WO2016138538A2 - Therapeutic use of integrin-binding antibodies - Google Patents
Therapeutic use of integrin-binding antibodies Download PDFInfo
- Publication number
- WO2016138538A2 WO2016138538A2 PCT/US2016/020133 US2016020133W WO2016138538A2 WO 2016138538 A2 WO2016138538 A2 WO 2016138538A2 US 2016020133 W US2016020133 W US 2016020133W WO 2016138538 A2 WO2016138538 A2 WO 2016138538A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- mabl07
- polypeptide
- organ
- antibody
- subject
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2839—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the integrin superfamily
- C07K16/2845—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the integrin superfamily against integrin beta2-subunit-containing molecules, e.g. CD11, CD18
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P13/00—Drugs for disorders of the urinary system
- A61P13/12—Drugs for disorders of the urinary system of the kidneys
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/55—Fab or Fab'
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
Definitions
- This disclosure relates to therapeutic use of integrin-binding antibodies.
- Integrins are heterodimeric receptors that mediate interactions both between cells and between cells and the extracellular matrix via ligand binding. Many integrins are thought to exist in two conformations, a low affinity state (the “closed” or “unliganded” conformation") and a high affinity state (the “open” or “liganded” conformation), the latter of which is responsible for high affinity ligand binding.
- Antibody to integrins have been developed.
- a ligand-mimetic monoclonal antibody mAb 107, produced by a hybridoma cell line, that can bind to CD1 lb in an activation-independent manner has been described, e.g., in US 7,998,738.
- This disclosure relates to therapeutic use of integrin-binding antibodies.
- the disclosure relates to a method of ameliorating a pathology associated with ischemia reperfusion injury in a subject.
- the method includes administering to the subject a therapeutically effective amount of composition having polypeptide that immunospecifically binds the epitope recognized by mabl07.
- the pathology is post-ischemic renal fibrosis, a kidney fibroinflammatory disease, pulmonary fibrosis, or post-myocardial infarction left ventricular adverse remodeling.
- the disclosure also relates to a method of treating a subject having a disorder associated with ischemia reperfusion injury in an organ.
- the method includes
- composition having a polypeptide that immunospecifically binds the epitope recognized by mabl07.
- the organ is a kidney, a heart, or a lung.
- the disorder is acute kidney injury, acute coronary syndrome, acute myocardial infarction (MI).
- the therapeutically effective amount of composition having a polypeptide that immunospecifically binds the epitope recognized by mabl07 is administered to the subject within about 5 hours after the ischemia reperfusion injury, within about 4 hours after the ischemia reperfusion injury, within about 3 hours after the ischemia reperfusion injury, within about 2 hours after the ischemia reperfusion injury, within about 1.5 hours after the ischemia reperfusion injury, or within about 1 hour after the ischemia reperfusion injury.
- the disclosure also relates to a method of providing an organ for transplantation.
- the method includes administering to an organ donor a composition having a polypeptide that immunospecifically binds the epitope recognized by mab 107; and harvesting the organ from the organ donor.
- the disclosure also relates to a method of reducing delayed graft function following organ transplantation.
- the method includes administering to an organ recipient a therapeutically effective amount of composition having a polypeptide that
- the disclosure also relates to a method of treating an organ prior to
- the method includes contacting the organ with a composition having a polypeptide that immunospecifically binds the epitope recognized by mab 107.
- the transplanted organ is a kidney, a heart, or a lung.
- the organ contacts the composition having a polypeptide that immunospecifically binds the epitope recognized by mabl07 through perfusion fluid.
- the disclosure also relates to a method of treating a subject having an
- the method includes administering to the subject a therapeutically effective amount of composition having a polypeptide that immunospecifically binds the epitope recognized by mabl07.
- the autoimmune disease is cytoplasmic antineutrophil cytoplasmic antibodies (cANCA)-associated vasculitis.
- the disclosure also relates to a method of treating a subject having diabetic nephropathy.
- the method includes administering to the subject a therapeutically effective amount of composition having a polypeptide that immunospecifically binds the epitope recognized by mabl07.
- the disclosure also relates to a method of ameliorating a pathology associated with chemotherapy in a subject.
- the method includes administering to the subject a therapeutically effective amount of composition having a polypeptide that
- the pathology is Adriamycin nephropathy.
- the polypeptide that immunospecifically binds the epitope recognized by mabl07 is mabl07.
- the polypeptide that immunospecifically binds the epitope recognized by mabl07 is humanized.
- the polypeptide that immunospecifically binds the epitope recognized by mabl07 is a single chain variable fragments (scFv).
- the polypeptide that immunospecifically binds the epitope recognized by mabl07 comprises one, two, three, four, five, or six of the following complementarity determining regions (CDR):
- polypeptide that immunospecifically binds the epitope recognized by mab 107 can be an antibody.
- polypeptide or antibody that immunospecifically binds the epitope recognized by mab 107 comprises an amino acid sequence that comprises an amino acid sequence at least 95%, 98%, or 100% identical to an amino acid sequence selected from the group consisting of:
- VQL VE S GGGL VQPGGSLRL S C A A S GFNIKDT YIHW VRQ APGKGLEW V A RIDPA DKTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSSEGHYG YDGY AMD YWGQGTL VTVSSGGGGSGGGGSGGGGSDIVMSQSPDSLAVSLGER VTLNCK S S Q LL YS SNQKN YL AW YQQKPGQ SPKLLI YW A S ARE S GVPDRF S GSG SGTDFTLTISSVQAEDVAVYYCQQYYSYPLTFGAGTKLELK (SEQ ID NO:5).
- polypeptide or antibody that immunospecifically binds the epitope recognized by mab 107 comprises an amino acid sequence that comprises an amino acid sequence at least 95% or 98% identical to an amino acid sequence selected from the group consisting of:
- epitope refers to a protein determinant capable of binding to an antibody.
- Epitopes usually consist of chemically active surface groupings of molecules such as amino acids or sugar side chains and usually have specific three dimensional structural characteristics, as well as specific charge characteristics.
- Conformational and non-conformational epitopes are distinguished in that the binding to the former but not the latter is lost in the presence of denaturing solvents.
- ischemia reperfusion injury refers to an injury of organs caused by putting the organs into an ischemic condition and/or an injury of organ occurred after reperfusion.
- treatment refers to the application or administration of a therapeutic agent to a patient, or application or administration of a therapeutic agent to an isolated tissue or cell line from a subject, who has a disease, a symptom of disease or a predisposition toward a disease, with the purpose to cure, heal, alleviate, relieve, alter, remedy, ameliorate, palliate, improve or affect the disease, the symptoms of disease or the predisposition toward disease.
- purified refers to other molecules, e.g. polypeptide, nucleic acid molecule that have been identified and separated and/or recovered from a component of its natural environment.
- the polypeptides are purified polypeptides wherein they have been separated from one or more components of their natural environment.
- FIG. 1 Schematic of the protocol used to develop a chronic kidney disease (CKD) model.
- CKD chronic kidney disease
- FIGS. 2a-2q Effect of mAbl07 on progression of acute kidney injury (AKI) to chronic kidney disease (CKD) in a treated and an untreated monkey.
- FIG. 2a Serum levels of mAbs 107 and X63 in treated (Al) and control (CI) monkeys 24 hours after I/R.
- FIG. 2b Serum creatinine (sCR) prior to (day 0, dO) and one day (dl) after ischemia- reperfusion (I/R). sCR returned to normal after clamp release (arrow).
- FIG. 2c Time of no-reflow in Al and CI .
- FIG. 2d Time of no-reflow in Al and CI .
- FIG. 2e Neutrophil levels measured prior to (dO) and 1 (dl), 2(d2) and 5(d5) days after I/R.
- FIG. 2f Monocyte levels measured prior to (dO) and 1 (dl), 2(d2) and 5(d5) days after I/R.
- FIG. 2g Lymphocyte levels measured prior to (dO) and 1 (dl), 2(d2) and 5(d5) days after I/R.
- FIG. 2h Platelet levels measured prior to (dO) and 1 (dl), 2(d2) and 5(d5) days after I/R.
- FIG. 2i Platelet levels measured prior to (dO) and 1 (dl), 2(d2) and 5(d5) days after I/R.
- FIG. 2j Histograms showing binding of mAb 24 to FMLF -activated PMNs from two different naive monkeys in the absence of presence of the Fab fragment of mAb 107. MFI, mean fluorescence units.
- FIG. 2k Histograms showing binding of mAb 24 to PMNs from Al and CI monkeys. PMNs were isolated 1 day after I/R.
- FIG. 21 Flow cytometric analysis of the PMNs studies in n, unstained and following staining with FITC-labeled anti-mouse Ig.
- FIG. 2m Flow cytometric analysis of the PMNs studies in n, unstained and following staining with FITC-labeled anti-mouse Ig.
- FIG. 2n Blood urea nitrogen (BUN) levels 2 days (-d2) and one day (-dl) prior to planned euthanasia (dO). Left ureter was ligated on -d2 (arrows) after blood was withdrawn.
- FIG. 2n sCR levels 2 days (-d2) and one day (-dl) prior to planned euthanasia (dO). Left ureter was ligated on -d2 (arrows) after blood was withdrawn.
- FIG. 2o Gross appearance of harvested left and right kidneys from CI and Al .
- FIG. 2p Gross appearance of harvested left and right kidneys from CI and Al .
- FIG. 2q Histograms showing the fibrosis area (tri chrome stain-positive) presented as % of total area in ten fields at 20X magnification.
- FIGS. 3a-3j Effect of mAb 107 on AKI.
- FIG. 3a Serum levels of mAbs 107 treated monkeys A2-A4 and A5) 24 hours after I/R.
- FIG. 3b Histograms (mean + SD) showing time of no-reflow in mAb l07-treated and controls. Data are shown as mean+SD.
- FIG. 3c White blood cell (WBCs) levels in treated (A) and controls (C) measured prior on dO, dl, d2 and d5 after I/R. Data are shown as mean+SD.
- FIG. 3d Neutrophil levels in treated (A) and controls (C) measured prior on dO, dl, d2 and d5 after I/R.
- WBCs White blood cell
- FIG. 3e Monocyte levels in treated (A) and controls (C) measured prior on dO, dl, d2 and d5 after I/R. Data are shown as mean+SD.
- FIG. 3f Lymphocyte levels in treated (A) and controls (C) measured prior on dO, dl, d2 and d5 after I/R. Data are shown as mean+SD.
- FIG. 3g Platelet levels in treated (A) and controls (C) measured prior on dO, dl, d2 and d5 after I/R. Data are shown as mean+SD.
- FIG. 3h The results in treated (A) and controls (C) measured prior on dO, dl, d2 and d5 after I/R. Data are shown as mean+SD.
- HCT Hematocrit
- FIGS. 4a-4i mAbl07 salvaged right kidney function several months after AKI.
- FIG. 4a BUN levels 2 days (-d2) and one day (-dl) prior to planned euthanasia (dO). Left ureter was ligated on -d2(arrows) after blood was withdrawn.
- FIG. 4b sCR levels 2 days (-d2) and one day (-dl) prior to planned euthanasia (dO). Left ureter was ligated on - d2(arrows) after blood was withdrawn.
- FIG. 4c Representative, gross appearance of left and right kidneys from control (C4) monkeys harvested 9 months after AKI.
- FIG. 4d C4 monkeys harvested 9 months after AKI.
- FIG. 4e Histograms (mean + SD) showing average number of macrophages deposition.
- FIG. 4f Histograms (mean + SD) showing average number of collagen deposition.
- FIG. 4g Histograms (mean + SD) showing degree of fibrosis.
- FIG. 4h Representative sections of control right kidney harvested 9 months after AKI.
- FIG. 4i Representative sections of treated right kidney harvested 9 months after AKI.
- FIGS. 5a-5b Effect of mAbl07 on kidney levels of inflammatory mediators.
- FIG. 5a Cytokine/chemokine and complement C3 levels in right kidney biopsies 1-2 days after AKI, 3 (Al) and 9 (A2) months later in two treated (Al, A2) and control animals.
- FIG. 5b Cytokine/chemokine and complement C3 levels in left and right kidneys 3 (Al) months after AKI in treated and control animals.
- FIG. 6 Histograms showing serum levels of IL8 and MCP1 in control (CI) and treated (Al) animals prior to (pre) and lday after I/R.
- FIG. 7 Amino acid sequences of mouse mAbl07 heavy chain (H-chain).
- CDR Complementarity determining regions
- FIG. 8 Amino acid sequences of mouse mAbl07 light chain (L-chain). CDRs are underlined. Text in brackets represents the VL region.
- FIG. 9. Amino acid sequences of humanized mAbl07 VH. CDRs are underlined.
- FIG. 10. Amino acid sequences of humanized mAbl07 VH. CDRs are underlined.
- FIG. 11. Amino acid sequences of a humanized single chain variable fragment of 107 (scFv) with a linker (in brackets) linking VH and VL segments. CDRs are underlined.
- the present disclosure is based, in part, on the observation that a polypeptide that immunospecifically binds the epitope recognized by mabl07 has various therapeutic uses, e.g., in treating disorders associated with ischemia reperfusion injury.
- Ischemia reperfusion injury are injuries caused by putting the organs into an ischemic condition and/or an injury of organ occurred after reperfusion.
- Ischemia generally refers to a restriction in blood supply to tissues, causing a shortage of oxygen and glucose needed for cellular metabolism.
- Reperfusion injury is the tissue damage caused when blood supply returns to the tissue after a period of ischemia. The absence of oxygen and nutrients from blood during the ischemic period creates a condition in which the restoration of circulation results in inflammation and oxidative damage through the induction of oxidative stress rather than restoration of normal function.
- Acute kidney injury an inflammatory disease often caused by ischemia- reperfusion (I/R) 1 2 , is a common and growing burden for the healthcare system worldwide 3 4 .
- AKI appears to incur long-term risks of developing chronic fibrosis and end stage renal disease (ESRD) in humans, especially following severe (dialysis- requiring) injury to native or transplanted kidneys 5"7 .
- ESRD end stage renal disease
- Ischemic acute kidney injury is a strong predictor of progression to fibrotic chronic kidney disease (CKD).
- CKD fibrotic chronic kidney disease
- the lack of effective therapies is due in part to the scarcity of animal models of CKD, especially in nonhuman primates.
- the innate immune system plays an important role in ischemic AKI but its contribution to progression to fibrotic kidney disease is less clear.
- This disclosure provides a model of post-ischemic CKD in Cynomolgus monkeys and assesses the potential role of the archetypal innate immune receptor CD l ib/CD 18 (Complement Receptor 3) in progression to CKD.
- mAbl07 deposited in the American Type Culture Collection under Accession Number ATCC PTA-11614
- mAbl07 binds in a divalent- cation-dependent manner to solvent-exposed residues on the MIDAS face of CDl lb, blocks interaction of 1 IbA or the holoreceptor with ligands, and inhibits spreading and phagocytosis by human neutrophils.
- mAb 107 preferentially binds to the inactive low-affinity form of the integrin, suggesting that its antagonistic effects are exerted in part by stabilizing the receptor in the low-affinity state.
- Prolonged renal hypoperfusion is the most frequent cause of intrinsic AKI in hospitalized patients 5 .
- Controversy currently exists as to whether AKI per se causes CKD and ESRD 39 ' 40 , given that patients who develop AKI tend to be older with a higher burden of comorbidities that could serve as more direct causes.
- the CKD model clearly shows that severe I/R AKI is the direct cause of ESRD in previously healthy cynomolgus monkeys.
- CR3 early inactivation of the innate immune receptor CD 1 lb/CD 18
- Ischemic injury targets renal tubular epithelial cells, peritubular capillary endothelium and the renal mononuclear phagocytic system.
- the resulting lethal or sublethal cell damage triggers an intrinsic inflammatory response that involves the activation of pattern recognition receptors (PRRs) by secretion of a multitude of damage- associated molecular patterns (DAMPs), and activation of the complement and coagulation systems.
- PRRs pattern recognition receptors
- DAMPs damage- associated molecular patterns
- the proinflammatory chemokines and cytokines produced recruit circulating inflammatory cells to the kidney following reperfusion 10 .
- Microvacular occlusion is further aggravated by the new supply of activated leukocytes and platelets after resumption of blood flow - the no-reflow phenomenon 42,43 .
- mAbl07 did not protect renal tubular epithelial from the initiating ischemic insult, as judged functionally by the life-threatening rise in serum creatinine, and pathologically by widespread acute tubular necrosis detected in the right injured kidney one to two days after severe I/R, but mAbl07 therapy salvaged kidney structure and function from otherwise irreversible fibrosis, microvascular rarefaction and organ failure 3-9 months later.
- One consistent and immediate response to mAbl07 was a significant reduction in the no-reflow phenomenon. Prolonged microvascular no-reflow is known to increase the risk of primary kidney allograft dysfunction 44 .
- CDl lb/CD 18 inactivation is likely related at least in part to inhibition of leukocyte adhesion-dependent damage to peritubular capillary endothelium, and prevention of intracapillary PMN-platelet and PMN-PMN aggregates.
- a second early response to mAbl07 therapy was a dramatic reduction in the pro- inflammatory mediators RANTES, IL18, complement C3, IL6 and IFNy in the right kidney 1- 2 days after I/R, which remained low in the same kidneys when harvested several months later.
- These mediators are produced by ischemic parenchymal cells, as well as infiltrating leukocytes including KT and neutrophils 12 ' 45 .
- Mouse knockouts of RANTES 46 , IL18 47 , complement 48 , IL6 45 or NKT (IFNy) depletion partially protected kidney function 1-7 days post-ischemic AKI.
- IL2 produced by activated CD4 + T cells and DCs 53 and was increased in treated right kidneys 1-2 days after injury, but returned to near baseline levels in harvested right kidneys.
- IL-2 plays an important role in expansion and/or function of CD4 + CD25 + regulatory T cells (Treg) 54 , which are known to attenuate I/R AKI in rodents 14 55 .
- Treg regulatory T cells
- Harvested mAb l07-treated kidneys expressed increased levels of active TGFp i, which is secreted by most immune cells, is required for Treg suppressor activity 56 .
- the early rise of IL-2, and late increase in TGFp i reflects the subtle shifts in cytokine and chemokine production occurring in the mAb l07-treated monkeys that contribute to the late recovery of kidney function.
- the present disclosure provides therapeutic uses of integrin-binding antibodies.
- the described method is designed to inhibit both the initial inflammatory reaction elicited by ischemic activation of intrinsic CDl lb + immune cells, and the one following reperfusion, by giving the half the dose mAb prior to ischemia and the other half before reperfusion.
- renal recovery can be improved further by adding a second dose a week later, for example, or by administering the mAb immediately prior to or after reperfusion.
- Preemptive use of mAb 107 as used in this model can be of therapeutic benefit in a various clinical settings associated with development of AKI with no active treatments, for example, high-risk cardiac surgery (e.g.
- Ischemic AKI is a common complication of cardiac surgery especially in high-risk patients with renal hypoperfusion 64 , and carries an increased risk of progression to CKD and long-term mortality 65 ⁇ 56 .
- Preoperative mAb 107 administration may accelerate kidney recovery and prevent CKD in this setting.
- CD1 lb + inflammatory cells play an important role in AKI-induced by Adriamycin: a mAb to CD 1 lb/CD 18 reduced renal injury in Adriamycin nephropathy by partially depleting CD1 lb + macrophages 67 .
- Pretreatment with mAb 107 is a safer and more effective alternative.
- I/R AKI after kidney transplantation is also a major cause of delayed graft function 51 , which negatively affects long-term graft survival 68 .
- Therapeutic strategies using mAb 107 can be implemented in both donor and recipient, or by adding mAb 107 to the perfusion fluid during machine preservation 69 .
- therapeutic compositions herein can interact with (e.g., bind, bind specifically and/or bind immunospecifically) binding partners (e.g., an immunogen(s), antigen(s), and/or epitope(s)) related to a disease or condition, wherein interaction between the therapeutic composition and the binding partners results in an improvement towards the condition or disease (e.g., a decrease in the level of disease or symptoms thereof in a subject).
- binding partners e.g., an immunogen(s), antigen(s), and/or epitope(s)
- therapeutic compositions can include a polypeptide that immunospecifically binds the epitope recognized by mabl07.
- the polypeptide can include (e.g., comprise, consist essentially of, or consist of) at least one (e.g., one, two, three, four, five, and/or six) complementarity determining region (CDR) of the variable heavy chain (VH) and/or variable light chain (VL) of antibody as shown in Table 1 (See also FIGS. 7 and 8).
- CDR complementarity determining region
- therapeutic compositions can include polypeptides that include (e.g., comprise, consist essentially of, or consist of) at least one (e.g., one, two, or three) complementarity determining region (CDR) of the variable heavy chain (VH) and/or at least one (e.g., one, two, or three) complementarity determining region (CDR) variable light chain (VL) of antibody as shown in Table 1.
- CDR complementarity determining region
- VH variable heavy chain
- VL variable light chain
- a polypeptide that immunospecifically binds the epitope recognized by mabl07 is mabl07 itself.
- therapeutic compositions can include polypeptides that include
- CDR complementarity determining region
- the affinity of binding between the polypeptide and integrin or integrin subunits can be between about O. lnM to ⁇ , for example, about ⁇ .
- therapeutic compositions can include peptides (e.g., polypeptides), including for example, antibodies, including full length and/or intact antibodies, or antibody fragments.
- peptides e.g., polypeptides
- An "antibody” is an immunoglobulin molecule capable of specific binding to a target, such as a carbohydrate, polynucleotide, lipid, polypeptide, etc., through at least one antigen recognition site, located in the variable region of the immunoglobulin molecule.
- an antibody encompasses not only intact polyclonal or monoclonal antibodies, but also any antigen binding fragment (i.e., "antigen-binding portion") or single chain thereof, fusion proteins comprising an antibody, and any other modified configuration of the immunoglobulin molecule that comprises an antigen recognition site.
- An antibody includes an antibody of any class, such as IgQ IgA, or IgM (or sub-class thereof), and the antibody need not be of any particular class.
- immunoglobulins can be assigned to different classes.
- immunoglobulins There are five major classes of immunoglobulins: IgA, IgD, IgE, IgQ and IgM, and several of these may be further divided into subclasses (isotypes), e.g., IgGl, IgG2, IgG3, IgG4, IgAl and IgA2.
- the heavy-chain constant regions that correspond to the different classes of immunoglobulins are called alpha, delta, epsilon, gamma, and mu, respectively.
- antibodies and antibody fragments include, but are not limited to, monoclonal antibodies (including full-length monoclonal antibodies), polyclonal antibodies, multispecific antibodies formed from at least two different epitope binding fragments (e.g., bispecific antibodies), camelised antibodies, chimeric antibodies, single chain variable fragments (scFv), single-chain antibodies, single domain antibodies, domain antibodies, Fab fragments, F(ab')2 fragments, antibody fragments that exhibit the desired biological activity (e.g.
- antigen binding portion disulfide-linked Fvs (dsFv), and anti -idiotypic (anti-Id) antibodies (including, e.g., anti-Id antibodies to antibodies of the invention), intrabodies, and epitope-binding fragments of any of the above.
- dsFv disulfide-linked Fvs
- anti-Id antibodies including, e.g., anti-Id antibodies to antibodies of the invention
- intrabodies intrabodies, and epitope-binding fragments of any of the above.
- antibodies or antibody fragments can be human or humanized.
- the VH region in a humanized antibody or antibody fragment includes amino acid sequences as shown in FIG. 9.
- the VL region in a humanized antibody or antibody fragment includes amino acid sequences as shown in FIG. 10.
- Fragments of antibodies are suitable for use in the methods provided so long as they retain the desired affinity and specificity of the full-length antibody.
- a fragment of an antibody that binds the epitope recognized by mabl07 will retain an ability to bind to the epitope recognized by mabl07 in the Fv portion.
- An Fv fragment is an antibody fragment which contains a complete antigen recognition and binding site.
- This region consists of a dimer of one heavy and one light chain variable domain in tight association, which can be covalent in nature, for example in scFv. It is in this configuration that the three CDRs of each variable domain interact to define an antigen binding site on the surface of the VH-VL dimer.
- CDRs or a subset thereof confer antigen binding specificity to the antibody.
- a single variable domain or half of an Fv comprising only three CDRs specific for an antigen
- Single-chain Fv or (scFv) antibody fragments comprise the VH and VL domains of antibody, wherein these domains are present in a single polypeptide chain.
- the Fv polypeptide further comprises a polypeptide linker between the VH and VL domains, which enables the scFv to form the desired structure for antigen binding.
- scFV that immunospecifically binds the epitope recognized by mab l07 is shown in FIG. 11. This scFV includes a humanized VH segment, a humanized VL segment, and a linker between these two segments.
- the Fab fragment contains a variable and constant domain of the light chain and a variable domain and the first constant domain (CHI) of the heavy chain.
- F(ab')2 antibody fragments comprise a pair of Fab fragments which are generally covalently linked near their carboxy termini by hinge cysteines between them. Other chemical couplings of antibody fragments are also known in the art.
- Diabodies are small antibody fragments with two antigen-binding sites, which fragments comprise a VH connected to a VL in the same polypeptide chain (VH and VL). By using a linker that is too short to allow pairing between the two domains on the same chain, the domains are forced to pair with the complementary domains of another chain and create two antigen-binding sites.
- Linear antibodies comprise a pair of tandem Fd segments (VH-CH1-VH-CH1) which, together with complementary light chain polypeptides, form a pair of antigen binding regions.
- Linear antibodies can be bispecific or monospecific.
- Antibodies and antibody fragments of the present disclosure can be modified in the Fc region to provide desired effector functions or serum half-life.
- the Fc region can be conjugated to PEG or albumin to increase the serum half-life, or some other conjugation that results in the desired effect.
- certain other Fc regions may be used.
- Human and humanized antibodies include antibodies having variable and constant regions derived from (or having the same amino acid sequence as those derived from) human germline immunoglobulin sequences. Human antibodies may include amino acid residues not encoded by human germline immunoglobulin sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo), for example in the CDRs and in particular CDR3.
- Polypeptides that immunospecifically bind the epitope recognized by mabl07 can be prepared from hybridoma cells, for example, a hybridoma cell line deposited on Jan. 26, 2011, in the American Type Culture Collection (10801 University Boulevard. Manassas, Va. 20110-2209) with Accession Number ATCC PTA-11614.
- mAb-containing supematants harvested from hybridoma cultures are clarified and concentrated.
- the mAb can be purified on various chromatographs, for example, Protein A affinity
- Endotoxin can removed by an endotoxin removing gel, such as Detoxi-GelTM Endotoxin Removing Gel (Pierce, Rockford, IL).
- the level of endotoxin in the final product and in buffers can be determined with the Limulus Amebocyte Lysate (LAL) gel-clot test.
- mAb concentration can be determined by UV absorbance. Purity can be assessed by sodium dodecyl sulphate polyacrylamide gel electrophoresis (SDS-PAGE) and Coomassie staining.
- SDS-PAGE sodium dodecyl sulphate polyacrylamide gel electrophoresis
- Coomassie staining The sterile and purified mAb can be stored at 4°C until used. Detailed methods of preparing monoclonal antibodies are described, e.g., in
- polypeptides that immunospecifically bind the epitope recognized by mabl07 can be prepared from immune cells and molecular biology techniques.
- Obtaining or targeting immune cells can include one or more and/or combinations of, for example: obtaining or providing a tetrameric immunogen (e.g., the epitope recognized by mabl07) that can bind (e.g., bind specifically) to a target immune cell; contacting the tetrameric immunogen with a sample; detecting the tetrameric immunogen; determining whether the tetrameric immunogen is bound to a target immune cell; and, if the tetrameric immunogen is bound to a target immune cell, then obtaining the target immune cell.
- a tetrameric immunogen e.g., the epitope recognized by mabl07
- bind e.g., bind specifically
- genetic material e.g., DNA and/or mRNA
- methods for isolating or purifying genetic material e.g., DNA and/or mRNA
- genetic material e.g., DNA and/or mRNA
- methods for using it to produce the therapeutic compositions disclosed herein are known in the art and/or are summarized below.
- genetic material can be varied, using techniques known in the art to create polypeptide variants disclosed herein.
- Generating polypeptides from nucleic acids (e.g., cDNA) contained within or obtained from the target cell can include, for example, analysis, e.g., sequencing of heavy and light chain variable domains from target immune cells (e.g., single or isolated identified target immune cells).
- methods can include generating fully human antibodies, or fragments thereof (e.g., as disclosed above), and humanization of nonhuman antibodies.
- DNA can be readily isolated and/or sequenced from the obtained immune cells using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of murine antibodies).
- DNA can be placed into expression vectors, which are then transfected into host cells such as Escherichia coli cells, simian COS cells, Chinese Hamster Ovary (CHO) cells, or myeloma cells that do not otherwise produce antibody protein, to obtain the synthesis of monoclonal antibodies in the recombinant host cells.
- host cells such as Escherichia coli cells, simian COS cells, Chinese Hamster Ovary (CHO) cells, or myeloma cells that do not otherwise produce antibody protein
- Recombinant expression of an antibody or variant thereof generally requires construction of an expression vector containing a polynucleotide that encodes the antibody.
- the invention thus, provides replicable vectors comprising a nucleotide sequence encoding an antibody molecule, a heavy or light chain of an antibody, a heavy or light chain variable domain of an antibody or a portion thereof, or a heavy or light chain CDR, operably linked to a promoter.
- Such vectors may include the nucleotide sequence encoding the constant region of the antibody molecule (see, e.g., US. Patent Nos. 5,981,216; 5,591,639; 5,658,759 and 5,122,464) and the variable domain of the antibody may be cloned into such a vector for expression of the entire heavy, the entire light chain, or both the entire heavy and light chains.
- the transfected cells are then cultured by conventional techniques to produce an antibody.
- the invention includes host cells containing a polynucleotide encoding an antibody of the invention or fragments thereof, or a heavy or light chain thereof, or portion thereof, or a single-chain antibody of the invention, operably linked to a heterologous promoter.
- vectors encoding both the heavy and light chains may be co-expressed in the host cell for expression of the entire immunoglobulin molecule, as detailed below.
- Mammalian cell lines available as hosts for expression of recombinant antibodies are well known in the art and include many immortalized cell lines available from the American Type Culture Collection (ATCC), including but not limited to Chinese hamster ovary (CHO) cells, HeLa cells, baby hamster kidney (BHK) cells, monkey kidney cells (COS), human hepatocellular carcinoma cells (e.g., Hep G2), human epithelial kidney 293 cells, and a number of other cell lines.
- ATCC American Type Culture Collection
- CHO Chinese hamster ovary
- HeLa cells HeLa cells
- BHK baby hamster kidney
- COS monkey kidney cells
- human hepatocellular carcinoma cells e.g., Hep G2
- human epithelial kidney 293 cells e.g., Hep G2
- Different host cells have characteristic and specific mechanisms for the post-translational processing and modification of proteins and gene products. Appropriate cell lines or host systems can be chosen to ensure the correct modification and processing of the antibody or portion thereof
- eukaryotic host cells which possess the cellular machinery for proper processing of the primary transcript, glycosylation, and phosphorylation of the gene product may be used.
- mammalian host cells include but are not limited to CHO, VERY, BHK, Hela, COS, MDCK, 293, 3T3, W138, BT483, Hs578T, HTB2, BT20 and T47D, NSO (a murine myeloma cell line that does not endogenously produce any functional
- human cell lines developed by immortalizing human lymphocytes can be used to recombinantly produce monoclonal antibodies.
- the human cell line PER.C6. (Crucell, Netherlands) can be used to recombinantly produce monoclonal antibodies.
- polypeptides disclosed herein can be generated
- Synthetic chemistry transformations and protecting group methodologies useful in synthesizing polypeptides described herein are known in the art and include, for example, those such as described in R. Larock,
- Peptides can also be made by chemical synthesis methods, which are well known to the ordinarily skilled artisan. See, for example, Fields et al., Chapter 3 in Synthetic Peptides: A User's Guide, ed. Grant, W. H. Freeman & Co., New York, N.Y., 1992, p. 77. Hence, peptides can be synthesized using the automated Merrifield techniques of solid phase synthesis with the a-NH2 protected by either t-Boc or Fmoc chemistry using side chain protected amino acids on, for example, an Applied Biosystems Peptide Synthesizer Model 43 OA or 431.
- C(O)-NH retro-inverso bonds
- NH-CH2 reduced amide bond
- S-CH2 or CH2-S o
- Peptides can be further modified by: acetylation, amidation, biotinylation, cinnamoylation, farnesylation, fluoresceination, formylation, myristoylation,
- peptides can be conjugated to, for example,
- polyethylene glycol PEG
- alkyl groups e.g., C1-C20 straight or branched alkyl groups
- fatty acid radicals and combinations thereof.
- peptides can be purified by any method known in the art for purification of an immunoglobulin molecule, for example, by chromatography (e.g., ion exchange, affinity, particularly by affinity for the specific antigens Protein A or Protein G, and sizing column chromatography), centrifugation, differential solubility, or by any other standard technique for the purification of proteins.
- the antibodies of the present invention or fragments thereof may be fused to heterologous polypeptide sequences (referred to herein as "tags") described above or otherwise known in the art to facilitate purification.
- Peptides can be further modified by: acetylation, amidation, biotinylation, cinnamoylation, farnesylation, fluoresceination, formylation, myristoylation, palmitoylation, phosphorylation (Ser, Tyr or Thr), stearoylation, succinylation and sulfurylation.
- peptides can be conjugated to, for example, polyethylene glycol (PEG); alkyl groups (e.g., C1-C20 straight or branched alkyl groups); fatty acid radicals; and combinations thereof.
- polypeptides can be purified by any method known in the art for purification of an immunoglobulin molecule, for example, by chromatography (e.g., ion exchange, affinity, particularly by affinity for the specific antigens Protein A or Protein G, and sizing column chromatography), centrifugation, differential solubility, or by any other standard technique for the purification of proteins.
- chromatography e.g., ion exchange, affinity, particularly by affinity for the specific antigens Protein A or Protein G, and sizing column chromatography
- centrifugation e.g., ion exchange, affinity, particularly by affinity for the specific antigens Protein A or Protein G, and sizing column chromatography
- differential solubility e.g., differential solubility
- the antibodies of the present invention or fragments thereof may be fused to heterologous polypeptide sequences (referred to herein as "tags") described above or otherwise known in the art to facilitate purification.
- the disclosure provides methods of treatment that include administering to a subject a composition disclosed herein.
- subject refers to any animal. In some embodiments, the subject is a mammal. In some embodiments, the term “subject”, as used herein, refers to a human (e.g., a man, a woman, or a child). Samples for use in the methods can include serum samples, e.g., obtained from the selected subject.
- subject selection can include obtaining a sample from a subject (e.g., a candidate subject) and testing the sample for an indication that the subject is suitable for selection.
- the subject can be confirmed or identified, e.g. by a health care professional, as having had or having a condition or disease.
- exhibition of a positive response towards a condition or disease can be made from patient records, family history, and/or detecting an indication of a positive response.
- multiple parties can be included in subject selection. For example, a first party can obtain a sample from a candidate subject and a second party can test the sample.
- subjects can be selected and/or referred by a medical practitioner (e.g., a general practitioner).
- subject selection can include obtaining a sample from a selected subject and storing the sample and/or using the in the methods disclosed herein. Samples can include, for example, cells or populations of cells. Ischemia reperfusion injuries
- Mammal organs usually require a continuous supply of oxygen to maintain normal function. Under aerobic conditions, the organ tissue derives its energy primarily from the mitochondria. Following the onset of ischemia there is a rapid decline in high- energy phosphate levels with alterations in mitochondrial structure, volume, oxygen consumption, and ATP synthesis. Ischemia reperfusion injuries may affect various organs.
- the methods described herein include methods for the treatment of disorders associated with ischemia reperfusion injuries in various organs, for example, kidney, heart, lung, brain etc. Many disorders are associated with ischemia reperfusion injuries. Methods described herein can be used to treat these disorders, for example, acute kidney injury, acute coronary syndrome, acute myocardial infarction, mesenteric ischemia, brain ischemia, stroke, acute limb ischemia, cyanosis, gangrene, etc.
- the methods described herein also include methods of preventing or ameliorating a pathology caused by ischemia reperfusion injury, for example, chronic kidney disease, kidney fibroinflammatory diseases, post-ischemic renal fibrosis, post-MI left ventricular adverse remodeling, pulmonary fibrosis, ischemic colitis, etc.
- ischemia reperfusion injury for example, chronic kidney disease, kidney fibroinflammatory diseases, post-ischemic renal fibrosis, post-MI left ventricular adverse remodeling, pulmonary fibrosis, ischemic colitis, etc.
- the methods include administering a therapeutically effective amount of composition comprising a polypeptide that immunospecifically binds the epitope recognized by mabl07, to a subject who is in need of, or who has been determined to be in need of, such treatment.
- a therapeutically effective amount of composition comprising a polypeptide that immunospecifically binds the epitope recognized by mabl07 is administered to the subject within about 3 hours after the ischemia reperfusion injury, within about 2 hours after the ischemia reperfusion injury, within about 1.5 hours after the ischemia reperfusion injury, within about 1 hours after the ischemia reperfusion injury, within about 0.5 hours after the ischemia reperfusion injury.
- Appropriate dosage and treatment regimen can be determined by an experienced clinician.
- an therapeutically effective amount of composition comprising a polypeptide that immunospecifically binds the epitope recognized by mabl07 can be administered to a subject.
- an amount of 4-12 mg/Kg of the polypeptide e.g., mabl07 is administered to a subject.
- a polypeptide that immunospecifically binds the epitope recognized by mabl07 is administered after the ischemia but before reperfusion occurs. In some embodiments, the polypeptide is administered after the reperfusion. In some embodiments, the intervention is preventive in nature. Thus, the polypeptide is administered to a subject who is likely to suffer ischemia reperfusion injury, but has not developed ischemia reperfusion injury. In some embodiments, the polypeptide is administered to the subject before the ischemia reperfusion injury.
- the ischemia-reperfusion injury is a very important problem during organ transplantation. Much damage in organ transplantation appears to be induced by reperfusion injury. Organs used for transplantation often undergoes lengthy periods of cold ischemic storage after devascularization and cold perfusion, resulting in an increased susceptibility to damage upon reperfusion. Ischemia/reperfusion injury often leads to delayed graft function.
- Methods described herein include methods of reducing delayed graft function followed by organ transplantation, for example, heart transplantation, kidney
- a polypeptide that immunospecifically binds the epitope recognized by mabl07 can be used to control ischemia/reperfusion damage for transplanted organs.
- a therapeutically effective amount of composition comprising a polypeptide that immunospecifically binds the epitope recognized by mabl07 is administered to the organ recipient prior to, during, or after the organ transplantation procedure.
- a therapeutically effective amount of composition comprising a polypeptide that immunospecifically binds the epitope recognized by mabl07 is administered to the donor before the organ is harvested.
- the polypeptide can be injected into the blood vessels (e.g., arteries, veins) of the transplanted organ or directly injected into the organ tissue, or the polypeptide can be added to the perfusion fluid for organ preservation, when the retrieved organ is preserved in a preservation apparatus.
- the blood vessels e.g., arteries, veins
- the polypeptide can be added to the perfusion fluid for organ preservation, when the retrieved organ is preserved in a preservation apparatus.
- Autoimmune diseases arise from an abnormal immune response of the body against substances and tissues normally present in the body (autoimmunity). This may be restricted to certain organs (e.g. in autoimmune thyroiditis) or involve a particular tissue in different places (e.g. Goodpasture's disease which may affect the basement membrane in both the lung and the kidney).
- Methods described herein includes methods of treating a subject having autoimmune diseases, for example, cytoplasmic antineutrophil cytoplasmic antibodies (cANCA)-associated vasculitis.
- the methods include
- composition comprising a polypeptide that immunospecifically binds the epitope recognized by mabl07.
- composition comprising a polypeptide that immunospecifically binds the epitope recognized by mabl07 is administered to a subject with at least one or two other immunosuppression compositions, for example, glucocorticoid, cyclophosphamide, azathioprine,
- Diabetic nephropathy (or diabetic kidney disease) is a progressive kidney disease caused by damage to the capillaries in the kidneys' glomeruli. It is due to longstanding diabetes mellitus, and characterized by nephrotic syndrome and diffuse scarring of the glomeruli.
- Methods described herein includes methods of treating a subject having diabetic nephropathy comprising.
- the methods include administering to the subject a therapeutically effective amount of composition comprising a polypeptide that immunospecifically binds the epitope recognized by mabl07.
- Chemotherapy is a common treatment for various cancers, however, it also causes several serious complications. Chemotherapy-induced organ toxicity is one complication that limits the clinical use of chemotherapeutic agents. For example, certain
- chemotherapeutic agents such as anthracyclines
- anthracyclines are highly effective against acute lymphoblastic and myeloblastic leukemias, but are particularly harmful to the heart due to its effects on mitochondria.
- Adriamycin is another example. Adriamycin
- doxorubicin is an anthracycline, a class of anti-tumor drugs with a very wide spectrum of activity in human cancers. In humans, Adriamycin undergoes rapid plasma clearance and there is significant tissue binding. Adriamycin accumulates mainly in the kidney. This probably accounts for the greater nephrotoxicity, leading to Adriamycin
- nephropathy nephropathy. These chemotherapies often induce organ failure by triggering
- a monoclonal antibody that targets CD 1 lb/CD 18 can reduce renal injury in Adriamycin nephropathy by partially depleting CD1 lb+ macrophages (Wang, Y., et al. Partial depletion of macrophages by ED7 reduces renal injury in Adriamycin
- pretreatment with a polypeptide that immunospecifically binds the epitope recognized by mabl07 may be a safer and more effective alternative, because the polypeptide that
- mabl07 immunospecifically binds the epitope recognized by mabl07 (e.g., mabl07) does not deplete leukocytes.
- Methods described herein includes methods of preventing or ameliorating a pathology caused by chemotherapy in a subject, for example, by reducing chemotherapy toxicity.
- One useful method to minimize chemotherapy-induced organ toxicity is to administer a therapeutically effective amount of composition comprising a polypeptide that immunospecifically binds the epitope recognized by mabl07 to a subject that is currently under a chemotherapy treatment regimen. If the subject needs to be treated with chemotherapy (e.g., because prescribed by a physician or veterinarian), the subject can be treated with a polypeptide that immunospecifically binds the epitope recognized by mabl07 before, during, and/or after administration of the chemotherapy.
- subjects can be treated with a polypeptide that immunospecifically binds the epitope recognized by mabl07 starting immediately after administering chemotherapy to a subject, as a singular treatment or continuing intermittently or continuously for about 1, 2, 5, 8, 10, 20, 30, 50, or 60 days, one year, indefinitely, or until a physician determines that administration of the polypeptide is no longer necessary.
- compositions comprising a polypeptide that immunospecifically binds the epitope recognized by mabl07 as an active ingredient.
- compositions typically include a pharmaceutically acceptable carrier.
- pharmaceutically acceptable carrier includes saline, solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like, compatible with pharmaceutical
- compositions are typically formulated to be compatible with its intended route of administration.
- routes of administration include parenteral, e.g., intravenous, intradermal, subcutaneous, oral (e.g., inhalation), transdermal (topical), transmucosal, and rectal administration.
- solutions or suspensions used for parenteral, intradermal, or subcutaneous application can include the following components: a sterile diluent such as water for injection, saline solution, fixed oils, polyethylene glycols, glycerine, propylene glycol or other synthetic solvents; antibacterial agents such as benzyl alcohol or methyl parabens; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as ethylenediaminetetraacetic acid; buffers such as acetates, citrates or phosphates and agents for the adjustment of tonicity such as sodium chloride or dextrose. pH can be adjusted with acids or bases, such as hydrochloric acid or sodium hydroxide.
- the parenteral preparation can be enclosed in ampoules, disposable syringes or multiple dose vials made of glass or plastic.
- compositions suitable for injectable use can include sterile aqueous solutions (where water soluble) or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion.
- suitable carriers include physiological saline, bacteriostatic water, Cremophor ELTM (BASF, Parsippany, NJ) or phosphate buffered saline (PBS).
- the composition must be sterile and should be fluid to the extent that easy syringability exists. It should be stable under the conditions of manufacture and storage and must be preserved against the contaminating action of microorganisms such as bacteria and fungi.
- the carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyetheylene glycol, and the like), and suitable mixtures thereof.
- the proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants.
- Prevention of the action of microorganisms can be achieved by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, ascorbic acid, thimerosal, and the like.
- isotonic agents for example, sugars, polyalcohols such as mannitol, sorbitol, sodium chloride in the composition.
- Prolonged absorption of the injectable compositions can be brought about by including in the composition an agent that delays absorption, for example, aluminum monostearate and gelatin.
- Sterile injectable solutions can be prepared by incorporating the active
- composition in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by filtered sterilization.
- dispersions are prepared by incorporating the active composition into a sterile vehicle, which contains a basic dispersion medium and the required other ingredients from those enumerated above.
- sterile powders for the preparation of sterile injectable solutions the preferred methods of preparation are vacuum drying and fireeze- drying, which yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
- Oral compositions generally include an inert diluent or an edible carrier.
- the active composition can be incorporated with excipients and used in the form of tablets, troches, or capsules, e.g., gelatin capsules.
- Oral compositions can also be prepared using a fluid carrier for use as a mouthwash.
- Pharmaceutically compatible binding agents, and/or adjuvant materials can be included as part of the composition.
- the tablets, pills, capsules, troches and the like can contain any of the following ingredients, or compounds of a similar nature: a binder such as microcrystalline cellulose, gum tragacanth or gelatin; an excipient such as starch or lactose, a disintegrating agent such as alginic acid, Primogel, or corn starch; a lubricant such as magnesium stearate or Sterotes; a glidant such as colloidal silicon dioxide; a sweetening agent such as sucrose or saccharin; or a flavoring agent such as peppermint, methyl salicylate, or orange flavoring.
- a binder such as microcrystalline cellulose, gum tragacanth or gelatin
- an excipient such as starch or lactose, a disintegrating agent such as alginic acid, Primogel, or corn starch
- a lubricant such as magnesium stearate or Sterotes
- a glidant such as colloidal silicon dioxide
- the composition can be delivered in the form of an aerosol spray from a pressured container or dispenser that contains a suitable propellant, e.g., a gas such as carbon dioxide, or a nebulizer.
- a suitable propellant e.g., a gas such as carbon dioxide, or a nebulizer.
- Systemic administration of a therapeutic composition as described herein can also be by transmucosal or transdermal means.
- transmucosal or transdermal For transmucosal or transdermal
- penetrants appropriate to the barrier to be permeated are used in the formulation.
- penetrants are generally known in the art, and include, for example, for transmucosal administration, detergents, bile salts, and fusidic acid derivatives.
- Transmucosal administration can be accomplished through the use of nasal sprays or suppositories.
- the active compositions are formulated into ointments, salves, gels, or creams as generally known in the art.
- the pharmaceutical compositions can be included in a container, pack, or dispenser together with instructions for administration.
- an "effective amount” is an amount sufficient to effect beneficial or desired results.
- a therapeutic amount is one that achieves the desired therapeutic effect. This amount can be the same or different from a prophylactically effective amount, which is an amount necessary to prevent onset of disease or disease symptoms.
- An effective amount can be administered in one or more administrations, applications or dosages.
- a therapeutically effective amount of a therapeutic compound i.e., an effective dosage depends on the therapeutic compounds selected.
- the compositions can be administered one from one or more times per day to one or more times per week;
- treatment of a subject with a therapeutically effective amount of the therapeutic compounds described herein can include a single treatment or a series of treatments.
- Dosage, toxicity and therapeutic efficacy of the therapeutic compounds can be determined by standard pharmaceutical procedures in cell cultures or experimental animals, e.g., for determining the LD50 (the dose lethal to 50% of the population) and the ED50 (the dose therapeutically effective in 50% of the population).
- the dose ratio between toxic and therapeutic effects is the therapeutic index and it can be expressed as the ratio LD50/ED50.
- Compounds which exhibit high therapeutic indices are preferred. While compounds that exhibit toxic side effects may be used, care should be taken to design a delivery system that targets such compounds to the site of affected tissue in order to minimize potential damage to uninfected cells and, thereby, reduce side effects.
- the data obtained from cell culture assays and animal studies can be used in formulating a range of dosage for use in humans.
- the dosage of such compounds lies preferably within a range of circulating concentrations that include the ED50 with little or no toxicity.
- the dosage may vary within this range depending upon the dosage form employed and the route of administration utilized.
- the therapeutically effective dose can be estimated initially from cell culture assays.
- a dose may be formulated in animal models to achieve a circulating plasma concentration range that includes the IC50 (i.e., the concentration of the test compound which achieves a half-maximal inhibition of symptoms) as determined in cell culture.
- IC50 i.e., the concentration of the test compound which achieves a half-maximal inhibition of symptoms
- levels in plasma may be measured, for example, by high performance liquid chromatography.
- Example 1 Ligand-mimetic mAb antagonist of leukocyte integrin CDllb/CD18 ameliorates fibrosis and kidney failure
- mAb-containing supernatants harvested from hybridoma cultures were clarified and concentrated by circulating it through a hollow fiber membrane cartridge.
- the mAb was purified by successive steps on Protein A affinity chromatography, hydroxyapatite charge exchange chromatography and size-exclusion chromatography. Endotoxin was removed using Detoxi-GelTM (Pierce, Rockford, IL) and its level in the final product and in buffers used in the purification was determined with the Limulus Amebocyte Lysate (LAL) gel-clot test.
- mAb concentration was determined by UV absorbance; purity assessed following sodium dodecyl sulphate polyacrylamide gel electrophoresis (SDS- PAGE) and Coomassie staining.
- the sterile and purified mAb was stored at 4°C until used.
- Methods of preparing monoclonal antibodies are described, e.g., in Horenstein, A.L., Durelli, I. & Malavasi, F. Purification of Clinical-Grade Monoclonal Antibodies by Chromatographic Methods. In Methods in Molecular Biology P. Therapeutic Proteins: Methods and Protocols (C Mark Smales and David C James., eds), Humana Press, Totowa, NJ, Chapter 16. (2005).
- Intravenous normal saline solution containing 40 mg cefazoline was started in the saphenous vein using a #24 angiocatheter. Detailed methods of preparing monkeys for surgery and performing surgery on monkeys are described, e.g., in Haug, C.E., et al. Real-time monitoring of renal function during ischemic injury in the rhesus monkey. Ren Fail 17, 489-502 (1995).
- Open right kidney biopsies were carried out 1-2 days and one month after reperfusion.
- the right kidney was exposed following a midline abdominal incision, and a 2x4 mm incision extending approximately 1-1/2 mm into the cortex made with the M75 blade.
- the wedge biopsy was then excised using iris scissors. Bleeding was controlled with finger pressure, and subcutaneous fat or muscle sutured into the cortical defect. After assuring hemostasis, the wound was closed in layers, the animal awakened, stable vital signs assured then returned to the housing area.
- Kidneys were exposed, inspected, the ureter and renal artery and vein were ligated and transected and the kidneys removed and submitted for testing.
- Kidney sections for histology was placed in 4% formaldehyde, embedded in paraffin, and stained with hematoxylin/eosin or immunostained using antibodies.
- RNAlater (Ambion), an RNA stabilization and protection agent. The tubes were refrigerated overnight at 4°C and stored at -70°C until ready for use.
- a videotape of the surgical procedure was used to measure the time taken for the ischemic dark purple-colored right kidney to change color back to red after right clamp release.
- Hematocrit total white blood cells, neutrophils, monocytes, lymphocytes and platelets were quantified in heparinized blood using established methods. Biochemical determinations
- cytokines, chemokines and complement C3 were performed in sera or extracts derived from equivalent amounts (by weight) of kidney tissue biopsy or autopsy using appropriate ELISA kits.
- Monkey peripheral blood leukocytes were isolated from EDTA-anti-coagulated whole blood using Ammonium-Chloride-Potassium (ACK) erythrocyte lysis buffer (Lonza) as described by the manufacturer. The leukocyte pellet was washed twice with Dulbecco's Phosphate Buffered saline solution (DPBS, Gibco®).
- DPBS Dulbecco's Phosphate Buffered saline solution
- Leukocytes were incubated with or without ⁇ of mAb 107 (lmg/ml) for 30 minutes in FACS-staining buffer (DPBS ++ solution + 1% fetal calf serum) at room temperature, washed then incubated with ⁇ FITC-anti-mouse Fab (1.4mg/ml, Jackson ImmunoResearch, West Grove, PA) for 20 minutes on ice. Cells were washed once with 0.5ml FACS-staining buffer, fixed and analyzed using a FACSCaliburTM or LSRFortessaTM flow cytometer (BD Biosciences). mAb binding was expressed as mean fluorescence intensity, as determined using the FlowJo software (BD Biosciences).
- Monkey PMNs were isolated from EDTA-anti-coagulated blood by fractionation over lympholyte-poly solution (CEDARLANE, Burlington, ON) as described by the manufacturer. Washed cells were then stained with mAb 107 as above.
- Leukocytes (1 ⁇ 10 6 cells in 100 ⁇ HBSS containing 1% globulin-free BSA (HBSS-BSA) and 1 mM each of CaCk and MgCk) were treated with FMLF (5 10 "7 M final concentration) for 10 min at 37°C.
- FMLF 10 "7 M final concentration
- Unlabeled Fab 107 was added to one half of the replicate tubes for an additional 30 min, followed by the addition of mouse mAb 24 to all of the tubes and incubation for an extra 20 min.
- Cells then were washed once, stained with the anti-Fc-specific fluorophore-labeled Ab (for 30 min at 0°C), washed again, fixed with 1% formaldehyde in PBS, and analyzed by flow cytometry as above.
- Slides were incubated in monoclonal antibody for one hr. at room temperature at 1/30, 1/100, and 1/300 dilutions. After incubation, the slides are tipped to one side to allow the excess conjugate to run off and washed in PBS four times for 5 to 10 min each. Then, the slides were incubated with polyclonal anti-mouse (rabbit-FITC labeled) at 1/200 dilution (a known optimal dilution) for 1 hr. at room temperature. Slides were then again rinsed in PBS four times for 5 - 10 minutes each, and cover-slipped with mounting medium (Aqua-Mount, Lerner Labs, Pittsburgh, PA.). The slides were then examined using a fluorescence microscope with epi-illumination equipment, which consists of barrier and excitation filters contained in a dichroic mirror package, to allow the visualization of fluorescein.
- the Aperio Scanscope allowed scanning and quantitation of the whole slide using a 20x objective lens with a numerical aperture of 0.75 coupled with a doubler objective to achieve a scan of whole slides at 40x magnification.
- the default parameters of the Positive Pixel Count (hue of 0.1 and width of 0.5) detected collagen III IHC adequately. Collagen deposition was expressed as percent of pixels positive for anti-Col antibody.
- Macrophages were identified with anti-CD68 mAb EDI (Abeam, Cambridge, MA). Antibody binding was detected with Envision Dual Link System with horseradish peroxidase (Dako, Carpineria, CA) and developed with diaminobenzidine using the Autostainer Plus automated immunohistochemical stainer (Dako). Interstitial macrophage count was expressed as an average number in 20 fields at 200X magnification. Quantitative real-time PCR
- Each 25- ⁇ 1 sample for quantitative PCR contained 2 ⁇ of cDNA, 12.5 ⁇ of 2* SYBR Green Master Mix (Applied Biosystems, Foster City, CA) and 250 nM of sense and antisense primers. Emitted fluorescence for each reaction was measured during the annealing/extension phase. The calculated number of copies was divided by the number of copies of the housekeeping gene glyceraldehyde-3 -phosphate dehydrogenase (GAPDH).
- GPDH housekeeping gene
- a nonhuman primate model of post-ischemic CKD We modified an earlier model of ischemic AKI in nonhuman primates to assess the impact of severe AKI on chronic fibrosis and kidney failure (Haug, C.E., et al. Realtime monitoring of renal function during ischemic injury in the rhesus monkey. Ren Fail 17, 489-502 (1995)).
- Haug, C.E., et al. Realtime monitoring of renal function during ischemic injury in the rhesus monkey. Ren Fail 17, 489-502 (1995) In a pilot study of 2 Cynomolgus monkeys, we induced warm ischemic AKI by a two-hour right hilar cross clamping, with contralateral ligation of the left ureter. This lead to acute right kidney failure, necessitating release of left ureter ligature 2 days later to avoid animal death from uremia.
- the above CKD model was used to assess the role of CD1 lb + innate immune cells in acute and chronic kidney injury in a pair of healthy Cynomolgus monkeys.
- One animal (Al, 4.2 kg) received intravenous mAb 107 at 6 mg/kg, with 1 ⁇ 2 the dose given 2 minutes prior to ischemia and the other half 2 minutes before reperfusion.
- the control animal (CI, 3.0 kg) received an equal dose of an IgGl -matched nonreactive mouse mAb X63 (ATCC).
- ATCC IgGl -matched nonreactive mouse mAb X63
- the surgical team was blinded as to which animal received the respective mAb.
- Serum creatinine (Cr) and blood urea nitrogen (BUN) were measured prior to and during left ureter ligation to assess right kidney function.
- Right kidney biopsies were performed one day after ischemia, at which time the serum levels of mAbs 107 and X63 were 105.6 ⁇ g/ml and 73.8 ⁇ g/ml, respectively. These levels were similar on day 2 and became undetectable by day 13 (FIG. 2a).
- Right kidney biopsy was repeated one month after AKI. Three months after right AKI and two days before planned euthanasia, the left ureter was again ligated for 2 days, and Cr levels measured daily. Both kidneys were harvested after animal sacrifice.
- Serum Cr rose by four- and seven fold in Al and CI, respectively, one day after I/R (FIG. 2b). Release of the contralateral left ureteral ligature normalized serum Cr in both animals two and five days after right AKI (FIG. 2b). Upon release of the right vascular obstruction, the no-reflow time, a reflection of the microvasculature perfusion rate, was 32 sec in Al vs. 84 sec in CI . Portions of CI right kidney retained the mottled appearance (FIG. 2c). mAbl07 did not result in depletion of peripheral white blood cells, neutrophils, monocytes, lymphocytes, platelets, or red blood cells on days 1, 2 and 5 post injury (FIG. 2d-i).
- mAbl07 is known to prevent agonist-induced conformational switching of human cellular CD1 lb/CD18 from its native inactive state to the active proadhesive state 35 . Binding of mAbl07 to polymorphonuclear cells (PMNs) isolated from two naive monkeys also blocked activation of monkey CD 1 lb/CD 18 induced by the
- mAbl07 also reduced integrin activation on monkey PMNs in vivo: flow cytometric analysis showed higher binding of APC-mAb24 to control PMNs obtained one day after AKI when compared with binding to PMNs from the treated monkey (FIG. 2k). That the latter cells already had bound mAb 107 on their surface was demonstrated by the selective binding of FITC-labeled goat anti-mouse Ig (FIG. 21).
- BUN/Cr from a baseline of 22/0.6 in the treated animal to 33/1.2 and 29/1.2 one and two days, respectively, after left ureter ligation (FIGS. 2m-n).
- the two animals were then euthanized on day 2 post left ureter ligation, and the left and right kidneys harvested, visually examined and submitted for histopathologic studies.
- the control right kidney was adherent to the surrounding tissue, and much smaller than the control left kidney, with thinning of the outer cortex (FIG.2o).
- the treated right kidney that did not adhere to the surrounding tissue, and was only slightly smaller than the left kidney (FIG. 2o).
- chemokine receptors CCR2 and CX3CR1 mediate monocyte/macrophage trafficking in kidney ischemia-reperfusion injury. Kidney international 14, 1526-1537 (2008).
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- Immunology (AREA)
- General Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- Engineering & Computer Science (AREA)
- General Chemical & Material Sciences (AREA)
- Pharmacology & Pharmacy (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Urology & Nephrology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Peptides Or Proteins (AREA)
Abstract
This disclosure relates to therapeutic use of integrin-binding antibodies.
Description
THERAPEUTIC USE OF INTEGRIN-BINDING ANTIBODIES
FEDERALLY SPONSORED RESEARCH OR DEVELOPMENT
This invention was made with United States government support under the National Institutes of Health (NIH) grants DK088327, DK48549 and DK007540 and the National Institutes of Diabetes, Digestive and Kidney diseases (NIDDK) grant. The United States government has certain rights in the invention.
TECHNICAL FIELD
This disclosure relates to therapeutic use of integrin-binding antibodies.
BACKGROUND
Integrins are heterodimeric receptors that mediate interactions both between cells and between cells and the extracellular matrix via ligand binding. Many integrins are thought to exist in two conformations, a low affinity state (the "closed" or "unliganded" conformation") and a high affinity state (the "open" or "liganded" conformation), the latter of which is responsible for high affinity ligand binding. Antibody to integrins have been developed. A ligand-mimetic monoclonal antibody mAb 107, produced by a hybridoma cell line, that can bind to CD1 lb in an activation-independent manner has been described, e.g., in US 7,998,738.
As integrins transduce signals that mediate the effects of the matrix on the physiological activity of cells, there is considerable interest in developing therapeutic use of integrin-binding antibodies.
SUMMARY
This disclosure relates to therapeutic use of integrin-binding antibodies.
In one aspect, the disclosure relates to a method of ameliorating a pathology associated with ischemia reperfusion injury in a subject. The method includes administering to the subject a therapeutically effective amount of composition having polypeptide that immunospecifically binds the epitope recognized by mabl07.
In some embodiments, the pathology is post-ischemic renal fibrosis, a kidney fibroinflammatory disease, pulmonary fibrosis, or post-myocardial infarction left ventricular adverse remodeling.
The disclosure also relates to a method of treating a subject having a disorder associated with ischemia reperfusion injury in an organ. The method includes
administering to the subject a therapeutically effective amount of composition having a polypeptide that immunospecifically binds the epitope recognized by mabl07.
In some embodiments, the organ is a kidney, a heart, or a lung. In some embodiments, the disorder is acute kidney injury, acute coronary syndrome, acute myocardial infarction (MI).
In some embodiments, the therapeutically effective amount of composition having a polypeptide that immunospecifically binds the epitope recognized by mabl07 is administered to the subject within about 5 hours after the ischemia reperfusion injury, within about 4 hours after the ischemia reperfusion injury, within about 3 hours after the ischemia reperfusion injury, within about 2 hours after the ischemia reperfusion injury, within about 1.5 hours after the ischemia reperfusion injury, or within about 1 hour after the ischemia reperfusion injury.
The disclosure also relates to a method of providing an organ for transplantation. The method includes administering to an organ donor a composition having a polypeptide that immunospecifically binds the epitope recognized by mab 107; and harvesting the organ from the organ donor.
The disclosure also relates to a method of reducing delayed graft function following organ transplantation. The method includes administering to an organ recipient a therapeutically effective amount of composition having a polypeptide that
immunospecifically binds the epitope recognized by mab 107 prior to transplantation of the organ to the recipient or within a day of the transplantation, thereby reducing delayed graft function following organ transplantation.
The disclosure also relates to a method of treating an organ prior to
transplantation into a recipient. The method includes contacting the organ with a composition having a polypeptide that immunospecifically binds the epitope recognized by mab 107.
In some embodiments, the transplanted organ is a kidney, a heart, or a lung.
In some embodiments, the organ contacts the composition having a polypeptide that immunospecifically binds the epitope recognized by mabl07 through perfusion fluid.
The disclosure also relates to a method of treating a subject having an
autoimmune disease. The method includes administering to the subject a therapeutically effective amount of composition having a polypeptide that immunospecifically binds the epitope recognized by mabl07. In some embodiments, the autoimmune disease is cytoplasmic antineutrophil cytoplasmic antibodies (cANCA)-associated vasculitis.
The disclosure also relates to a method of treating a subject having diabetic nephropathy. The method includes administering to the subject a therapeutically effective amount of composition having a polypeptide that immunospecifically binds the epitope recognized by mabl07.
The disclosure also relates to a method of ameliorating a pathology associated with chemotherapy in a subject. The method includes administering to the subject a therapeutically effective amount of composition having a polypeptide that
immunospecifically binds the epitope recognized by mabl07. In some embodiments, the pathology is Adriamycin nephropathy.
In some embodiments, the polypeptide that immunospecifically binds the epitope recognized by mabl07 is mabl07.
In some embodiments, the polypeptide that immunospecifically binds the epitope recognized by mabl07 is humanized.
In some embodiments, the polypeptide that immunospecifically binds the epitope recognized by mabl07 is a single chain variable fragments (scFv).
In some embodiments, the polypeptide that immunospecifically binds the epitope recognized by mabl07 comprises one, two, three, four, five, or six of the following complementarity determining regions (CDR):
1) CDR 1 of the VH of mabl07;
2) CDR 1 of the VL of mabl07;
3) CDR 2 of the VH of mabl07;
4) CDR 2 of the VL of mabl07;
5) CDR3 of the VH of mabl07; and
6) CDR 3 of the VL of mab 107.
In all of the embodiments described here the polypeptide that immunospecifically binds the epitope recognized by mab 107 can be an antibody.
In various embodiments the polypeptide or antibody that immunospecifically binds the epitope recognized by mab 107 comprises an amino acid sequence that comprises an amino acid sequence at least 95%, 98%, or 100% identical to an amino acid sequence selected from the group consisting of:
QVQLQQSGAELVKPGASVKLSCTPSGFNIKDIYMQWVKQRPEQGLEWIGRIDPA DKTKYDPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCASEGHYGYDGYA MDYWGQGTTVTVSS (SEQ ID NO: l);
DIEMTQSPSSLGVSVGEKVTMSCKSSQ LLYSSNQKNYLAWYQQKPGQS PKLLIYWASTRESGVPDRFTGTGSGTDFTLTISSVKAEDLAVYYCQQYYSYPLTF GAGTKLELK (SEQ ID NO:2);
VQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVAR IDPANDKTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSSEGHYGY DGYAMD YWGQGTL VT VS S (SEQ ID NO:3);
DIVMSQSPDSLAVSLGERVTLNCKSSQ LLYSSNQKNYLAWYQQKPGQS PKLLIYWASARESGVPDRFSGSGSGTDFTLTISSVQAEDVAVYYCQQYYSYPLTF GAGTKLELK (SEQ ID NO:4); and
M VQL VE S GGGL VQPGGSLRL S C A A S GFNIKDT YIHW VRQ APGKGLEW V A RIDPA DKTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSSEGHYG YDGY AMD YWGQGTL VTVSSGGGGSGGGGSGGGGSDIVMSQSPDSLAVSLGER VTLNCK S S Q LL YS SNQKN YL AW YQQKPGQ SPKLLI YW A S ARE S GVPDRF S GSG SGTDFTLTISSVQAEDVAVYYCQQYYSYPLTFGAGTKLELK (SEQ ID NO:5).
In some embodiments the polypeptide or antibody that immunospecifically binds the epitope recognized by mab 107 comprises an amino acid sequence that comprises an amino acid sequence at least 95% or 98% identical to an amino acid sequence selected from the group consisting of:
Q VQLQQ SGAEL VKPGAS VKL SCTP SGFNIKDIYMQW VKQRPEQGLEWIGRIDPA DKTKYDPKFOGKATITADTSSNTAYLOLSSLTSEDTAVYYCASEGHYGYDGYA MDYWGQGTTVTVSS (SEQ ID NO: l);
DIEMTQSPSSLGVSVGEKVTMSCKSSQ LLYSSNQKNYLAWYQQKPGQS PKLLIYWASTRESGVPDRFTGTGSGTDFTLTISSVKAEDLAVYYCQQYYSYPLTF GAGTKLELK (SEQ ID NO:2);
VQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVAR IDPANDKTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSSEGHYGY DGYAMD YWGQGTL VT VS S (SEQ ID NO:3);
DIVMSQSPDSLAVSLGERVTLNCKSSQ LLYSSNQKNYLAWYQQKPGQS PKLLIYWASARESGVPDRFSGSGSGTDFTLTISSVQAEDVAVYYCQQYYSYPLTF GAGTKLELK (SEQ ID NO:4); and
M VOL VE S GGGL VQPGGSLRL S C A A S GFNIKDT YMW VRQ APGKGLEW V A RIDPA DKTRYADSVKGRFTISADTSKNTAYLOMNSLRAEDTAVYYCSSEGHYG YDGYAMD YWGQGTL VTVSSGGGGSGGGGSGGGGSDIVMSQSPDSLAVSLGE RVTLNCKS SQ LL YS SNQKNYLAWYQQKPGQSPKLLIYWAS ARESGVPDRF SGS GSGTDFTLTISSVQAEDVAVYYCQQYYSYPLTFGAGTKLELK (SEQ ID NO: 5), provided that the under lined portions of the sequence are not altered.
The term "epitope" as used herein refers to a protein determinant capable of binding to an antibody. Epitopes usually consist of chemically active surface groupings of molecules such as amino acids or sugar side chains and usually have specific three dimensional structural characteristics, as well as specific charge characteristics.
Conformational and non-conformational epitopes are distinguished in that the binding to the former but not the latter is lost in the presence of denaturing solvents.
As used herein, the term "ischemia reperfusion injury" refers to an injury of organs caused by putting the organs into an ischemic condition and/or an injury of organ occurred after reperfusion.
As used herein, the term "treatment" or "treating a subject" refers to the application or administration of a therapeutic agent to a patient, or application or administration of a therapeutic agent to an isolated tissue or cell line from a subject, who has a disease, a symptom of disease or a predisposition toward a disease, with the purpose to cure, heal, alleviate, relieve, alter, remedy, ameliorate, palliate, improve or affect the disease, the symptoms of disease or the predisposition toward disease.
The term "purified" as used herein, refers to other molecules, e.g. polypeptide, nucleic acid molecule that have been identified and separated and/or recovered from a component of its natural environment. Thus, in some embodiments, the polypeptides are purified polypeptides wherein they have been separated from one or more components of their natural environment.
Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Methods and materials are described herein for use in the present invention; other, suitable methods and materials known in the art can also be used. The materials, methods, and examples are illustrative only and not intended to be limiting. All publications, patent applications, patents, sequences, database entries, and other references mentioned herein are incorporated by reference in their entirety. In case of conflict, the present specification, including definitions, will control.
Other features and advantages of the invention will be apparent from the following detailed description and figures, and from the claims.
DESCRIPTION OF DRAWINGS
The patent or application file contains at least one drawing executed in color. Copies of this patent or patent application publication with color drawing(s) will be provided by the Office upon request and payment of the necessary fee.
FIG. 1. Schematic of the protocol used to develop a chronic kidney disease (CKD) model.
FIGS. 2a-2q. Effect of mAbl07 on progression of acute kidney injury (AKI) to chronic kidney disease (CKD) in a treated and an untreated monkey. FIG. 2a. Serum levels of mAbs 107 and X63 in treated (Al) and control (CI) monkeys 24 hours after I/R. FIG. 2b. Serum creatinine (sCR) prior to (day 0, dO) and one day (dl) after ischemia- reperfusion (I/R). sCR returned to normal after clamp release (arrow). FIG. 2c. Time of no-reflow in Al and CI . FIG. 2d. White blood cell (WBCs) levels measured prior to (dO) and 1 (dl), 2(d2) and 5(d5) days after I/R. FIG. 2e. Neutrophil levels measured prior to (dO) and 1 (dl), 2(d2) and 5(d5) days after I/R. FIG. 2f. Monocyte levels measured prior to (dO) and 1 (dl), 2(d2) and 5(d5) days after I/R. FIG. 2g. Lymphocyte levels measured
prior to (dO) and 1 (dl), 2(d2) and 5(d5) days after I/R. FIG. 2h. Platelet levels measured prior to (dO) and 1 (dl), 2(d2) and 5(d5) days after I/R. FIG. 2i. Hematocrit (HCT) levels measured prior to (dO) and 1 (dl), 2(d2) and 5(d5) days after I/R. FIG. 2j. Histograms showing binding of mAb 24 to FMLF -activated PMNs from two different naive monkeys in the absence of presence of the Fab fragment of mAb 107. MFI, mean fluorescence units. FIG. 2k. Histograms showing binding of mAb 24 to PMNs from Al and CI monkeys. PMNs were isolated 1 day after I/R. FIG. 21. Flow cytometric analysis of the PMNs studies in n, unstained and following staining with FITC-labeled anti-mouse Ig. FIG. 2m. Blood urea nitrogen (BUN) levels 2 days (-d2) and one day (-dl) prior to planned euthanasia (dO). Left ureter was ligated on -d2 (arrows) after blood was withdrawn. FIG. 2n. sCR levels 2 days (-d2) and one day (-dl) prior to planned euthanasia (dO). Left ureter was ligated on -d2 (arrows) after blood was withdrawn. FIG. 2o. Gross appearance of harvested left and right kidneys from CI and Al . FIG. 2p.
Histograms showing average number of macrophages in 20 high power (200X) fields. FIG. 2q. Histograms showing the fibrosis area (tri chrome stain-positive) presented as % of total area in ten fields at 20X magnification.
FIGS. 3a-3j. Effect of mAb 107 on AKI. FIG. 3a. Serum levels of mAbs 107 treated monkeys A2-A4 and A5) 24 hours after I/R. FIG. 3b. Histograms (mean + SD) showing time of no-reflow in mAb l07-treated and controls. Data are shown as mean+SD. FIG. 3c. White blood cell (WBCs) levels in treated (A) and controls (C) measured prior on dO, dl, d2 and d5 after I/R. Data are shown as mean+SD. FIG. 3d. Neutrophil levels in treated (A) and controls (C) measured prior on dO, dl, d2 and d5 after I/R. Data are shown as mean+SD. FIG. 3e. Monocyte levels in treated (A) and controls (C) measured prior on dO, dl, d2 and d5 after I/R. Data are shown as mean+SD. FIG. 3f. Lymphocyte levels in treated (A) and controls (C) measured prior on dO, dl, d2 and d5 after I/R. Data are shown as mean+SD. FIG. 3g. Platelet levels in treated (A) and controls (C) measured prior on dO, dl, d2 and d5 after I/R. Data are shown as mean+SD. FIG. 3h. Hematocrit (HCT) levels in treated (A) and controls (C) measured prior on dO, dl, d2 and d5 after I/R. Data are shown as mean+SD. FIG. 3i. BUN levels on dO prior to ischemia, on dl, d2 after ligation of left ureter and on d5 after clamp release. Data are shown as mean+SD.
FIG. 3j. sCR levels on dO prior to ischemia, on dl, d2 after ligation of left ureter and on d5 after clamp release. Data are shown as mean+SD.
FIGS. 4a-4i. mAbl07 salvaged right kidney function several months after AKI. FIG. 4a. BUN levels 2 days (-d2) and one day (-dl) prior to planned euthanasia (dO). Left ureter was ligated on -d2(arrows) after blood was withdrawn. FIG. 4b. sCR levels 2 days (-d2) and one day (-dl) prior to planned euthanasia (dO). Left ureter was ligated on - d2(arrows) after blood was withdrawn. FIG. 4c. Representative, gross appearance of left and right kidneys from control (C4) monkeys harvested 9 months after AKI. FIG. 4d. Representative, gross appearance of left and right kidneys from treated (A4) monkeys harvested 9 months after AKI. FIG. 4e. Histograms (mean + SD) showing average number of macrophages deposition. FIG. 4f. Histograms (mean + SD) showing average number of collagen deposition. FIG. 4g. Histograms (mean + SD) showing degree of fibrosis. FIG. 4h. Representative sections of control right kidney harvested 9 months after AKI. FIG. 4i. Representative sections of treated right kidney harvested 9 months after AKI.
FIGS. 5a-5b. Effect of mAbl07 on kidney levels of inflammatory mediators. FIG. 5a. Cytokine/chemokine and complement C3 levels in right kidney biopsies 1-2 days after AKI, 3 (Al) and 9 (A2) months later in two treated (Al, A2) and control animals. FIG. 5b. Cytokine/chemokine and complement C3 levels in left and right kidneys 3 (Al) months after AKI in treated and control animals.
FIG. 6. Histograms showing serum levels of IL8 and MCP1 in control (CI) and treated (Al) animals prior to (pre) and lday after I/R.
FIG. 7. Amino acid sequences of mouse mAbl07 heavy chain (H-chain).
Complementarity determining regions (CDR) are underlined. Text in brackets represents the VH region.
FIG. 8. Amino acid sequences of mouse mAbl07 light chain (L-chain). CDRs are underlined. Text in brackets represents the VL region.
FIG. 9. Amino acid sequences of humanized mAbl07 VH. CDRs are underlined. FIG. 10. Amino acid sequences of humanized mAbl07 VH. CDRs are underlined.
FIG. 11. Amino acid sequences of a humanized single chain variable fragment of 107 (scFv) with a linker (in brackets) linking VH and VL segments. CDRs are underlined.
DETAILED DESCRIPTION
The present disclosure is based, in part, on the observation that a polypeptide that immunospecifically binds the epitope recognized by mabl07 has various therapeutic uses, e.g., in treating disorders associated with ischemia reperfusion injury.
Ischemia reperfusion injury are injuries caused by putting the organs into an ischemic condition and/or an injury of organ occurred after reperfusion. Ischemia generally refers to a restriction in blood supply to tissues, causing a shortage of oxygen and glucose needed for cellular metabolism. Reperfusion injury is the tissue damage caused when blood supply returns to the tissue after a period of ischemia. The absence of oxygen and nutrients from blood during the ischemic period creates a condition in which the restoration of circulation results in inflammation and oxidative damage through the induction of oxidative stress rather than restoration of normal function.
Acute kidney injury (AKI), an inflammatory disease often caused by ischemia- reperfusion (I/R) 1 2, is a common and growing burden for the healthcare system worldwide 3 4. AKI appears to incur long-term risks of developing chronic fibrosis and end stage renal disease (ESRD) in humans, especially following severe (dialysis- requiring) injury to native or transplanted kidneys 5"7.
Ischemic acute kidney injury is a strong predictor of progression to fibrotic chronic kidney disease (CKD). The lack of effective therapies is due in part to the scarcity of animal models of CKD, especially in nonhuman primates. The innate immune system plays an important role in ischemic AKI but its contribution to progression to fibrotic kidney disease is less clear.
This disclosure provides a model of post-ischemic CKD in Cynomolgus monkeys and assesses the potential role of the archetypal innate immune receptor CD l ib/CD 18 (Complement Receptor 3) in progression to CKD.
The studies below describe the use of mAbl07 (deposited in the American Type Culture Collection under Accession Number ATCC PTA-11614), a murine antibody that
behaves as a ligand mimic. Earlier studies have shown that mAbl07 binds in a divalent- cation-dependent manner to solvent-exposed residues on the MIDAS face of CDl lb, blocks interaction of 1 IbA or the holoreceptor with ligands, and inhibits spreading and phagocytosis by human neutrophils. However, in contrast to physiologic ligands, mAb 107 preferentially binds to the inactive low-affinity form of the integrin, suggesting that its antagonistic effects are exerted in part by stabilizing the receptor in the low-affinity state.
A 2-hour unilateral right kidney vascular occlusion followed by reperfusion was induced in 10 animals, with subsequent periods of left ureter ligation to assess right kidney function. Early inactivation of CD l ib/CD 18 in five animals using mAb 107 improved microvascular perfusion and reduced key pro-inflammatory mediators in the right kidney, but did not significantly improve right kidney function 1-2 days post AKI. However, mAb 107 salvaged kidney function from otherwise irreversible fibrotic right kidney failure in all treated animals three, six and nine months after ischemic AKI. These studies reveal an unsuspected critical early role of CDl lb+ innate immune cells in post- ischemic chronic fibrosis in non-human primates, and a potential therapeutic approach to prevent progression to CKD in the clinical setting.
Prolonged renal hypoperfusion is the most frequent cause of intrinsic AKI in hospitalized patients 5. Controversy currently exists as to whether AKI per se causes CKD and ESRD 39'40, given that patients who develop AKI tend to be older with a higher burden of comorbidities that could serve as more direct causes. The CKD model clearly shows that severe I/R AKI is the direct cause of ESRD in previously healthy cynomolgus monkeys. Using this model, we also show that early inactivation of the innate immune receptor CD 1 lb/CD 18 (CR3) interrupts the irreversible course of progressive kidney failure caused by severe I/R AKI. Five of five control animals subjected to severe I/R in this study lost kidney function 3, 6 and 9 months later, in contrast to all mAbl07-treated animals, where life-sustaining kidney function was observed at the end of the observation periods. Histopathologic examination of interval right kidney biopsies showed progressive recovery from acute tubular necrosis induced by I/R AKI. At sacrifice, 3-9 months after the initial injury, significant reductions in intrarenal macrophages, interstitial fibrosis and collagen deposition were observed in the harvested right kidney
from all treated animals vs. controls.
Ischemic injury targets renal tubular epithelial cells, peritubular capillary endothelium and the renal mononuclear phagocytic system. The resulting lethal or sublethal cell damage triggers an intrinsic inflammatory response that involves the activation of pattern recognition receptors (PRRs) by secretion of a multitude of damage- associated molecular patterns (DAMPs), and activation of the complement and coagulation systems. The proinflammatory chemokines and cytokines produced recruit circulating inflammatory cells to the kidney following reperfusion 10. Attenuated vascular relaxation, capillary leak, complement activation, adhesion of trapped leukocytes to endothelium, platelet-leukocyte aggregation and leukoaggregation clogs capillaries 41. Microvacular occlusion is further aggravated by the new supply of activated leukocytes and platelets after resumption of blood flow - the no-reflow phenomenon 42,43.
mAbl07 did not protect renal tubular epithelial from the initiating ischemic insult, as judged functionally by the life-threatening rise in serum creatinine, and pathologically by widespread acute tubular necrosis detected in the right injured kidney one to two days after severe I/R, but mAbl07 therapy salvaged kidney structure and function from otherwise irreversible fibrosis, microvascular rarefaction and organ failure 3-9 months later. One consistent and immediate response to mAbl07 was a significant reduction in the no-reflow phenomenon. Prolonged microvascular no-reflow is known to increase the risk of primary kidney allograft dysfunction 44. The observed reduction in non-reflow by CDl lb/CD 18 inactivation is likely related at least in part to inhibition of leukocyte adhesion-dependent damage to peritubular capillary endothelium, and prevention of intracapillary PMN-platelet and PMN-PMN aggregates.
A second early response to mAbl07 therapy was a dramatic reduction in the pro- inflammatory mediators RANTES, IL18, complement C3, IL6 and IFNy in the right kidney 1- 2 days after I/R, which remained low in the same kidneys when harvested several months later. These mediators are produced by ischemic parenchymal cells, as well as infiltrating leukocytes including KT and neutrophils 12'45. Mouse knockouts of RANTES 46, IL18 47 , complement 48, IL6 45 or NKT (IFNy) depletion partially protected kidney function 1-7 days post-ischemic AKI. Simultaneous reductions in all five proinflammatory mediators by mAbl07 indicate that intrinsic and/or infiltrating CDl lb+
leukocytes play a primary role in their production. The underlying mechanism is most likely secondary to inhibition of the established roles of CDl lb in phagocytosis, Fey Ila/III 29-31 and TLR4 signaling 49 , pathogenic processes associated with production of inflammatory mediators including cytokines, chemokines, complement and reactive oxygen species 33'34.
Levels of the other chemokines/cytokines measured (ILip, TNF-a, IL8 and MCP1) in treated kidneys 1-2 days after I/R were variable, but did not correlate with long-term right kidney functional improvement in our model. This is consistent with the variable outcomes seen in rodent models of AKI, where double knockout of IL-IR and T FR1 did not protect against ischemic AKI in mice 50 or was protective (IL8 and MCP1) in short term studies 51'52.
Interestingly, IL2, produced by activated CD4+ T cells and DCs 53 and was increased in treated right kidneys 1-2 days after injury, but returned to near baseline levels in harvested right kidneys. IL-2 plays an important role in expansion and/or function of CD4+CD25+ regulatory T cells (Treg) 54, which are known to attenuate I/R AKI in rodents 14 55. Harvested mAb l07-treated kidneys expressed increased levels of active TGFp i, which is secreted by most immune cells, is required for Treg suppressor activity 56. The early rise of IL-2, and late increase in TGFp i reflects the subtle shifts in cytokine and chemokine production occurring in the mAb l07-treated monkeys that contribute to the late recovery of kidney function.
A third early and potentially relevant observation also made one day after I/R was the stabilization of CDl lb/CD 18 in the inactive conformation by mAb l07, despite presence of high serum concentration of a variety of agonists known to switch this integrin into the active state such as IL-8 and MCP-1 (FIG. 6). The present data suggest that early targeting of CDl lb/CD18 signaling with a "pure" antagonist (i.e. that dose not inadvertently activate the integrin) may provide a new approach in preventing
progressive fibrosis and promoting functional recovery after ischemic AKI.
The present disclosure provides therapeutic uses of integrin-binding antibodies. In some embodiments, the described method is designed to inhibit both the initial inflammatory reaction elicited by ischemic activation of intrinsic CDl lb+ immune cells, and the one following reperfusion, by giving the half the dose mAb prior to ischemia and
the other half before reperfusion. In some embodiments, renal recovery can be improved further by adding a second dose a week later, for example, or by administering the mAb immediately prior to or after reperfusion. Preemptive use of mAb 107 as used in this model can be of therapeutic benefit in a various clinical settings associated with development of AKI with no active treatments, for example, high-risk cardiac surgery (e.g. elective coronary artery bypass grafting), prior to chemotherapy or kidney transplantation. Ischemic AKI is a common complication of cardiac surgery especially in high-risk patients with renal hypoperfusion 64, and carries an increased risk of progression to CKD and long-term mortality 65 <56. Preoperative mAb 107 administration may accelerate kidney recovery and prevent CKD in this setting. CD1 lb+ inflammatory cells play an important role in AKI-induced by Adriamycin: a mAb to CD 1 lb/CD 18 reduced renal injury in Adriamycin nephropathy by partially depleting CD1 lb+ macrophages 67. Pretreatment with mAb 107 is a safer and more effective alternative. I/R AKI after kidney transplantation is also a major cause of delayed graft function 51, which negatively affects long-term graft survival 68. Therapeutic strategies using mAb 107 can be implemented in both donor and recipient, or by adding mAb 107 to the perfusion fluid during machine preservation 69.
Therapeutic compositions
In some embodiments, therapeutic compositions herein can interact with (e.g., bind, bind specifically and/or bind immunospecifically) binding partners (e.g., an immunogen(s), antigen(s), and/or epitope(s)) related to a disease or condition, wherein interaction between the therapeutic composition and the binding partners results in an improvement towards the condition or disease (e.g., a decrease in the level of disease or symptoms thereof in a subject).
In some embodiments, therapeutic compositions can include a polypeptide that immunospecifically binds the epitope recognized by mabl07.
In some embodiments, the polypeptide can include (e.g., comprise, consist essentially of, or consist of) at least one (e.g., one, two, three, four, five, and/or six) complementarity determining region (CDR) of the variable heavy chain (VH) and/or variable light chain (VL) of antibody as shown in Table 1 (See also FIGS. 7 and 8). In
some embodiments, therapeutic compositions can include polypeptides that include (e.g., comprise, consist essentially of, or consist of) at least one (e.g., one, two, or three) complementarity determining region (CDR) of the variable heavy chain (VH) and/or at least one (e.g., one, two, or three) complementarity determining region (CDR) variable light chain (VL) of antibody as shown in Table 1. In some embodiments, a polypeptide that immunospecifically binds the epitope recognized by mabl07 is mabl07 itself.
In some embodiments, therapeutic compositions can include polypeptides that include
(e.g., comprise, consist essentially of, or consist of) at least one (e.g., one, two, three, four, five, and/or six) complementarity determining region (CDR) of the variable heavy chain (VH) and/or variable light chain (VL) of antibody as shown in Table 1, and that interact with (e.g., bind, bind specifically and/or bind immunospecifically) to integrin or integrin subunits (e.g. integrin alpha subunit CDl lb), including epitopes thereof.
In some embodiments, the affinity of binding between the polypeptide and integrin or integrin subunits (e.g. integrin alpha subunit CDl lb) can be between about O. lnM to ΙμΜ, for example, about ΙΟηΜ.
In some embodiments, therapeutic compositions can include peptides (e.g., polypeptides), including for example, antibodies, including full length and/or intact antibodies, or antibody fragments. An "antibody" is an immunoglobulin molecule capable of specific binding to a target, such as a carbohydrate, polynucleotide, lipid, polypeptide, etc., through at least one antigen recognition site, located in the variable region of the immunoglobulin molecule. As used herein, the term "antibody" encompasses not only intact polyclonal or monoclonal antibodies, but also any antigen binding fragment (i.e., "antigen-binding portion") or single chain thereof, fusion proteins comprising an antibody, and any other modified configuration of the immunoglobulin molecule that comprises an antigen recognition site. An antibody includes an antibody of any class,
such as IgQ IgA, or IgM (or sub-class thereof), and the antibody need not be of any particular class. Depending on the antibody amino acid sequence of the constant region of its heavy chains, immunoglobulins can be assigned to different classes. There are five major classes of immunoglobulins: IgA, IgD, IgE, IgQ and IgM, and several of these may be further divided into subclasses (isotypes), e.g., IgGl, IgG2, IgG3, IgG4, IgAl and IgA2. The heavy-chain constant regions that correspond to the different classes of immunoglobulins are called alpha, delta, epsilon, gamma, and mu, respectively. The subunit structures and three-dimensional configurations of different classes of
immunoglobulins are well known. Exemplary antibodies and antibody fragments include, but are not limited to, monoclonal antibodies (including full-length monoclonal antibodies), polyclonal antibodies, multispecific antibodies formed from at least two different epitope binding fragments (e.g., bispecific antibodies), camelised antibodies, chimeric antibodies, single chain variable fragments (scFv), single-chain antibodies, single domain antibodies, domain antibodies, Fab fragments, F(ab')2 fragments, antibody fragments that exhibit the desired biological activity (e.g. the antigen binding portion), disulfide-linked Fvs (dsFv), and anti -idiotypic (anti-Id) antibodies (including, e.g., anti-Id antibodies to antibodies of the invention), intrabodies, and epitope-binding fragments of any of the above.
In some embodiments, antibodies or antibody fragments can be human or humanized. In some embodiments, the VH region in a humanized antibody or antibody fragment includes amino acid sequences as shown in FIG. 9. In some embodiments, the VL region in a humanized antibody or antibody fragment includes amino acid sequences as shown in FIG. 10.
Fragments of antibodies are suitable for use in the methods provided so long as they retain the desired affinity and specificity of the full-length antibody. Thus, a fragment of an antibody that binds the epitope recognized by mabl07 will retain an ability to bind to the epitope recognized by mabl07 in the Fv portion.
An Fv fragment is an antibody fragment which contains a complete antigen recognition and binding site. This region consists of a dimer of one heavy and one light chain variable domain in tight association, which can be covalent in nature, for example in scFv. It is in this configuration that the three CDRs of each variable domain interact to
define an antigen binding site on the surface of the VH-VL dimer. Collectively, the six
CDRs or a subset thereof confer antigen binding specificity to the antibody. However, even a single variable domain (or half of an Fv comprising only three CDRs specific for an antigen) can have the ability to recognize and bind antigen, although usually at a lower affinity than the entire binding site.
Single-chain Fv or (scFv) antibody fragments comprise the VH and VL domains of antibody, wherein these domains are present in a single polypeptide chain. Generally the Fv polypeptide further comprises a polypeptide linker between the VH and VL domains, which enables the scFv to form the desired structure for antigen binding. One exemplary scFV that immunospecifically binds the epitope recognized by mab l07 is shown in FIG. 11. This scFV includes a humanized VH segment, a humanized VL segment, and a linker between these two segments.
The Fab fragment contains a variable and constant domain of the light chain and a variable domain and the first constant domain (CHI) of the heavy chain. F(ab')2 antibody fragments comprise a pair of Fab fragments which are generally covalently linked near their carboxy termini by hinge cysteines between them. Other chemical couplings of antibody fragments are also known in the art.
Diabodies are small antibody fragments with two antigen-binding sites, which fragments comprise a VH connected to a VL in the same polypeptide chain (VH and VL). By using a linker that is too short to allow pairing between the two domains on the same chain, the domains are forced to pair with the complementary domains of another chain and create two antigen-binding sites.
Linear antibodies comprise a pair of tandem Fd segments (VH-CH1-VH-CH1) which, together with complementary light chain polypeptides, form a pair of antigen binding regions. Linear antibodies can be bispecific or monospecific. Antibodies and antibody fragments of the present disclosure can be modified in the Fc region to provide desired effector functions or serum half-life.
In some embodiments, the Fc region can be conjugated to PEG or albumin to increase the serum half-life, or some other conjugation that results in the desired effect. Alternatively, where it is desirable to eliminate or reduce effector function, so as to minimize side effects or therapeutic complications, certain other Fc regions may be used.
Human and humanized antibodies include antibodies having variable and constant regions derived from (or having the same amino acid sequence as those derived from) human germline immunoglobulin sequences. Human antibodies may include amino acid residues not encoded by human germline immunoglobulin sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo), for example in the CDRs and in particular CDR3.
Therapeutic composition preparation
Polypeptides that immunospecifically bind the epitope recognized by mabl07 can be prepared from hybridoma cells, for example, a hybridoma cell line deposited on Jan. 26, 2011, in the American Type Culture Collection (10801 University Blvd. Manassas, Va. 20110-2209) with Accession Number ATCC PTA-11614. mAb-containing supematants harvested from hybridoma cultures are clarified and concentrated. The mAb can be purified on various chromatographs, for example, Protein A affinity
chromatography, hydroxyapatite charge exchange chromatography and size-exclusion chromatography, etc. Endotoxin can removed by an endotoxin removing gel, such as Detoxi-Gel™ Endotoxin Removing Gel (Pierce, Rockford, IL). The level of endotoxin in the final product and in buffers can be determined with the Limulus Amebocyte Lysate (LAL) gel-clot test. mAb concentration can be determined by UV absorbance. Purity can be assessed by sodium dodecyl sulphate polyacrylamide gel electrophoresis (SDS-PAGE) and Coomassie staining. The sterile and purified mAb can be stored at 4°C until used. Detailed methods of preparing monoclonal antibodies are described, e.g., in
US7998738B2; Horenstein, A.L., Durelli, I. & Malavasi, F. Purification of Clinical- Grade Monoclonal Antibodies by Chromatographic Methods. In Methods in Molecular Biology P. Therapeutic Proteins: Methods and Protocols (C Mark Smales and David C James., eds), Humana Press, Totowa, NJ, Chapter 16. (2005).
In some embodiments, polypeptides that immunospecifically bind the epitope recognized by mabl07 can be prepared from immune cells and molecular biology techniques. Obtaining or targeting immune cells can include one or more and/or combinations of, for example: obtaining or providing a tetrameric immunogen (e.g., the epitope recognized by mabl07) that can bind (e.g., bind specifically) to a target immune
cell; contacting the tetrameric immunogen with a sample; detecting the tetrameric immunogen; determining whether the tetrameric immunogen is bound to a target immune cell; and, if the tetrameric immunogen is bound to a target immune cell, then obtaining the target immune cell.
Methods for isolating or purifying genetic material (e.g., DNA and/or mRNA) from the obtained target immune cell are known in the art and are exemplified herein. Once such genetic material has been obtained, methods for using it to produce the therapeutic compositions disclosed herein are known in the art and/or are summarized below. As discussed above, genetic material can be varied, using techniques known in the art to create polypeptide variants disclosed herein. Generating polypeptides from nucleic acids (e.g., cDNA) contained within or obtained from the target cell can include, for example, analysis, e.g., sequencing of heavy and light chain variable domains from target immune cells (e.g., single or isolated identified target immune cells).
In some embodiments, methods can include generating fully human antibodies, or fragments thereof (e.g., as disclosed above), and humanization of nonhuman antibodies. DNA can be readily isolated and/or sequenced from the obtained immune cells using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of murine antibodies).
Once isolated, DNA can be placed into expression vectors, which are then transfected into host cells such as Escherichia coli cells, simian COS cells, Chinese Hamster Ovary (CHO) cells, or myeloma cells that do not otherwise produce antibody protein, to obtain the synthesis of monoclonal antibodies in the recombinant host cells. Review articles on recombinant expression in bacteria of DNA encoding the antibody include Skerra et al., Curr. Opinion in Immunol., :2 6-262 (1993) and Pluckthun, Immunol. Revs., 130: 1 1-188 (1992).
Recombinant expression of an antibody or variant thereof generally requires construction of an expression vector containing a polynucleotide that encodes the antibody. The invention, thus, provides replicable vectors comprising a nucleotide sequence encoding an antibody molecule, a heavy or light chain of an antibody, a heavy or light chain variable domain of an antibody or a portion thereof, or a heavy or light chain CDR, operably linked to a promoter. Such vectors may include the nucleotide
sequence encoding the constant region of the antibody molecule (see, e.g., US. Patent Nos. 5,981,216; 5,591,639; 5,658,759 and 5,122,464) and the variable domain of the antibody may be cloned into such a vector for expression of the entire heavy, the entire light chain, or both the entire heavy and light chains.
Once the expression vector is transferred to a host cell by conventional techniques, the transfected cells are then cultured by conventional techniques to produce an antibody. Thus, the invention includes host cells containing a polynucleotide encoding an antibody of the invention or fragments thereof, or a heavy or light chain thereof, or portion thereof, or a single-chain antibody of the invention, operably linked to a heterologous promoter. In certain embodiments for the expression of double-chained antibodies, vectors encoding both the heavy and light chains may be co-expressed in the host cell for expression of the entire immunoglobulin molecule, as detailed below.
Mammalian cell lines available as hosts for expression of recombinant antibodies are well known in the art and include many immortalized cell lines available from the American Type Culture Collection (ATCC), including but not limited to Chinese hamster ovary (CHO) cells, HeLa cells, baby hamster kidney (BHK) cells, monkey kidney cells (COS), human hepatocellular carcinoma cells (e.g., Hep G2), human epithelial kidney 293 cells, and a number of other cell lines. Different host cells have characteristic and specific mechanisms for the post-translational processing and modification of proteins and gene products. Appropriate cell lines or host systems can be chosen to ensure the correct modification and processing of the antibody or portion thereof expressed. To this end, eukaryotic host cells which possess the cellular machinery for proper processing of the primary transcript, glycosylation, and phosphorylation of the gene product may be used. Such mammalian host cells include but are not limited to CHO, VERY, BHK, Hela, COS, MDCK, 293, 3T3, W138, BT483, Hs578T, HTB2, BT20 and T47D, NSO (a murine myeloma cell line that does not endogenously produce any functional
immunoglobulin chains), SP20, CRL7030 and HsS78Bst cells. In some embodiments, human cell lines developed by immortalizing human lymphocytes can be used to recombinantly produce monoclonal antibodies. In one embodiment, the human cell line PER.C6. (Crucell, Netherlands) can be used to recombinantly produce monoclonal antibodies.
In some embodiments, polypeptides disclosed herein can be generated
synthetically. Synthetic chemistry transformations and protecting group methodologies (protection and deprotection) useful in synthesizing polypeptides described herein are known in the art and include, for example, those such as described in R. Larock,
Comprehensive Organic Transformations, VCH Publishers (1989); T.W. Greene and P.G.M. Wuts, Protective Groups in Organic Synthesis, 3d. Ed., John Wiley and Sons (1999); L. Fieser and M. Fieser, Fieser and Fieser's Reagents for Organic Synthesis, John Wiley and Sons (1994); and L. Paquette, ed., Encyclopedia of Reagents for Organic Synthesis, John Wiley and Sons (1995), and subsequent editions thereof.
Peptides can also be made by chemical synthesis methods, which are well known to the ordinarily skilled artisan. See, for example, Fields et al., Chapter 3 in Synthetic Peptides: A User's Guide, ed. Grant, W. H. Freeman & Co., New York, N.Y., 1992, p. 77. Hence, peptides can be synthesized using the automated Merrifield techniques of solid phase synthesis with the a-NH2 protected by either t-Boc or Fmoc chemistry using side chain protected amino acids on, for example, an Applied Biosystems Peptide Synthesizer Model 43 OA or 431.
Peptide bonds can be replaced, e.g., to increase physiological stability of the peptide, by: a retro-inverso bonds (C(O)-NH); a reduced amide bond (NH-CH2); a thiomethylene bond (S-CH2 or CH2-S); an oxomethylene bond (O-CH2 or CH2-O); an ethylene bond (CH2-CH2); a thioamide bond (C(S)-NH); a trans-olefin bond (CH=CH); a fluoro substituted trans-olefin bond (CF=CH); a ketomethylene bond (C(O)-CHR) or CHR-C(O) wherein R is H or CH3; and a fluoro-ketomethylene bond (C(O)-CFR or CFR-C(O) wherein R is H or F or CH3.
Peptides can be further modified by: acetylation, amidation, biotinylation, cinnamoylation, farnesylation, fluoresceination, formylation, myristoylation,
palmitoylation, phosphorylation (Ser, Tyr or Thr), stearoylation, succinylation and sulfurylation. As indicated above, peptides can be conjugated to, for example,
polyethylene glycol (PEG); alkyl groups (e.g., C1-C20 straight or branched alkyl groups); fatty acid radicals; and combinations thereof. In some embodiments, peptides can be purified by any method known in the art for purification of an immunoglobulin molecule, for example, by chromatography (e.g., ion exchange, affinity, particularly by affinity for
the specific antigens Protein A or Protein G, and sizing column chromatography), centrifugation, differential solubility, or by any other standard technique for the purification of proteins. Further, the antibodies of the present invention or fragments thereof may be fused to heterologous polypeptide sequences (referred to herein as "tags") described above or otherwise known in the art to facilitate purification. Peptides can be further modified by: acetylation, amidation, biotinylation, cinnamoylation, farnesylation, fluoresceination, formylation, myristoylation, palmitoylation, phosphorylation (Ser, Tyr or Thr), stearoylation, succinylation and sulfurylation. As indicated above, peptides can be conjugated to, for example, polyethylene glycol (PEG); alkyl groups (e.g., C1-C20 straight or branched alkyl groups); fatty acid radicals; and combinations thereof.
In some embodiments, polypeptides can be purified by any method known in the art for purification of an immunoglobulin molecule, for example, by chromatography (e.g., ion exchange, affinity, particularly by affinity for the specific antigens Protein A or Protein G, and sizing column chromatography), centrifugation, differential solubility, or by any other standard technique for the purification of proteins. Further, the antibodies of the present invention or fragments thereof may be fused to heterologous polypeptide sequences (referred to herein as "tags") described above or otherwise known in the art to facilitate purification. Therapeutic use
The disclosure provides methods of treatment that include administering to a subject a composition disclosed herein.
The term "subject," as used herein, refers to any animal. In some embodiments, the subject is a mammal. In some embodiments, the term "subject", as used herein, refers to a human (e.g., a man, a woman, or a child). Samples for use in the methods can include serum samples, e.g., obtained from the selected subject.
In some embodiments, subject selection can include obtaining a sample from a subject (e.g., a candidate subject) and testing the sample for an indication that the subject is suitable for selection. In some embodiments, the subject can be confirmed or identified, e.g. by a health care professional, as having had or having a condition or disease. In some embodiments, exhibition of a positive response towards a condition or disease can be
made from patient records, family history, and/or detecting an indication of a positive response. In some embodiments multiple parties can be included in subject selection. For example, a first party can obtain a sample from a candidate subject and a second party can test the sample. In some embodiments, subjects can be selected and/or referred by a medical practitioner (e.g., a general practitioner). In some embodiments, subject selection can include obtaining a sample from a selected subject and storing the sample and/or using the in the methods disclosed herein. Samples can include, for example, cells or populations of cells. Ischemia reperfusion injuries
Mammal organs usually require a continuous supply of oxygen to maintain normal function. Under aerobic conditions, the organ tissue derives its energy primarily from the mitochondria. Following the onset of ischemia there is a rapid decline in high- energy phosphate levels with alterations in mitochondrial structure, volume, oxygen consumption, and ATP synthesis. Ischemia reperfusion injuries may affect various organs.
The methods described herein include methods for the treatment of disorders associated with ischemia reperfusion injuries in various organs, for example, kidney, heart, lung, brain etc. Many disorders are associated with ischemia reperfusion injuries. Methods described herein can be used to treat these disorders, for example, acute kidney injury, acute coronary syndrome, acute myocardial infarction, mesenteric ischemia, brain ischemia, stroke, acute limb ischemia, cyanosis, gangrene, etc.
The methods described herein also include methods of preventing or ameliorating a pathology caused by ischemia reperfusion injury, for example, chronic kidney disease, kidney fibroinflammatory diseases, post-ischemic renal fibrosis, post-MI left ventricular adverse remodeling, pulmonary fibrosis, ischemic colitis, etc.
Generally, the methods include administering a therapeutically effective amount of composition comprising a polypeptide that immunospecifically binds the epitope recognized by mabl07, to a subject who is in need of, or who has been determined to be in need of, such treatment.
In some embodiments, a therapeutically effective amount of composition comprising a polypeptide that immunospecifically binds the epitope recognized by mabl07 is administered to the subject within about 3 hours after the ischemia reperfusion injury, within about 2 hours after the ischemia reperfusion injury, within about 1.5 hours after the ischemia reperfusion injury, within about 1 hours after the ischemia reperfusion injury, within about 0.5 hours after the ischemia reperfusion injury.
Appropriate dosage and treatment regimen can be determined by an experienced clinician. In some embodiments, an therapeutically effective amount of composition comprising a polypeptide that immunospecifically binds the epitope recognized by mabl07 can be administered to a subject. In some embodiments, an amount of 4-12 mg/Kg of the polypeptide (e.g., mabl07) is administered to a subject.
In some embodiments, a polypeptide that immunospecifically binds the epitope recognized by mabl07 is administered after the ischemia but before reperfusion occurs. In some embodiments, the polypeptide is administered after the reperfusion. In some embodiments, the intervention is preventive in nature. Thus, the polypeptide is administered to a subject who is likely to suffer ischemia reperfusion injury, but has not developed ischemia reperfusion injury. In some embodiments, the polypeptide is administered to the subject before the ischemia reperfusion injury.
Organ transplantation
The ischemia-reperfusion injury is a very important problem during organ transplantation. Much damage in organ transplantation appears to be induced by reperfusion injury. Organs used for transplantation often undergoes lengthy periods of cold ischemic storage after devascularization and cold perfusion, resulting in an increased susceptibility to damage upon reperfusion. Ischemia/reperfusion injury often leads to delayed graft function.
Methods described herein include methods of reducing delayed graft function followed by organ transplantation, for example, heart transplantation, kidney
transplantation, lung transplantation, live transplantation, bone marrow transplantation etc. In some embodiments, a polypeptide that immunospecifically binds the epitope recognized by mabl07 can be used to control ischemia/reperfusion damage for
transplanted organs. In some embodiments, a therapeutically effective amount of composition comprising a polypeptide that immunospecifically binds the epitope recognized by mabl07 is administered to the organ recipient prior to, during, or after the organ transplantation procedure. In some embodiments, a therapeutically effective amount of composition comprising a polypeptide that immunospecifically binds the epitope recognized by mabl07 is administered to the donor before the organ is harvested. In some embodiments, a therapeutically effective amount of composition comprising a polypeptide that immunospecifically binds the epitope recognized by mabl07
administered to the transplanted organ, for example, the polypeptide can be injected into the blood vessels (e.g., arteries, veins) of the transplanted organ or directly injected into the organ tissue, or the polypeptide can be added to the perfusion fluid for organ preservation, when the retrieved organ is preserved in a preservation apparatus.
Autoimmune disease
Autoimmune diseases arise from an abnormal immune response of the body against substances and tissues normally present in the body (autoimmunity). This may be restricted to certain organs (e.g. in autoimmune thyroiditis) or involve a particular tissue in different places (e.g. Goodpasture's disease which may affect the basement membrane in both the lung and the kidney).
Methods described herein includes methods of treating a subject having autoimmune diseases, for example, cytoplasmic antineutrophil cytoplasmic antibodies (cANCA)-associated vasculitis. In some embodiments, the methods include
administering to the subject a therapeutically effective amount of composition comprising a polypeptide that immunospecifically binds the epitope recognized by mabl07.
In some embodiments, a therapeutically effective amount of composition comprising a polypeptide that immunospecifically binds the epitope recognized by mabl07 is administered to a subject with at least one or two other immunosuppression compositions, for example, glucocorticoid, cyclophosphamide, azathioprine,
dactinomycin, methotrexate etc.
Diabetic nephropathy
Diabetic nephropathy (or diabetic kidney disease) is a progressive kidney disease caused by damage to the capillaries in the kidneys' glomeruli. It is due to longstanding diabetes mellitus, and characterized by nephrotic syndrome and diffuse scarring of the glomeruli.
Methods described herein includes methods of treating a subject having diabetic nephropathy comprising. In some embodiments, the methods include administering to the subject a therapeutically effective amount of composition comprising a polypeptide that immunospecifically binds the epitope recognized by mabl07.
Chemotherapy toxicity
Chemotherapy is a common treatment for various cancers, however, it also causes several serious complications. Chemotherapy-induced organ toxicity is one complication that limits the clinical use of chemotherapeutic agents. For example, certain
chemotherapeutic agents, such as anthracyclines, are highly effective against acute lymphoblastic and myeloblastic leukemias, but are particularly harmful to the heart due to its effects on mitochondria. Another example is Adriamycin. Adriamycin
(doxorubicin) is an anthracycline, a class of anti-tumor drugs with a very wide spectrum of activity in human cancers. In humans, Adriamycin undergoes rapid plasma clearance and there is significant tissue binding. Adriamycin accumulates mainly in the kidney. This probably accounts for the greater nephrotoxicity, leading to Adriamycin
nephropathy. These chemotherapies often induce organ failure by triggering
inflammation. A monoclonal antibody that targets CD 1 lb/CD 18 can reduce renal injury in Adriamycin nephropathy by partially depleting CD1 lb+ macrophages (Wang, Y., et al. Partial depletion of macrophages by ED7 reduces renal injury in Adriamycin
nephropathy. Nephrology (Carlton) 10, 470-477 (2005)). But in some cases, pretreatment with a polypeptide that immunospecifically binds the epitope recognized by mabl07 may be a safer and more effective alternative, because the polypeptide that
immunospecifically binds the epitope recognized by mabl07 (e.g., mabl07) does not deplete leukocytes.
Methods described herein includes methods of preventing or ameliorating a pathology caused by chemotherapy in a subject, for example, by reducing chemotherapy
toxicity. One useful method to minimize chemotherapy-induced organ toxicity is to administer a therapeutically effective amount of composition comprising a polypeptide that immunospecifically binds the epitope recognized by mabl07 to a subject that is currently under a chemotherapy treatment regimen. If the subject needs to be treated with chemotherapy (e.g., because prescribed by a physician or veterinarian), the subject can be treated with a polypeptide that immunospecifically binds the epitope recognized by mabl07 before, during, and/or after administration of the chemotherapy. For example, subjects can be treated with a polypeptide that immunospecifically binds the epitope recognized by mabl07 starting immediately after administering chemotherapy to a subject, as a singular treatment or continuing intermittently or continuously for about 1, 2, 5, 8, 10, 20, 30, 50, or 60 days, one year, indefinitely, or until a physician determines that administration of the polypeptide is no longer necessary.
Pharmaceutical compositions
The methods described herein include the use of pharmaceutical compositions comprising a polypeptide that immunospecifically binds the epitope recognized by mabl07 as an active ingredient.
Pharmaceutical compositions typically include a pharmaceutically acceptable carrier. As used herein the language "pharmaceutically acceptable carrier" includes saline, solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like, compatible with pharmaceutical
administration.
Pharmaceutical compositions are typically formulated to be compatible with its intended route of administration. Examples of routes of administration include parenteral, e.g., intravenous, intradermal, subcutaneous, oral (e.g., inhalation), transdermal (topical), transmucosal, and rectal administration.
Methods of formulating suitable pharmaceutical compositions are known in the art, see, e.g., Remington: The Science and Practice of Pharmacy, 21st ed., 2005; and the books in the series Drugs and the Pharmaceutical Sciences: a Series of Textbooks and Monographs (Dekker, NY). For example, solutions or suspensions used for parenteral, intradermal, or subcutaneous application can include the following components: a sterile
diluent such as water for injection, saline solution, fixed oils, polyethylene glycols, glycerine, propylene glycol or other synthetic solvents; antibacterial agents such as benzyl alcohol or methyl parabens; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as ethylenediaminetetraacetic acid; buffers such as acetates, citrates or phosphates and agents for the adjustment of tonicity such as sodium chloride or dextrose. pH can be adjusted with acids or bases, such as hydrochloric acid or sodium hydroxide. The parenteral preparation can be enclosed in ampoules, disposable syringes or multiple dose vials made of glass or plastic.
Pharmaceutical compositions suitable for injectable use can include sterile aqueous solutions (where water soluble) or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion. For intravenous administration, suitable carriers include physiological saline, bacteriostatic water, Cremophor EL™ (BASF, Parsippany, NJ) or phosphate buffered saline (PBS). In all cases, the composition must be sterile and should be fluid to the extent that easy syringability exists. It should be stable under the conditions of manufacture and storage and must be preserved against the contaminating action of microorganisms such as bacteria and fungi. The carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyetheylene glycol, and the like), and suitable mixtures thereof. The proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants.
Prevention of the action of microorganisms can be achieved by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, ascorbic acid, thimerosal, and the like. In many cases, it will be preferable to include isotonic agents, for example, sugars, polyalcohols such as mannitol, sorbitol, sodium chloride in the composition. Prolonged absorption of the injectable compositions can be brought about by including in the composition an agent that delays absorption, for example, aluminum monostearate and gelatin.
Sterile injectable solutions can be prepared by incorporating the active
composition in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by filtered sterilization.
Generally, dispersions are prepared by incorporating the active composition into a sterile vehicle, which contains a basic dispersion medium and the required other ingredients from those enumerated above. In the case of sterile powders for the preparation of sterile injectable solutions, the preferred methods of preparation are vacuum drying and fireeze- drying, which yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
Oral compositions generally include an inert diluent or an edible carrier. For the purpose of oral therapeutic administration, the active composition can be incorporated with excipients and used in the form of tablets, troches, or capsules, e.g., gelatin capsules. Oral compositions can also be prepared using a fluid carrier for use as a mouthwash. Pharmaceutically compatible binding agents, and/or adjuvant materials can be included as part of the composition. The tablets, pills, capsules, troches and the like can contain any of the following ingredients, or compounds of a similar nature: a binder such as microcrystalline cellulose, gum tragacanth or gelatin; an excipient such as starch or lactose, a disintegrating agent such as alginic acid, Primogel, or corn starch; a lubricant such as magnesium stearate or Sterotes; a glidant such as colloidal silicon dioxide; a sweetening agent such as sucrose or saccharin; or a flavoring agent such as peppermint, methyl salicylate, or orange flavoring.
For administration by inhalation, the composition can be delivered in the form of an aerosol spray from a pressured container or dispenser that contains a suitable propellant, e.g., a gas such as carbon dioxide, or a nebulizer. Such methods include those described in U.S. Patent No. 6,468,798.
Systemic administration of a therapeutic composition as described herein can also be by transmucosal or transdermal means. For transmucosal or transdermal
administration, penetrants appropriate to the barrier to be permeated are used in the formulation. Such penetrants are generally known in the art, and include, for example, for transmucosal administration, detergents, bile salts, and fusidic acid derivatives.
Transmucosal administration can be accomplished through the use of nasal sprays or suppositories. For transdermal administration, the active compositions are formulated into ointments, salves, gels, or creams as generally known in the art.
The pharmaceutical compositions can be included in a container, pack, or dispenser together with instructions for administration.
Dosage
An "effective amount" is an amount sufficient to effect beneficial or desired results. For example, a therapeutic amount is one that achieves the desired therapeutic effect. This amount can be the same or different from a prophylactically effective amount, which is an amount necessary to prevent onset of disease or disease symptoms. An effective amount can be administered in one or more administrations, applications or dosages. A therapeutically effective amount of a therapeutic compound (i.e., an effective dosage) depends on the therapeutic compounds selected. The compositions can be administered one from one or more times per day to one or more times per week;
including once every other day. The skilled artisan will appreciate that certain factors may influence the dosage and timing required to effectively treat a subject, including but not limited to the severity of the disease or disorder, previous treatments, the general health and/or age of the subject, and other diseases present. Moreover, treatment of a subject with a therapeutically effective amount of the therapeutic compounds described herein can include a single treatment or a series of treatments.
Dosage, toxicity and therapeutic efficacy of the therapeutic compounds can be determined by standard pharmaceutical procedures in cell cultures or experimental animals, e.g., for determining the LD50 (the dose lethal to 50% of the population) and the ED50 (the dose therapeutically effective in 50% of the population). The dose ratio between toxic and therapeutic effects is the therapeutic index and it can be expressed as the ratio LD50/ED50. Compounds which exhibit high therapeutic indices are preferred. While compounds that exhibit toxic side effects may be used, care should be taken to design a delivery system that targets such compounds to the site of affected tissue in order to minimize potential damage to uninfected cells and, thereby, reduce side effects.
The data obtained from cell culture assays and animal studies can be used in formulating a range of dosage for use in humans. The dosage of such compounds lies preferably within a range of circulating concentrations that include the ED50 with little or no toxicity. The dosage may vary within this range depending upon the dosage form
employed and the route of administration utilized. For any compound used in the method of the invention, the therapeutically effective dose can be estimated initially from cell culture assays. A dose may be formulated in animal models to achieve a circulating plasma concentration range that includes the IC50 (i.e., the concentration of the test compound which achieves a half-maximal inhibition of symptoms) as determined in cell culture. Such information can be used to more accurately determine useful doses in humans. Levels in plasma may be measured, for example, by high performance liquid chromatography. EXAMPLES
The invention is further described in the following examples, which do not limit the scope of the invention described in the claims.
Example 1: Ligand-mimetic mAb antagonist of leukocyte integrin CDllb/CD18 ameliorates fibrosis and kidney failure
Materials and methods
mAb preparation
mAb-containing supernatants harvested from hybridoma cultures were clarified and concentrated by circulating it through a hollow fiber membrane cartridge. The mAb was purified by successive steps on Protein A affinity chromatography, hydroxyapatite charge exchange chromatography and size-exclusion chromatography. Endotoxin was removed using Detoxi-Gel™ (Pierce, Rockford, IL) and its level in the final product and in buffers used in the purification was determined with the Limulus Amebocyte Lysate (LAL) gel-clot test. mAb concentration was determined by UV absorbance; purity assessed following sodium dodecyl sulphate polyacrylamide gel electrophoresis (SDS- PAGE) and Coomassie staining. The sterile and purified mAb was stored at 4°C until used. Methods of preparing monoclonal antibodies are described, e.g., in Horenstein, A.L., Durelli, I. & Malavasi, F. Purification of Clinical-Grade Monoclonal Antibodies by Chromatographic Methods. In Methods in Molecular Biology P. Therapeutic Proteins:
Methods and Protocols (C Mark Smales and David C James., eds), Humana Press, Totowa, NJ, Chapter 16. (2005).
Animal procurement
Pathogen-free Cynomolgus (macaque) male monkeys were bought from Charles
River Lab (Texas), weighed 2.6 - 4 kg and were approximately 2-3 years old. They were housed in wire-mesh cages in air-conditioned, humidity and temperature-controlled rooms with a 12-h light-dark cycle until use. Animals were fed LabDiet® 5038 and tap water ad libitum.
Animal Procedures
All procedures were approved by the Institutional Animal Care and Use
Committee of Massachusetts General Hospital. Anti-coagulated blood was obtained from the saphenous vein. The monkeys were prepared for surgery. Briefly, animals were fasted overnight and then sedated with FM ketamine, 3.0-5.0 mg/kg plus Dexdomitor 0.03-0.06 mg/kg. Atropine, 0.05 mg/kg IM, was given. Anesthesia was achieved by administration of Isoflurane 1-3% inhalant with intermittent administration of ketamine as needed. The trachea was intubated and the animal ventilated with positive pressure and a gas mixture of 40% 02/60%) N2, and BP continuously monitored. The chest, abdomen and posterior aspect of both calves were shaved. Intravenous normal saline solution containing 40 mg cefazoline was started in the saphenous vein using a #24 angiocatheter. Detailed methods of preparing monkeys for surgery and performing surgery on monkeys are described, e.g., in Haug, C.E., et al. Real-time monitoring of renal function during ischemic injury in the rhesus monkey. Ren Fail 17, 489-502 (1995).
Unilateral right kidney ischemia was induced by 2 hour hilar cross clamping. The contralateral ureter was ligated. Five animals were treated with mAb 107 (4-12 mg/Kg) and five with saline or the irrelevant mAb X63. One-half the mAb does was given prior to ischemia and the other half 2 minutes before reperfusion. The doses used were predicted to achieve blood levels of the mAb 7-12 fold greater than the half-maximal phagocytosis-inhibitory concentration {Ki ~\ 5 μg/ml) in vitro 71 , and based on an estimated circulating blood volume of ~65ml/kg of body weight for cynomolgous
monkeys. 3-9 months post I/R, the surgically exposed left ureter was religated 2 days prior to planned euthanasia and kidney function measured prior to and one and 2days afterwards.
Open right kidney biopsies were carried out 1-2 days and one month after reperfusion. The right kidney was exposed following a midline abdominal incision, and a 2x4 mm incision extending approximately 1-1/2 mm into the cortex made with the M75 blade. The wedge biopsy was then excised using iris scissors. Bleeding was controlled with finger pressure, and subcutaneous fat or muscle sutured into the cortical defect. After assuring hemostasis, the wound was closed in layers, the animal awakened, stable vital signs assured then returned to the housing area.
Animals were euthanized at the indicated times by intravenous administration of euthasol, 0.33mg/kg (1ml contains 390 mgs of pentobarbital and 50 mgs phenytoin). This method is consistent with the recommendation of the panel on Euthanasia of the
American Veterinary Medical Association. Kidneys were exposed, inspected, the ureter and renal artery and vein were ligated and transected and the kidneys removed and submitted for testing.
Kidney sections for histology was placed in 4% formaldehyde, embedded in paraffin, and stained with hematoxylin/eosin or immunostained using antibodies.
Sections for RNA analysis were placed immediately in 2-mL tubes containing RNAlater (Ambion), an RNA stabilization and protection agent. The tubes were refrigerated overnight at 4°C and stored at -70°C until ready for use.
Measurement of non-reflow
A videotape of the surgical procedure was used to measure the time taken for the ischemic dark purple-colored right kidney to change color back to red after right clamp release.
Quantitation of peripheral blood leukocytes
Hematocrit, total white blood cells, neutrophils, monocytes, lymphocytes and platelets were quantified in heparinized blood using established methods.
Biochemical determinations
Blood samples were allowed to clot and were centrifuged at high speed for 30 min. Serum was obtained and stored at -80°C until use. BUN and sCR were measured in duplicates in 96-well plates using a colorimetric method. Mouse mAbs were measured using eBioscience mouse IgG total ELISA kit (Affymetrix, San Diego, CA) as described by the manufacturer.
Quantitation of cytokines, chemokines and complement C3 was performed in sera or extracts derived from equivalent amounts (by weight) of kidney tissue biopsy or autopsy using appropriate ELISA kits.
Leukocyte isolation and flow cytometry
Monkey peripheral blood leukocytes were isolated from EDTA-anti-coagulated whole blood using Ammonium-Chloride-Potassium (ACK) erythrocyte lysis buffer (Lonza) as described by the manufacturer. The leukocyte pellet was washed twice with Dulbecco's Phosphate Buffered saline solution (DPBS, Gibco®). Leukocytes were incubated with or without Ιμΐ of mAb 107 (lmg/ml) for 30 minutes in FACS-staining buffer (DPBS++ solution + 1% fetal calf serum) at room temperature, washed then incubated with Ιμΐ FITC-anti-mouse Fab (1.4mg/ml, Jackson ImmunoResearch, West Grove, PA) for 20 minutes on ice. Cells were washed once with 0.5ml FACS-staining buffer, fixed and analyzed using a FACSCalibur™ or LSRFortessa™ flow cytometer (BD Biosciences). mAb binding was expressed as mean fluorescence intensity, as determined using the FlowJo software (BD Biosciences). Monkey PMNs were isolated from EDTA-anti-coagulated blood by fractionation over lympholyte-poly solution (CEDARLANE, Burlington, ON) as described by the manufacturer. Washed cells were then stained with mAb 107 as above.
Integrin activation
Leukocytes (1 χ 106 cells in 100 μΐ HBSS containing 1% globulin-free BSA (HBSS-BSA) and 1 mM each of CaCk and MgCk) were treated with FMLF (5 10"7 M final concentration) for 10 min at 37°C. Unlabeled Fab 107 was added to one half of the replicate tubes for an additional 30 min, followed by the addition of mouse mAb 24 to all
of the tubes and incubation for an extra 20 min. Cells then were washed once, stained with the anti-Fc-specific fluorophore-labeled Ab (for 30 min at 0°C), washed again, fixed with 1% formaldehyde in PBS, and analyzed by flow cytometry as above.
Immunocytochemistry
Air dried (30 min) frozen sections of normal human or monkey kidney for direct immunofluorescence are cut in a cryostat at a thickness of 2 to 4 mm. Afterward, slides are washed for 5 minutes in 0.01 M sodium-phosphate buffered saline (PBS)-0.15 M NaCl (pH 7.3) to remove unbound serum proteins. MPO+ cells were identified. Detailed methods were described, e.g., in Farris, A.B., et al. Morphometric and visual evaluation of fibrosis in renal biopsies, Journal of the American Society of Nephrology : JASN 22, 176-186 (2011); Ysebaert, D.K., et al. Identification and kinetics of leukocytes after severe ischaemia/reperfusion renal injury, Nephrol Dial Transplant 15, 1562-1574 (2000).
Slides were incubated in monoclonal antibody for one hr. at room temperature at 1/30, 1/100, and 1/300 dilutions. After incubation, the slides are tipped to one side to allow the excess conjugate to run off and washed in PBS four times for 5 to 10 min each. Then, the slides were incubated with polyclonal anti-mouse (rabbit-FITC labeled) at 1/200 dilution (a known optimal dilution) for 1 hr. at room temperature. Slides were then again rinsed in PBS four times for 5 - 10 minutes each, and cover-slipped with mounting medium (Aqua-Mount, Lerner Labs, Pittsburgh, PA.). The slides were then examined using a fluorescence microscope with epi-illumination equipment, which consists of barrier and excitation filters contained in a dichroic mirror package, to allow the visualization of fluorescein.
6 μιη-thick serial sections were prepared and stained with hematoxylin/eosin or trichrome (Toulouse Latrec 1 Step Trichrome Stain Kit, Biocare Medical, Concord Park, CA). Fibrosis was expressed as the percent area that is Trichrome Stain-positive in ten fields at 20X magnification.
For collagen III immunohistochemistry (IHC), antigen retrieval was performed using the Borg Decloaker (Biocare Medical). Polyclonal rabbit anti-human collagen III (LS-B693; Lifespan Biosciences, Seattle, WA) was used at a dilution of 1 :400. For
collagen III morphometry, stained sections were scanned with an Aperio Scan-Scope CS (Aperio Technologies, Inc., Vista, CA) and analyzed using the ImageScope Positive Pixel Count algorithm (Aperio Technologies, Inc., Vista, CA). The Aperio Scanscope allowed scanning and quantitation of the whole slide using a 20x objective lens with a numerical aperture of 0.75 coupled with a doubler objective to achieve a scan of whole slides at 40x magnification. The default parameters of the Positive Pixel Count (hue of 0.1 and width of 0.5) detected collagen III IHC adequately. Collagen deposition was expressed as percent of pixels positive for anti-Col antibody.
Macrophages were identified with anti-CD68 mAb EDI (Abeam, Cambridge, MA). Antibody binding was detected with Envision Dual Link System with horseradish peroxidase (Dako, Carpineria, CA) and developed with diaminobenzidine using the Autostainer Plus automated immunohistochemical stainer (Dako). Interstitial macrophage count was expressed as an average number in 20 fields at 200X magnification. Quantitative real-time PCR
Total RNA was extracted from kidney tissue with an RNeasy kit and was treated with DNase according to the manufacturer's protocol (Qiagen, Hilden, Germany), and each sample was reverse-transcribed with Multi Scribe reverse transcriptase (Applied Biosystems, Foster City, CA). Each 25-μ1 sample for quantitative PCR contained 2 μΐ of cDNA, 12.5 μΐ of 2* SYBR Green Master Mix (Applied Biosystems, Foster City, CA) and 250 nM of sense and antisense primers. Emitted fluorescence for each reaction was measured during the annealing/extension phase. The calculated number of copies was divided by the number of copies of the housekeeping gene glyceraldehyde-3 -phosphate dehydrogenase (GAPDH).
Statistical Analysis
For comparisons data were analyzed by the two-tailed Student t-test. Values of p less than 5% were considered significant. Results
A nonhuman primate model of post-ischemic CKD
We modified an earlier model of ischemic AKI in nonhuman primates to assess the impact of severe AKI on chronic fibrosis and kidney failure (Haug, C.E., et al. Realtime monitoring of renal function during ischemic injury in the rhesus monkey. Ren Fail 17, 489-502 (1995)). In a pilot study of 2 Cynomolgus monkeys, we induced warm ischemic AKI by a two-hour right hilar cross clamping, with contralateral ligation of the left ureter. This lead to acute right kidney failure, necessitating release of left ureter ligature 2 days later to avoid animal death from uremia. Animals were then followed for several weeks, at which time the left ureter was again ligated and right kidney function measured one and 2 days later followed by animal sacrifice (FIG. 1). Non-life sustaining kidney failure developed on day 2 post left ureter ligation, and was associated with severe interstitial fibrosis in the harvested right kidney.
Effect of mAb 107 on right I/R AKI
The above CKD model was used to assess the role of CD1 lb+ innate immune cells in acute and chronic kidney injury in a pair of healthy Cynomolgus monkeys. One animal (Al, 4.2 kg) received intravenous mAb 107 at 6 mg/kg, with ½ the dose given 2 minutes prior to ischemia and the other half 2 minutes before reperfusion. The control animal (CI, 3.0 kg) received an equal dose of an IgGl -matched nonreactive mouse mAb X63 (ATCC). The surgical team was blinded as to which animal received the respective mAb. Serum creatinine (Cr) and blood urea nitrogen (BUN) were measured prior to and during left ureter ligation to assess right kidney function. Right kidney biopsies were performed one day after ischemia, at which time the serum levels of mAbs 107 and X63 were 105.6 μg/ml and 73.8 μg/ml, respectively. These levels were similar on day 2 and became undetectable by day 13 (FIG. 2a). Right kidney biopsy was repeated one month after AKI. Three months after right AKI and two days before planned euthanasia, the left ureter was again ligated for 2 days, and Cr levels measured daily. Both kidneys were harvested after animal sacrifice.
Serum Cr rose by four- and seven fold in Al and CI, respectively, one day after I/R (FIG. 2b). Release of the contralateral left ureteral ligature normalized serum Cr in both animals two and five days after right AKI (FIG. 2b). Upon release of the right vascular obstruction, the no-reflow time, a reflection of the microvasculature perfusion
rate, was 32 sec in Al vs. 84 sec in CI . Portions of CI right kidney retained the mottled appearance (FIG. 2c). mAbl07 did not result in depletion of peripheral white blood cells, neutrophils, monocytes, lymphocytes, platelets, or red blood cells on days 1, 2 and 5 post injury (FIG. 2d-i). A blinded histopathologic examination of right kidney biopsy one day after injury did not find an appreciable difference in the extent of acute tubular necrosis between the two animals, but found decreased interstitial MPO+ leukocytes in the cortical-medullary area in the treated vs. control kidney. mAbl07 inhibited integrin activation
mAbl07 is known to prevent agonist-induced conformational switching of human cellular CD1 lb/CD18 from its native inactive state to the active proadhesive state 35. Binding of mAbl07 to polymorphonuclear cells (PMNs) isolated from two naive monkeys also blocked activation of monkey CD 1 lb/CD 18 induced by the
chemoattractant f-met-leu-phe (FMLF), as reported by binding of the activation-sensitive mAb 24 38(FIG. 2j). mAbl07 also reduced integrin activation on monkey PMNs in vivo: flow cytometric analysis showed higher binding of APC-mAb24 to control PMNs obtained one day after AKI when compared with binding to PMNs from the treated monkey (FIG. 2k). That the latter cells already had bound mAb 107 on their surface was demonstrated by the selective binding of FITC-labeled goat anti-mouse Ig (FIG. 21).
Recovery of right kidney function in the mAb-07 -treated animal 3 months after I/R
Blinded histopathologic examination of right kidney biopsy obtained one month after AKI showed 5% interstitial fibrosis in the treated animal vs. 15% in control, suggesting that mAb 107 promotes kidney recovery. Because of the potential bias in biopsy tissue sampling, right kidney function was measured 3 months after AKI by religation of the contralateral left ureter for two days, with daily measurements of urea nitrogen (BUN) and serum Cr. BUN/Cr rapidly rose in the control from normal pre- ligation levels (22 mg/dL /0.7 mg/dL) to 55/2.5 and 63/3.1 one and two days after left ureter ligation, respectively (FIGS. 2m-n). In contrast, BUN/Cr from a baseline of 22/0.6 in the treated animal to 33/1.2 and 29/1.2 one and two days, respectively, after left ureter ligation (FIGS. 2m-n).
The two animals were then euthanized on day 2 post left ureter ligation, and the left and right kidneys harvested, visually examined and submitted for histopathologic studies. The control right kidney was adherent to the surrounding tissue, and much smaller than the control left kidney, with thinning of the outer cortex (FIG.2o). In contrast, the treated right kidney that did not adhere to the surrounding tissue, and was only slightly smaller than the left kidney (FIG. 2o). Histopathologic examination of the left kidney showed acute tubular injury secondary to obstruction and largely resolved acute tubular necrosis in the right kidney. Intrarenal macrophages, interstitial fibrosis (FIGS. 2p-q) and collagen deposition were all reduced in the right kidney of the treated vs. control animal.
Right kidney evaluation in four additional pairs of monkeys 1-2 days after I/R
To assess the significance of the above findings in a larger cohort, and the longer- term effects on kidney function, the above studies were repeated in eight additional monkeys, four in each of the treated and control groups. We also extended the follow up period to 6 months after I/R in two pairs (A2/C2, A3/C3) and to 9 month in the two others (A4/C4, A5/C5). Serum levels of mAbl07 measured in three of the four treated animals yielded values comparable to those seen in Al above, and followed a similar half-life (FIG. 3a).
No-reflow was again shortened in the four treated animals vs. controls (FIG. 3b). mAbl07 did not reduce circulating red blood cells, leukocytes or platelets 1, 2 and 5 days after I/R (FIG. 3c-h), with neutrophil counts returning to baseline on day five vs. those in controls (FIG. 3d), perhaps reflecting persistent inflammation in the control animals. BUN and Cr also rose to equivalent degrees in the two groups one and two days after left ureter ligation, and returned to normal by day five after release of left ureter ligature (FIGS. 3i-j)
Right kidney biopsies performed on day 2 after AKI showed comparable degrees of acute tubular necrosis in the treated and control groups (FIGS. 3k-l). Assessment of kidney function and histopathology 6-9 months after AKI
Right kidney function was measured 6 and 9 months after AKI and one and two days following re-ligation of the contralateral left ureter in seven of the eight animals (3 treated and four controls). BUN and Cr were significantly lower in the mAb-107-treated group one day after religation (BUN=28.5+6.61 mg/dL, Cr=l .15+0.08 mg/dL) vs.
controls (BUN=43.2+8.73 mg/dL, Cr=3.64+1.59 mg/dL), did not rise further the following day vs. controls (BUN=51.2+6.0 mg/dL, Cr=5.08+2.24 mg/dL) (FIGS. 4a-b). The BUN/Cr in treated animals approached but remained significantly higher than the baseline levels prior to left ureter ligation (BUN= 17.25+4.43 mg/dL, Cr=0.87+0.06 mg/dL) (FIGS. 4a-b).
Harvested control right kidneys were more adherent to surrounding tissue, were visibly smaller and of abnormal architecture when compared with their left counterparts or with right kidneys from mAbl07-treated animals (representative shown in FIGS. 4c- d). Histopathologic examination of kidneys from each of the mAbl07-treated animals showed tubular recovery, with absent or only focal areas of fibrosis (FIGS. 4h-i).
Quantitative assessments showed significant reductions in interstitial leukocytes and collagen deposition vs. controls (FIGS. 4e-h).
Cytokine/chemokine profiles 24 hours after reperfusion
Chemokines, cytokines and complement have been suggested to play an important pathogenic role in rodent models of I/R AKI 10. To assess the impact of inactivation of CD 1 lb/CD 18 on early changes in these inflammatory mediators, we quantified serum and tissue levels of thirteen such mediators in two treated and two control animals, one to two days after AKI, as well in the harvested left and right kidneys at sacrifice. Tissue protein levels of right kidney biopsies obtained 1-2 days post I/R showed marked reductions in RANTES, IL18, complement C3, IFN-γ and IL6 vs. control kidneys. mRNA levels for Variable changes were found in levels of TNFa, IL8, MCP1, ILIRa and active TGFp, but levels of IL2 and ILip were increased in the treated kidneys (FIG. 5a)
In right kidneys harvested 3 and 6 months after AKI from treated animals, protein levels of all measured mediators except for active TGFp were much reduced vs. control right kidney (FIG. 5b). Interestingly, levels of IL8, MCP1, ILIRa were elevated in the
left treated kidney. mRNA levels of RANTES, IL18, IL6 and HIFla but not IL17a were reduced in right kidneys of treated animals vs. control (FIG. 5b).
OTHER EMBODIMENTS
It is to be understood that while the invention has been described in conjunction with the detailed description thereof, the foregoing description is intended to illustrate and not limit the scope of the invention, which is defined by the scope of the appended claims. Other aspects, advantages, and modifications are within the scope of the following claims.
LIST OF REFERENCES
1. Solez, K., Morel -Maroger, L. & Sraer, J.D. The morphology of "acute tubular necrosis" in man: analysis of 57 renal biopsies and a comparison with the glycerol model. Medicine (Baltimore) 58, 362-376 (1979).
2. Rabb, H., et al. Inflammation in AKI: Current Understanding, Key Questions, and Knowledge Gaps. Journal of the American Society of Nephrology : JASN (2015).
3. Lameire, N.H., et al. Acute kidney injury: an increasing global concern. Lancet 382,
170-179 (2013).
4. Susantitaphong, P., et al. World incidence of AKI: a meta-analysis. Clinical journal of the American Society of Nephrology : CJASN S, 1482-1493 (2013).
5. Chertow, G.M., Burdick, E., Honour, M., Bonventre, J.V. & Bates, D.W. Acute kidney injury, mortality, length of stay, and costs in hospitalized patients. Journal of the American Society of Nephrology : JASN 16, 3365-3370 (2005).
6. Boros, P. & Bromberg, J.S. New cellular and molecular immune pathways in ischemia/reperfusion injury. Am J Transplant 6, 652-658 (2006).
7. Lo, L.J., et al. Dialysis-requiring acute renal failure increases the risk of progressive chronic kidney disease. Kidney international 76, 893-899 (2009).
8. Nelson, P. J., et al. The renal mononuclear phagocytic system. Journal of the American Society of Nephrology : JASN 23, 194-203 (2012).
9. Lupher, M.L., Jr. & Gallatin, W.M. Regulation of fibrosis by the immune system.
Adv Immunol 89, 245-288 (2006).
Eltzschig, H.K. & Eckle, T. Ischemia and reperfusi on—from mechanism to translation. Nature medicine 17, 1391-1401 (2011).
Kurts, C, Panzer, U., Anders, H.J. & Rees, A.J. The immune system and kidney disease: basic concepts and clinical implications. Nat Rev Immunol 13, 738-753 (2013).
Li, L., et al. KT cell activation mediates neutrophil IFN-gamma production and renal ischemia-reperfusion injury. J Immunol 178, 5899-5911 (2007).
Li, L., et al. The chemokine receptors CCR2 and CX3CR1 mediate monocyte/macrophage trafficking in kidney ischemia-reperfusion injury. Kidney international 14, 1526-1537 (2008).
Gandolfo, M.T., et al. Foxp3+ regulatory T cells participate in repair of ischemic acute kidney injury. Kidney international 76, 717 '-729 (2009).
Wynn, T.A. & Ramalingam, T.R. Mechanisms of fibrosis: therapeutic translation for fibrotic disease. Nature medicine 18, 1028-1040 (2012).
Clements, M., et al. Differential Ly6C Expression after Renal Ischemia- Reperfusion Identifies Unique Macrophage Populations. Journal of the American Society of Nephrology : JASN21, 159-170 (2016).
Murray, P. J., et al. Macrophage activation and polarization: nomenclature and experimental guidelines. Immunity 41, 14-20 (2014).
Cerda, J., et al. Promoting Kidney Function Recovery in Patients with AKI Requiring RRT. Clinical journal of the American Society of Nephrology : CJASN 10, 1859-1867 (2015).
Molitoris, B.A., Okusa, M.D., Palevsky, P.M., Kimmel, P.L. & Star, R.A. Designing clinical trials in acute kidney injury. Clinical journal of the American Society of Nephrology : CJASN1, 842-843 (2012).
Mestas, J. & Hughes, C.C. Of mice and not men: differences between mouse and human immunology. J Immunol 172, 2731-2738 (2004).
Lim, B.J., Yang, H.C. & Fogo, A.B. Animal models of regression/progression of kidney disease. Drug Discov Today Dis Models 11, 45-51 (2014).
Arnaout, M.A. Structure and function of the leukocyte adhesion molecules Cm \ICm . Blood 15, 1037-1050 (1990).
Wagner, C, et al. The complement receptor 3, CR3 (CD1 lb/CD18), on T lymphocytes: activation-dependent up-regulation and regulatory function. Eur J Immunol Sl, 1173-1180 (2001).
Lahmers, K.K., et al. Comparative gene expression by WC1+ gammadelta and CD4+ alphabeta T lymphocytes, which respond to Anaplasma marginale, demonstrates higher expression of chemokines and other myeloid cell-associated genes by WC1+ gammadelta T cells. JLeukoc Biol 80, 939-952 (2006).
Pilling, D., Fan, T., Huang, D., Kaul, B. & Gomer, R.H. Identification of markers that distinguish monocyte-derived fibrocytes from monocytes, macrophages, and fibroblasts. PLoS One 4, e7475 (2009).
Arnaout, M.A., et al. Deficiency of a granulocyte-membrane glycoprotein (gpl50) in a boy with recurrent bacterial infections. N Engl J Med 306, 693-699 (1982). Evangelista, V., et al. Platelet/polymorphonuclear leukocyte interaction in dynamic conditions: evidence of adhesion cascade and cross talk between P-selectin and the beta 2 integrin CDl lb/CD18. Blood 88, 4183-4194 (1996).
Parkos, C.A., Delp, C, Arnaout, M.A. & Madara, J.L. Neutrophil migration across a cultured intestinal epithelium. Dependence on a CD 1 lb/CD 18-mediated event and enhanced efficiency in physiological direction. The Journal of clinical investigation 88, 1605-1612 (1991).
Annenkov, A., Ortlepp, S. & Hogg, N. The beta 2 integrin Mac-1 but not pl50,95 associates with Fc gamma RIIA. Eur J Immunol 26, 207-212 (1996).
Zhou, M.J. & Brown, E.J. CR3 (Mac-1, alpha M beta 2, CDl lb/CD18) and Fc gamma RIII cooperate in generation of a neutrophil respiratory burst: requirement for Fc gamma RIII and tyrosine phosphorylation. The Journal of cell biology 125, 1407-1416 (1994).
van Spriel, A.B., et al. Mac-1 (CDl lb/CD18) is essential for Fc receptor-mediated neutrophil cytotoxicity and immunologic synapse formation. Blood 97, 2478-2486 (2001).
Ingalls, R.R., Arnaout, M.A. & Golenbock, D.T. Outside-in signaling by lipopolysaccharide through a tailless integrin. J Immunol 159, 433-438 (1997).
Wu, H., et al. TLR4 activation mediates kidney ischemia/reperfusion injury. The Journal of clinical investigation 117, 2847-2859 (2007).
Castano, A.P., et al. Serum amyloid P inhibits fibrosis through Fc gamma R- dependent monocyte-macrophage regulation in vivo. Sci Transl Med 1, 5ral3 (2009).
Mahalingam, B., et al. Stable coordination of the inhibitory Ca2+ ion at the metal ion-dependent adhesion site in integrin CDl lb/CD18 by an antibody-derived ligand aspartate: implications for integrin regulation and structure-based drug design. J Immunol 187, 6393-6401 (2011).
Cox, D., Brennan, M. & Moran, N. Integrins as therapeutic targets: lessons and opportunities. Nat Rev Drug Discov 9, 804-820 (2010).
Haug, C.E., et al. Real-time monitoring of renal function during ischemic injury in the rhesus monkey. Ren Fail 17, 489-502 (1995).
Kamata, T., et al. The role of the CP KEKEC sequence in the beta(2) subunit I domain in regulation of integrin alpha(L)beta(2) (LFA-1). J Immunol 168, 2296- 2301 (2002).
Hsu, C.Y. Yes, AKI truly leads to CKD. Journal of the American Society of Nephrology : JASN 23, 967-969 (2012).
Rifkin, D.E., Coca, S.G. & Kalantar-Zadeh, K. Does AKI truly lead to CKD? Journal of the American Society of Nephrology : JASN 23, 979-984 (2012).
Devarajan, P. Update on mechanisms of ischemic acute kidney injury. Journal of the American Society of Nephrology : JASN 17, 1503-1520 (2006).
Flores, L, DiBona, D.R., Beck, C.H. & Leaf, A. The role of cell swelling in ischemic renal damage and the protective effect of hypertonic solute. The Journal of clinical investigation 51, 118-126 (1972).
Summers, W.K. & Jamison, R.L. The no reflow phenomenon in renal ischemia. Lab Invest 25, 635-643 (1971).
Siedlecki, A., Irish, W. & Brennan, D.C. Delayed graft function in the kidney transplant. Am J Transplant 11, 2279-2296 (2011).
Kielar, M.L., et al. Maladaptive role of IL-6 in ischemic acute renal failure. Journal of the American Society of Nephrology : JASN 16, 3315-3325 (2005).
46. Yu, T.M., et al. RANTES mediates kidney ischemia reperfusion injury through a possible role of HIF-lalpha and LncRNA PRINS. Sci Rep 6, 18424 (2016).
47. Wu, H., et al. IL-18 contributes to renal damage after ischemia-reperfusion. Journal of the American Society of Nephrology : JASN 19, 2331-2341 (2008).
48. Thurman, J.M., Ljubanovic, D., Edelstein, C.L., Gilkeson, G.S. & Holers, V.M.
Lack of a functional alternative complement pathway ameliorates ischemic acute renal failure in mice. J Immunol 170, 1517-1523 (2003).
49. Ling, G.S., et al. Integrin CDl lb positively regulates TLR4-induced signalling pathways in dendritic cells but not in macrophages. Nat Commun 5, 3039 (2014). 50. Burne, M.J., et al. IL-1 and TNF independent pathways mediate ICAM-l/VCAM-1 up-regulation in ischemia reperfusion injury. J Leukoc Biol 70, 192-198 (2001). 51. Cugini, D., et al. Inhibition of the chemokine receptor CXCR2 prevents kidney graft function deterioration due to ischemia/reperfusion. Kidney international 67,
1753-1761 (2005).
52. Furuichi, K., et al. CCR2 signaling contributes to ischemia-reperfusion injury in kidney. Journal of the American Society of Nephrology : JASN 14, 2503-2515
(2003) .
53. Granucci, F., et al. Inducible IL-2 production by dendritic cells revealed by global gene expression analysis. Nat Immunol 2, 882-888 (2001).
54. Nelson, B.H. IL-2, regulatory T cells, and tolerance. J Immunol 172, 3983-3988
(2004) .
55. Kinsey, G.R., et al. Regulatory T cells suppress innate immunity in kidney ischemia-reperfusion injury. Journal of the American Society of Nephrology : JASN 20, 1744-1753 (2009).
56. Bach, J.F. Regulatory T cells under scrutiny. Nat Rev Immunol 3, 189-198 (2003).
57. Aster, R.H., Curtis, B.R., McFarland, J.G. & Bougie, D.W. Drug-induced immune thrombocytopenia: pathogenesis, diagnosis, and management. J Thromb Haemost 7, 911-918 (2009).
58. Rabb, H., et al. Role of CDl la and CDl lb in ischemic acute renal failure in rats.
Am J Physiol 261, F 1052- 1058 (1994).
Booster, M., et al. Inhibition of CD18-dependent leukocyte adherence by mAb 6.5 E does not prevent ischemia-reperfusion injury as seen in grafted kidneys. Transpl M S, 126-132 (1995).
Tajra, L.C., et al. In vivo effects of monoclonal antibodies against rat beta(2) integrins on kidney ischemia-reperfusion injury. J Surg Res 87, 32-38 (1999).
Thornton, M.A., Winn, R., Alpers, C.E. & Zager, R.A. An evaluation of the neutrophil as a mediator of in vivo renal ischemic-reperfusion injury. The American journal of pathology 135, 509-515 (1989).
Rezzonico, R., Imbert, V., Chicheportiche, R. & Dayer, J.M. Ligation of CDl lb and CDl lc beta(2) integrins by antibodies or soluble CD23 induces macrophage inflammatory protein 1 alpha (MIP-1 alpha) and MTP-lbeta production in primary human monocytes through a pathway dependent on nuclear factor-kappaB. Blood 97, 2932-2940 (2001).
Jakus, Z., Berton, G., Ligeti, E., Lowell, C.A. & Mocsai, A. Responses of neutrophils to anti-integrin antibodies depends on costimulation through low affinity Fc gamma Rs: full activation requires both integrin and nonintegrin signals. J Immunol 173, 2068-2077 (2004).
Thiele, R.H., Isbell, J.M. & Rosner, M.H. AKI associated with cardiac surgery. Clinical journal of the American Society of Nephrology : CJASN 10, 500-514 (2015).
Ishani, A., et al. The magnitude of acute serum creatinine increase after cardiac surgery and the risk of chronic kidney disease, progression of kidney disease, and death. Arch Intern Med 111, 226-233 (2011).
Hobson, C.E., et al. Acute kidney injury is associated with increased long-term mortality after cardiothoracic surgery. Circulation 119, 2444-2453 (2009).
Wang, Y., et al. Partial depletion of macrophages by ED7 reduces renal injury in Adriamycin nephropathy. Nephrology (Carlton) 10, 470-477 (2005).
Yarlagadda, S.G., Coca, S.G., Formica, R.N., Jr., Poggio, E D. & Parikh, C.R. Association between delayed graft function and allograft and patient survival: a systematic review and meta-analysis. Nephrol Dial Transplant 24, 1039-1047 (2009).
69. Moers, C, et al. Machine perfusion or cold storage in deceased-donor kidney transplantation. NEnglJMed 36 , 7-19 (2009).
70. Horenstein, A.L., Durelli, I. & Malavasi, F. Purification of Clinical-Grade Monoclonal Antibodies by Chromatographic Methods. In Methods in Molecular Biology P. Therapeutic Proteins: Methods and Protocols (C Mark Smales and David C James., eds), Humana Press, Totowa, NJ, Chapter 16. (2005).
71. Li, R., et al. Characterization of a conformationally sensitive murine monoclonal antibody directed to the metal ion-dependent adhesion site face of integrin CDl lb. J Immunol 168, 1219-1225 (2002).
72. Farris, A.B., et al. Morphometric and visual evaluation of fibrosis in renal biopsies.
Journal of the American Society of Nephrology : JASN 22, 176-186 (2011).
73. Ysebaert, D.K., et al. Identification and kinetics of leukocytes after severe ischaemia/reperfusion renal injury. Nephrol Dial Transplant 15, 1562-1574 (2000).
Claims
1. A method of ameliorating a pathology associated with ischemia reperfusion injury in a subject comprising:
administering to the subject a composition comprising a therapeutically effective amount of polypeptide or antibody that immunospecifically binds the epitope recognized by mabl07.
2. The method of claim 1, wherein the pathology is post-ischemic renal fibrosis.
3. The method of claim 1, wherein the pathology is a kidney fibroinflammatory disease.
4. The method of claim 1, wherein the pathology is pulmonary fibrosis.
5. The method of claim 1, wherein the pathology is post-myocardial infarction left ventricular adverse remodeling.
6. The method of claim 1, wherein the composition is administered to the subject within about 5 hours after the ischemia reperfusion injury.
7. The method of claim 1, wherein is administered to the subject within about 2 hours after the ischemia reperfusion injury.
8. A method of treating a subject having or at risk of developing a disorder associated with ischemia reperfusion injury in an organ comprising:
administering to the subject a composition comprising a therapeutically effective amount of a polypeptide or antibody that immunospecifically binds the epitope recognized by mabl07.
9. The method of claim 8, wherein the organ is a kidney.
10. The method of claim 9, wherein the disorder is acute kidney injury.
11. The method of claim 8, wherein the organ is a heart.
12. The method of claim 11, wherein the disorder is acute coronary syndrome.
13. The method of claim 11, wherein the disorder is acute myocardial infarction (MI).
14. The method of claim 8, wherein the organ is a lung.
15. The method of claim 8, wherein the composition is administered to the subject within about 5 hours after the ischemia reperfusion injury.
16. The method of claim 8, wherein the composition is administered to the subject within about 2 hours after the ischemia reperfusion injury.
17. A method of providing an organ for transplantation, comprising:
administering to an organ donor a composition comprising a polypeptide or antibody that immunospecifically binds the epitope recognized by mabl07; and
harvesting the organ from the organ donor.
18. The method of claim 17, wherein the organ is a kidney, a heart, or a lung.
19. A method of reducing delayed graft function following organ transplantation,
comprising
administering to an organ recipient a therapeutically effective amount of composition comprising a polypeptide that immunospecifically binds the epitope recognized by mabl07 prior to transplantation of the organ to the recipient or within a day of the transplantation,
thereby reducing delayed graft function following organ transplantation.
20. The method of claim 19, wherein the organ is a kidney, a heart, or a lung.
21. A method of treating an organ prior to transplantation into a recipient, comprising contacting the organ with a composition comprising a polypeptide or antibody that immunospecifically binds the epitope recognized by mabl07.
22. The method of claim 21, wherein the organ is a kidney, a heart, or a lung.
23. The method of claim 21, wherein the contacting step comprises perfusing the organ with the composition comprising a polypeptide or antibody that immunospecifically binds the epitope recognized by mabl07.
24. A method of treating a subject having an autoimmune disease comprising
administering to the subject a therapeutically effective amount of composition comprising a polypeptide or antibody that immunospecifically binds the epitope recognized by mabl07.
25. The method of claim 24, wherein the autoimmune disease is cytoplasmic
antineutrophil cytoplasmic antibodies (cANCA)-associated vasculitis.
26. A method of treating a subject having diabetic nephropathy comprising
administering to the subject a therapeutically effective amount of composition comprising a polypeptide or antibody that immunospecifically binds the epitope recognized by mabl07.
27. A method of ameliorating a pathology associated with chemotherapy in a subject comprising
administering to the subject a therapeutically effective amount of composition comprising a polypeptide or antibody that immunospecifically binds the epitope recognized by mabl07.
28. The method of claim 27, wherein the pathology is Adriamycin nephropathy.
29. The method as in any of claims 1-28, wherein the polypeptide or antibody that immunospecifically binds the epitope recognized by mabl07 is mabl07.
30. The method as in any of claims 1-28, wherein the polypeptide or antibody that immunospecifically binds the epitope recognized by mabl07 is humanized.
31. The method as in any of claims 1-28, wherein the polypeptide or antibody that immunospecifically binds the epitope recognized by mabl07 is a single chain variable fragment (scFv).
32. The method as in any of claims 1-28, wherein the polypeptide or antibody that immunospecifically binds the epitope recognized by mabl07 comprises an amino acid sequence that comprises one, two, three, four, five, or six of the following complementarity determining regions (CDR)
1) CDR 1 of the VH of mabl07;
2) CDR 1 of the VL of mabl07;
3) CDR 2 of the VH of mab 107;
4) CDR 2 of the VL of mab 107;
5) CDR3 of the VH of mab 107; and
6) CDR 3 of the VL of mab 107.
33. The method as in any of claims 1-28, wherein the polypeptide or antibody that immunospecifically binds the epitope recognized by mab 107 comprises an amino acid sequence that comprises an amino acid sequence at least 95% identical to an amino acid sequence selected from the group consisting of:
QVQLQQSGAELVKPGASVKLSCTPSGFNIKDIYMQWVKQRPEQGLEWIGRID PA DKTKYDPKFQGK ATITADT S SNTAYLQL S SLT SEDTAVY YC ASEGHYGYD GYAMD YWGQGTT VT VS S (SEQ ID NO: l);
DIEMTQSPSSLGVSVGEKVTMSCKSSQ LLYSSNQKNYLAWYQQKPGQSPKL LIYWASTRESGVPDRFTGTGSGTDFTLTISSVKAEDLAVYYCQQYYSYPLTFG AGTKLELK (SEQ ID NO:2);
VQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARIDP ANDKTRYAD S VKGRFTIS ADT SKNTAYLQMNSLRAEDTAVYYC S SEGHYGYD GYAMD YWGQGTLVT VS S (SEQ ID NO:3);
DIVMSQSPDSLAVSLGERVTLNCKSSQ LLYSSNQKNYLAWYQQKPGQSPKL LIYWASARESGVPDRFSGSGSGTDFTLTISSVQAEDVAVYYCQQYYSYPLTFG AGTKLELK (SEQ ID NO:4); and
MVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARID PA DKTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSSEGHYGY DGYAMDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIVMSQSPDSLAVSLGER VTLNCKSSQ LLYSSNQKNYLAWYQQKPGQSPKLLIYWASARESGVPDRFSG SGSGTDFTLTISSVQAEDVAVYYCQQYYSYPLTFGAGTKLELK (SEQ ID NO: 5).
34. The method of claim 33 wherein the wherein the polypeptide or antibody that
immunospecifically binds the epitope recognized by mabl07 comprises an amino acid sequence that comprises an amino acid sequence at least 95% identical to an amino acid sequence selected from the group consisting of:
QVQLQQSGAELVKPGASVKLSCTPSGFNIKDIYMQWVKQRPEQGLEWIGRID PANDKTK YDPKFQGK ATITADT S SNTAYLQL S SLT SEDTAVY YC ASEGHYGYD GYAMD YWGQGTTVTVSS (SEQ ID NO: l);
DIEMTQSPSSLGVSVGEKVTMSCKSSQNLLYSSNQKNYLAWYQQKPGQSPKL LIYWASTRESGVPDRFTGTGSGTDFTLTISSVKAEDLAVYYCQQYYSYPLTFG AGTKLELK (SEQ ID NO:2);
VQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARIDP ANDKTRYAD S VKGRFTIS APT SKNTAYLQMNSLRAEDTAVYYC S SEGHYGYD GYAMD YWGQGTLVT VSS (SEQ ID NO:3);
DIVMSQSPDSLAVSLGERVTLNCKSSQNLLYSSNQKNYLAWYQQKPGQSPKL LIYWASARESGVPDRFSGSGSGTDFTLTISSVQAEDVAVYYCQQYYSYPLTFG AGTKLELK (SEQ ID NO:4); and
MVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARID PA DKTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSSEGHYGY DGYAMDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIVMSQSPDSLAVSLGE RVTLNCKSSQNLLYSSNQKNYLAWYQQKPGQSPKLLIYWASARESGVPDRF S GS GS GTDFTLTI S S VQ AED VAV Y YCQQ YYSYPLTF GAGTKLELK (SEQ ID
NO: 5), provided that the under lined portions of the sequence are not altered.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US15/553,925 US10738121B2 (en) | 2015-02-27 | 2016-02-29 | Therapeutic use of integrin-binding antibodies |
Applications Claiming Priority (8)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201562121656P | 2015-02-27 | 2015-02-27 | |
| US62/121,656 | 2015-02-27 | ||
| US201562126755P | 2015-03-02 | 2015-03-02 | |
| US62/126,755 | 2015-03-02 | ||
| US201562132642P | 2015-03-13 | 2015-03-13 | |
| US62/132,642 | 2015-03-13 | ||
| US201562134394P | 2015-03-17 | 2015-03-17 | |
| US62/134,394 | 2015-03-17 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2016138538A2 true WO2016138538A2 (en) | 2016-09-01 |
| WO2016138538A3 WO2016138538A3 (en) | 2016-10-20 |
Family
ID=56789800
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2016/020133 Ceased WO2016138538A2 (en) | 2015-02-27 | 2016-02-29 | Therapeutic use of integrin-binding antibodies |
Country Status (2)
| Country | Link |
|---|---|
| US (1) | US10738121B2 (en) |
| WO (1) | WO2016138538A2 (en) |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2022204516A1 (en) * | 2021-03-26 | 2022-09-29 | The General Hospital Corporation | Humanized mab107 |
Families Citing this family (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2024040194A1 (en) | 2022-08-17 | 2024-02-22 | Capstan Therapeutics, Inc. | Conditioning for in vivo immune cell engineering |
| AU2024279278A1 (en) | 2023-05-31 | 2025-12-18 | Capstan Therapeutics, Inc. | Lipid nanoparticle formulations and compositions |
| US20250127728A1 (en) | 2023-10-05 | 2025-04-24 | Capstan Therapeutics, Inc. | Constrained Ionizable Cationic Lipids and Lipid Nanoparticles |
| WO2025076113A1 (en) | 2023-10-05 | 2025-04-10 | Capstan Therapeutics, Inc. | Ionizable cationic lipids with conserved spacing and lipid nanoparticles |
| US20250302763A1 (en) | 2024-02-22 | 2025-10-02 | Capstan Therapeutics, Inc. | Immune engineering amplification |
| WO2025217452A1 (en) | 2024-04-11 | 2025-10-16 | Capstan Therapeutics, Inc. | Constrained ionizable cationic lipids and lipid nanoparticles |
| WO2025217454A2 (en) | 2024-04-11 | 2025-10-16 | Capstan Therapeutics, Inc. | Ionizable cationic lipids and lipid nanoparticles |
Family Cites Families (10)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20050227296A1 (en) * | 1988-06-28 | 2005-10-13 | The General Hospital Corporation, A Massachusetts Corporation | Method for indentifying integrin antagonists |
| GB2266664A (en) * | 1992-04-28 | 1993-11-10 | Pierre Francois Piguet | Monoclonal antibodies for prophylaxis and treatment of pulmonary fibrosis |
| US7435802B2 (en) | 1994-01-25 | 2008-10-14 | Elan Pharaceuticals, Inc. | Humanized anti-VLA4 immunoglobulins |
| US7323552B2 (en) * | 2000-07-31 | 2008-01-29 | The General Hospital Corporation | Variant integrin polypeptides and uses thereof |
| CA2514117A1 (en) | 2003-01-24 | 2004-08-12 | Elan Pharmaceuticals, Inc. | Composition for and treatment of demyelinating diseases and paralysis by administration of remyelinating agents |
| MY162179A (en) * | 2004-04-01 | 2017-05-31 | Elan Pharm Inc | Steroid sparing agents and methods of using same |
| US20100047252A1 (en) | 2006-11-22 | 2010-02-25 | 3M Innovative Properties Company | Antibody with protein a selectivity |
| AU2008347218B2 (en) * | 2007-12-31 | 2015-02-05 | Xoma Technology Ltd. | Methods and materials for targeted mutagenesis |
| US9023876B2 (en) | 2010-07-08 | 2015-05-05 | Adhaere Pharmaceuticals, Inc. | Compounds and methods for regulating integrins |
| CA2882853C (en) * | 2012-04-20 | 2021-11-23 | Vineet Gupta | Compounds and methods for regulating integrins |
-
2016
- 2016-02-29 US US15/553,925 patent/US10738121B2/en active Active
- 2016-02-29 WO PCT/US2016/020133 patent/WO2016138538A2/en not_active Ceased
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2022204516A1 (en) * | 2021-03-26 | 2022-09-29 | The General Hospital Corporation | Humanized mab107 |
| CN117355322A (en) * | 2021-03-26 | 2024-01-05 | 总医院公司 | Humanized mAb107 |
Also Published As
| Publication number | Publication date |
|---|---|
| US10738121B2 (en) | 2020-08-11 |
| WO2016138538A3 (en) | 2016-10-20 |
| US20180244782A1 (en) | 2018-08-30 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US10738121B2 (en) | Therapeutic use of integrin-binding antibodies | |
| US9732149B2 (en) | Treatment of paroxysmal nocturnal hemoglobinuria patients by an inhibitor of complement | |
| RU2662671C2 (en) | Antibody to adrenomedullin (adm) or anti-adm antibody element, or anti-adm he-iq framing for application in therapy | |
| EP3490603A1 (en) | Compositions and methods of inhibiting masp-3 for the treatment of various diseases and disorders | |
| KR20150031298A (en) | Compositions and methods of inhibiting masp-1 and/or masp-2 and/or masp-3 for the treatment of various diseases and disorders | |
| EP2566514A2 (en) | Methods of inhibiting fibrosis using anti-pai-1 antibodies | |
| WO2022271716A2 (en) | Methods of using activin receptor type ii signaling inhibitors | |
| WO2019246367A1 (en) | Compositions and methods of inhibiting masp-2 for the treatment of various thrombotic diseases and disorders | |
| EP3642230A1 (en) | Treatment of inflammatory diseases with inhibitors of c5a activity | |
| TW202140554A (en) | ANTI-αvβ8 INTEGRIN ANTIBODIES FOR USE IN TREATING KIDNEY DISEASE | |
| EP3641802A1 (en) | Methods and pharmaceutical compositions for the treatment of fibrosis with agents capable of inhibiting the activation of mucosal-associated invariant t (mait) cells | |
| US20220372159A1 (en) | Treatment and Prevention of Ischemic Diseases And/Or Ischemic Tissue Damages | |
| US20240366777A1 (en) | Anti-folate receptor conjugate combination therapy with bevacizumab | |
| HK40105220A (en) | Treatment of paroxysmal nocturnal hemoglobinuria patients by an inhibitor of complement | |
| Calvetti | Identification of IL6 mediated molecular Mechanisms and Potential Role of lectin pathway activation in antibody-mediated rejection | |
| TW202515906A (en) | Method of treating stroke | |
| KR20260052059A (en) | Targeted therapy of complement-mediated diseases through local complement inhibition based on urinary uC5b-9 detection | |
| WO2025129254A1 (en) | Composition comprising a cell penetrating, anti-dna binding protein and methods of treatment | |
| Hunze | Generation of recombinant factor H proteins to control alternative pathway activation in the kidney | |
| WO2021030423A1 (en) | Tetranectin-targeting monoclonal antibodies to fight against lethal sepsis and other pathologies | |
| HK1235319A1 (en) | Treatment of paroxysmal nocturnal hemoglobinuria patients by an inhibitor of complement | |
| HK1232786A1 (en) | Treatment of paroxysmal nocturnal hemoglobinuria patients by an inhibitor of complement | |
| AU2013206214A1 (en) | Treatment of paroxysmal nocturnal hemoglobinuria patients by an inhibitor of complement |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 16756559 Country of ref document: EP Kind code of ref document: A2 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 15553925 Country of ref document: US |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 16756559 Country of ref document: EP Kind code of ref document: A2 |
