof, and wherein the HDAC inhibitor is orally administered at a dose of 400 mg once daily, and pembrolizumab is administered at 200 mg Q3W.
29. A medicament comprising pembrolizumab for use in combination with SAHA or a pharmaceutically acceptable salt thereof for treating cancer in a human individual by a method comprising administering to the individual SAHA or a pharmaceutically acceptable salt thereof at an oral dose of 400 mg once daily, and pembrolizumab at 200 mg Q3W.
30. A medicament comprising SAHA or a pharmaceutically acceptable salt thereof for use in combination with pembrolizumab for treating cancer in a human individual by a method comprising administering to the individual SAHA or a pharmaceutically acceptable salt thereof, at an oral dose of 400 mg once daily, and pembrolizumab at 200 mg Q3W.
31. The method or medicament of any of embodiments 28 to 30, wherein the cancer is NSCLC, RCC, endometrial cancer, urothelial cancer, squamous cell carcinoma of head and neck or melanoma.
32. The method or medicament of embodiment 31, wherein the individual has not been previously treated for NSCLC, RCC, endometrial cancer, urothelial cancer, squamous cell carcinoma of head and neck or melanoma.
33. The method or medicament of any of embodiments 28 to 32, wherein a tissue section of the cancer removed from the individual prior to administration of the combination therapy tested positive for PD-L1 expression.
34. The method or medicament of embodiment 33, wherein at least 50% of the tumor cells in the tissue section tested positive for PD-L1 expression by an immunohistochemical (IHC) assay.
35. The method or medicament of embodiment 34, wherein the IHC assay employed the antibody 22C3 to detect PD-L1 expression. 36. The method or medicament of any of embodiments 28 to 35, wherein pembrolizumab is administered by IV infusion for 25 to 40 minutes or about 30 minutes.
37. The method, medicament, kit or use of any of embodiments 1-36, wherein the HDAC inhibitor is SAHA.
38. A combination of i) SAHA (suberoylanilide hydroxamic acid) or a pharmaceutically acceptable salt thereof and pembrolizumab or a pembrolizumab biosimilar, for use in treating cancer, wherein SAHA or the pharmaceutically acceptable salt is for oral administration once daily at a dose of 400 mg, and pembrolizumab is administered at a dose of 200 mg Q3W.
GENERAL METHODS
[00157] Standard methods in molecular biology are described Sambrook, Fritsch and Maniatis (1982 & 1989 2nd Edition, 2001 3rd Edition) Molecular Cloning, A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY; Sambrook and Russell (2001) Molecular Cloning, 3rd ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY; Wu (1993) Recombinant DNA, Vol. 217, Academic Press, San Diego, CA). Standard methods also appear in Ausbel, et al. (2001) Current Protocols in Molecular Biology, Vols.1-4, John Wiley and Sons, Inc. New York, NY, which describes cloning in bacterial cells and DNA mutagenesis (Vol. 1), cloning in mammalian cells and yeast (Vol. 2), glycoconjugates and protein expression (Vol. 3), and bioinformatics (Vol. 4).
[00158] Methods for protein purification including immunoprecipitation, chromatography, electrophoresis, centrifugation, and crystallization are described (Coligan, et al. (2000) Current Protocols in Protein Science, Vol. 1, John Wiley and Sons, Inc., New York). Chemical analysis, chemical modification, post-translational modification, production of fusion proteins, glycosylation of proteins are described (see, e.g., Coligan, et al. (2000) Current Protocols in Protein Science, Vol. 2, John Wiley and Sons, Inc., New York; Ausubel, et al. (2001) Current Protocols in Molecular Biology, Vol. 3, John Wiley and Sons, Inc., NY, NY, pp. 16.0.5-16.22.17; Sigma-Aldrich, Co. (2001) Products for Life Science Research, St. Louis, MO; pp. 45-89; Amersham Pharmacia Biotech (2001) BioDirectory, Piscataway, N.J., pp. 384-391). Production,
purification, and fragmentation of polyclonal and monoclonal antibodies are described (Coligan, et al. (2001) Current Protcols in Immunology, Vol. 1, John Wiley and Sons, Inc., New York; Harlow and Lane (1999) Using Antibodies, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY; Harlow and Lane, supra). Standard techniques for characterizing ligand/receptor interactions are available (see, e.g., Coligan, et al. (2001) Current Protocols in Immunology, Vol. 4, John Wiley, Inc., New York).
[00159] Monoclonal, polyclonal, and humanized antibodies can be prepared (see, e.g., Sheperd and Dean (eds.) (2000) Monoclonal Antibodies, Oxford Univ. Press, New York, NY; Kontermann and Dubel (eds.) (2001) Antibody Engineering, Springer- Verlag, New York; Harlow and Lane (1988) Antibodies A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, pp. 139-243; Carpenter, et al. (2000) J. Immunol. 165:6205; He, et al. (1998) J. Immunol. 160: 1029; Tang et al. (1999) J. Biol. Chem. 274:27371-27378; Baca et al. (1997) J. Biol. Chem. 272: 10678-10684; Chothia et al. (1989) Nature 342:877-883; Foote and Winter (1992) J. Mol. Biol. 224:487-499; U.S. Pat. No. 6,329,511). [00160] An alternative to humanization is to use human antibody libraries displayed on phage or human antibody libraries in transgenic mice (Vaughan et al. (1996) Nature Biotechnol. 14:309-314; Barbas (1995) Nature Medicine 1 :837-839; Mendez et al. (1997) Nature Genetics 15: 146-156; Hoogenboom and Chames (2000) Immunol. Today 21 :371-377; Barbas et al. (2001) Phage Display: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, New York; Kay et al. (1996) Phage Display of Peptides and Proteins: A Laboratory Manual, Academic Press, San Diego, CA; de Bruin et al. (1999) Nature Biotechnol. 17:397-399).
[00161] Purification of antigen is not necessary for the generation of antibodies. Animals can be immunized with cells bearing the antigen of interest. Splenocytes can then be isolated from the immunized animals, and the splenocytes can fuse with a myeloma cell line to produce a hybridoma (see, e.g., Meyaard et al. (1997) Immunity 7:283-290; Wright et al. (2000) Immunity 13 :233-242; Preston et al, supra; Kaithamana et al. (1999) J. Immunol. 163 :5157-5164).
[00162] Antibodies can be conjugated, e.g., to small drug molecules, enzymes, liposomes, polyethylene glycol (PEG). Antibodies are useful for therapeutic, diagnostic, kit or other purposes, and include antibodies coupled, e.g., to dyes, radioisotopes, enzymes, or metals, e.g., colloidal gold (see, e.g., Le Doussal et al. (1991) J. Immunol. 146: 169-175; Gibellini et al. (1998) J. Immunol. 160:3891-3898; Hsing and Bishop (1999) J. Immunol. 162:2804-2811; Everts et al. (2002) J. Immunol. 168:883-889).
[00163] Methods for flow cytometry, including fluorescence activated cell sorting
(FACS), are available (see, e.g., Owens, et al. (1994) Flow Cytometry Principles for Clinical Laboratory Practice, John Wiley and Sons, Hoboken, NJ; Givan (2001) Flow Cytometry, 2nd ed.; Wiley-Liss, Hoboken, NJ; Shapiro (2003) Practical Flow Cytometry, John Wiley and Sons, Hoboken, NJ). Fluorescent reagents suitable for modifying nucleic acids, including nucleic acid primers and probes, polypeptides, and antibodies, for use, e.g., as diagnostic reagents, are available (Molecular Probesy (2003) Catalogue, Molecular Probes, Inc., Eugene, OR; Sigma- Aldrich (2003) Catalogue, St. Louis, MO).
[00164] Standard methods of histology of the immune system are described (see, e.g., Muller-Harmelink (ed.) (1986) Human Thymus: Histopathology and Pathology, Springer Verlag, New York, NY; Hiatt, et al. (2000) Color Atlas of Histology, Lippincott, Williams, and Wilkins, Phila, PA; Louis, et al. (2002) Basic Histology: Text and Atlas, McGraw-Hill, New York, NY).
[00165] Software packages and databases for determining, e.g., antigenic fragments, leader sequences, protein folding, functional domains, glycosylation sites, and sequence alignments, are available (see, e.g., GenBank, Vector NTI® Suite (Informax, Inc, Bethesda, MD); GCG Wisconsin Package (Accelrys, Inc., San Diego, CA); DeCypher® (TimeLogic Corp., Crystal Bay, Nevada); Menne, et al. (2000) Bioinformatics 16: 741-742; Menne, et al. (2000) Bioinformatics Applications Note 16:741-742; Wren, et al. (2002) Comput. Methods Programs Biomed. 68: 177-181; von Heijne (1983) Eur. J. Biochem. 133 : 17-21; von Heijne (1986) Nucleic Acids Res. 14:4683-4690).
Table 3 provides a brief description of the sequences in the sequence listing.
SEQ ID NO: Description
1 hPD-1.08A light chain CDR1
2 hPD-1.08A light chain CDR2
3 hPD-l-08A light chain CDR3
4 hPD-1.08A heavy chain CDR1
5 hPD-1.08A heavy chain CDR2
6 hPD-1.08A heavy chain CDR3
7 hPD-1.09A light chain CDR1
8 hPD-1.09A light chain CDR2
9 hPD-1.09A light chain CDR3
10 hPD-1.09A heavy chain CDR1
SEQ ID NO: Description
11 hPD-1.09A heavy chain CDR2
12 hPD-1.09A heavy chain CDR3
13 109A-H heavy chain variable region
14 409A-H heavy chain full length
15 K09A-L-11 light chain variable region
16 K09A-L-16 light chain variable region
17 K09A-L-17 light chain variable region
18 K09A-L-1 1 light chain full length
19 K09A-L-16 light chain full length
20 K09A-L-17 light chain full length
21 Pembrolizumab Heavy chain
22 Pembrolizumab Light chain
23 Nivolumab Heavy chain
24 Nivolumab light chain
25 Human PD-L1
[00166] The manufacturing process for the drug product Zolinza® (Vorinostat) is described in WO2006/127321. [00167] Example 1. Anti -tumor response of concurrent administration of a PD-1 antagonist and Vorinostat in tumor-bearing mice.
[00168] This experiment compared the anti-tumor response of tumor-bearing mice to treatment with one of three regimens: monotherapy with a murine anti-mouse PD-1 monoclonal antibody (anti-PD-1), monotherapy with Vorinostat and combination therapy with these two agents admini stered concurrently .
[00169] Tumor-bearing mice for this study were initiated by implanting 3 x 105 log-phase and sub-confluent CT-26 cells on the right lower dorsal flank of 7-8 week old female BALB/cAnN mice with an average body weight of 18 grams. When the mean tumor volume in these mice reached - 100 cubic mm (60mm3-150 mm ) (Figure 1(A)), the tumor-bearing mice were randomized to 4 treatment groups of 12 mice per group: (1) Isotype control + Vehicle control group;(2) anti-PD-1 + Vehicle control; (3) Vorinostat + Isotype control and; (4) anti-PD-1
+ Vorinostat. A monoclonal antibody of murine isotype IgGl against murine PD-1 and isotype control were obtained from internal sources. The isotype control was a mouse monoclonal antibody specific for adenoviral hexon 25 and was of the isotype IgGl . Formulations for each reagent were as follows: Isotype control :75mM NaCl, lOmM sodium phosphate, 3% sucrose, pH7.3; anti-PD-1 : 20mM sodium acetate, 7% sucrose, pH5.5; and Vorinostat: 0.5% HPC (hydroxypropylcellulose) with 0.002% SDS (sodium dodecyl sulfate) in sterile water. Anti-PD-1 was administered to treatment groups 2 and 4 at 10 mg/kg i.p. every 5 days for each of 5 cycles. Vorinostat was administered to treatment groups 3 and 4 at 150 mg/kg every day for 27 days.
[00170] Administration of Vorinostat did not demonstrate antagonistic effects on anti-PD- 1 anti -tumor activity in the combination treatment arm. As demonstrated by the results, which are shown in Figure 8(A), the mean anti-tumor response of combination therapy with the PD-1 antagonist and Vorinostat was significantly greater than the anti-tumor response observed with either Vorinostat single agent treatment (p<0.001) or anti-PD-1 (p<0.01) single agent treatment, One-way ANOVA/Bonferroni multiple comparison test at Day 20. The combination of these two agents demonstrated 25% complete regressions (CR) such that no measureable tumor remained in 3 out of 12 animals and 17% partial regressions (PRs) as measured through Day 29. The anti- PD-1 monotherapy arm resulted in 17% CRs as measured through Day 29. No CRs were observed in the Vorinostat monotherapy treatment group. As shown in Figure 8 (B), combination treatment demonstrated significantly enhanced survival (100%) at Day 30 as compared to anti-PD-1 (42%) and Vorinostat (10%) single agent treatment.
Example 2. Anti -tumor response of concurrent administration of a PD-1 antagonist and
Vorinostat in tumor-bearing mice.
[00171] This experiment compared the anti-tumor response of tumor-bearing mice to treatment with one of three regimens: monotherapy with a murine anti-mouse PD-1 monoclonal antibody (anti-PD-1), monotherapy with Vorinostat and combination therapy with these two agents administered concurrently.
[00172] Tumor-bearing mice for this study were initiated by implanting 1 x 106 log-phase andsub-confluent RENCA cells on the right lower dorsal flank of 7-8 week old female BALB/cmice with an average body weight of 19 grams. When the mean tumor volume in these mice reached - 100 cubic mm (65mm3-140 mm ) (Figure 9(A)), the tumor-bearing mice were randomized to 4 treatment groups of 12 mice per group: (1) Isotype control + Vehicle control group;(2) Anti-PD-1 + Vehicle control; (3) Vorinostat + Isotype control and; (4) Anti-PD-1 + Vorinostat. A monoclonal antibody of murine isotype IgGl against murine PD-1 and isotype
control were obtained from internal sources. The isotype control was a mouse monoclonal antibody specific for adenoviral hexon 25 and was of the isotype IgGl . The formulations for each reagent was as follows: Isotype control :75mM NaCl, lOmM sodium phosphate, 3% sucrose, pH7.3; anti-PD-1 : 20mM sodium acetate, 7% sucrose, pH5.5; and Vorinostat vehicle: 0.5% HPC (hydroxypropylcellulose) with 0.002% SDS (sodium dodecyl sulfate) in sterile water. Anti-PD-1 was administered to treatment groups 2 and 4 at 5 mg/kg i.p. every 5 days for each of 5 cycles. Vorinostat was administered to treatment groups 3 and 4 at 150 mg/kg every day for 29 days.
[00173] Administration of Vorinostat did not demonstrate antagonistic effects on anti-PD-
1 anti-tumor activity in the combination treatment arm. As demonstrated by the results, which are shown in Figure 9 (A), the mean anti-tumor response of combination therapy with the PD-1 antagonist and Vorinostat was significantly greater than the anti-tumor response observed with either Vorinostat single agent treatment (p<0.0001) or anti-PD-1 (p<0.05) single agent treatment, One-Way ANOVA/Bonferroni comparison test at Day 19. The combination of these two agents demonstrated 50% complete regressions (CR) such that no measureable tumor remained in 6 out of 12 animals as measured through Day 30. One partial regression (PR) was observed. The anti-PD-1 monotherapy arm resulted in 17% CRs as measured through Day 29. No CRs were observed in the Vorinostat monotherapy treatment group. As shown in Figure 9 (B), combination treatment demonstrated significantly enhanced survival (92%) at Day 30 as compared to anti-PD-1 (42%) and Vorinostat (23%) single agent treatment.
REFERENCES
1. Sharpe, A.H, Wherry, E.J., Ahmed R., and Freeman G.J. The function of programmed cell death 1 and its ligands in regulating autoimmunity and infection. Nature Immunology (2007); 8:239-245.
2. Dong H et al. Tumor-associated B7-H1 promotes T-cell apoptosis: a potential mechanism of immune evasion. Nat Med. 2002 Aug;8(8):793-800.
3. Yang et al. PD-1 interaction contributes to the functional suppression of T-cell responses to human uveal melanoma cells in vitro. Invest Ophthalmol Vis Sci. 2008 Jun;49(6 (2008): 49:
2518-2525.
4. Ghebeh et al. The B7-H1 (PD-L1) T lymphocyte-inhibitory molecule is expressed in breast cancer patients with infiltrating ductal carcinoma: correlation with important high-risk prognostic factors. Neoplasia (2006) 8: 190-198. 5. Hamanishi J et al. Programmed cell death 1 ligand 1 and tumor-infiltrating CD8+ T lymphocytes are prognostic factors of human ovarian cancer. Proceeding of the National Academy of Sciences (2007): 104: 3360-3365.
6. Thompson RH et al. Significance of B7-H1 overexpression in kidney cancer. Clinical genitourin Cancer (2006) : 5 : 206-211.
7. Nomi, T. Sho, M., Akahori, T., et al. Clinical significance and therapeutic potential of the programmed death- 1 ligand/programmed death- 1 pathway in human pancreatic cancer. Clinical Cancer Research (2007); 13 : 2151 -2157.
8. Ohigashi Y et al. Clinical significance of programmed death- 1 ligand- 1 and programmed death-1 ligand 2 expression in human esophageal cancer. Clin. Cancer Research (2005): 11 : 2947-2953. 9. Inman et al. PD-L1 (B7-H1) expression by urothelial carcinoma of the bladder and BCG- induced granulomata: associations with localized stage progression. Cancer (2007): 109: 1499- 1505.
10. Shimauchi T et al. Augmented expression of programmed death-1 in both neoplasmatic and nonneoplastic CD4+ T-cells in adult T-cell Leukemia/ Lymphoma. Int. J. Cancer (2007):
121 :2585-2590.
11. Gao et al. Overexpression of PD-L1 significantly associates with tumor aggressiveness and postoperative recurrence in human hepatocellular carcinoma. Clinical Cancer Research (2009) 15: 971-979.
12. Nakanishi J. Overexpression of B7-H1 (PD-L1) significantly associates with tumor grade and postoperative prognosis in human urothelial cancers. Cancer Immunol Immunother . (2007) 56: 1173- 1182.
13. Hino et al. Tumor cell expression of programmed cell death-1 is a prognostic factor for malignant melanoma. Cancer (2010): 00: 1-9.
14. Ghebeh H. Foxp3+ tregs and B7-H1+/PD-1+ T lymphocytes co-infiltrate the tumor tissues of high-risk breast cancer patients: implication for immunotherapy. BMC Cancer. 2008 Feb
23;8:57.
15. Ahmadzadeh M et al. Tumor antigen-specific CD8 T cells infiltrating the tumor express high levels of PD-1 and are functionally impaired. Blood (2009) 114: 1537-1544.
16. Thompson RH et al. PD-1 is expressed by tumor infiltrating cells and is associated with poor outcome for patients with renal carcinoma. Clinical Cancer Research (2007) 15: 1757-1761.
[00174] All references cited herein are incorporated by reference to the same extent as if each individual publication, database entry (e.g. Genbank sequences or GenelD entries), patent application, or patent, was specifically and individually indicated to be incorporated by reference. The contents of the priority U.S. provisional application 62/136,017 is also incorporated herein by reference. This statement of incorporation by reference is intended by Applicants, pursuant to 37 C.F.R. § 1.57(b)(1), to relate to each and every individual publication, database entry (e.g. Genbank sequences or GenelD entries), patent application, or patent, each of which is clearly identified in compliance with 37 C.F.R. §1.57(b)(2), even if such citation is not immediately adjacent to a dedicated statement of incorporation by reference. The inclusion of dedicated statements of incorporation by reference, if any, within the specification does not in any way weaken this general statement of incorporation by reference. Citation of the references herein is not intended as an admission that the reference is pertinent prior art, nor does it constitute any admission as to the contents or date of these publications or documents. To the extent that the references provide a definition for a claimed term that conflicts with the definitions provided in the instant specification, the definitions provided in the instant specification shall be used to interpret the claimed invention.
Claims
1. A method for treating cancer in a human patient comprising administering to the patient a combination therapy which comprises an antagonist of a human Programmed Death 1 protein (PD-1) and a histone deactylase (HDAC) inhibitor, wherein the HDAC inhibitor is suberoylanilide hydroxamic acid (SAHA) or a pharmaceutically acceptable salt thereof.
2. The method of claim 1, wherein the cancer is a solid tumor.
3. A medicament comprising an antagonist of a Programmed Death 1 protein (PD-1) for use in combination with a histone deactylase (HDAC) inhibitor for treating cancer in an individual, wherein the HDAC inhibitor is suberoylanilide hydroxamic acid (SAHA) or a pharmaceutically acceptable salt thereof.
4. The medicament of claim 3, wherein the individual is a human.
5. The medicament of any of claims 3 to 4, wherein the cancer is NSCLC, RCC, endometrial cancer, urothelial cancer, squamous cell carcinoma of head and neck or melanoma.
6. The medicament of any of claims 3 to 5, wherein the cancer is a solid tumor that tests positive for PD-L1 expression by an immunohistochemical (IHC) assay.
7. The medicament of any of claims 3 to 6, wherein the PD-1 antagonist is a monoclonalantibody, or an antigen binding fragment thereof, which specifically binds to human PD-1 and blocks the binding of human PD-L1 to human PD-1.
8. The medicament of any of claims 3 to 7, wherein the PD-1 antagonist is an anti-PD-1 monoclonal antibody which comprises a heavy chain and a light chain, and wherein the heavy chain comprises SEQ ID NO:23 and the light chain comprises SEQ ID NO:24.
9. The medicament of any of claims 3 to 8, wherein the PD-1 antagonist is pembrolizumab and the HDAC inhibitor is SAHA.
10. The medicament of claim 9, wherein pembrolizumab is formulated as a liquid medicament which comprises 25 mg/ml pembrolizumab, 7% (w/v) sucrose, 0.02% (w/v) polysorbate 80 in 10 mM histidine buffer pH 5.5 and SAHA is formulated as a 100 mg capsule.
11. A medicament comprising:
(a) pembrolizumab for use in combination with SAHA or a pharmaceutically acceptable salt thereof for treating cancer in a human individual by a method comprising administering to the individual SAHA or a pharmaceutically acceptable salt thereof at a once daily dose of 400 mg, and pembrolizumab at a dose of 200 mg Q3W; or
(b) SAHA or a pharmaceutically acceptable salt thereof for use in combination with pembrolizumab for treating cancer in a human individual by a method comprising administering to the individual SAHA or a pharmaceutically acceptable salt thereof at a once daily dose of 400 mg, and pembrolizumab at a dose of 200 mg Q3W.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US15/559,744 US20180044418A1 (en) | 2015-03-20 | 2016-03-15 | Combination of a pd-1 antagonist and vorinostat for treating cancer |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201562136017P | 2015-03-20 | 2015-03-20 | |
| US62/136,017 | 2015-03-20 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2016153839A1 true WO2016153839A1 (en) | 2016-09-29 |
Family
ID=56978605
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2016/022402 Ceased WO2016153839A1 (en) | 2015-03-20 | 2016-03-15 | Combination of a pd-1 antagonist and vorinostat for treating cancer |
Country Status (2)
| Country | Link |
|---|---|
| US (1) | US20180044418A1 (en) |
| WO (1) | WO2016153839A1 (en) |
Cited By (12)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2017120204A3 (en) * | 2016-01-05 | 2017-09-14 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Combination of histone deacetylase inhibitor and immunotherapy |
| WO2018226939A1 (en) * | 2017-06-07 | 2018-12-13 | Ranedis Pharmaceuticals, Llc | Compositions and methods of treating and/or preventing cancer |
| US10287353B2 (en) | 2016-05-11 | 2019-05-14 | Huya Bioscience International, Llc | Combination therapies of HDAC inhibitors and PD-1 inhibitors |
| US10385131B2 (en) | 2016-05-11 | 2019-08-20 | Huya Bioscience International, Llc | Combination therapies of HDAC inhibitors and PD-L1 inhibitors |
| US10478494B2 (en) | 2015-04-03 | 2019-11-19 | Astex Therapeutics Ltd | FGFR/PD-1 combination therapy for the treatment of cancer |
| US10513558B2 (en) | 2015-07-13 | 2019-12-24 | Cytomx Therapeutics, Inc. | Anti-PD1 antibodies, activatable anti-PD1 antibodies, and methods of use thereof |
| CN113015748A (en) * | 2018-10-31 | 2021-06-22 | 默沙东公司 | Anti-human PD-1 antibody crystals and methods of use thereof |
| WO2021129616A1 (en) * | 2019-12-23 | 2021-07-01 | 信达生物制药(苏州)有限公司 | Pharmaceutical combination of anti-pd-1 antibody and histone deaceylase inhibitor, use thereof, and usage method therefor |
| US20220287993A1 (en) * | 2019-09-04 | 2022-09-15 | Crystalgenomics, Inc. | Pharmaceutical composition comprising hdac inhibitor and anti-pd1 antibody or anti pd-l1 antibody |
| US12319735B2 (en) | 2018-11-07 | 2025-06-03 | Merck Sharp & Dohme Llc | Co-formulations of anti-LAG3 antibodies and anti-PD-1 antibodies |
| US12427152B2 (en) | 2016-07-15 | 2025-09-30 | Viracta Therapeutics, Inc. | HDAC inhibitors for use with NK cell based therapies |
| US12553903B2 (en) | 2023-06-01 | 2026-02-17 | Cg Pharmaceuticals, Inc | Ivaltinostat combination therapy for treating pancreatic cancer |
Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2015035112A1 (en) * | 2013-09-05 | 2015-03-12 | The Johns Hopkins University | Cancer therapy via a combination of epigenetic modulation and immune modulation |
-
2016
- 2016-03-15 US US15/559,744 patent/US20180044418A1/en not_active Abandoned
- 2016-03-15 WO PCT/US2016/022402 patent/WO2016153839A1/en not_active Ceased
Patent Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2015035112A1 (en) * | 2013-09-05 | 2015-03-12 | The Johns Hopkins University | Cancer therapy via a combination of epigenetic modulation and immune modulation |
Non-Patent Citations (2)
| Title |
|---|
| DUVIC, M ET AL.: "Phase 2 Trial of Oral Vorinostat (Suberoylanilide Hydroxamic Acid, SAHA) for Refractory Cutaneous T- cell Lymphoma (CTCL).", BLOOD., vol. 109, no. 1, 7 September 2006 (2006-09-07), pages 31 - 39, XP055318316 * |
| ROBERT, C ET AL.: "Anti-programmed-death-receptor-1 Treatment with Pembrolizumab in Ipilimumab-refractory Advanced Melanoma: a Randomised Dose-comparison Cohort of a Phase 1 Trial.", LANCET., vol. 384, no. 9948, 15 July 2014 (2014-07-15), pages 1 - 9, XP055318318 * |
Cited By (18)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10478494B2 (en) | 2015-04-03 | 2019-11-19 | Astex Therapeutics Ltd | FGFR/PD-1 combination therapy for the treatment of cancer |
| US10513558B2 (en) | 2015-07-13 | 2019-12-24 | Cytomx Therapeutics, Inc. | Anti-PD1 antibodies, activatable anti-PD1 antibodies, and methods of use thereof |
| WO2017120204A3 (en) * | 2016-01-05 | 2017-09-14 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Combination of histone deacetylase inhibitor and immunotherapy |
| US20220040160A1 (en) * | 2016-01-05 | 2022-02-10 | The United States Of America,As Represented By The Secretary,Department Of Health And Human Services | Combination of histone deacetylase inhibitor and immunotherapy |
| US20230151099A1 (en) * | 2016-05-11 | 2023-05-18 | Huyabio International, Llc | Combination therapies of hdac inhibitors and pd-l1 inhibitors |
| US10385131B2 (en) | 2016-05-11 | 2019-08-20 | Huya Bioscience International, Llc | Combination therapies of HDAC inhibitors and PD-L1 inhibitors |
| US10385130B2 (en) | 2016-05-11 | 2019-08-20 | Huya Bioscience International, Llc | Combination therapies of HDAC inhibitors and PD-1 inhibitors |
| US10287353B2 (en) | 2016-05-11 | 2019-05-14 | Huya Bioscience International, Llc | Combination therapies of HDAC inhibitors and PD-1 inhibitors |
| US11535670B2 (en) | 2016-05-11 | 2022-12-27 | Huyabio International, Llc | Combination therapies of HDAC inhibitors and PD-L1 inhibitors |
| US12122833B2 (en) | 2016-05-11 | 2024-10-22 | Huyabio International, Llc | Combination therapies of HDAC inhibitors and PD-1 inhibitors |
| US12427152B2 (en) | 2016-07-15 | 2025-09-30 | Viracta Therapeutics, Inc. | HDAC inhibitors for use with NK cell based therapies |
| WO2018226939A1 (en) * | 2017-06-07 | 2018-12-13 | Ranedis Pharmaceuticals, Llc | Compositions and methods of treating and/or preventing cancer |
| CN113015748A (en) * | 2018-10-31 | 2021-06-22 | 默沙东公司 | Anti-human PD-1 antibody crystals and methods of use thereof |
| US12576159B2 (en) | 2018-10-31 | 2026-03-17 | Merck Sharp & Dohme Llc | Anti-human PD-1 antibody crystals and methods of use thereof |
| US12319735B2 (en) | 2018-11-07 | 2025-06-03 | Merck Sharp & Dohme Llc | Co-formulations of anti-LAG3 antibodies and anti-PD-1 antibodies |
| US20220287993A1 (en) * | 2019-09-04 | 2022-09-15 | Crystalgenomics, Inc. | Pharmaceutical composition comprising hdac inhibitor and anti-pd1 antibody or anti pd-l1 antibody |
| WO2021129616A1 (en) * | 2019-12-23 | 2021-07-01 | 信达生物制药(苏州)有限公司 | Pharmaceutical combination of anti-pd-1 antibody and histone deaceylase inhibitor, use thereof, and usage method therefor |
| US12553903B2 (en) | 2023-06-01 | 2026-02-17 | Cg Pharmaceuticals, Inc | Ivaltinostat combination therapy for treating pancreatic cancer |
Also Published As
| Publication number | Publication date |
|---|---|
| US20180044418A1 (en) | 2018-02-15 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12534530B2 (en) | Combination of a PD-1 antagonist and a VEGFR inhibitor for treating cancer | |
| KR102232153B1 (en) | Treating cancer with a combination of a pd-1 antagonist and dinaciclib | |
| US10695426B2 (en) | Combination of a PD-1 antagonist and an ALK inhibitor for treating cancer | |
| EP3102604B1 (en) | Combination of a pd-1 antagonist and a 4-1bb agonist for treating cancer | |
| RU2737216C2 (en) | Combination of pd-1 antagonist and eribulin for treating cancer | |
| US20180044418A1 (en) | Combination of a pd-1 antagonist and vorinostat for treating cancer | |
| CA2978226A1 (en) | Combination of a pd-1 antagonist and a vegfr/fgfr/ret tyrosine kinase inhibitor for treating cancer | |
| CN106456753A (en) | Combinations of PD‑1 antagonists and IDO1 inhibitors for the treatment of cancer | |
| HK40010365A (en) | Combination of a pd-1 antagonist and a vegfr inhibitor for treating cancer | |
| HK40010365B (en) | Combination of a pd-1 antagonist and a vegfr inhibitor for treating cancer |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 16769333 Country of ref document: EP Kind code of ref document: A1 |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 16769333 Country of ref document: EP Kind code of ref document: A1 |


