WO2016122865A1 - Compositions and methods for treating age-related diabetes and related disorders - Google Patents

Compositions and methods for treating age-related diabetes and related disorders Download PDF

Info

Publication number
WO2016122865A1
WO2016122865A1 PCT/US2016/013004 US2016013004W WO2016122865A1 WO 2016122865 A1 WO2016122865 A1 WO 2016122865A1 US 2016013004 W US2016013004 W US 2016013004W WO 2016122865 A1 WO2016122865 A1 WO 2016122865A1
Authority
WO
WIPO (PCT)
Prior art keywords
subject
ftreg
antibody
mice
insulin resistance
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2016/013004
Other languages
French (fr)
Inventor
Sagar P. BAPAT
Ye ZHENG
Ronald Evans
Michael Downes
Annette R. ATKINS
Ruth T. Yu
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Salk Institute for Biological Studies
Original Assignee
Salk Institute for Biological Studies
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Salk Institute for Biological Studies filed Critical Salk Institute for Biological Studies
Priority to US15/544,385 priority Critical patent/US10539572B2/en
Publication of WO2016122865A1 publication Critical patent/WO2016122865A1/en
Anticipated expiration legal-status Critical
Priority to US16/702,870 priority patent/US11428697B2/en
Priority to US17/813,383 priority patent/US12253527B2/en
Ceased legal-status Critical Current

Links

Classifications

    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G01N33/6863Cytokines, i.e. immune system proteins modifying a biological response such as cell growth proliferation or differentiation, e.g. TNF, CNF, GM-CSF, lymphotoxin, MIF or their receptors
    • G01N33/6869Interleukin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/08Drugs for disorders of the metabolism for glucose homeostasis
    • A61P3/10Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2866Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for cytokines, lymphokines, interferons
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q1/00Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
    • C12Q1/68Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q1/00Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
    • C12Q1/68Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
    • C12Q1/6876Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes
    • C12Q1/6883Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for diseases caused by alterations of genetic material
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q2600/00Oligonucleotides characterized by their use
    • C12Q2600/118Prognosis of disease development
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q2600/00Oligonucleotides characterized by their use
    • C12Q2600/158Expression markers
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/435Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
    • G01N2333/705Assays involving receptors, cell surface antigens or cell surface determinants
    • G01N2333/715Assays involving receptors, cell surface antigens or cell surface determinants for cytokines; for lymphokines; for interferons
    • G01N2333/7155Assays involving receptors, cell surface antigens or cell surface determinants for cytokines; for lymphokines; for interferons for interleukins [IL]
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2800/00Detection or diagnosis of diseases
    • G01N2800/04Endocrine or metabolic disorders
    • G01N2800/042Disorders of carbohydrate metabolism, e.g. diabetes, glucose metabolism
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2800/00Detection or diagnosis of diseases
    • G01N2800/50Determining the risk of developing a disease

Definitions

  • Aging and obesity are the two primary etiologies of insulin resistance and diabetes, the defining epidemics of the modern world. While the complex interplay between the immune system and adipose tissue inflammation drives obesity-associated insulin resistance, the underlying mechanisms of aging-associated insulin resistance have yet to be determined. Age-associated insulin resistance is prevalent. In the US alone incidence of diabetes among adults, ages 65-79 years, has significantly increased from 6.9 per 1000 in 1980 to 15.4 per 1000 in 201 1. Over 25% of all Americans over 60 years have type 2 diabetes and more than 50% are insulin resistant. Accordingly, methods of treating age-related insulin resistance, type 2 diabetes and related disorders are urgently needed.
  • the present invention features compositions and methods treating or preventing age-related insulin resistance, type 2 diabetes and related disorders.
  • the method involves depleting fat-resident regulatory T cells (fTregs) cells with an anti-ST2 antibody to decrease age-related fTreg accumulation and restore insulin sensitivity, thereby treating age-related insulin resistance, type 2 diabetes and related disorders.
  • fTregs fat-resident regulatory T cells
  • the invention provides a method of enhancing insulin sensitivity in a cell or tissue, the method involving contacting the cell or tissue with an anti-ST2 antibody or antigen binding fragment thereof, thereby decreasing the number of adipose-resident regulatory T cells (fTreg) and enhancing insulin sensitivity relative to a reference.
  • fTreg adipose-resident regulatory T cells
  • the invention provides a method of reducing insulin resistance in a cell or tissue, the method involving contacting the cell or tissue with an anti-ST2 antibody or antigen binding fragment thereof, thereby decreasing the number of adipose-resident regulatory T cells (fTreg) and reducing insulin resistance relative to a reference.
  • the cell is an adipocyte.
  • the tissue is adipose tissue.
  • the invention provides a method of enhancing insulin sensitivity in a subject, the method involving contacting the subject with an anti-ST2 antibody or antigen binding fragment thereof, thereby decreasing the number of adipose-resident regulatory T cells in the subject and enhancing insulin sensitivity relative to a reference.
  • the invention provides a method of reducing insulin resistance in a subject, the method involving contacting the subject with an anti-ST2 antibody or antigen binding fragment thereof, thereby decreasing the number of adipose-resident regulatory T cells in the subject and reducing insulin resistance relative to a reference.
  • the invention provides a method for treating or preventing age-related insulin resistance, type 2 diabetes and related disorders in a subject, the method involving contacting the subject with an anti-ST2 antibody or antigen binding fragment thereof, thereby treating or preventing age-related insulin resistance, type 2 diabetes and related disorders in a subject.
  • the invention provides a method for treating or preventing age-associated metabolic dysregulation in a subject, the method involving contacting the subject with an anti-ST2 antibody or antigen binding fragment thereof, thereby treating or preventing age-associated metabolic dysregulation in the subject.
  • the invention provides a method for identifying a subject having or at risk of developing age-related insulin resistance, type 2 diabetes and related disorders, the method involving detecting an increase in an ST2 polypeptide or polynucleotide expression in an fTreg or detecting an increase in the number of fTregs relative to a control.
  • the fTreg is present in a tissue biopsy.
  • the tissue biopsy if obtained from visceral adipose tissue.
  • the ST2 polypeptide is detected in an immunoassay.
  • the invention provides a method of reducing insulin resistance in a subject, the method involving administering to the subject an anti-ST2 antibody or antigen binding fragment thereof, wherein the subject is identified as having an increase in an ST2 polypeptide or polynucleotide expression in an fTreg or detecting an increase in the number of fTregs relative to a control.
  • the subject has or is at risk of developing age-related insulin resistance.
  • the invention provides a kit for treating or preventing age-related insulin resistance, the kit containing an effective amount of an ST2 antibody in a
  • the subject is fifty, sixty, or sixty-five, years old or older.
  • the method reduces body weight relative to a reference.
  • the method decreased visceral adipose tissue and/or subcutaneous adipose tissue adiposity relative to a reference.
  • the method increases respiratory exchange ratio, oxygen consumption, and/or core body temperature relative to a reference.
  • the method reduces fasting serum glucose and insulin levels relative to a reference.
  • said method reduces glucose excursions during a glucose tolerance test and/or increases sensitivity during an insulin tolerance test relative to a reference.
  • said method reduces serum non-esterified free fatty acid (NEFA) levels relative to a reference.
  • NEFA serum non-esterified free fatty acid
  • said method increases insulin sensitivity relative to a reference.
  • said method decreases hepatic steatosis relative to a reference.
  • said method decreases fasting hepatic and/or serum triglyceride content.
  • the method does not produce an autoimmune syndrome.
  • said method specifically decreases fTreg numbers while preserving splenic Treg numbers.
  • said method increases the glucose uptake capacity of visceral adipose tissue compared to a reference.
  • the anti-ST2 antibody administration is parenterally.
  • ST2 Interleukin 1 receptor-like 1 protein
  • ST2 Interleukin 1 receptor-like 1 protein
  • ST2 Interleukin 1 receptor-like 1 antibody
  • ST2 Interleukin 1 receptor-like 1 antibody
  • a mouse anti-human ST2 antibody is available, for example, from Novus Biologicals.
  • Other anti-human ST2 antibodies are known in the art (e.g., Palmer et al., Arthritis Rheum, 2009 Mar;60(3):738-49).
  • fTreg fat-resident regulatory T cell
  • fTreg a regulatory T cell that is resident in adipose tissue.
  • an fTreg expresses Foxp3.
  • an fTreg expresses an increased level of ST2 relative to a splenic Treg of fat conventional CD4 +
  • ST2 is at least about 10, 20, 30, 40, 50, or 60 times more highly expressed in an fTreg compared to a splenic Treg.
  • ameliorate is meant decrease, suppress, attenuate, diminish, arrest, or stabilize the development or progression of a disease.
  • agent any small molecule chemical compound, antibody, nucleic acid molecule, or polypeptide, or fragments thereof.
  • an alteration is meant a change (increase or decrease) in the levels or activity of an analyte detected by standard art known methods such as those described herein.
  • an alteration includes a 10% change in analyte levels, preferably a 25% change, more preferably a 40% change, and most preferably a 50% or greater change in analyte levels.
  • an analyte is a cell, such as a fat regulatory T cells (fTreg).
  • analog is meant a molecule that is not identical, but has analogous functional or structural features.
  • a polypeptide analog retains the biological activity of a corresponding naturally-occurring polypeptide, while having certain biochemical
  • An analog may include an unnatural amino acid.
  • biopsy is meant a test involving sampling of cells or tissues for examination by removing tissue from a living subject to determine the presence or extent of a disease.
  • biopsies include removal of visceral adipose tissues or cells.
  • Detect refers to identifying the presence, absence or amount of the analyte to be detected.
  • disease is meant any condition or disorder that damages or interferes with the normal function of a cell, tissue, or organ.
  • diseases include age-related insulin resistance, type 2 diabetes and related disorders.
  • Related disorders include metabolic disorders characterized by an increase in the number of ITregs.
  • effective amount is meant the amount of an agent of the invention (e.g., antibody or antigen binding fragment thereof) required to ameliorate the symptoms of a disease relative to an untreated patient.
  • an effective amount is the amount required to significantly reduce the number of fat-resident regulatory T cells in a adipose tissue relative to the number present in an untreated control.
  • the effective amount of active agent used to practice the present invention for therapeutic treatment of a disease varies depending upon the manner of administration, the age, body weight, and general health of the subject. Ultimately, the attending physician or veterinarian will decide the appropriate amount and dosage regimen. Such amount is referred to as an "effective" amount.
  • fragment is meant a portion of a polypeptide or nucleic acid molecule. This portion contains, preferably, at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90% of the entire length of the reference nucleic acid molecule or polypeptide.
  • a fragment may contain 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100, 200, 300, 400, 500, 600, 700, 800, 900, or 1000 nucleotides or amino acids.
  • isolated refers to material that is free to varying degrees from components which normally accompany it as found in its native state.
  • Isolate denotes a degree of separation from original source or surroundings.
  • Purify denotes a degree of separation that is higher than isolation.
  • a “purified” or “biologically pure” protein is sufficiently free of other materials such that any impurities do not materially affect the biological properties of the protein or cause other adverse consequences. That is, a nucleic acid or peptide of this invention is purified if it is substantially free of cellular material, viral material, or culture medium when produced by recombinant DNA techniques, or chemical precursors or other chemicals when chemically synthesized.
  • Purity and homogeneity are typically determined using analytical chemistry techniques, for example, polyacrylamide gel electrophoresis or high performance liquid chromatography.
  • the term "purified" can denote that a nucleic acid or protein gives rise to essentially one band in an electrophoretic gel.
  • modifications for example, phosphorylation or glycosylation, different modifications may give rise to different isolated proteins, which can be separately purified.
  • isolated polynucleotide is meant a nucleic acid (e.g., a DNA) that is free of the genes which, in the naturally-occurring genome of the organism from which the nucleic acid molecule of the invention is derived, flank the gene.
  • the term therefore includes, for example, a recombinant DNA that is incorporated into a vector; into an autonomously replicating plasmid or virus; or into the genomic DNA of a prokaryote or eukaryote; or that exists as a separate molecule (for example, a cDNA or a genomic or cDNA fragment produced by PCR or restriction endonuclease digestion) independent of other sequences.
  • the term includes an RNA molecule that is transcribed from a DNA molecule, as well as a recombinant DNA that is part of a hybrid gene encoding additional polypeptide sequence.
  • an “isolated polypeptide” is meant a polypeptide of the invention that has been separated from components that naturally accompany it.
  • the polypeptide is isolated when it is at least 60%, by weight, free from the proteins and naturally-occurring organic molecules with which it is naturally associated.
  • the preparation is at least 75%, more preferably at least 90%, and most preferably at least 99%, by weight, a polypeptide of the invention.
  • An isolated polypeptide of the invention may be obtained, for example, by extraction from a natural source, by expression of a recombinant nucleic acid encoding such a polypeptide; or by chemically synthesizing the protein. Purity can be measured by any appropriate method, for example, column chromatography, polyacrylamide gel electrophoresis, or by HPLC analysis.
  • obtaining as in “obtaining an agent” includes synthesizing, purchasing, or otherwise acquiring the agent.
  • reference is meant a standard or control condition.
  • binds is meant a compound or antibody that recognizes and binds a polypeptide of the invention, but which does not substantially recognize and bind other molecules in a sample, for example, a biological sample, which naturally includes a polypeptide of the invention.
  • subject is meant a mammal, including, but not limited to, a human or non- human mammal, such as a bovine, equine, canine, ovine, or feline.
  • Ranges provided herein are understood to be shorthand for all of the values within the range.
  • a range of 1 to 50 is understood to include any number, combination of numbers, or sub-range from the group consisting 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31 , 32, 33, 34, 35, 36, 37, 38, 39, 40, 41 , 42, 43, 44, 45, 46, 47, 48, 49, or 50.
  • treat refers to reducing or ameliorating a disorder and/or symptoms associated therewith. It will be appreciated that, although not precluded, treating a disorder or condition does not require that the disorder, condition or symptoms associated therewith be completely eliminated.
  • the term "about” is understood as within a range of normal tolerance in the art, for example within 2 standard deviations of the mean. About can be understood as within 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, 0.5%, 0.1%, 0.05%, or 0.01% of the stated value. Unless otherwise clear from context, all numerical values provided herein are modified by the term about.
  • compositions or methods provided herein can be combined with one or more of any of the other compositions and methods provided herein.
  • Figures 1A-1 C are a schematic and pie charts showing that fTregs were selectively enriched in aged mice.
  • Figure 1 A is a schematic showing pthe etiologies for obesity- versus age-related insulin resistance in mice.
  • VAT visceral adipose tissue
  • AIP adipo-immune profiles
  • Immune cells abundance expressed as percentage of CD45.2 + cells.
  • Figure 1C is a bar graph comparing changes in immune cell abundance between indicated groups, expressed as fold change in cell number per gram of VAT.
  • FIGS. 2A-2C are 12 scatter plots showing selected gating strategies used to generate adipolmmune Profiles (AIPs) - Adipolmmune Profiles were generated through the use of several distinct antibody cocktails.
  • AIPs adipolmmune Profiles
  • Figures 2A-2C using Foxp3 Cre"YFP reporter mice, show how the stromal vascular fraction of visceral adipose tissue (VAT) was analyzed by flow cytometry to identify several T cell subtypes (Figure 2A), macrophage subsets ( Figure 2B), and eosinophils and neutrophils (Figure 2C).
  • VAT visceral adipose tissue
  • Figures 3 A-3H are scatter plots, linear, and bar graphs showing that fTreg knock out (KO) mice were protected from general hallmarks of metabolic aging.
  • Figure 3 A is a scatter plot showing representative Fluorescence Activated Cell Sorting (FACS) plots of fTreg KO (Foxp3 Cre PPARg tl/n ) and control (Foxp3 Cre PPARg +/+ ) mice depicting Treg enrichment in visceral adipose tissue (VAT) and spleen.
  • Figure 3H is a scatter plot showing principal component analysis of non-macrophage adipolmmune Profiles (AIPs) of young (12 weeks), aged ( ⁇ 15 months) and aged-fTreg KO ( ⁇ 15 months) mice. Data represents mean ⁇ s.e.m. *p ⁇ 0.05, **p ⁇ 0.01 , ***p ⁇ 0.001 , *** *p ⁇ 0.0001.
  • Figures 4A and 4B are pie charts and a bar graph showing visceral adipose tissue (VAT) adipolmmune Profiles (AIPs) of aged fTreg KO and control mice.
  • Figures 5A and 5B are two bar graphs showing subcutaneous adipose tissue (SAT) adipolmmune and spleen immune profiles of fTreg KO and control mice.
  • Figures 6A-6D are bar graphs and histological images showing that aged fTreg KO mice did not show signs of systemic autoimmunity or breakdown in peripheral tolerance.
  • Figure 6C is a bar graph comparing the histopathology score in the small intestine and colon of fTreg KO and control mice. The severity and extent of inflammation and epithelial changes as well as mucosal architecture were each graded on a score of 1 (minimal) to 5 (severe) and added to obtain an overall score over 20. There were minimal inflammatory changes with no significant differences between groups.
  • Figures 7A-7P are linear and bar graphs and histological images showing that loss of fTregs protected against the clinical hallmarks of age-associated insulin resistance.
  • VAT visceral adipose tissue
  • H&E hematoxylin and eosin
  • Figure 7L is a bar graph showing representative images of
  • Figure 8 is a bar graph comparing body weights of weight-matched cohorts of control and fTreg KO young, aged, and obese mice.
  • DIO diet- induced obese
  • HFD high fat diet
  • Figures 9A and 9B are pie charts and a bar graph showing visceral adipose tissue
  • FIGS. 9A and 9B are pie charts of adipolmmune profiles of obese fTreg KO and control mice.
  • Figure 10 includes two pie charts showing frequency of small, medium, and large adipocytes in visceral adipose tissue (VAT) of aged control and fTreg KO mice.
  • VAT visceral adipose tissue
  • Figures 1 1 A and 1 IB depict an R A-Seq analysis heat map and a scatter plot of fTreg gene expression.
  • Figure 1 1 A is a heat map showing expression of several canonical Treg genes across fat and splenic Tregs and fat and splenic Tconv cells. Cells were pooled from 3 and 4 mice before isolating RNA for subsequent RNA-Seq analysis.
  • Figure 1 IB is a scatter plot comparing expression of ST2 across all hematopoietic cells catalogued in the Immunological Genome Project database. Position of adipose CD4 + CD25 + T cells is marked.
  • Figures 12A-12I are heat maps and graphs showing that fTreg depletion improved adipose glucose uptake.
  • Figures 12A and 12B are a heat map and a scatter plot showing hierarchical clustering of differentially expressed genes between fat Tregs and Tconv and splenic Tregs and Tconv cells (Figure 12 A), and fold change in expression levels of differentially expressed genes (Figure 12B) across fat Tregs and Tconv and splenic Tregs and Tconv cells from Foxp3-Thyl . l mice (47 weeks, cells pooled from 3 to 4 mice). Fat Treg cluster genes are labeled in red. Position of ST2 is marked.
  • Figure 12F is a line graph of FACS histograms
  • Figure 12G is a bar graph showing quantification of Tregs (%Foxp3 + of CD45 + CD4 + population)
  • Figure 12J is a bar graph showing percentages of CD4 + , fTreg, and CD4 + Tconv cells in VAT
  • Figure 12L is schematic of an adipo-immune model of metabolic aging. Data represents mean ⁇ s.e.m. *p ⁇ 0.05, **p ⁇ 0.01.
  • Figures 13A-13C are three bar graphs showing that depleting anti-ST2 antibody treatment does not promote T cell activation associated with systemic Treg-dysfunction.
  • Figure 13 A is a bar graph comparing total weight before beginning course of anti-ST2 or isotype control antibodies (Day 0) and upon terminal analysis.
  • the present invention features compositions and methods for treating or preventing age-related insulin resistance, type 2 diabetes and related disorders.
  • the method involves depleting fTreg cells with an anti-ST2 antibody to decrease age-related fTreg accumulation and restore insulin sensitivity, thereby treating age-related insulin resistance, type 2 diabetes and related disorders.
  • the invention is based, at least in part, on the discovery that adipose (fat)-resident regulatory T cells (fTregs) accumulate in adipose tissue as a function of age, and their accumulation in adipose is a driver of age-associated insulin resistance.
  • fTregs adipose-resident regulatory T cells
  • ST2 antibodies depleted fTregs while preserving splenic Treg numbers. Additionally adipose from aged mice treated with anti-ST2 antibody had increased insulin sensitivity compared to controls.
  • Age-associated insulin resistance and obesity-associated insulin resistance are two physiologically distinct forms of adult onset diabetes. While macrophage-driven
  • the immune system is complex, and the relative populations of different immune cells within adipose tissue are essentially uncharacterized.
  • FACS Fluorescence activated cell sorting
  • Fat-resident regulatory T cells termed fTregs, drove age-associated insulin resistance and can be specifically depleted to increase adipose insulin sensitivity.
  • the invention provides methods featuring an anti-ST2 antibody for enhancing insulin sensitivity in adipose tissue, and treating age-related insulin resistance, type 2 diabetes and related disorders.
  • Antibodies that selectively bind ST2 are useful in the methods of the invention. Methods of preparing antibodies are well known to those of ordinary skill in the science of immunology.
  • the term “antibody” means not only intact antibody molecules, but also fragments of antibody molecules that retain immunogen-binding ability. Such fragments are also well known in the art and are regularly employed both in vitro and in vivo. Accordingly, as used herein, the term “antibody” means not only intact immunoglobulin molecules but also the well-known active fragments F(ab')2, and Fab.
  • the antibodies of the invention comprise whole native antibodies, bispecific antibodies; chimeric antibodies; Fab, Fab', single chain V region fragments (scFv), fusion polypeptides, and unconventional antibodies.
  • Unconventional antibodies include, but are not limited to, nanobodies, linear antibodies (Zapata et al, Protein Eng. 8(10): 1057-1062,1995), single domain antibodies, single chain antibodies, and antibodies having multiple valencies (e.g., diabodies, tribodies, tetrabodies, and pentabodies).
  • Nanobodies are the smallest fragments of naturally occurring heavy-chain antibodies that have evolved to be fully functional in the absence of a light chain. Nanobodies have the affinity and specificity of conventional antibodies although they are only half of the size of a single chain Fv fragment. The consequence of this unique structure, combined with their extreme stability and a high degree of homology with human antibody frameworks, is that nanobodies can bind therapeutic targets not accessible to conventional antibodies.
  • Recombinant antibody fragments with multiple valencies provide high binding avidity and unique targeting specificity to cancer cells.
  • These muitimeric scFvs e.g., diabodies, tetrabodies
  • Power et al (Generation of recombinant muitimeric antibody fragments for tumor diagnosis and therapy. Methods Mol Biol, 207, 335-50, 2003); and Wu et al. (Anti-carcinoembryonic antigen (CEA) diabody for rapid tumor targeting and imaging. Tumor Targeting, 4, 47-58, 1999).
  • CEA Anti-carcinoembryonic antigen
  • Bispecific antibodies produced using leucine zippers are described by Kostelny et al. (J. Immunol. 148(5): 1547-1553, 1992). Diabody technology is described by Hollinger et al. (Proc. Natl. Acad. Sci. USA 90:6444-6448, 1993). Another strategy for making bispecific antibody fragments by the use of single-chain Fv (sFv) diners is described by Gruber et al. (J. Immunol. 152:5368, 1994). Trispecific antibodies are described by Tutt et al. (J. Immunol. 147:60, 1991).
  • Single chain Fv polypeptide antibodies include a covalently linked VH::VL heterodimer which can be expressed from a nucleic acid including VR- and VL-encoding sequences either joined directly or joined by a peptide-encoding linker as described by Huston, et al. (Proc. Nat. Acad. Sci. USA, 85:5879-5883, 1988). See, also, U.S. Patent Nos. 5,091 ,513, 5,132,405 and 4,956,778; and U.S. Patent Publication Nos. 20050196754 and 20050196754.
  • an antibody that binds ST2 is monoclonal.
  • the anti- ST2 antibody is a polyclonal antibody.
  • the preparation and use of polyclonal antibodies are also known the skilled artisan.
  • the invention also encompasses hybrid antibodies, in which one pair of heavy and light chains is obtained from a first antibody, while the other pair of heavy and light chains is obtained from a different second antibody. Such hybrids may also be formed using humanized heavy and light chains. Such antibodies are often referred to as "chimeric" antibodies.
  • intact antibodies are said to contain "Fc” and "Fab” regions.
  • the Fc regions are involved in complement activation and are not involved in antigen binding.
  • An antibody from which the Fc' region has been enzymatically cleaved, or which has been produced without the Fc' region, designated an "F(ab ) 2 " fragment retains both of the antigen binding sites of the intact antibody.
  • an antibody from which the Fc region has been enzymatically cleaved, or which has been produced without the Fc region designated an "Fab"' fragment, retains one of the antigen binding sites of the intact antibody.
  • Fabjzi fragments consist of a covalently bound antibody light chain and a portion of the antibody heavy chain, denoted "Fd.”
  • the Fd fragments are the major determinants of antibody specificity (a single Fd fragment may be associated with up to ten different light chains without altering antibody specificity). Isolated Fd fragments retain the ability to specifically bind to immunogenic epitopes.
  • Antibodies can be made by any of the methods known in the art utilizing ST2 polypeptide, or immunogenic fragments thereof, as an immunogen.
  • One method of obtaining antibodies is to immunize suitable host animals with an immunogen and to follow standard procedures for polyclonal or monoclonal antibody production.
  • the immunogen will facilitate presentation of the immunogen on the cell surface.
  • Immunization of a suitable host can be carried out in a number of ways. Nucleic acid sequences encoding an ST2 polypeptide or immunogenic fragments thereof, can be provided to the host in a delivery vehicle that is taken up by immune cells of the host. The cells will in turn express the receptor on the cell surface generating an immunogenic response in the host. Alternatively, nucleic acid sequences encoding a ST2 polypeptide, or immunogenic fragments thereof, can be expressed in cells in vitro, followed by isolation of the receptor and administration of the receptor to a suitable host in which antibodies are raised.
  • antibodies against an ST2 polypeptide may, if desired, be derived from an antibody phage display library.
  • a bacteriophage is capable of infecting and reproducing within bacteria, which can be engineered, when combined with human antibody genes, to display human antibody proteins.
  • Phage display is the process by which the phage is made to 'display' the human antibody proteins on its surface. Genes from the human antibody gene libraries are inserted into a population of phage. Each phage carries the genes for a different antibody and thus displays a different antibody on its surface.
  • Antibodies made by any method known in the art can then be purified from the host.
  • Antibody purification methods may include salt precipitation (for example, with ammonium sulfate), ion exchange chromatography (for example, on a cationic or anionic exchange column preferably run at neutral pH and eluted with step gradients of increasing ionic strength), gel filtration chromatography (including gel filtration HPLC), and chromatography on affinity resins such as protein A, protein G, hydroxyapatite, and anti-immunoglobulin.
  • Antibodies can be conveniently produced from hybridoma cells engineered to express the antibody. Methods of making hybridomas are well known in the art.
  • the hybridoma cells can be cultured in a suitable medium, and spent medium can be used as an antibody source. Polynucleotides encoding the antibody of interest can in turn be obtained from the hybridoma that produces the antibody, and then the antibody may be produced synthetically or recombinantly from these DNA sequences. For the production of large amounts of antibody, it is generally more convenient to obtain an ascites fluid.
  • the method of raising ascites generally comprises injecting hybridoma cells into an immunologically naive histocompatible or immunotolerant mammal, especially a mouse. The mammal may be primed for ascites production by prior administration of a suitable composition (e.g., Pristane).
  • a suitable composition e.g., Pristane
  • Monoclonal antibodies (Mabs) produced by methods of the invention can be any monoclonal antibodies (Mabs) produced by methods of the invention.
  • Humanized antibodies by methods known in the art. “Humanized” antibodies are antibodies in which at least part of the sequence has been altered from its initial form to render it more like human immunoglobulins. Techniques to humanize antibodies are particularly useful when non- human animal (e.g., murine) antibodies are generated. Examples of methods for humanizing a murine antibody are provided in U.S. patents 4,816,567, 5,530, 101 , 5,225,539, 5,585,089, 5,693,762 and 5,859,205.
  • the present invention features diagnostic assays for the detection of age-related insulin resistance, type 2 diabetes and related disorders or the propensity to develop such conditions.
  • levels of ST2 polypeptides and/or polynucleotides are measured in a subject sample (e.g., adipose tissue, fTregs) and used as an indicator of age- related insulin resistance, type 2 diabetes and related disorders or the propensity to develop such conditions.
  • the number of fTregs are measured in a subject sample (e.g., adipose tissue) and used as an indicator of age-related insulin resistance, type 2 diabetes and related disorders or the propensity to develop such conditions.
  • Detection of an increase in an ST2 polypeptide or polynucleotide expression in an fTreg or detecting an increase in the number of fTregs in the sample relative to a control is indicative of age-related insulin resistance, type 2 diabetes and related disorders or the propensity to develop such conditions.
  • Standard methods may be used to measure levels of ST2 polypeptides and/or polynucleotides in fTregs. Such methods include immunoassay, ELISA, western blotting using an anti-ST2 antibody, and radioimmunoassay. Methods for measuring the number of fTregs present in a sample are known in the art and described herein below (e.g., using adipose immune profiling).
  • kits that comprises an antibody or other means for detecting an ST2 polypeptide.
  • the kits includes instructions for the use of the kit in the methods of the invention.
  • the kit further comprises reagents, equipment (test tubes, reaction vessels, needles, syringes, etc.).
  • the instructions provided in a kit according to the invention may be directed to suitable operational parameters in the form of a label or a separate insert.
  • the kit may further comprise a standard or control information so that the test sample can be compared with the control information standard to determine whether a consistent result is achieved.
  • Example 1 Age-associated insulin resistance was driven by fTregs.
  • AIP anti-inflammatory M2 adipose tissue macrophages
  • eosinophils In contrast to the decrease in anti-inflammatory M2 adipose tissue macrophages (ATMs) and eosinophils observed in obesity-driven insulin resistance, AIP revealed that these cell populations were largely unperturbed in visceral adipose tissue from aged mice (M2 ATMs - aged: 33.6 ⁇ 3.8%, young: 29.8 ⁇ 4.1%, obese: 22.9 ⁇ 6.3%; eosinophils - aged: 4.4% ⁇ 1.6%, young: 4.7% ⁇ 0.7%, obese: 0.8% ⁇ 1.0%, Figure IB).
  • Example 2 Adipolmmune profiles of control and fTreg KO mice looked nearly identical.
  • Tregs fat-resident regulatory T cells
  • Foxp3 Pparg m mice were utilized in which Tregs were selectively depleted from visceral adipose tissue (fTreg KO mice, Figure 3A, Figures 4A and 4B, Cipoletta et al., Nature. doi: 10.1038/naturel 1 132, 2012) without significantly altering the immune profiles of subcutaneous adipose tissue or spleen ( Figures 5 A and 5B).
  • the visceral adipose tissue -specific loss of fTregs did not elicit any overt signs of systemic inflammation generally associated with Treg dysfunction.
  • Example 3 fTreg KO mice were protected against age-associated, but not obesity- associated insulin resistance
  • Example 4 Hallmarks of insulin resistance were attenuated in fTreg KO mice compared to age-matched controls
  • fTregs are functionally distinct from splenic Tregs and more highly express the IL-33 receptor ST2 than splenic Tregs or conventional CD4 + T (Tconv) cells.
  • fTregs clustered more closely with fat conventional CD4 + T cells than splenic Tregs ( Figure 12A), indicating that the functional specification of fTregs was informed by their anatomical location within adipose tissue, as well as the expression of the Treg lineage-specifying transcription factor Foxp3. It was posited that the transcriptional differences between fTregs and splenic Tregs (found in the fTreg cluster of 1049 genes) might provide a therapeutic avenue to selectively manipulate fTreg populations.
  • the IL-33 receptor ST2 which lies within the fTreg cluster, had been recently implicated in effector Treg and in particular fTreg development (Vasanthakumar et al., Nat Immunol 1-12. doi: 10.1038/ni.3085), 2015; Schiering, C. et al., Nature 513, 564- 568, 2014). Indeed, ST2 was -60 and -30 times more highly expressed in fTregs compared to splenic Tregs and fat conventional CD4 + T cells, respectively, consistent with the ImmGen database (website of the Immunological Genome Project), ( Figure 12B and Figure 1 IB).
  • mice were initially injected with IL-33 (0.5 mg intraperitoneally (i.p.) on days 0, 2, 4) to expand the fat-resident regulatory T cell (fTreg) population ( Figures 12F-12H).
  • IL2/anti-IL2 treatment mice injected with IT-33 displayed signs of insulin resistance (basal glucose uptake in visceral adipose tissue reduced to -60% of control mice, Figure 121).
  • acute treatment with an anti-ST2 antibody 200 mg/mouse i.p. on days 0 and 2 was able to partially deplete fTregs (Figure 12J).
  • mice All mice were bred or housed in specific pathogen-free facilities at The Salk Institute for Biological Studies or purchased from Taconic Biosciences. C57BL/6NTac and
  • 129S6/SvEvTac mice were purchased from Taconic Biosciences for comparative adipo- immune profiling (AIP).
  • Age-matched retired breeders were purchased for AIP of aged adipose, and DIO C57BL/6NTac mice were purchased for profiling of obese adipose.
  • fTreg KO mice were generated by crossing B6.129(Cg)-Foxp3 tm4(YFP/cre)Ay 7J (Rubtsov, Y. P. et al., Immunity 28, 546-558, 2008) and B6.129-Pparg tm2Rev /J (He et al., PNAS 100, 15712-15717, 2003) mice.
  • mice were utilized when isolating Tregs and conventional CD4 + T cells from spleen and fat for subsequent RNA-Seq analysis.
  • Mice within The Salk Institute for Biological Studies received autoclaved normal chow (MI laboratory rodent diet 5001 , Harlan Teklad) or autoclaved HFD (60 kcal% fat, Research Diets). All mice used for studies were male.
  • Adipo-immune profiling (AIP) Adipo-immune profiling
  • Visceral (epididymal) and subcutaneous (inguinal) adipose depots were dissected from mice after lOmL PBS perfusion through left ventricle. Inguinal lymph nodes resident in inguinal adipose were removed. Adipose was minced into fine pieces (2-5mm ) and digested in adipocyte isolation buffer (l OOmM HEPES pH7.4, 120mM NaCl, 50mM KC1, 5mM glucose, ImM CaC12, 1.5% BSA) containing lmg/ml collagenase at 37°C with intermittent shaking for 1.5 hours. The suspension was then passed through a 100 ⁇ mesh to remove undigested clumps and debri.
  • adipocyte isolation buffer l OOmM HEPES pH7.4, 120mM NaCl, 50mM KC1, 5mM glucose, ImM CaC12, 1.5% BSA
  • the flowthrough was allowed to stand for 10 minutes to separate the floating adipocyte fraction and infranatant containing the stromal vascular fraction.
  • the infranatant was removed while minimally disturbing the floating adipocyte fraction and centrifuged at 400g for 10 minutes.
  • the pellet containing the stromal vascular fraction was washed once in lOmL RPMI.
  • the resultant isolated cells were subjected to Fluorescence Activated Cell Sorting (FACS) analysis.
  • FACS Fluorescence Activated Cell Sorting
  • Body composition was measured with an ECHO ® MRI-100 body composition analyzer (ECHO MEDICAL SYSTEMS ® ).
  • Visceral adipose tissue VAT (epididymal adipose) was dissected, and the wet weight was determined.
  • Adipose tissues were fixed in 10% formalin, sectioned, and stained in hematoxylin and eosin. An adipocyte cross-sectional area was determined from photomicrographs of VAT using ImageJ.
  • C02 production, 02 consumption, and ambulatory counts were determined for at least three consecutive days and nights after at least 24 hours for adaptation before data recording.
  • PC A Principal component analysis
  • Non-macrophage immune cell populations described as percent of the total CD45.2 + immune compartment, were inputted into Metabo Analyst 3.0 (a comprehensive tool suite for metabolomic data analysis) for principal component analysis (PCA). No normalizations, transformations, or scalings were implemented. Glucose homeostasis studies
  • GTTs glucose tolerance tests
  • ITTs insulin tolerance tests
  • Sections (4 mm) of fixed tissues were stained with haematoxylin and eosin according to standard procedures. Histopathological scores were graded on blinded samples for severity and extent of inflammation and morphological changes by a pathologist.
  • mice were single housed, and core body temperature was measured with a clinical rectal thermometer (THERMALERTTM model TH-5; PHYSITEMP ® ) at 1 :30PM.
  • the probe was dipped in a room temperature lubricating glycerol before insertion.
  • Adipose was dissected from mouse, cut into small pieces with scissors, washed and incubated for 30 minutes with Krebs-Ringer Bicarbonate HEPES buffer (KRBH, 120 mM NaCl, 4 mM KH 2 P0 4 , 1 mM MgS0 4 , 0.75 mM CaCl 2 , 30 mM Hepes, 10 mM NaHC0 3 , pH 7.4, supplemented with 1 % fatty-acid free BSA).
  • Krebs-Ringer Bicarbonate HEPES buffer KRBH, 120 mM NaCl, 4 mM KH 2 P0 4 , 1 mM MgS0 4 , 0.75 mM CaCl 2 , 30 mM Hepes, 10 mM NaHC0 3 , pH 7.4, supplemented with 1 % fatty-acid free BSA.
  • 2-DG 2-deoxy-D-glucose
  • IL-2-anti-IL-2 complexes were prepared by incubating 2 ⁇ g of murine IL-2 (Biolegend) with 10 ⁇ g of anti-IL-2 antibody (JES6.1, BIOXCELL ® ) in a total volume of 200 ⁇ , of PBS for 30 minutes at 37°C (amounts given per injection). Mice were injected intraperitoneally (i.p.) three times (days 0,1 , 2) and analyzed on day 8. For IL-33 expansion assays, mice were injected i.p. with 0.5 ⁇ g of recombinant murine IL-33 in PBS (R&D SYSTEMS ® ) three times (days 0, 2, 4) and analyzed on day 6. PBS was used for control injections.
  • TRUSEQ ® RNA sample preparation kit v2 (ILLUMINA ® ) according to the manufacturer's protocol. Briefly, mRNA was purified, fragmented and used for first- and second-strand cDNA synthesis followed by adenylation of 3' ends. Samples were ligated to unique adaptors and subjected to PCR amplification. Libraries were then validated using the 2100
  • BIOANALYZER ® AGILENT ®
  • BIOANALYZER ® AGILENT ®
  • RNA-Seq libraries prepared from two biological replicates for each experimental condition were sequenced on the ILLUMINA ® HISEQ ® 2500 using barcoded multiplexing and a 100-bp read length.
  • Transcript expression was calculated as gene-level relative abundance in fragments per kilobase of exon model per million mapped fragments and employed correction for transcript abundance bias (Roberts et al., Bioinformatics 27, 2325-2329, 201 1 ). RNA-Seq results for genes of interest were also explored visually using the UCSC Genome Browser.
  • Hierarchical Clustering Differentially expressed gene names and corresponding fragments per kilobase of exon per million fragments mapped (FPKM) values across samples were inputted into GENE-E (Broad Institute) for hierarchical clustering analysis (implemented one minus pearson correlation for sample and gene distance metrics and the average linkage method) and visualization. Gene cluster names were created to describe the gene expression characteristics within each cluster (i.e. Fat-Residence Cluster refers to the gene cluster whose genes were expressed at greater levels in T cells residing in fat. Fat-Treg Cluster refers to the gene cluster whose genes were expressed highest in only the fTregs.)
  • Fat-Residence Cluster refers to the gene cluster whose genes were expressed at greater levels in T cells residing in fat.
  • Fat-Treg Cluster refers to the gene cluster whose genes were expressed highest in only the fTregs.
  • Fluorescence Activated Cell Sorting (FACS) antibody for ST2 was purchased from MD BIOPRODUCTS ® , clone DJ8. Mice were injected intraperitoneally (i.p.) with 200 ⁇ g depleting anti-ST2 antibodies (Monticelli et al, Nat Immunol 12, 1045-1054, 2011 ; R&D ® systems, clone 245707) or isotype control (BIOXCELL ® ) twice (days 0, 2) and sacrificed for analysis on day 3. Statistical analyses

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Engineering & Computer Science (AREA)
  • Organic Chemistry (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Biochemistry (AREA)
  • Hematology (AREA)
  • Analytical Chemistry (AREA)
  • Microbiology (AREA)
  • Genetics & Genomics (AREA)
  • Biomedical Technology (AREA)
  • Urology & Nephrology (AREA)
  • Physics & Mathematics (AREA)
  • Biotechnology (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biophysics (AREA)
  • Cell Biology (AREA)
  • Diabetes (AREA)
  • Pathology (AREA)
  • Food Science & Technology (AREA)
  • General Physics & Mathematics (AREA)
  • General Engineering & Computer Science (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Endocrinology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Emergency Medicine (AREA)
  • Obesity (AREA)
  • Mycology (AREA)

Abstract

The invention features compositions and methods treating or preventing for age-related insulin resistance, type 2 diabetes and related disorders. The method involves depleting fTreg cells with an anti-ST2 antibody to decrease age-related fTreg accumulation and restore insulin sensitivity, thereby treating age-related insulin resistance, type 2 diabetes and related disorders.

Description

COMPOSITIONS AND METHODS FOR TREATING AGE-RELATED DIABETES
AND RELATED DISORDERS
CROSS-REFERENCE TO RELATED APPLICATION
This application claims priority to U.S. Provisional Patent Application Serial Nos. 62/1 10,349, filed January 30, 2015 and 62/154,652, filed April 29, 2015. The entire content of these applications are hereby incorporated by reference herein.
STATEMENT OF RIGHTS TO INVENTIONS MADE UNDER FEDERALLY
SPONSORED RESEARCH
This work was supported by the following grants from the National Institutes of Health, Grant Nos: 5 F30 DK096929-03; HL088093; and HL105278. The government has certain rights in the invention.
BACKGROUND OF THE INVENTION
Aging and obesity are the two primary etiologies of insulin resistance and diabetes, the defining epidemics of the modern world. While the complex interplay between the immune system and adipose tissue inflammation drives obesity-associated insulin resistance, the underlying mechanisms of aging-associated insulin resistance have yet to be determined. Age-associated insulin resistance is prevalent. In the US alone incidence of diabetes among adults, ages 65-79 years, has significantly increased from 6.9 per 1000 in 1980 to 15.4 per 1000 in 201 1. Over 25% of all Americans over 60 years have type 2 diabetes and more than 50% are insulin resistant. Accordingly, methods of treating age-related insulin resistance, type 2 diabetes and related disorders are urgently needed.
SUMMARY OF THE INVENTION
As described herein below, the present invention features compositions and methods treating or preventing age-related insulin resistance, type 2 diabetes and related disorders. The method involves depleting fat-resident regulatory T cells (fTregs) cells with an anti-ST2 antibody to decrease age-related fTreg accumulation and restore insulin sensitivity, thereby treating age-related insulin resistance, type 2 diabetes and related disorders.
In one aspect, the invention provides a method of enhancing insulin sensitivity in a cell or tissue, the method involving contacting the cell or tissue with an anti-ST2 antibody or antigen binding fragment thereof, thereby decreasing the number of adipose-resident regulatory T cells (fTreg) and enhancing insulin sensitivity relative to a reference.
In another aspect, the invention provides a method of reducing insulin resistance in a cell or tissue, the method involving contacting the cell or tissue with an anti-ST2 antibody or antigen binding fragment thereof, thereby decreasing the number of adipose-resident regulatory T cells (fTreg) and reducing insulin resistance relative to a reference. In various embodiments, the cell is an adipocyte. In various embodiments, the tissue is adipose tissue.
In yet another aspect, the invention provides a method of enhancing insulin sensitivity in a subject, the method involving contacting the subject with an anti-ST2 antibody or antigen binding fragment thereof, thereby decreasing the number of adipose-resident regulatory T cells in the subject and enhancing insulin sensitivity relative to a reference.
In still another aspect, the invention provides a method of reducing insulin resistance in a subject, the method involving contacting the subject with an anti-ST2 antibody or antigen binding fragment thereof, thereby decreasing the number of adipose-resident regulatory T cells in the subject and reducing insulin resistance relative to a reference.
In another aspect, the invention provides a method for treating or preventing age- related insulin resistance, type 2 diabetes and related disorders in a subject, the method involving contacting the subject with an anti-ST2 antibody or antigen binding fragment thereof, thereby treating or preventing age-related insulin resistance, type 2 diabetes and related disorders in a subject.
In yet another aspect, the invention provides a method for treating or preventing age- associated metabolic dysregulation in a subject, the method involving contacting the subject with an anti-ST2 antibody or antigen binding fragment thereof, thereby treating or preventing age-associated metabolic dysregulation in the subject.
In one aspect, the invention provides a method for identifying a subject having or at risk of developing age-related insulin resistance, type 2 diabetes and related disorders, the method involving detecting an increase in an ST2 polypeptide or polynucleotide expression in an fTreg or detecting an increase in the number of fTregs relative to a control. In one embodiment the fTreg is present in a tissue biopsy. In another embodiment the tissue biopsy if obtained from visceral adipose tissue. In still another embodiment the ST2 polypeptide is detected in an immunoassay. In another aspect, the invention provides a method of reducing insulin resistance in a subject, the method involving administering to the subject an anti-ST2 antibody or antigen binding fragment thereof, wherein the subject is identified as having an increase in an ST2 polypeptide or polynucleotide expression in an fTreg or detecting an increase in the number of fTregs relative to a control. In one embodiment the subject has or is at risk of developing age-related insulin resistance.
In one aspect, the invention provides a kit for treating or preventing age-related insulin resistance, the kit containing an effective amount of an ST2 antibody in a
pharmaceutical excipient.
In various embodiments of any of the previous aspects or any other aspect of the invention delineated herein, the subject is fifty, sixty, or sixty-five, years old or older. In various embodiments of any of the previous aspects or any other aspect of the invention delineated herein, the method reduces body weight relative to a reference. In various embodiments of any of the previous aspects or any other aspect of the invention delineated herein, the method decreased visceral adipose tissue and/or subcutaneous adipose tissue adiposity relative to a reference. In various embodiments of any of the previous aspects or any other aspect of the invention delineated herein, the method increases respiratory exchange ratio, oxygen consumption, and/or core body temperature relative to a reference.
In various embodiments of any of the previous aspects or any other aspect of the invention delineated herein, the method reduces fasting serum glucose and insulin levels relative to a reference. In various embodiments said method reduces glucose excursions during a glucose tolerance test and/or increases sensitivity during an insulin tolerance test relative to a reference. In various embodiments said method reduces serum non-esterified free fatty acid (NEFA) levels relative to a reference. In various embodiments said method increases insulin sensitivity relative to a reference. In various embodiments said method decreases hepatic steatosis relative to a reference. In various embodiments said method decreases fasting hepatic and/or serum triglyceride content.
In various embodiments of any of the previous aspects or any other aspect of the invention delineated herein, the method does not produce an autoimmune syndrome. In various embodiments said method specifically decreases fTreg numbers while preserving splenic Treg numbers. In various embodiments said method increases the glucose uptake capacity of visceral adipose tissue compared to a reference. In various embodiments of any of the previous aspects or any other aspect of the invention delineated herein, the anti-ST2 antibody administration is parenterally.
Definitions
Unless defined otherwise, all technical and scientific terms used herein have the meaning commonly understood by a person skilled in the art to which this invention belongs. The following references provide one of skill with a general definition of many of the terms used in this invention: Singleton et al., Dictionary of Microbiology and Molecular Biology (2nd ed. 1994); The Cambridge Dictionary of Science and Technology (Walker ed., 1988); The Glossary of Genetics, 5th Ed., R. Rieger et al. (eds.), Springer Verlag (1991); and Hale & Marham, The Harper Collins Dictionary of Biology (1991). As used herein, the following terms have the meanings ascribed to them below, unless specified otherwise.
By "ST2 (Interleukin 1 receptor-like 1) protein" is meant a protein having at least about 85%, 90%, 95%, or 100% amino acid identity to NCBI Accession No. Q01638 or a fragment thereof that binds IL-33.
An exemplary amino acid sequence is provided below.
>sp|Q01638|ILRLl_HUMAN Interleukin- 1 receptor-like 1 OS=Homo sapiens GN=IL 1RL1 PE=1 SV=4
MGFWILAILTILMYSTAAKFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQ
ERNRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYS TVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYT CKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPAQNEIKEVEIGKNANLTCSACFG KGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSNGLACLDMVLRIADVKEEDLLLQ YDCLALNLHGLRRHTVRLSR NPIDHHSIYCIIAVCSVFLMLI VLVIILKMFWIEATLL WRDIAKPYKTRNDGKLYDAYVVYPRNYKSSTDGASRVEHFVHQILPDVLENKCGYTLCIY GRDMLPGEDVVTAVETNIRKSRRHIFILTPQITHNKEFAYEQEVALHCALIQNDAKVILI
EMEALSELDMLQAEALQDSLQHLMKVQGTIKWREDHIANKRSLNSKFWKHVRYQMPVPSK IPRKASSLTPLAAQ Q
By "ST2 (Interleukin 1 receptor-like 1) antibody" is meant an antibody or antigen binding fragment thereof that specifically binds an ST2 polypeptide or fragment thereof. Such antibodies are known in the art and commercially available. A mouse anti-human ST2 antibody is available, for example, from Novus Biologicals. Other anti-human ST2 antibodies are known in the art (e.g., Palmer et al., Arthritis Rheum, 2009 Mar;60(3):738-49).
By "fat-resident regulatory T cell (fTreg)" is meant a regulatory T cell that is resident in adipose tissue. In one embodiment, an fTreg expresses Foxp3. In another embodiment, an fTreg expresses an increased level of ST2 relative to a splenic Treg of fat conventional CD4+
T cells. For example, ST2 is at least about 10, 20, 30, 40, 50, or 60 times more highly expressed in an fTreg compared to a splenic Treg. By "ameliorate" is meant decrease, suppress, attenuate, diminish, arrest, or stabilize the development or progression of a disease.
By "agent" is meant any small molecule chemical compound, antibody, nucleic acid molecule, or polypeptide, or fragments thereof.
By "alteration" is meant a change (increase or decrease) in the levels or activity of an analyte detected by standard art known methods such as those described herein. As used herein, an alteration includes a 10% change in analyte levels, preferably a 25% change, more preferably a 40% change, and most preferably a 50% or greater change in analyte levels. In one embodiment, an analyte is a cell, such as a fat regulatory T cells (fTreg).
By "analog" is meant a molecule that is not identical, but has analogous functional or structural features. For example, a polypeptide analog retains the biological activity of a corresponding naturally-occurring polypeptide, while having certain biochemical
modifications that enhance the analog's function relative to a naturally occurring polypeptide. Such biochemical modifications could increase the analog's protease resistance, membrane permeability, or half-life, without altering, for example, ligand binding. An analog may include an unnatural amino acid.
By "biopsy" is meant a test involving sampling of cells or tissues for examination by removing tissue from a living subject to determine the presence or extent of a disease.
Examples of biopsies include removal of visceral adipose tissues or cells.
In this disclosure, "comprises," "comprising," "containing" and "having" and the like can have the meaning ascribed to them in U.S. Patent law and can mean " includes,"
"including," and the like; "consisting essentially of or "consists essentially" likewise has the meaning ascribed in U.S. Patent law and the term is open-ended, allowing for the presence of more than that which is recited so long as basic or novel characteristics of that which is recited is not changed by the presence of more than that which is recited, but excludes prior art embodiments.
"Detect" refers to identifying the presence, absence or amount of the analyte to be detected.
By "disease" is meant any condition or disorder that damages or interferes with the normal function of a cell, tissue, or organ. Examples of diseases include age-related insulin resistance, type 2 diabetes and related disorders. Related disorders include metabolic disorders characterized by an increase in the number of ITregs. By "effective amount" is meant the amount of an agent of the invention (e.g., antibody or antigen binding fragment thereof) required to ameliorate the symptoms of a disease relative to an untreated patient. In one embodiment, an effective amount is the amount required to significantly reduce the number of fat-resident regulatory T cells in a adipose tissue relative to the number present in an untreated control. The effective amount of active agent used to practice the present invention for therapeutic treatment of a disease varies depending upon the manner of administration, the age, body weight, and general health of the subject. Ultimately, the attending physician or veterinarian will decide the appropriate amount and dosage regimen. Such amount is referred to as an "effective" amount.
By "fragment" is meant a portion of a polypeptide or nucleic acid molecule. This portion contains, preferably, at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90% of the entire length of the reference nucleic acid molecule or polypeptide. A fragment may contain 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100, 200, 300, 400, 500, 600, 700, 800, 900, or 1000 nucleotides or amino acids.
The terms "isolated," "purified," or "biologically pure" refer to material that is free to varying degrees from components which normally accompany it as found in its native state. "Isolate" denotes a degree of separation from original source or surroundings. "Purify" denotes a degree of separation that is higher than isolation. A "purified" or "biologically pure" protein is sufficiently free of other materials such that any impurities do not materially affect the biological properties of the protein or cause other adverse consequences. That is, a nucleic acid or peptide of this invention is purified if it is substantially free of cellular material, viral material, or culture medium when produced by recombinant DNA techniques, or chemical precursors or other chemicals when chemically synthesized. Purity and homogeneity are typically determined using analytical chemistry techniques, for example, polyacrylamide gel electrophoresis or high performance liquid chromatography. The term "purified" can denote that a nucleic acid or protein gives rise to essentially one band in an electrophoretic gel. For a protein that can be subjected to modifications, for example, phosphorylation or glycosylation, different modifications may give rise to different isolated proteins, which can be separately purified.
By "isolated polynucleotide" is meant a nucleic acid (e.g., a DNA) that is free of the genes which, in the naturally-occurring genome of the organism from which the nucleic acid molecule of the invention is derived, flank the gene. The term therefore includes, for example, a recombinant DNA that is incorporated into a vector; into an autonomously replicating plasmid or virus; or into the genomic DNA of a prokaryote or eukaryote; or that exists as a separate molecule (for example, a cDNA or a genomic or cDNA fragment produced by PCR or restriction endonuclease digestion) independent of other sequences. In addition, the term includes an RNA molecule that is transcribed from a DNA molecule, as well as a recombinant DNA that is part of a hybrid gene encoding additional polypeptide sequence.
By an "isolated polypeptide" is meant a polypeptide of the invention that has been separated from components that naturally accompany it. Typically, the polypeptide is isolated when it is at least 60%, by weight, free from the proteins and naturally-occurring organic molecules with which it is naturally associated. Preferably, the preparation is at least 75%, more preferably at least 90%, and most preferably at least 99%, by weight, a polypeptide of the invention. An isolated polypeptide of the invention may be obtained, for example, by extraction from a natural source, by expression of a recombinant nucleic acid encoding such a polypeptide; or by chemically synthesizing the protein. Purity can be measured by any appropriate method, for example, column chromatography, polyacrylamide gel electrophoresis, or by HPLC analysis.
As used herein, "obtaining" as in "obtaining an agent" includes synthesizing, purchasing, or otherwise acquiring the agent.
By "reduces" is meant a negative alteration of at least 10%, 25%, 50%, 75%, or
100%.
By "reference" is meant a standard or control condition.
. By "specifically binds" is meant a compound or antibody that recognizes and binds a polypeptide of the invention, but which does not substantially recognize and bind other molecules in a sample, for example, a biological sample, which naturally includes a polypeptide of the invention.
By "subject" is meant a mammal, including, but not limited to, a human or non- human mammal, such as a bovine, equine, canine, ovine, or feline.
Ranges provided herein are understood to be shorthand for all of the values within the range. For example, a range of 1 to 50 is understood to include any number, combination of numbers, or sub-range from the group consisting 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31 , 32, 33, 34, 35, 36, 37, 38, 39, 40, 41 , 42, 43, 44, 45, 46, 47, 48, 49, or 50.
As used herein, the terms "treat," treating," "treatment," and the like refer to reducing or ameliorating a disorder and/or symptoms associated therewith. It will be appreciated that, although not precluded, treating a disorder or condition does not require that the disorder, condition or symptoms associated therewith be completely eliminated.
Unless specifically stated or obvious from context, as used herein, the term "or" is understood to be inclusive. Unless specifically stated or obvious from context, as used herein, the terms "a", "an", and "the" are understood to be singular or plural.
Unless specifically stated or obvious from context, as used herein, the term "about" is understood as within a range of normal tolerance in the art, for example within 2 standard deviations of the mean. About can be understood as within 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, 0.5%, 0.1%, 0.05%, or 0.01% of the stated value. Unless otherwise clear from context, all numerical values provided herein are modified by the term about.
The recitation of a listing of chemical groups in any definition of a variable herein includes definitions of that variable as any single group or combination of listed groups. The recitation of an embodiment for a variable or aspect herein includes that embodiment as any single embodiment or in combination with any other embodiments or portions thereof.
Any compositions or methods provided herein can be combined with one or more of any of the other compositions and methods provided herein.
BRIEF DESCRIPTION OF THE DRAWINGS
Figures 1A-1 C are a schematic and pie charts showing that fTregs were selectively enriched in aged mice. Figure 1 A is a schematic showing pthe etiologies for obesity- versus age-related insulin resistance in mice. Figure IB depicts pie charts showing visceral adipose tissue (VAT) adipo-immune profiles (AIP) from mice at 12 weeks (young, n=T0), 44 weeks (aged, n=10), and in diet-induced obese (DIO) mice (n=10). Immune cells abundance, expressed as percentage of CD45.2+ cells. Figure 1C is a bar graph comparing changes in immune cell abundance between indicated groups, expressed as fold change in cell number per gram of VAT. #, false discovery rate < 2%>. Obese mice were fed a high fat diet for 12 weeks from 12 weeks of age. Data represents mean ± standard error of the mean (s.e.m). Figures 2A-2C are 12 scatter plots showing selected gating strategies used to generate adipolmmune Profiles (AIPs) - Adipolmmune Profiles were generated through the use of several distinct antibody cocktails. Figures 2A-2C, using Foxp3Cre"YFP reporter mice, show how the stromal vascular fraction of visceral adipose tissue (VAT) was analyzed by flow cytometry to identify several T cell subtypes (Figure 2A), macrophage subsets (Figure 2B), and eosinophils and neutrophils (Figure 2C).
Figures 3 A-3H are scatter plots, linear, and bar graphs showing that fTreg knock out (KO) mice were protected from general hallmarks of metabolic aging. Figure 3 A is a scatter plot showing representative Fluorescence Activated Cell Sorting (FACS) plots of fTreg KO (Foxp3Cre PPARgtl/n) and control (Foxp3Cre PPARg+/+) mice depicting Treg enrichment in visceral adipose tissue (VAT) and spleen. Figure 3B is a bar graph showing total body weight (n=15 per group), and lean and fat mass of control and fTreg KO mice (~12 months, n=8 per group). Figure 3C is a bar graph showing mass of VAT, subcutaneous adipose tissue (SAT), and spleen in aged control and fTreg KO mice (-15 months, n=9 per group). Figure 3D is a linear graph showing cumulative food consumption of control and fTreg KO mice (~8-9 months old, n=8 per group). Figures 3E and 3F are bar graphs showing average 24 hour respiratory exchange ratio (RER) of (Figure 3E) and average V02 (Figure 3F) consumed by aged control and fTreg KO mice (~11 months, n=6 per group). Figure 3G is a bar graph showing core body temperature of control and fTreg mice (~13 months old, n=9 per group). Figure 3H is a scatter plot showing principal component analysis of non-macrophage adipolmmune Profiles (AIPs) of young (12 weeks), aged (~15 months) and aged-fTreg KO (~15 months) mice. Data represents mean ± s.e.m. *p<0.05, **p<0.01 , ***p<0.001 , *** *p<0.0001.
Figures 4A and 4B are pie charts and a bar graph showing visceral adipose tissue (VAT) adipolmmune Profiles (AIPs) of aged fTreg KO and control mice. Figure 4A are pie charts showing adipolmmune Profiles of aged (-14 months old) fTreg KO and control mice male mice depicting immune cell abundance, expressed as percentage of CD45.2+ cells. Entirety of immune compartment (top) was further divided into pan-macrophage (middle) and non-macrophage (bottom) pie charts (n=9 mice per group). Figure 4B is a bar graph showing immune cell abundance between fTreg KO and control mice, expressed as cells per gram of VAT (n=9 mice per group). #, false discovery rate < 2%. Data represents mean ± s.e.m. Figures 5A and 5B are two bar graphs showing subcutaneous adipose tissue (SAT) adipolmmune and spleen immune profiles of fTreg KO and control mice. Figures 5A and 5B compare immune cell abundance between fTreg KO and control mice, expressed as cells per gram of subcutaneous adipose tissue (SAT, Figure 5A) and spleen (Figure 5B) (n=9 mice per group). Data represents mean ± s.e.m.
Figures 6A-6D are bar graphs and histological images showing that aged fTreg KO mice did not show signs of systemic autoimmunity or breakdown in peripheral tolerance. Figure 6A is a bar graph showing percentage of splenic naive CD4 T cells as defined by CD62hi CD4410 relative to total CD4+ Foxp3-YFP" CD25" population (n=9 mice per group). Figure 6B are eight representative histology images of gastrointestinal tract— duodenum, jejunum, ileum, and colon (left to right), (n=3 mice per group). There were no significant lesions observed or differences in inflammation, epithelial changes, or mucosal architecture between the two groups (hematoxylin and eosin (H&E), xl OO, scale bar 50 μηι). Figure 6C is a bar graph comparing the histopathology score in the small intestine and colon of fTreg KO and control mice. The severity and extent of inflammation and epithelial changes as well as mucosal architecture were each graded on a score of 1 (minimal) to 5 (severe) and added to obtain an overall score over 20. There were minimal inflammatory changes with no significant differences between groups. Figure 6D is a bar graph showing a multiplex inflammation panel of serum from fTreg KO and control mice (n=4 pooled samples (3 mice per sample) per group).
Figures 7A-7P are linear and bar graphs and histological images showing that loss of fTregs protected against the clinical hallmarks of age-associated insulin resistance. Figure 7A is a bar graph showing fTreg levels in visceral adipose tissue (VAT) from control and fTreg KO (Foxp3Cre PPARgf1/f1) mice in young (control n=6; fTreg KO n=6), aged (-15 months old; control n=T 0; fTreg KO n=10), and obese mice (control n=6; fTreg KO n=8).
Figures 7B and 7C are two bar graphs showing fasting serum glucose (Figure 7B) and insulin levels (Figure 7C) in control and fTreg KO mice in young (control n=9; fTreg KO n=9), aged (36 weeks old, control n=9; fTreg KO n=l 1), and obese mice (control n=10; fTreg KO n=10). Figures 7D-7F are six linear graphs showing glucose tolerance and insulin tolerance tests of control and fTreg KO mice at young (Figure 7D, 12 weeks, control n=8; fTreg KO n=8), aged (Figure 7E, 36-37 weeks, control n=8; fTreg KO n=9), and obese mice (Figure 7F, control n=9; fTreg KO n-10). Figure 7G shows four representative images of hematoxylin and eosin (H&E) staining of visceral adipose tissue (VAT, gonadal) from -14 month old control (n=3) and fTreg KO mice (n=5) (scale bar, 50 μΜ). Figure 7H is a box and whisker plot of adipocyte size distribution in visceral adipose tissue from control (n=3) and fTreg KO mice (n=3) (-14 months old). Figure 71 is a bar graph comparing ad libitum fed serum non- esterified fatty acid (NEFA) levels in aged control (n=9) and fTreg KO mice (n=T 0). Figure 7 J is a bar graph comparing serum resistin levels in -14 month old fasted control and fTreg KO mice (n=4 pooled samples (2 mice per sample) per group). Figure 7K is a bar graph comparing post-prandial glucose uptake in visceral adipose tissue of aged control (n=5) and fTreg KO mice (n=4). Figure 7L is a bar graph showing representative images of
hematoxylin and eosin (H&E) staining of liver from -14 month old control (n=3) and fTreg KO mice (n=5) (scale bar, 200 μΜ). Figure 7M is a bar graph comparing hepatic triglyceride levels in -14 month old control (n=5) and fTreg KO mice (n=3). Figure 7N is a bar graph showing fasting serum triglycerides in -14 month old control (n=9) and fTreg KO mice (n=10). Figure 70 is a bar graph showing fTregs, expressed as % of total CD45.2+ cells, in control and FL2/anti-IL2 treated mice (n=3 mice per group). Figure 7P is a bar graph showing relative glucose uptake in VAT of 16 week old wild-type and IL2/anti-IL2 treated mice (n=4 mice per group). Data represents mean ± s.e.m. *p<0.05, **p<0.01, ***p<0.001, ****p<0.0001.
Figure 8 is a bar graph comparing body weights of weight-matched cohorts of control and fTreg KO young, aged, and obese mice. Body weights of fTreg KO and control male mice used in weight-matched metabolic studies in young (12 week old; control n=9; fTreg KO n=9), aged (36 week old; control, n=9 mice; fTreg KO, n=l 1 mice), and obese (diet- induced obese (DIO), 12 weeks of high fat diet (HFD) starting at 12 weeks old; control n=10; fTreg KO n=10) settings.
Figures 9A and 9B are pie charts and a bar graph showing visceral adipose tissue
(VAT) adipolmmune profiles of obese fTreg KO and control mice. Figure 9A are pie charts of adipolmmune profiles of obese (diet-induced obese (DIO), 16 weeks high fat diet (HFD) started at 12 weeks of age) control (n=6 mice) and fTreg KO (n=8 mice) male mice depicting immune cell abundance, expressed as percentage of CD45.2+ cells. Entirety of immune compartment (top) was further divided into pan- macrophage (middle) and non-macrophage (bottom) pie charts. Figure 9B is a bar graph showing immune cell abundance between fTreg KO and control mice, expressed as cells per gram of VAT (n=9 mice per group). Data represents mean ± s.e.m.
Figure 10 includes two pie charts showing frequency of small, medium, and large adipocytes in visceral adipose tissue (VAT) of aged control and fTreg KO mice. Frequency of small (0-5000 μιη2), medium (5000-10,000 μηι2), and large (>10,000 μιη2) adipocytes in VAT of aged control and fTreg KO mice (n=3 mice per group, 850 adipocytes counted from control mice, 269 adipocytes counted from fTreg KO adipose).
Figures 1 1 A and 1 IB depict an R A-Seq analysis heat map and a scatter plot of fTreg gene expression. Figure 1 1 A is a heat map showing expression of several canonical Treg genes across fat and splenic Tregs and fat and splenic Tconv cells. Cells were pooled from 3 and 4 mice before isolating RNA for subsequent RNA-Seq analysis. Figure 1 IB is a scatter plot comparing expression of ST2 across all hematopoietic cells catalogued in the Immunological Genome Project database. Position of adipose CD4+ CD25+ T cells is marked.
Figures 12A-12I are heat maps and graphs showing that fTreg depletion improved adipose glucose uptake. Figures 12A and 12B are a heat map and a scatter plot showing hierarchical clustering of differentially expressed genes between fat Tregs and Tconv and splenic Tregs and Tconv cells (Figure 12 A), and fold change in expression levels of differentially expressed genes (Figure 12B) across fat Tregs and Tconv and splenic Tregs and Tconv cells from Foxp3-Thyl . l mice (47 weeks, cells pooled from 3 to 4 mice). Fat Treg cluster genes are labeled in red. Position of ST2 is marked. Figures 12C and 12D are a line graph and a bar graph showing representative FACS analysis (Figure 12C) and quantification of ST2 expression (Figure 12D) in CD4+ T cells from aged mice (45 weeks, n=5 mice). Figure 12E is a bar graph comparing total number of ST2+ Tregs and Tconv cells per gram of tissue in visceral adipose tissue (VAT) and spleen (n=5 mice). Figure 12F is a line graph of FACS histograms, Figure 12G is a bar graph showing quantification of Tregs (%Foxp3+ of CD45+ CD4+ population), and Figure 12H is a bar graph depicting cells per gram of tissue in VAT and spleen after IL-33 or PBS treatment (16 weeks, n=5 mice per group). Figure 121 is a bar graph showing ex vivo glucose uptake in VAT from wild type mice after control or IL- 33 treatment (16 weeks, n=5 mice per group). Figure 12J is a bar graph showing percentages of CD4+, fTreg, and CD4+ Tconv cells in VAT, and Figure 12K is a bar graph showing ex vivo insulin stimulated glucose uptake in VAT from wild type mice after anti-ST2 depleting antibody or isotype control treatment (-45 weeks old, n=4 mice per group). Figure 12L is schematic of an adipo-immune model of metabolic aging. Data represents mean ± s.e.m. *p<0.05, **p<0.01.
Figures 13A-13C are three bar graphs showing that depleting anti-ST2 antibody treatment does not promote T cell activation associated with systemic Treg-dysfunction. Figure 13 A is a bar graph comparing total weight before beginning course of anti-ST2 or isotype control antibodies (Day 0) and upon terminal analysis. Figure 13B and 13C are two bar graphs showing spleen weight (Figure 13B) and percentage of splenic naive CD4+ T cells as defined by CD62hi CD4410 relative to total splenic CD45+ CD4+ CD25' T cell population (Figure 13C) of mice upon terminal analysis (Day 3, n=4 mice per group).
DETAILED DESCRIPTION OF THE INVENTION
As described herein below, the present invention features compositions and methods for treating or preventing age-related insulin resistance, type 2 diabetes and related disorders. The method involves depleting fTreg cells with an anti-ST2 antibody to decrease age-related fTreg accumulation and restore insulin sensitivity, thereby treating age-related insulin resistance, type 2 diabetes and related disorders.
The invention is based, at least in part, on the discovery that adipose (fat)-resident regulatory T cells (fTregs) accumulate in adipose tissue as a function of age, and their accumulation in adipose is a driver of age-associated insulin resistance. Treatment with anti-
ST2 antibodies depleted fTregs while preserving splenic Treg numbers. Additionally adipose from aged mice treated with anti-ST2 antibody had increased insulin sensitivity compared to controls.
Age-associated insulin resistance and obesity-associated insulin resistance are two physiologically distinct forms of adult onset diabetes. While macrophage-driven
inflammation is a core driver of obesity-associated insulin resistance, the underlying mechanisms of the obesity-independent yet highly prevalent age-associated insulin resistance are largely unexplored. Comparative adipo-immune profiling revealed that fat-resident regulatory T cells, termed fTregs, progressively accumulated in adipose tissue as a function of age, but not obesity. Supporting the existence of two distinct mechanisms underlying age- associated versus obesity-associated insulin resistance, mice deficient in fTregs were protected against age-associated insulin resistance, yet remained susceptible to obesity- associated insulin resistance and metabolic disease. In contrast, selective depletion of fTregs via anti-ST2 antibody treatment increased adipose tissue insulin sensitivity. These findings established that distinct immune cell populations within adipose tissue underlie aging- and obesity-associated insulin resistance and implicated fTregs as adipo-immune drivers and potential therapeutic targets in the treatment of age-associated insulin resistance.
The immune system is complex, and the relative populations of different immune cells within adipose tissue are essentially uncharacterized. To better understand the immune system in aged adipose tissue, a quantitative, global picture of the immune system within adipose tissue was assembled using Adipolmmune Profile and fluorescence activated cell sorting (FACS).
Fat-resident regulatory T cells, termed fTregs, drove age-associated insulin resistance and can be specifically depleted to increase adipose insulin sensitivity.
Comparative Adipolmmune profiling in young, aged, and obese mice revealed that fTregs progressively enriched in adipose as a function of age, but not obesity. fTreg-deficient mice were protected from age-associated insulin resistance and its accompanying physiological hallmarks. In contrast, fTreg-deficiency offered no protection from obesity- associated insulin resistance. One general problem about studying tissue-specific immune cells is that there is generally
not a clean way of depleting, expanding, or perturbing a given immune cell type in a tissue-specific manner. Leveraging the high differential expression of ST2 in fTregs compared to splenic Tregs, it was found that treatment with anti-ST2 antibody depletes fTregs and increases adipose insulin sensitivity while preserving splenic Treg numbers. Taken together, it was demonstrated that distinct immunophysiologies underlie aging- versus obesity-associated insulin resistance and posit fTregs as adipoimmune drivers of and potential therapeutic targets against age-associated insulin resistance. Accordingly, the invention provides methods featuring an anti-ST2 antibody for enhancing insulin sensitivity in adipose tissue, and treating age-related insulin resistance, type 2 diabetes and related disorders. ST2 Antibodies
Antibodies that selectively bind ST2 are useful in the methods of the invention. Methods of preparing antibodies are well known to those of ordinary skill in the science of immunology. As used herein, the term "antibody" means not only intact antibody molecules, but also fragments of antibody molecules that retain immunogen-binding ability. Such fragments are also well known in the art and are regularly employed both in vitro and in vivo. Accordingly, as used herein, the term "antibody" means not only intact immunoglobulin molecules but also the well-known active fragments F(ab')2, and Fab. F(ab')2, and Fab fragments that lack the Fc fragment of intact antibody, clear more rapidly from the circulation, and may have less non-specific tissue binding of an intact antibody (Wahl et al., J Nucl. Med. 24:316-325 (1983). The antibodies of the invention comprise whole native antibodies, bispecific antibodies; chimeric antibodies; Fab, Fab', single chain V region fragments (scFv), fusion polypeptides, and unconventional antibodies.
Unconventional antibodies include, but are not limited to, nanobodies, linear antibodies (Zapata et al, Protein Eng. 8(10): 1057-1062,1995), single domain antibodies, single chain antibodies, and antibodies having multiple valencies (e.g., diabodies, tribodies, tetrabodies, and pentabodies). Nanobodies are the smallest fragments of naturally occurring heavy-chain antibodies that have evolved to be fully functional in the absence of a light chain. Nanobodies have the affinity and specificity of conventional antibodies although they are only half of the size of a single chain Fv fragment. The consequence of this unique structure, combined with their extreme stability and a high degree of homology with human antibody frameworks, is that nanobodies can bind therapeutic targets not accessible to conventional antibodies. Recombinant antibody fragments with multiple valencies provide high binding avidity and unique targeting specificity to cancer cells. These muitimeric scFvs (e.g., diabodies, tetrabodies) offer an improvement over the parent antibody since small molecules of ~60-100kDa in size provide faster blood clearance and rapid tissue uptake' See Power et al, (Generation of recombinant muitimeric antibody fragments for tumor diagnosis and therapy. Methods Mol Biol, 207, 335-50, 2003); and Wu et al. (Anti-carcinoembryonic antigen (CEA) diabody for rapid tumor targeting and imaging. Tumor Targeting, 4, 47-58, 1999).
Various techniques for making and unconventional antibodies have been described. Bispecific antibodies produced using leucine zippers are described by Kostelny et al. (J. Immunol. 148(5): 1547-1553, 1992). Diabody technology is described by Hollinger et al. (Proc. Natl. Acad. Sci. USA 90:6444-6448, 1993). Another strategy for making bispecific antibody fragments by the use of single-chain Fv (sFv) diners is described by Gruber et al. (J. Immunol. 152:5368, 1994). Trispecific antibodies are described by Tutt et al. (J. Immunol. 147:60, 1991). Single chain Fv polypeptide antibodies include a covalently linked VH::VL heterodimer which can be expressed from a nucleic acid including VR- and VL-encoding sequences either joined directly or joined by a peptide-encoding linker as described by Huston, et al. (Proc. Nat. Acad. Sci. USA, 85:5879-5883, 1988). See, also, U.S. Patent Nos. 5,091 ,513, 5,132,405 and 4,956,778; and U.S. Patent Publication Nos. 20050196754 and 20050196754.
In one embodiment, an antibody that binds ST2 is monoclonal. Alternatively, the anti- ST2 antibody is a polyclonal antibody. The preparation and use of polyclonal antibodies are also known the skilled artisan. The invention also encompasses hybrid antibodies, in which one pair of heavy and light chains is obtained from a first antibody, while the other pair of heavy and light chains is obtained from a different second antibody. Such hybrids may also be formed using humanized heavy and light chains. Such antibodies are often referred to as "chimeric" antibodies.
In general, intact antibodies are said to contain "Fc" and "Fab" regions. The Fc regions are involved in complement activation and are not involved in antigen binding. An antibody from which the Fc' region has been enzymatically cleaved, or which has been produced without the Fc' region, designated an "F(ab )2" fragment, retains both of the antigen binding sites of the intact antibody. Similarly, an antibody from which the Fc region has been enzymatically cleaved, or which has been produced without the Fc region, designated an "Fab"' fragment, retains one of the antigen binding sites of the intact antibody. Fabjzi fragments consist of a covalently bound antibody light chain and a portion of the antibody heavy chain, denoted "Fd." The Fd fragments are the major determinants of antibody specificity (a single Fd fragment may be associated with up to ten different light chains without altering antibody specificity). Isolated Fd fragments retain the ability to specifically bind to immunogenic epitopes.
Antibodies can be made by any of the methods known in the art utilizing ST2 polypeptide, or immunogenic fragments thereof, as an immunogen. One method of obtaining antibodies is to immunize suitable host animals with an immunogen and to follow standard procedures for polyclonal or monoclonal antibody production. The immunogen will facilitate presentation of the immunogen on the cell surface. Immunization of a suitable host can be carried out in a number of ways. Nucleic acid sequences encoding an ST2 polypeptide or immunogenic fragments thereof, can be provided to the host in a delivery vehicle that is taken up by immune cells of the host. The cells will in turn express the receptor on the cell surface generating an immunogenic response in the host. Alternatively, nucleic acid sequences encoding a ST2 polypeptide, or immunogenic fragments thereof, can be expressed in cells in vitro, followed by isolation of the receptor and administration of the receptor to a suitable host in which antibodies are raised.
Alternatively, antibodies against an ST2 polypeptide may, if desired, be derived from an antibody phage display library. A bacteriophage is capable of infecting and reproducing within bacteria, which can be engineered, when combined with human antibody genes, to display human antibody proteins. Phage display is the process by which the phage is made to 'display' the human antibody proteins on its surface. Genes from the human antibody gene libraries are inserted into a population of phage. Each phage carries the genes for a different antibody and thus displays a different antibody on its surface.
Antibodies made by any method known in the art can then be purified from the host. Antibody purification methods may include salt precipitation (for example, with ammonium sulfate), ion exchange chromatography (for example, on a cationic or anionic exchange column preferably run at neutral pH and eluted with step gradients of increasing ionic strength), gel filtration chromatography (including gel filtration HPLC), and chromatography on affinity resins such as protein A, protein G, hydroxyapatite, and anti-immunoglobulin.
Antibodies can be conveniently produced from hybridoma cells engineered to express the antibody. Methods of making hybridomas are well known in the art. The hybridoma cells can be cultured in a suitable medium, and spent medium can be used as an antibody source. Polynucleotides encoding the antibody of interest can in turn be obtained from the hybridoma that produces the antibody, and then the antibody may be produced synthetically or recombinantly from these DNA sequences. For the production of large amounts of antibody, it is generally more convenient to obtain an ascites fluid. The method of raising ascites generally comprises injecting hybridoma cells into an immunologically naive histocompatible or immunotolerant mammal, especially a mouse. The mammal may be primed for ascites production by prior administration of a suitable composition (e.g., Pristane).
Monoclonal antibodies (Mabs) produced by methods of the invention can be
"humanized" by methods known in the art. "Humanized" antibodies are antibodies in which at least part of the sequence has been altered from its initial form to render it more like human immunoglobulins. Techniques to humanize antibodies are particularly useful when non- human animal (e.g., murine) antibodies are generated. Examples of methods for humanizing a murine antibody are provided in U.S. patents 4,816,567, 5,530, 101 , 5,225,539, 5,585,089, 5,693,762 and 5,859,205.
Diagnostics
The present invention features diagnostic assays for the detection of age-related insulin resistance, type 2 diabetes and related disorders or the propensity to develop such conditions. In one embodiment, levels of ST2 polypeptides and/or polynucleotides are measured in a subject sample (e.g., adipose tissue, fTregs) and used as an indicator of age- related insulin resistance, type 2 diabetes and related disorders or the propensity to develop such conditions. In another embodiment, the number of fTregs are measured in a subject sample (e.g., adipose tissue) and used as an indicator of age-related insulin resistance, type 2 diabetes and related disorders or the propensity to develop such conditions. Detection of an increase in an ST2 polypeptide or polynucleotide expression in an fTreg or detecting an increase in the number of fTregs in the sample relative to a control is indicative of age-related insulin resistance, type 2 diabetes and related disorders or the propensity to develop such conditions.
Standard methods may be used to measure levels of ST2 polypeptides and/or polynucleotides in fTregs. Such methods include immunoassay, ELISA, western blotting using an anti-ST2 antibody, and radioimmunoassay. Methods for measuring the number of fTregs present in a sample are known in the art and described herein below (e.g., using adipose immune profiling).
Diagnostic Kits
The invention also provides for a diagnostic test kit that comprises an antibody or other means for detecting an ST2 polypeptide. Desirably, the kits includes instructions for the use of the kit in the methods of the invention. In one embodiment, the kit further comprises reagents, equipment (test tubes, reaction vessels, needles, syringes, etc.). The instructions provided in a kit according to the invention may be directed to suitable operational parameters in the form of a label or a separate insert. Optionally, the kit may further comprise a standard or control information so that the test sample can be compared with the control information standard to determine whether a consistent result is achieved.
The practice of the present invention employs, unless otherwise indicated, conventional techniques of molecular biology (including recombinant techniques), microbiology, cell biology, biochemistry and immunology, which are well within the purview of the skilled artisan. Such techniques are explained fully in the literature, such as,
"Molecular Cloning: A Laboratory Manual", second edition (Sambrook, 1989);
"Oligonucleotide Synthesis" (Gait, 1984); "Animal Cell Culture" (Freshney, 1987);
"Methods in Enzymology" "Handbook of Experimental Immunology" (Weir, 1996); "Gene Transfer Vectors for Mammalian Cells" (Miller and Calos, 1987); "Current Protocols in Molecular Biology" (Ausubel, 1987); "PCR: The Polymerase Chain Reaction", (Mullis, 1994); "Current Protocols in Immunology" (Coligan, 1991). These techniques are applicable to the production of the polynucleotides and polypeptides of the invention, and, as such, may be considered in making and practicing the invention. Particularly useful techniques for particular embodiments will be discussed in the sections that follow.
The following examples are put forth so as to provide those of ordinary skill in the art with a complete disclosure and description of how to make and use the assay, screening, and therapeutic methods of the invention, and are not intended to limit the scope of what the inventors regard as their invention.
EXAMPLES
Example 1: Age-associated insulin resistance was driven by fTregs.
The young, lean state is associated with insulin sensitivity, however both aging and obesity can lead to the development of insulin resistance (Figure 1 A). To distinguish key immune cell types that drive age- versus obesity-associated insulin resistance, the immune cell components of adipose depots were quantitatively profiled using a flow cytometry approach termed adipo-immune profiling (AIP) (Figures 2A-C, Table 1). In contrast to the decrease in anti-inflammatory M2 adipose tissue macrophages (ATMs) and eosinophils observed in obesity-driven insulin resistance, AIP revealed that these cell populations were largely unperturbed in visceral adipose tissue from aged mice (M2 ATMs - aged: 33.6 ± 3.8%, young: 29.8 ± 4.1%, obese: 22.9 ± 6.3%; eosinophils - aged: 4.4% ± 1.6%, young: 4.7% ± 0.7%, obese: 0.8% ± 1.0%, Figure IB). Rather, the relative portion of the non- macrophage compartment was significantly increased in aged compared to young or obese mice (aged: 24.3 ± 4.6%, young: 17.9 ± 2.8%, obese 15.7 ± 3.8%, Figure I B), which was largely attributable to a ~13.5 fold expansion in the fat-resident regulatory T cell (fTreg) population (aged: 5.0 ± 1.2%, young: 0.4 ± 0.1%, obese: 0.1 ±0.1%, Figures IB and 1C). These varying AIP signatures of adipose tissue indicated that distinct pathophysiologic processes drive age- and obesity-associated insulin resistance and implicated fTregs as potential drivers of age-associated insulin resistance.
Table 1. Antibodies used to molecularly identify the given immune cell type.
Immune Cell Type Molecular Identification Scheme
TCRYO CD45.2* F4/8Q- CD3* TCRb" TCRy*
CD8* CD45.2* F4/80' CDS* TCRb* CD4" CD8+
Treg CD4* CD45.2+ CD4+ CD25* Foxp3+
Naive CD4* CD45.2* CD4+ CD25- Foxp3" CD62LM CD44*
Activated CD4* CD45.2* CD4* CD25- Foxp3- 00621» CD44fti
NKT CD45.2* NK1.1 * TCRb*
NK CD45 2* NK1 1 * TCRb"
B CD45.2* NK1 1 - CD19*
Eosinophil CD45.2* F4/80 Siglec-F*
Neutrophil CD45.2* F4/80- CD11 c- CD 11 b* Ly6G* M2 ATM CD45.2+ F4/80' CDH c^ CD206* M1 ATM CD45 2* F4/80* CD11c" CD206"
DN (Double-negative) ATM CD45.2* F4/80* CD 11C CD206-
Example 2: Adipolmmune profiles of control and fTreg KO mice looked nearly identical.
To explore the role of fat-resident regulatory T cells (fTregs) in age-associated insulin resistance, Foxp3 Ppargm mice were utilized in which Tregs were selectively depleted from visceral adipose tissue (fTreg KO mice, Figure 3A, Figures 4A and 4B, Cipoletta et al., Nature. doi: 10.1038/naturel 1 132, 2012) without significantly altering the immune profiles of subcutaneous adipose tissue or spleen (Figures 5 A and 5B). Importantly, the visceral adipose tissue -specific loss of fTregs did not elicit any overt signs of systemic inflammation generally associated with Treg dysfunction. Aged fTreg KO mice had normal-sized spleens and increased CD62Lhi CD4410 naive CD4+ T cell populations compared to wild-type controls (Figure 3C, Figure 6A). The normal intestinal histology provided additional evidence that the Treg population was not perturbed (Figures 6B and 6C). Furthermore, no differences were observed in the levels of inflammatory cytokines, including TNFa, ILlb, IL6, IFNy, and IL17, in the serum of aged fTreg KO compared to control mice (Figure 6D).
Example 3: fTreg KO mice were protected against age-associated, but not obesity- associated insulin resistance
Importantly, the selective loss of fTregs attenuated many of the hallmarks of age- associated metabolic dysregulation. They weighed less than control mice and were leaner (decreased visceral adipose tissue and subcutaneous adipose tissue adiposity) despite increased food consumption (Figures 3B-3D). In addition, the respiratory exchange ratio (RER, Figure 3E), oxygen consumption (Figure 3F), and core body temperature (Figure 3G) were increased in aged fTreg KO mice relative to control mice. These marked improvements indicated that the age-associated metabolic phenotype was closely linked with visceral adipose tissue immune responses, and that in the aged setting, a reduction in fTreg numbers might be protective. Indeed, the adipo-immune pro filings of aged fTreg KO mice were shifted towards those of young mice, as visualized by principal component analysis (Figure 3H).
The fTreg KO phenotype was most pronounced in aged mice, though a reduction in fTreg levels was also seen in obese fTreg KO mice (Figure 7A). Consistent with the notion that fTregs are drivers of age-associated metabolic dysregulation, fasting serum glucose and insulin levels were significantly reduced in aged fTreg KO mice (Figures 7B and 7C and Figure 8). Furthermore, aged fTreg KO mice displayed smaller glucose excursions during glucose tolerance tests and increased sensitivity during insulin tolerance tests compared to weight-matched control mice (Figure 7E). Notably, these improvements in glucose homeostasis were observed only in aged mice; no significant differences were seen in young or obese ITreg KO mice (Figures 7D and 7F), which was consistent with the largely unchanged adipo-immune profiling (AIP) of obese iTreg KO mice (Figures 9A and 9B).
Example 4: Hallmarks of insulin resistance were attenuated in fTreg KO mice compared to age-matched controls
Histologically, aged fat-resident regulatory T cell (fTreg) KO visceral adipose tissue depots appeared similar to control mice, and inflammatory processes such as crowning were observed at comparable frequencies (Figure 7G). However, adipocytes from aged fTreg KO mice were smaller than those in control mice (fTreg KO 70% <5000 mm , control -41% <5000 mm2, Figure 7H and Figure 10), and serum non-esterified free fatty acid (NEFA) levels were reduced to almost half those of control mice; both indicators of improved insulin sensitivity (Figure 71). In addition, circulating levels of the adipokine resistin, which positively correlates with murine insulin resistance, were reduced in the aged fTreg KO mice (Figure 11). Furthermore, aged fTreg KO mice presented with decreased hepatic steatosis, as determined histologically and by decreased fasting hepatic and serum triglyceride content (Figures 7L-7N). In combination, these findings indicated that the loss of fTregs in adipose tissue alleviated many of the indications of age-associated insulin resistance in mice, a primary clinical manifestation of metabolic aging.
To more directly associate fTregs with age-associated insulin resistance, basal glucose uptake was measured in adipose tissue ex vivo. Notably, visceral adipose tissue from fTreg KO mice took up almost twice the amount of glucose as control tissue (Figure 7K).
Conversely, expansion of fTregs in wild-type mice via treatment with IL-2/IL-2 mAb complex treatment abrogated basal glucose uptake in visceral adipose tissue by -50% (Figures 70 and 7P). This inverse correlation between fTreg numbers and glucose uptake in adipose tissue supported a causal association between fTregs and insulin resistance during aging. Example 5: fTregs are functionally distinct from splenic Tregs and more highly express the IL-33 receptor ST2 than splenic Tregs or conventional CD4+ T (Tconv) cells.
These findings of an association between fat-resident regulatory T cells (fTregs) and age-associated insulin resistance and metabolic aging indicated that these cells were functionally distinct from splenic Tregs. To investigate this notion, the transcriptomes of Tregs were compared, as well as conventional CD4+ T cells, isolated from visceral adipose tissue and spleen. Comparative analyses revealed that while certain canonical genes were similarly expressed (e.g. Foxp3, Ctla4, and Tigit), visceral adipose tissue and splenic Tregs had discrete expression signatures, consistent with the indicated functional distinction. In particular, Pparg, Gata3, and Irf4 were selectively enriched in visceral adipose tissue, but not splenic Tregs (Figure 1 1 A). Furthermore, unbiased comparative gene expression analyses combined with hierarchical clustering defined extensive fat- and splenic-residence clusters (1 142 genes and 1431 genes, respectively) relative to much smaller Pan-Treg Clusters 1 and 2 (56 and 162 genes, respectively). Transcriptionally, fTregs clustered more closely with fat conventional CD4+ T cells than splenic Tregs (Figure 12A), indicating that the functional specification of fTregs was informed by their anatomical location within adipose tissue, as well as the expression of the Treg lineage-specifying transcription factor Foxp3. It was posited that the transcriptional differences between fTregs and splenic Tregs (found in the fTreg cluster of 1049 genes) might provide a therapeutic avenue to selectively manipulate fTreg populations. The IL-33 receptor ST2, which lies within the fTreg cluster, had been recently implicated in effector Treg and in particular fTreg development (Vasanthakumar et al., Nat Immunol 1-12. doi: 10.1038/ni.3085), 2015; Schiering, C. et al., Nature 513, 564- 568, 2014). Indeed, ST2 was -60 and -30 times more highly expressed in fTregs compared to splenic Tregs and fat conventional CD4+ T cells, respectively, consistent with the ImmGen database (website of the Immunological Genome Project), (Figure 12B and Figure 1 IB). Flow cytometry confirmed that ST2 was expressed on the cell surface of the majority of fTregs, but on relatively few fat conventional CD4+ T cells , or splenic Tregs or conventional CD4+ T cells (Figures 12C and 12D). Furthermore, visceral adipose tissue had -lOx more ST2+ fTregs than ST2+ fat conventional CD4+ T ; a similar ratio was seen in the spleen (Figure 12E). Example 6: Acute treatment with an anti-ST2 antibody led to partial depletion of fTregs concomitantly with a reduction in fat CD4+ T (Tconv) cells and an increase in insulin sensitivity.
To explore the therapeutic potential of the IL-33/ST2 signaling pathway, aged mice were initially injected with IL-33 (0.5 mg intraperitoneally (i.p.) on days 0, 2, 4) to expand the fat-resident regulatory T cell (fTreg) population (Figures 12F-12H). In agreement with fTreg expansion driven by IL2/anti-IL2 treatment, mice injected with IT-33 displayed signs of insulin resistance (basal glucose uptake in visceral adipose tissue reduced to -60% of control mice, Figure 121). In the converse approach, acute treatment with an anti-ST2 antibody (200 mg/mouse i.p. on days 0 and 2) was able to partially deplete fTregs (Figure 12J). This depletion occurred concomitantly with a reduction in fat CD4+ T (Tconv) cells, indicating a possible role for ST2 and/or fTregs in maintaining this population. Importantly, partial depletion of fTregs achieved with acute anti-ST2 treatment was sufficient to increase insulin-stimulated glucose uptake in visceral adipose tissue (-25% increase in glucose uptake compared to control treated mice, Figure 12K). Furthermore, this increase in insulin sensitivity was achieved without any signs of conventional CD4+ T cell activation associated with systemic Treg dysfunction (Figure 13).
Taken together, these data provide evidence that distinct adipo-immune populations drive age- and obesity-associated insulin resistance. The findings that fTregs accumulated in mouse adipose tissue as a function of age and exacerbated the decline of adipose metabolic function associated with aging (Figure 12L), complements the established role of Ml ATMs in the decline of adipose metabolic function in the setting of obesity. Thus, these studies showcased the ability of the immune compartment within adipose to drive key aspects of metabolic aging, in particular insulin resistance. Given the classical immune suppressive and anti-inflammatory nature of Tregs, it was speculated that the chronic inflammatory processes that drove obesity-associated insulin resistance were likely not driving age-associated insulin resistance. Indeed, it was possible that maintaining a certain degree of inflammation was beneficial for adipose tissue remodeling and its metabolic function, and the increased abundance of fTregs in the aged state might prevent beneficial inflammatory processes like adipose remodeling necessary for maintenance of adipose insulin sensitivity. Finally, this study indicated that selective targeting of fTregs might represent a new therapeutic avenue in the treatment of age-related diabetes, and more generally provided a proof-of-principle that different subtypes of Tregs could be targeted in a clinically achievable manner bringing researchers closer to the promise that the identification of Tregs heralded many years ago.
The experiments above were performed with the following methods and materials. Methods and Materials
Mice
All mice were bred or housed in specific pathogen-free facilities at The Salk Institute for Biological Studies or purchased from Taconic Biosciences. C57BL/6NTac and
129S6/SvEvTac mice were purchased from Taconic Biosciences for comparative adipo- immune profiling (AIP). Age-matched retired breeders were purchased for AIP of aged adipose, and DIO C57BL/6NTac mice were purchased for profiling of obese adipose. fTreg KO mice were generated by crossing B6.129(Cg)-Foxp3tm4(YFP/cre)Ay7J (Rubtsov, Y. P. et al., Immunity 28, 546-558, 2008) and B6.129-Ppargtm2Rev/J (He et al., PNAS 100, 15712-15717, 2003) mice. The Foxp3Thy reporter mice were utilized when isolating Tregs and conventional CD4+ T cells from spleen and fat for subsequent RNA-Seq analysis. Mice within The Salk Institute for Biological Studies received autoclaved normal chow (MI laboratory rodent diet 5001 , Harlan Teklad) or autoclaved HFD (60 kcal% fat, Research Diets). All mice used for studies were male. Adipo-immune profiling (AIP)
Visceral (epididymal) and subcutaneous (inguinal) adipose depots were dissected from mice after lOmL PBS perfusion through left ventricle. Inguinal lymph nodes resident in inguinal adipose were removed. Adipose was minced into fine pieces (2-5mm ) and digested in adipocyte isolation buffer (l OOmM HEPES pH7.4, 120mM NaCl, 50mM KC1, 5mM glucose, ImM CaC12, 1.5% BSA) containing lmg/ml collagenase at 37°C with intermittent shaking for 1.5 hours. The suspension was then passed through a 100 μπι mesh to remove undigested clumps and debri. The flowthrough was allowed to stand for 10 minutes to separate the floating adipocyte fraction and infranatant containing the stromal vascular fraction. The infranatant was removed while minimally disturbing the floating adipocyte fraction and centrifuged at 400g for 10 minutes. The pellet containing the stromal vascular fraction was washed once in lOmL RPMI. The resultant isolated cells were subjected to Fluorescence Activated Cell Sorting (FACS) analysis. The following antibodies were used to assemble the Adipo-immune Profile with the manufacturer preceding and clone number within parentheses: BioLegend - CD45.2 (104), CD44 (IM7), CD62L (MEL- 14), TC g/d (GL3), CD19 (6D5), CD25 (PC61), CD206 (C068C2), CD301 (LOM-14); eBioscience - CD3 (145-2C1 1), CD25 (PC61), CD4 (RM4-5), TCRb (H57-597), B220 (RA3-6B2), NK1.1 (PK136), CD49b (DX5), Foxp3 (FJK-16s), F4/80 (BM8), CD l lc (N418), CDl lb (Ml/70); Tonbo biosciences - F4/80 (BM8.1), CD4 (RM4-5), CD44 (IM7), CD62L (MEL- 14), Ly6G (RB6-8C5); BD Pharmingen - Siglec-F (E50-2440); BD Biosciences - CD8a (53-6.7). When analyzing myeloid cell populations, Fc blocking antibody (CD 16/CD32, Tonbo biosciences, 2.4G2) was utilized. Cells were analyzed using the BD® FACS Aria instrument and FlowJo software.
Body composition and adipocyte size analyses
Body composition was measured with an ECHO® MRI-100 body composition analyzer (ECHO MEDICAL SYSTEMS®). Visceral adipose tissue (VAT) (epididymal adipose) was dissected, and the wet weight was determined. Adipose tissues were fixed in 10% formalin, sectioned, and stained in hematoxylin and eosin. An adipocyte cross-sectional area was determined from photomicrographs of VAT using ImageJ.
In vivo metabolic phenotype analysis Real-time metabolic analyses were conducted in a Comprehensive Lab Animal
Monitoring System (COLUMBUS INSTRUMENTS®). C02 production, 02 consumption, and ambulatory counts were determined for at least three consecutive days and nights after at least 24 hours for adaptation before data recording.
Principal component analysis (PC A) of adipo-immune profding (A IP)
Non-macrophage immune cell populations, described as percent of the total CD45.2+ immune compartment, were inputted into Metabo Analyst 3.0 (a comprehensive tool suite for metabolomic data analysis) for principal component analysis (PCA). No normalizations, transformations, or scalings were implemented. Glucose homeostasis studies
Fasting was induced for 6 hours, except for glucose tolerance tests (GTTs), which were conducted after overnight fasting. Glucose (1-2 g/kg, intraperitoneally (i.p.)) and insulin (0.5-1.0 U/kg, i.p.) was injected for GTTs and insulin tolerance tests (ITTs), respectively. Blood glucose was monitored using a Nova Max Plus glucometer.
Histological analyses
Sections (4 mm) of fixed tissues were stained with haematoxylin and eosin according to standard procedures. Histopathological scores were graded on blinded samples for severity and extent of inflammation and morphological changes by a pathologist.
Serum analyses
Blood was collected by tail bleeding or right atrial puncture. Non-esterified fatty acids (Wako) and triglycerides (Thermo) were measured using colorimetric methods. Serum insulin levels (ULTRA SENSITIVE INSULIN™, CRYSTAL CHEM®) were measured by ELISAs. Serum cytokine and metabolic hormone levels were analyzed by the LUMINEX™ BIO-PLEX® system using the Mouse Cytokine 23-Plex Panel and Diabetes Panel, respectively, as according to the manufacturer's instructions (BIO-RAD®). Core body temperature
Mice were single housed, and core body temperature was measured with a clinical rectal thermometer (THERMALERT™ model TH-5; PHYSITEMP®) at 1 :30PM. The probe was dipped in a room temperature lubricating glycerol before insertion.
Ex vivo 2-DG uptake assay
Adipose was dissected from mouse, cut into small pieces with scissors, washed and incubated for 30 minutes with Krebs-Ringer Bicarbonate HEPES buffer (KRBH, 120 mM NaCl, 4 mM KH2P04, 1 mM MgS04, 0.75 mM CaCl2, 30 mM Hepes, 10 mM NaHC03, pH 7.4, supplemented with 1 % fatty-acid free BSA). For determination of exogenous insulin- stimulated 2-deoxy-D-glucose (2-DG) uptake, adipose was incubated in KRBH with 100- 200nM insulin for 20 minutes in 37 °C. Cold 2-DG and hot 2-DG-L2- H(N) was added to incubated adipose such that the final concentration of cold 2-DG was 0.1 mM and final quantity of hot 2-DG-l,2-" H(N) was 0.1 μθ (assuming total reaction volume -400 uL). Adipose was further incubated 20 minutes in 37°C, then washed three times with PBS before being lysed by scintillation fluid. 2-DG uptake was determined by measuring scintillation counts normalized to adipose mass utilized for assay. Non-specific 2-DG uptake levels were determined by treating adipose with cytochalasin B (0.1 μΜ final concentration) before addition of cold and hot 2-DG.
IL-2-anti-IL-2 complex and IL-33 injections
IL-2-anti-IL-2 complexes were prepared by incubating 2 μg of murine IL-2 (Biolegend) with 10 μg of anti-IL-2 antibody (JES6.1, BIOXCELL®) in a total volume of 200 μΐ, of PBS for 30 minutes at 37°C (amounts given per injection). Mice were injected intraperitoneally (i.p.) three times (days 0,1 , 2) and analyzed on day 8. For IL-33 expansion assays, mice were injected i.p. with 0.5 μg of recombinant murine IL-33 in PBS (R&D SYSTEMS®) three times (days 0, 2, 4) and analyzed on day 6. PBS was used for control injections.
RNA-Seq library generation
Total RNA was isolated from sorted cells using TRIZOL® reagent (IFNVITROGEN®) as per the manufacturer's instructions and treated with DNASEI® (QIAGEN®) for 30 minutes at 22°C. Sequencing libraries were prepared from 10-100 ng of total RNA using the
TRUSEQ® RNA sample preparation kit v2 (ILLUMINA®) according to the manufacturer's protocol. Briefly, mRNA was purified, fragmented and used for first- and second-strand cDNA synthesis followed by adenylation of 3' ends. Samples were ligated to unique adaptors and subjected to PCR amplification. Libraries were then validated using the 2100
BIOANALYZER® (AGILENT®), normalized and pooled for sequencing. RNA-Seq libraries prepared from two biological replicates for each experimental condition were sequenced on the ILLUMINA® HISEQ® 2500 using barcoded multiplexing and a 100-bp read length.
High-throughput sequencing and analysis
Image analysis and base calling were done with ILLUMINA® CASAVA®-1.8.2. This yielded a median of 29.9M usable reads per sample. Short read sequences were mapped to a UCSC mm9 reference sequence using the RNA-Seq aligner STAR® (Dobin, A. et al., Bioinformatics 29, 15-21 , 2012). Known splice junctions from mm9 were supplied to the aligner and de novo junction discovery was also permitted. Differential gene expression analysis, statistical testing and annotation were performed using CUFFDIFF® 2 (Trapnell et al., Nat Biotechnol 31, 46-53, 2012). Transcript expression was calculated as gene-level relative abundance in fragments per kilobase of exon model per million mapped fragments and employed correction for transcript abundance bias (Roberts et al., Bioinformatics 27, 2325-2329, 201 1 ). RNA-Seq results for genes of interest were also explored visually using the UCSC Genome Browser.
Hierarchical Clustering Differentially expressed gene names and corresponding fragments per kilobase of exon per million fragments mapped (FPKM) values across samples were inputted into GENE-E (Broad Institute) for hierarchical clustering analysis (implemented one minus pearson correlation for sample and gene distance metrics and the average linkage method) and visualization. Gene cluster names were created to describe the gene expression characteristics within each cluster (i.e. Fat-Residence Cluster refers to the gene cluster whose genes were expressed at greater levels in T cells residing in fat. Fat-Treg Cluster refers to the gene cluster whose genes were expressed highest in only the fTregs.)
ST2 studies and anti-ST2 depleting antibody treatment
Fluorescence Activated Cell Sorting (FACS) antibody for ST2 was purchased from MD BIOPRODUCTS®, clone DJ8. Mice were injected intraperitoneally (i.p.) with 200 μg depleting anti-ST2 antibodies (Monticelli et al, Nat Immunol 12, 1045-1054, 2011 ; R&D® systems, clone 245707) or isotype control (BIOXCELL®) twice (days 0, 2) and sacrificed for analysis on day 3. Statistical analyses
Statistical analyses were performed with Prism 6.0 (GraphPad). p values were calculated using two-tailed unpaired Student's t test. When analyzing adipo-immune profiles, a false discovery rate approach was utilized to avoid the problem of an inflated false- positive rate due to the substantial number of hypothesis tests. Other Embodiments
From the foregoing description, it will be apparent that variations and modifications may be made to the invention described herein to adopt it to various usages and conditions. Such embodiments are also within the scope of the following claims.
The recitation of a listing of elements in any definition of a variable herein includes definitions of that variable as any single element or combination (or subcombination) of listed elements. The recitation of an embodiment herein includes that embodiment as any single embodiment or in combination with any other embodiments or portions thereof.
All patents and publications mentioned in this specification are herein incorporated by reference to the same extent as if each independent patent and publication was specifically and individually indicated to be incorporated by reference.

Claims

What is claimed is:
1. A method of enhancing insulin sensitivity in a cell or tissue, the method comprising contacting the cell or tissue with an anti-ST2 antibody or antigen binding fragment thereof, thereby decreasing the number of adipose-resident regulatory T cells (fTreg) and enhancing insulin sensitivity relative to a reference.
2. A method of reducing insulin resistance in a cell or tissue, the method comprising contacting the cell or tissue with an anti-ST2 antibody or antigen binding fragment thereof, thereby decreasing the number of adipose-resident regulatory T cells (fTreg) and reducing insulin resistance relative to a reference.
3. The method of claim 1 or 2, wherein the cell is an adipocyte.
4. The method of claim 1 or 2, wherein the tissue is adipose tissue.
5. A method of enhancing insulin sensitivity in a subject, the method comprising
administering to the subject an anti-ST2 antibody or antigen binding fragment thereof, thereby decreasing the number of adipose-resident regulatory T cells in the subject and enhancing insulin sensitivity relative to a reference.
6. A method of reducing insulin resistance in a subject, the method comprising administering to the subject an anti-ST2 antibody or antigen binding fragment thereof, thereby decreasing the number of adipose-resident regulatory T cells in the subject and reducing insulin resistance relative to a reference,
7. A method for treating or preventing age-related insulin resistance, type 2 diabetes and related disorders in a subject, the method comprising administering to the subject an anti-ST2 antibody or antigen binding fragment thereof, thereby treating or preventing age-related insulin resistance, type 2 diabetes and related disorders in a subject.
8. A method for treating or preventing age-associated metabolic dysregulation in a subject, the method comprising administering to the subject an anti-ST2 antibody or antigen binding fragment thereof, thereby treating or preventing age-associated metabolic dysregulation in the subject.
9. The method of any one of claims 5-8, wherein the subject is fifty years old or older.
10. The method of any one of claims 5-8, wherein the subject is sixty years old or older.
1 1. The method of any one of claims 5-8, wherein the subject is sixty-five years old or older.
12. The method of any one of claims 5-1 1 , wherein the method reduces body weight relative to a reference.
13. The method of any one of claims 5-1 1, wherein the method decreased visceral adipose tissue and/or subcutaneous adipose tissue adiposity relative to a reference.
14. The method of any one of claims 5-1 1 , wherein the method increases respiratory exchange ratio, oxygen consumption, and/or core body temperature relative to a reference.
15. The method of any of one of claims 5-1 1 , wherein the method reduces fasting serum glucose and insulin levels relative to a reference.
16. The method of any one of claims 5-1 1 , wherein the method reduces glucose excursions during a glucose tolerance test and/or increases sensitivity during an insulin tolerance test relative to a reference.
17. The method of any one of claims 5-1 1 , wherein the method reduces serum non-esterified free fatty acid (NEFA) levels relative to a reference.
18. The method of any one of claims 5-11 , wherein the method increases insulin sensitivity relative to a reference.
19. The method of any of claims 5-1 1 , wherein the method decreases hepatic steatosis relative to a reference.
20. The method of any one of claims 5-1 1 , wherein the method decreases fasting hepatic and/or serum triglyceride content.
21. The method of any one of claims 1-10, wherein the method does not produce an autoimmune syndrome.
22. The method of any one of claims 1 -10, wherein the method specifically decreases fTreg numbers while preserving splenic Treg numbers.
23. The method of any one of claims 1-10, wherein the method increases the glucose uptake capacity of visceral adipose tissue compared to a reference.
24. The method of any one of claims 5-1 1 , wherein the anti-ST2 antibody administration is parenterally.
25. A method for identifying a subject having or at risk of developing age-related insulin resistance, type 2 diabetes and related disorders, the method comprising detecting an increase in an ST2 polypeptide or polynucleotide expression in an fTreg or detecting an increase in the number of fTregs relative to a control.
26. The method of claim 25, wherein the fTreg is present in a tissue biopsy.
27. The method of claim 25, wherein the tissue biopsy if obtained from visceral adipose tissue.
28. The method of claim 24, wherein the ST2 polypeptide is detected in an immunoassay.
29. A method of reducing insulin resistance in a subject, the method comprising
administering to the subject an anti-ST2 antibody or antigen binding fragment thereof, wherein the subject is identified as having an increase in an ST2 polypeptide or polynucleotide expression in an fTreg or detecting an increase in the number of fTregs relative to a control.
30. The method of claim 29, wherein the subject has or is at risk of developing age-related insulin resistance.
31. A kit for treating or preventing age-related insulin resistance, the kit comprising an effective amount of an ST2 antibody in a pharmaceutical excipient.
PCT/US2016/013004 2015-01-30 2016-01-12 Compositions and methods for treating age-related diabetes and related disorders Ceased WO2016122865A1 (en)

Priority Applications (3)

Application Number Priority Date Filing Date Title
US15/544,385 US10539572B2 (en) 2015-01-30 2016-01-12 Compositions and methods for treating age-related diabetes and related disorders
US16/702,870 US11428697B2 (en) 2015-01-30 2019-12-04 Compositions and methods for treating age-related diabetes and related disorders
US17/813,383 US12253527B2 (en) 2015-01-30 2022-07-19 Compositions and methods for treating age-related diabetes and related disorders

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201562110349P 2015-01-30 2015-01-30
US62/110,349 2015-01-30
US201562154652P 2015-04-29 2015-04-29
US62/154,652 2015-04-29

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US15/544,385 A-371-Of-International US10539572B2 (en) 2015-01-30 2016-01-12 Compositions and methods for treating age-related diabetes and related disorders
US16/702,870 Division US11428697B2 (en) 2015-01-30 2019-12-04 Compositions and methods for treating age-related diabetes and related disorders

Publications (1)

Publication Number Publication Date
WO2016122865A1 true WO2016122865A1 (en) 2016-08-04

Family

ID=56544162

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2016/013004 Ceased WO2016122865A1 (en) 2015-01-30 2016-01-12 Compositions and methods for treating age-related diabetes and related disorders

Country Status (2)

Country Link
US (3) US10539572B2 (en)
WO (1) WO2016122865A1 (en)

Cited By (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10093730B2 (en) 2014-11-10 2018-10-09 Genentech, Inc. Anti-interleukin-33 antibodies and uses thereof
US11428697B2 (en) 2015-01-30 2022-08-30 Salk Institute For Biological Studies Compositions and methods for treating age-related diabetes and related disorders
US11708608B2 (en) 2014-11-10 2023-07-25 Genentech, Inc. Therapeutic and diagnostic methods for IL-33-mediated disorders
US11760797B2 (en) 2020-03-13 2023-09-19 Genentech, Inc. Anti-interleukin-33 antibodies and uses thereof

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN121851171A (en) * 2020-05-12 2026-04-14 正大天晴药业集团股份有限公司 ST2 antigen-binding protein

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20120064100A1 (en) * 2009-03-18 2012-03-15 Simon Barry Biomarkers and uses thereof
US20140004107A1 (en) * 2012-05-18 2014-01-02 Amgen Inc. St2 antigen binding proteins

Family Cites Families (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US5225539A (en) 1986-03-27 1993-07-06 Medical Research Council Recombinant altered antibodies and methods of making altered antibodies
US5132405A (en) 1987-05-21 1992-07-21 Creative Biomolecules, Inc. Biosynthetic antibody binding sites
US5091513A (en) 1987-05-21 1992-02-25 Creative Biomolecules, Inc. Biosynthetic antibody binding sites
JPS6412935A (en) 1987-07-02 1989-01-17 Mitsubishi Electric Corp Constant-speed travel device for vehicle
US5530101A (en) 1988-12-28 1996-06-25 Protein Design Labs, Inc. Humanized immunoglobulins
US5859205A (en) 1989-12-21 1999-01-12 Celltech Limited Humanised antibodies
US6436703B1 (en) 2000-03-31 2002-08-20 Hyseq, Inc. Nucleic acids and polypeptides
WO2016122865A1 (en) 2015-01-30 2016-08-04 Salk Institute For Biological Studies Compositions and methods for treating age-related diabetes and related disorders

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20120064100A1 (en) * 2009-03-18 2012-03-15 Simon Barry Biomarkers and uses thereof
US20140004107A1 (en) * 2012-05-18 2014-01-02 Amgen Inc. St2 antigen binding proteins

Non-Patent Citations (5)

* Cited by examiner, † Cited by third party
Title
BAPAT ET AL.: "Depletion of fat-resident Treg cells prevents age-associated insulin resistance.", NATURE, vol. 528, 3 December 2015 (2015-12-03), pages 137 - 141 *
CIPOLLETTA ET AL.: "PPARgamma is a major driver of the accumulation and phenotype of adipose-tissue Treg cells", NATURE, vol. 486, no. 7404, 28 June 2012 (2012-06-28), pages 549 - 553 *
FEUERER ET AL.: "Lean, but not obese, fat is enriched for a unique population of regulatory T cells that affect metabolic parameters", NATURE MEDICINE, vol. 15, 11 September 2008 (2008-09-11), pages 930 - 939 *
MILLER ET AL.: "IL -33 induces protective effects in adipose tissue inflammation during obesity in mice", CIRC RES., vol. 107, no. 5, 3 September 2010 (2010-09-03), pages 650 - 658 *
ZEYDA ET AL.: "Severe obesity increases adipose tissue expression of interleukin-33 and its receptor ST2, both predominantly detectable in endothelial cells of human adipose tissue", INTERNATIONAL JOURNAL OF OBESITY, vol. 37, 17 July 2012 (2012-07-17), pages 658 - 665 *

Cited By (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10093730B2 (en) 2014-11-10 2018-10-09 Genentech, Inc. Anti-interleukin-33 antibodies and uses thereof
US10723795B2 (en) 2014-11-10 2020-07-28 Genentech, Inc. Anti-interleukin-33 antibodies and uses thereof
US11708608B2 (en) 2014-11-10 2023-07-25 Genentech, Inc. Therapeutic and diagnostic methods for IL-33-mediated disorders
US11725050B2 (en) 2014-11-10 2023-08-15 Genentech, Inc. Anti-interleukin-33 antibodies and uses thereof
US11428697B2 (en) 2015-01-30 2022-08-30 Salk Institute For Biological Studies Compositions and methods for treating age-related diabetes and related disorders
US12253527B2 (en) 2015-01-30 2025-03-18 Salk Institute For Biological Studies Compositions and methods for treating age-related diabetes and related disorders
US11760797B2 (en) 2020-03-13 2023-09-19 Genentech, Inc. Anti-interleukin-33 antibodies and uses thereof

Also Published As

Publication number Publication date
US20180267059A1 (en) 2018-09-20
US12253527B2 (en) 2025-03-18
US20200141947A1 (en) 2020-05-07
US10539572B2 (en) 2020-01-21
US20230078590A1 (en) 2023-03-16
US11428697B2 (en) 2022-08-30

Similar Documents

Publication Publication Date Title
US12253527B2 (en) Compositions and methods for treating age-related diabetes and related disorders
Kelsen et al. Exome sequencing analysis reveals variants in primary immunodeficiency genes in patients with very early onset inflammatory bowel disease
Dart et al. Conserved γδ T cell selection by BTNL proteins limits progression of human inflammatory bowel disease
EP3974450A2 (en) Biomarker
JP2016515508A5 (en)
WO2017087784A1 (en) Tumor infiltrating lymphocytes for treatment of cancer
US20220017960A1 (en) Inflammation-enabling polypeptides and uses thereof
Wang et al. B-cell receptor repertoire: recent advances in autoimmune diseases
WO2020263192A1 (en) Method of identifying pro-inflammatory dendritic cells
JP2016525538A (en) Use of CD6 binding partners and methods based thereon
JP7778567B2 (en) Combination therapy of α4β7 inhibitor and IL-23 inhibitor
Visser et al. Acquisition of N-glycosylation sites in immunoglobulin heavy chain genes during local expansion in parotid salivary glands of primary Sjögren patients
Knox et al. One hundred thirty-four germ line PU. 1 variants and the agammaglobulinemic patients carrying them
HK1211042A1 (en) Inflammation-enabling polypeptides and uses thereof
US20160340731A1 (en) Method
EP4499875B1 (en) Biomarkers of il7r modulator activity
US20170072071A1 (en) Inflammation-enabling polypeptides and uses thereof
Boast et al. A point mutation in IKAROS ZF1 causes a B cell deficiency in mice
WO2016191289A2 (en) Biomarker for inflammatory disorders and uses thereof
Bank A Cohort of Anti-TNF Treated Danish Patients with Inflammatory Bowel Disease, Used for Identifying Genetic Markers Associated with Treatment Response: PhD Dissertation
Chapoval et al. Requirements for allergen-induced airway inflammation and hyperreactivity in CD4-deficient and CD4-sufficient HLA-DQ transgenic mice
WO2020178193A1 (en) Method of treatment of sarcoidosis
US20130195840A1 (en) Therapeutics and processes for treatment of immune disorders
US12618837B2 (en) Method of identifying pro-inflammatory dendritic cells
US20160326585A1 (en) Inflammation-enabling polypeptides and uses thereof

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 16743830

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 16743830

Country of ref document: EP

Kind code of ref document: A1