WO2016118538A1 - Functionalized protein-based materials and their uses - Google Patents

Functionalized protein-based materials and their uses Download PDF

Info

Publication number
WO2016118538A1
WO2016118538A1 PCT/US2016/013977 US2016013977W WO2016118538A1 WO 2016118538 A1 WO2016118538 A1 WO 2016118538A1 US 2016013977 W US2016013977 W US 2016013977W WO 2016118538 A1 WO2016118538 A1 WO 2016118538A1
Authority
WO
WIPO (PCT)
Prior art keywords
ubx
protein
composition
materials
seq
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2016/013977
Other languages
French (fr)
Inventor
Sarah BONDOS
Kayla BAYLESS
Kathleen MATTHEWS
Jan Patterson
Colette ABBEY
David Howell
Hao-Ching HSIAO
Kelly CHURION
Shang-Pu TSAI
Sandhya RAMASAMY
Dustin PORTERPAN
Kiera NORTHERN
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Texas A&M University System
William Marsh Rice University
Original Assignee
Texas A&M University System
William Marsh Rice University
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Texas A&M University System, William Marsh Rice University filed Critical Texas A&M University System
Priority to US15/544,216 priority Critical patent/US10947282B2/en
Publication of WO2016118538A1 publication Critical patent/WO2016118538A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/43504Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates
    • C07K14/43563Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates from insects
    • C07K14/43577Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates from insects from flies
    • C07K14/43581Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates from insects from flies from Drosophila
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/04Peptides having up to 20 amino acids in a fully defined sequence; Derivatives thereof
    • A61K38/08Peptides having 5 to 11 amino acids
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/1767Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/18Growth factors; Growth regulators
    • A61K38/1825Fibroblast growth factor [FGF]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/18Growth factors; Growth regulators
    • A61K38/1858Platelet-derived growth factor [PDGF]
    • A61K38/1866Vascular endothelial growth factor [VEGF]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/19Cytokines; Lymphokines; Interferons
    • A61K38/195Chemokines, e.g. RANTES
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/70Web, sheet or filament bases ; Films; Fibres of the matrix type containing drug
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/70Web, sheet or filament bases ; Films; Fibres of the matrix type containing drug
    • A61K9/7007Drug-containing films, membranes or sheets

Definitions

  • Proteins implement most of the vital molecular functions of living organisms, including providing structural support, generating energy, sensing biomolecules, and catalyzing, storing, and degrading important biomolecules. Proteins are particularly adept at highly specific molecular recognition, which can be adapted to bind virtually any ligand, ranging from small chemicals to specific types of cells. Such interactions are often regulated by the chemical environment, by binding additional ligands (allostery), or by post- translational modification of the protein.
  • Physically trapped proteins can be inactivated by the harsh chemical environment often used to instigate the assembly of the proteins into materials. Furthermore, the functional proteins are free to diffuse out of the materials. Although covalent crosslinking tethers functional proteins to the materials, the crosslinking agent can also inactivate the appended protein or remain embedded in the materials, rendering them toxic to cells. In addition, materials held together by non-covalent bonds may be too fragile for chemical modifications after assembly. Finally, depending on the specificity of the cross-linking strategy, some portion of the functional protein may be oriented such that the materials structure blocks ligand binding and hence protein function.
  • This method offers several advantages for incorporating functional proteins: (i) materials assembly and functionalization can be combined into a single step, (ii) stoichiometric levels of functionalization can be achieved, (iii) covalent attachment prevents loss of the functional protein due to diffusion, (iv) toxic by- products (remnants of chemical cross-linking) are not created, and (v) the functional proteins can be patterned within the materials.
  • all of the appended proteins have a uniform orientation, although there are only two possible points of attachment - the N- and C-termini of the self- assembling protein.
  • the gene fusion approach requires mild conditions for materials assembly that will not perturb the structure of the appended functional protein.
  • Embodiments of the invention are directed to Ubx-appended molecules that maintain their mechanical strength and properties even after being fused with Ubx.
  • Ubx fusions with VEGF and other growth factors, cell signaling proteins, and cell binding proteins can be used to induce angiogenesis.
  • Ubx fibers and mesh, embedded within a tissue engineering scaffold induce formation of vasculature within the scaffold. The presence of vasculature is necessary to provide oxygen and nutrients to other cells growing within the scaffold.
  • FIG. 1 shows a comparison of the fluorescence intensity of wild-type Ubx and several tyrosine mutants
  • FIG. 2 shows that EGFP-VEGF-Ubx fibers promote enhanced recruitment and migration of endothelial cells.
  • nanoscale to macroscale materials composed of the Drosophila melanogaster protein Ultrabithorax (Ubx) are generated. These materials are in the form of sheets, fibers, meshes, or fiber/mesh combinations.
  • Ubx materials are biocompatible and non-immunogenic. The materials have mechanical properties appropriate for tissue engineering.
  • the strength of Ubx materials derives from dityrosine covalent bonds that form spontaneously during assembly. Dityrosine bond content can be manipulated by mutagenesis to increase or decrease the strength of the materials.
  • Chemical functions can be easily incorporated into Ubx materials in two ways. First, a gene encoding a protein with a useful function can be fused to the gene encoding Ubx.
  • the resulting fusion gene when transformed into E. coli, produces a fusion protein encompassing the sequences of both the functional protein and Ubx.
  • Ubx fusion proteins retain the ability to assemble into materials. Furthermore, in the Ubx fusion proteins that have been tested thus far, the appended protein also retains its ability to function.
  • Ubx fusions including the VEGF protein can induce angiogenic behaviors in endothelial cells. Cells can be layered on Ubx fibers (endothelial cells on a fiber, smooth muscle cells on top of the endothelial cells) to mimic the layers of cells in blood vessels. Additionally, fiber/mesh structures in which the morphology resembles that of a vascular bed can also be created.
  • VEGF-Ubx fibers when placed on top of a chicken embryo, induce the formation of vasculature.
  • the Ubx protein contains a DNA binding domain, and this domain remains folded and capable of binding DNA in a sequence-specific manner in Ubx materials. DNA sequences with multiple Ubx binding sites remain bound to Ubx materials for over a week, even though the Ubx-DNA interaction is non-covalent. A DNA bound to Ubx fibers will orient such that the region with the most Ubx binding sites is facing the fiber.
  • Ubx fusions with VEGF and other growth factors, cell signaling proteins, and cell binding proteins can be used to induce angiogenesis.
  • Ubx fibers and mesh, embedded within a tissue engineering scaffold should induce formation of vasculature within the scaffold. The presence of vasculature is necessary to provide oxygen and nutrients to other cells growing within the scaffold. Because all of the proteins that induce vasculature formation (angiogenic proteins) are only located on Ubx materials, they will not misinstruct cells in other locations in the scaffold (e.g., liver cells will not be instructed to become blood vessels). Because the angiogenic proteins are covalently bound to Ubx materials, they cannot diffuse away, thus losing the instructions or "fuzzing" the pattern.
  • Ubx assembly and properties Ubx self-assembles rapidly in gentle buffers to form films and fibers.
  • Ubx materials are biocompatible, strong, and remarkably extensible.
  • proteins fused to Ubx retain their activity once incorporated into materials.
  • the proteins fused to Ubx were selected to test a range of sizes, structures, stabilities, solubility, and charges. It was found that the appended protein had a large effect on protein production, with the solubility and quaternary structure of the appended protein being the best predictors for success. In contrast, the ability to self-assemble into materials was dominated by Ubx, and the presence or identity of a fused protein had little impact on materials assembly.
  • Ubx is unique in that it contains a DNA binding domain.
  • dityrosine provides an opportunity to manipulate the properties of Ubx materials by controlling dityrosine bond formation. Controlling dityrosine bond formation makes the Ubx protein easier to manipulate in the context of a fusion protein.
  • Ubx has 15 tyrosine residues.
  • Ubx When bound to DNA, Ubx can oligomerize in multiple orientations: side-to-side cooperative interactions when binding to linear DNA, and back-to-back interactions between clusters of cooperatively bound Ubx proteins to form the stem of a DNA loop.
  • Ubx fibers retain the ability to bind DNA, it is possible that interactions used on a small scale to enable cooperative DNA binding and DNA loop formation in vivo may also be applied on a much larger scale to form Ubx materials in vitro: side-to-side interactions to form nanoscale fibrils, and back-to-back inter- actions to allow the fibrils to interact to form films and fibers.
  • FIG. 1 shows that the mutants Y4S + Y12S + Y240S, Y240S + Y296L, Y100S + Y240S + Y296L, and Y293L + Y296L + Y310L all show a loss of 250 fluorescence units per micrometer when compared to Ubx, suggesting a loss of more than one tyrosine bond
  • mutation of tyrosines Y52 and Y85 which were not predicted to be involved in dityrosine bonds has no effect either in wild-type Ubx or in the Y296 background.
  • the below sequences are recommended for transfer to other proteins to create dityrosine bonds.
  • the homeodomain LRRRGRQTYTYQTLELEKE FHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKEI; SEQ ID NO: 1
  • MNSYFEQA MNSYFEQA
  • the full length Ubx protein is used to create a fusion protein.
  • the Ubx protein that is used to form a Ubx fusion protein is a combination of SEQ ID NO: 1 and SEQ ID NO:2, or a combination of SEQ ID NO:3 and SEQ ID NO: 4.
  • Ubx fusion proteins are used to create materials that induce damaged endothelium in blood vessels to heal.
  • Clogged arteries are typically re-opened by angioplasty, in which a balloon is inflated to open the artery, and a stent placed to hold the artery open. Both the initial damage and deployment of the stent damage the endothelial lining and can cause a clot to form, thus re-blocking the artery.
  • Stents coated in functionalized Ubx materials have been shown to cause a new, healthy endothelial layer to form and prevent clot formation.
  • Ultrabithorax (Ubx) protein molecules have the ability to self- assemble. Ubx materials can be functionalized 1) more easily and cheaply 2) with defined orientations of the functional molecules and 3) with a greater range of functional molecules than other materials. This characteristic of Ubx proteins makes it possible to create protein composite materials that are not otherwise available.
  • a Ubx fusion protein with VEGF is created. This fusion is made with either the full length Ubx protein, a combination of SEQ ID NO: 1 and SEQ ID NO:2, or a combination of SEQ ID NO:3 and SEQ ID NO: 4.
  • VEGF-Ubx vascular endothelial growth factor
  • Ubx ultrabithorax
  • FIG. 2 shows quantification of the number of cells/100 ⁇ distance attached to EGFP-Ubx vs. EGFP- VEGF-Ubx fibers. A significantly greater number of cells migrated onto EGFP- VEGF- Ubx fibers when compared to control EGFP-Ubx fibers, indicating that VEGF-Ubx materials stimulated migration of ECs in low serum conditions. This approach provides an inexpensive and facile mechanism to stimulate and pattern angiogenesis.
  • the gene of the functional protein, followed by DNA encoding a flexible, water soluble linker, followed by the ubx gene, are placed in tandem without intervening stop codons.
  • the linker DNA encodes alternating glycine and serine residues. Glycine provides flexibility and serine provides water solubility.
  • This fusion gene is cloned into the pET-19b plasmid (it should be noted that other plasmids work equally well).
  • the plasmid is transformed into E. coli.
  • E. coli are fermented until the optical density reaches ⁇ 0.6 - 0.7, and then production of the fusion protein is induced with 1 mM IPTG. Depending on the solubility and stability of the fusion protein, the E. coli are allowed to produce the fusion protein between 2 and 16 hours.
  • Fibers are wrapped around a structural support and dipped into a buffer containing DNA.
  • the DNA sequence needs to contain at least one Ubx binding sequence to adhere to Ubx materials.
  • Ubx monomers are incubated with DNA prior to materials assembly. Both the Ubx and DNA concentrations need to be higher than 160 pM, the affinity constant. Embedding Ubx materials in scaffolds
  • Ubx fibers are wrapped around a supporting structure (e.g. a plastic inoculation loop) or Ubx film is supported by the loop (think about soapy water in a bubble wand).
  • the Ubx materials are then placed in a container, such as a well in a cell culture plate.
  • the scaffold material e.g., collagen
  • Ubx film is allowed to dry in air. We generally use inoculation loops to support the film, but other supports (e.g. plastic coated paper clips) work as well. Creating layers of cells on Ubx materials
  • Ubx fibers are dipped in the first cell type (endothelial cells) and the cells are allowed to attach. Subsequently, the fibers are moved to a culture containing the second cell type (smooth muscle cells) and these are given the opportunity to attach. Creating Ubx materials in structures that look like vascular beds
  • Ubx fibers are wrapped around an inoculation loop or other support.
  • the loop is used to pick up a Ubx film. When the film dries, the structure is complete.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Animal Behavior & Ethology (AREA)
  • Epidemiology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Zoology (AREA)
  • Immunology (AREA)
  • Insects & Arthropods (AREA)
  • Organic Chemistry (AREA)
  • Vascular Medicine (AREA)
  • Toxicology (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Peptides Or Proteins (AREA)

Abstract

Embodiments of the invention are directed to Ubx-fusion molecules that maintain their mechanical strength and properties even after being fused with Ubx. Ubx fusions with VEGF and other growth factors, cell signaling proteins, and cell binding proteins can be used to induce angiogenesis. Ubx fibers and mesh, embedded within a tissue engineering scaffold, induce formation of vasculature within the scaffold. The presence of vasculature is necessary to provide oxygen and nutrients to other cells growing within the scaffold.

Description

FUNCTIONALIZED PROTEIN-BASED MATERIALS AND THEIR USES
CROSS-REFERENCES TO RELATED APPLICATIONS
[0001] This application claims the benefit under 35 U.S.C. § 119(e) of U.S.
Provisional Patent Application No. 62/105,132, filed January 19, 2015, which is incorporated herein by reference in its entirety as if fully set forth herein.
STATEMENT REGARDING FEDERALLY-SPONSORED RESEARCH OR
DEVELOPMENT
[0002] This invention was made with government support under Grant No.
R01HL095786 awarded by The National Institutes of Health and Grant No. R3E821 awarded by the National Science Foundation. The government has certain rights in the invention.
BACKGROUND
[0003] Proteins implement most of the vital molecular functions of living organisms, including providing structural support, generating energy, sensing biomolecules, and catalyzing, storing, and degrading important biomolecules. Proteins are particularly adept at highly specific molecular recognition, which can be adapted to bind virtually any ligand, ranging from small chemicals to specific types of cells. Such interactions are often regulated by the chemical environment, by binding additional ligands (allostery), or by post- translational modification of the protein.
[0004] Devices that capture proteins in materials have the potential to mimic these functions and be regulated by eternally applied factors. However, this approach is technically challenging. The three-dimensional structures of proteins are maintained by non-covalent bonds, which are sensitive to the surrounding medium. Perturbations of this chemical environment can easily result in loss of protein function. Proteins are commonly
incorporated into materials either by physically trapping them within the matrix of the materials during assembly or by covalently crosslinking them to the surface of the materials post-assembly. Both of these approaches can result in the loss of functional proteins.
Physically trapped proteins can be inactivated by the harsh chemical environment often used to instigate the assembly of the proteins into materials. Furthermore, the functional proteins are free to diffuse out of the materials. Although covalent crosslinking tethers functional proteins to the materials, the crosslinking agent can also inactivate the appended protein or remain embedded in the materials, rendering them toxic to cells. In addition, materials held together by non-covalent bonds may be too fragile for chemical modifications after assembly. Finally, depending on the specificity of the cross-linking strategy, some portion of the functional protein may be oriented such that the materials structure blocks ligand binding and hence protein function.
[0005] For materials composed of recombinant proteins, the use of protein fusions provides an attractive alternative. By fusing a gene encoding a functional protein to a gene encoding a self-assembling protein, a single polypeptide can be produced that contains the sequences of both proteins. This fusion protein should retain both the functional and self- assembly properties of the parent proteins. This method offers several advantages for incorporating functional proteins: (i) materials assembly and functionalization can be combined into a single step, (ii) stoichiometric levels of functionalization can be achieved, (iii) covalent attachment prevents loss of the functional protein due to diffusion, (iv) toxic by- products (remnants of chemical cross-linking) are not created, and (v) the functional proteins can be patterned within the materials. In addition, all of the appended proteins have a uniform orientation, although there are only two possible points of attachment - the N- and C-termini of the self- assembling protein. The gene fusion approach requires mild conditions for materials assembly that will not perturb the structure of the appended functional protein. [0006] Not every functional protein is a good candidate for incorporation into materials via gene fusion. Unstable or insoluble functional proteins could hamper expression of the fusion protein, or large/multimeric functional proteins may misposition the self- assembling protein, thus altering the mechanical properties of the materials or even preventing materials assembly. Thus, it is important for any functional protein to maintain its stability and properties.
SUMMARY
[0007] Embodiments of the invention are directed to Ubx-appended molecules that maintain their mechanical strength and properties even after being fused with Ubx. Ubx fusions with VEGF and other growth factors, cell signaling proteins, and cell binding proteins can be used to induce angiogenesis. Ubx fibers and mesh, embedded within a tissue engineering scaffold, induce formation of vasculature within the scaffold. The presence of vasculature is necessary to provide oxygen and nutrients to other cells growing within the scaffold.
BRIEF DESCRIPTION OF THE DRAWINGS
[0008] FIG. 1 shows a comparison of the fluorescence intensity of wild-type Ubx and several tyrosine mutants; and
[0009] FIG. 2 shows that EGFP-VEGF-Ubx fibers promote enhanced recruitment and migration of endothelial cells.
DETAILED DESCRIPTION
[00010] In an embodiment of the claimed invention, nanoscale to macroscale materials composed of the Drosophila melanogaster protein Ultrabithorax (Ubx) are generated. These materials are in the form of sheets, fibers, meshes, or fiber/mesh combinations. Ubx materials are biocompatible and non-immunogenic. The materials have mechanical properties appropriate for tissue engineering. The strength of Ubx materials derives from dityrosine covalent bonds that form spontaneously during assembly. Dityrosine bond content can be manipulated by mutagenesis to increase or decrease the strength of the materials. Chemical functions can be easily incorporated into Ubx materials in two ways. First, a gene encoding a protein with a useful function can be fused to the gene encoding Ubx. The resulting fusion gene, when transformed into E. coli, produces a fusion protein encompassing the sequences of both the functional protein and Ubx. Ubx fusion proteins retain the ability to assemble into materials. Furthermore, in the Ubx fusion proteins that have been tested thus far, the appended protein also retains its ability to function. Ubx fusions including the VEGF protein can induce angiogenic behaviors in endothelial cells. Cells can be layered on Ubx fibers (endothelial cells on a fiber, smooth muscle cells on top of the endothelial cells) to mimic the layers of cells in blood vessels. Additionally, fiber/mesh structures in which the morphology resembles that of a vascular bed can also be created. VEGF-Ubx fibers, when placed on top of a chicken embryo, induce the formation of vasculature.
[00011] The Ubx protein contains a DNA binding domain, and this domain remains folded and capable of binding DNA in a sequence-specific manner in Ubx materials. DNA sequences with multiple Ubx binding sites remain bound to Ubx materials for over a week, even though the Ubx-DNA interaction is non-covalent. A DNA bound to Ubx fibers will orient such that the region with the most Ubx binding sites is facing the fiber.
[00012] Ubx fusions with VEGF and other growth factors, cell signaling proteins, and cell binding proteins can be used to induce angiogenesis. Ubx fibers and mesh, embedded within a tissue engineering scaffold, should induce formation of vasculature within the scaffold. The presence of vasculature is necessary to provide oxygen and nutrients to other cells growing within the scaffold. Because all of the proteins that induce vasculature formation (angiogenic proteins) are only located on Ubx materials, they will not misinstruct cells in other locations in the scaffold (e.g., liver cells will not be instructed to become blood vessels). Because the angiogenic proteins are covalently bound to Ubx materials, they cannot diffuse away, thus losing the instructions or "fuzzing" the pattern.
[00013] Several proteins have been fused to Ubx to examine their impact on
Ubx assembly and properties. Ubx self-assembles rapidly in gentle buffers to form films and fibers. Ubx materials are biocompatible, strong, and remarkably extensible. Furthermore, proteins fused to Ubx retain their activity once incorporated into materials. The proteins fused to Ubx were selected to test a range of sizes, structures, stabilities, solubility, and charges. It was found that the appended protein had a large effect on protein production, with the solubility and quaternary structure of the appended protein being the best predictors for success. In contrast, the ability to self-assemble into materials was dominated by Ubx, and the presence or identity of a fused protein had little impact on materials assembly. Although the appended protein can alter the mechanical properties of the materials, these properties, like those of Ubx fibers, (i) can be adjusted by varying fiber diameter and (ii) remain similar to the extracellular matrix protein elastin. In addition, unlike other self-assembling proteins found in nature, Ubx is unique in that it contains a DNA binding domain. [00014] The presence of dityrosine provides an opportunity to manipulate the properties of Ubx materials by controlling dityrosine bond formation. Controlling dityrosine bond formation makes the Ubx protein easier to manipulate in the context of a fusion protein. Ubx has 15 tyrosine residues. The identity of tyrosines contributing to a single bond may vary, and more than one dityrosine bond may be present in the materials, creating an enormous array of possible bond arrangements. When bound to DNA, Ubx can oligomerize in multiple orientations: side-to-side cooperative interactions when binding to linear DNA, and back-to-back interactions between clusters of cooperatively bound Ubx proteins to form the stem of a DNA loop. Because Ubx fibers retain the ability to bind DNA, it is possible that interactions used on a small scale to enable cooperative DNA binding and DNA loop formation in vivo may also be applied on a much larger scale to form Ubx materials in vitro: side-to-side interactions to form nanoscale fibrils, and back-to-back inter- actions to allow the fibrils to interact to form films and fibers.
[00015] Two dityrosine bonds in Ubx are identified by site-directed mutagenesis followed by measurements of fiber fluorescence intensity. One bond is located between the N-terminus and the homeodomain (Y4/Y296, Y12/Y293), and another bond is formed by Y167 and Y240. The intensity of blue fluorescence corresponds with
immunostaining using the antidityrosine primary antibody (confirming that changes in fiber fluorescence directly correspond to alterations in dityrosine content). FIG. 1 shows that the mutants Y4S + Y12S + Y240S, Y240S + Y296L, Y100S + Y240S + Y296L, and Y293L + Y296L + Y310L all show a loss of 250 fluorescence units per micrometer when compared to Ubx, suggesting a loss of more than one tyrosine bond However, mutation of tyrosines Y52 and Y85, which were not predicted to be involved in dityrosine bonds has no effect either in wild-type Ubx or in the Y296 background.
[00016] The Y167S and Y240S mutations both reduce fluorescence to a similar degree, suggesting that Y167 and Y240 participate in the same dityrosine bond. To test this hypothesis, a Y167S + Y240S double mutant was created. No further reduction in fluorescence was observed for the Y167S + Y240S double mutant (FIG. 1), suggesting that Y167 and Y240 form a single dityrosine bond. The Y167S + Y240S bond is responsible for a significant portion of the observed fluorescence in Ubx fibers (200/360 fluorescence units per micrometer).
[00017] Fiber fluorescence closely correlates with fiber strength, demonstrating that these bonds are intermolecular. The percentage of Ubx molecules harboring both bonds can be decreased or increased by mutagenesis, providing an additional mechanism to control the mechanical properties of Ubx materials. Duplication of tyrosine-containing motifs in Ubx increases dityrosine content in Ubx fibers, suggesting these motifs could be inserted in other self-assembling proteins to strengthen the corresponding materials. [00018] Since adding an entire region of the Ubx protein might not be feasible for some self-assembling proteins, shorter sequences have been identified to replace the large insertion. The sequences surrounding tyrosines that form dityrosine bonds must contribute to interaction specificity, and thus would need to be transferred to the heterologous system. Based on Ubx sequence conservation, structure/disorder data, and the predicted propensity to engage in protein interactions, the below sequences are recommended for transfer to other proteins to create dityrosine bonds. For protein systems that can accommodate large insertions, the homeodomain (LRRRGRQTYTYQTLELEKE FHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKEI; SEQ ID NO: 1) and the N-terminus (MNSYFEQA; SEQ ID NO: 2) are used. As an additional benefit, the solubility and stability of the homeodomain is expected to improve protein production when fused to a self-assembling protein. For protein systems that can only tolerate small insertions or that self-assemble upon exposure to denaturing conditions, the conserved motifs surrounding residues 167 ( VRPS ACTPDSRVGGYLDTS ; SEQ ID NO: 3) and 240 (FYPWMAIA; SEQ ID NO: 4) are used. Thus the specific dityrosine -bond forming motifs in Ubx have the potential to be a useful tool for engineering the fluorescent and mechanical properties of other protein systems.
[00019] In certain embodiments of the claimed invention, the full length Ubx protein is used to create a fusion protein. In other embodiments of the invention, the Ubx protein that is used to form a Ubx fusion protein is a combination of SEQ ID NO: 1 and SEQ ID NO:2, or a combination of SEQ ID NO:3 and SEQ ID NO: 4.
[00020] In certain embodiments, Ubx fusion proteins are used to create materials that induce damaged endothelium in blood vessels to heal. Clogged arteries are typically re-opened by angioplasty, in which a balloon is inflated to open the artery, and a stent placed to hold the artery open. Both the initial damage and deployment of the stent damage the endothelial lining and can cause a clot to form, thus re-blocking the artery. Stents coated in functionalized Ubx materials have been shown to cause a new, healthy endothelial layer to form and prevent clot formation.
[00021] Because 3-dimensional structures can be easily designed and created using DNA, many materials are composed of DNA, or materials decorated with DNA with some engineered function. Since proteins can expand the possible functions or allow creation of more exotic shapes, there is interest in creating protein/DNA composite materials. Current approaches are to chemically crosslink protein to DNA (a method that is expensive, generates toxic byproducts, and possesses a geometry that is difficult to control), or to append a string of positively charged amino acids to the protein to get DNA to non-specifically bind (a method that has no control over geometry or orientation, and the binding is low affinity). On the other hand, Ubx materials bind DNA in a sequence specific manner, meaning there is control over affinity, patterning, and orientation. In certain embodiments, Ubx materials are coated in DNA sensors. Both the orientation of the DNA and the affinity of Ubx materials for DNA increases the sensitivity of these devices.
[00022] Ultrabithorax (Ubx) protein molecules have the ability to self- assemble. Ubx materials can be functionalized 1) more easily and cheaply 2) with defined orientations of the functional molecules and 3) with a greater range of functional molecules than other materials. This characteristic of Ubx proteins makes it possible to create protein composite materials that are not otherwise available.
[00023] It has previously been established that materials with Ubx fusion proteins can be made. However, the proteins used in those studies were small, stable, highly soluble, and monomeric and thus likely to succeed. Since that time, materials with large, less soluble, and/or multimeric proteins have been made, greatly expanding the range of proteins that can be used.
[00024] In certain embodiments of the invention, a Ubx fusion protein with VEGF is created. This fusion is made with either the full length Ubx protein, a combination of SEQ ID NO: 1 and SEQ ID NO:2, or a combination of SEQ ID NO:3 and SEQ ID NO: 4. Studies with VEGF-Ubx (VEGF is a dimer) demonstrate that the fused protein is still active. VEGF-Ubx fibers induce formation of vasculature. Fusing the gene encoding vascular endothelial growth factor (VEGF) with the ultrabithorax (Ubx) gene, to produce fusion proteins capable of self-assembly into materials. VEGF-Ubx materials enhance human endothelial cell migration and prolong cell survival. FIG. 2 shows quantification of the number of cells/100 μιη distance attached to EGFP-Ubx vs. EGFP- VEGF-Ubx fibers. A significantly greater number of cells migrated onto EGFP- VEGF- Ubx fibers when compared to control EGFP-Ubx fibers, indicating that VEGF-Ubx materials stimulated migration of ECs in low serum conditions. This approach provides an inexpensive and facile mechanism to stimulate and pattern angiogenesis. [00025] Embodiments of the invention can be understood by reference to the following examples:
Creating protein fusions
[00026] The gene of the functional protein, followed by DNA encoding a flexible, water soluble linker, followed by the ubx gene, are placed in tandem without intervening stop codons. The linker DNA encodes alternating glycine and serine residues. Glycine provides flexibility and serine provides water solubility. This fusion gene is cloned into the pET-19b plasmid (it should be noted that other plasmids work equally well). The plasmid is transformed into E. coli. E. coli are fermented until the optical density reaches ~ 0.6 - 0.7, and then production of the fusion protein is induced with 1 mM IPTG. Depending on the solubility and stability of the fusion protein, the E. coli are allowed to produce the fusion protein between 2 and 16 hours.
Coating the surface of materials with DNA
[00027] Fibers are wrapped around a structural support and dipped into a buffer containing DNA. The DNA sequence needs to contain at least one Ubx binding sequence to adhere to Ubx materials.
Embedding DNA in the materials
[00028] Ubx monomers are incubated with DNA prior to materials assembly. Both the Ubx and DNA concentrations need to be higher than 160 pM, the affinity constant. Embedding Ubx materials in scaffolds
[00029] Ubx fibers are wrapped around a supporting structure (e.g. a plastic inoculation loop) or Ubx film is supported by the loop (think about soapy water in a bubble wand). The Ubx materials are then placed in a container, such as a well in a cell culture plate. The scaffold material (e.g., collagen) is then polymerized around the Ubx materials. Creating Ubx mesh
[00030] Ubx film is allowed to dry in air. We generally use inoculation loops to support the film, but other supports (e.g. plastic coated paper clips) work as well. Creating layers of cells on Ubx materials
[00031] Ubx fibers are dipped in the first cell type (endothelial cells) and the cells are allowed to attach. Subsequently, the fibers are moved to a culture containing the second cell type (smooth muscle cells) and these are given the opportunity to attach. Creating Ubx materials in structures that look like vascular beds
[00032] Ubx fibers are wrapped around an inoculation loop or other support. The loop is used to pick up a Ubx film. When the film dries, the structure is complete.
[00033] While the invention has been particularly shown and described with references to example embodiments thereof, it will be understood by those skilled in the art that various changes in form and details may be made therein without departing from the scope of the invention encompassed by the appended claims.

Claims

CLAIMS: What is claimed is:
1. A composition comprising at least one Ubx protein coupled with a first biomolecule.
2. The composition of claim 1, wherein the first biomolecule is coupled with the Ubx protein with a linker.
3. The composition of claim 1, wherein the first biomolecule is a monomelic protein.
4. The composition of claim 1, wherein the first biomolecule is a multimeric protein.
5. The composition of claim 1, further comprising a second biomolecule.
6. The composition of claim 5, wherein the second biomolecule is a highly soluble protein or an additional functional protein.
7. The composition of claim 1, wherein the Ubx protein contains mutations within tyrosine residues involved in the formation of di-tyrosine bonds.
8. The composition of claim 1, wherein the Ubx protein contains mutations within tyrosine residues that are not involved in the formation of di-tyrosine bonds.
9. The composition of claim 1, wherein the dityrosine content is lower than in the wild type protein.
10. The composition of claim 1, wherein the dityrosine content is greater than in the wild type protein.
11. The composition of claim 1, wherein the first biomolecule is VEGF, FGF or SDF-1.
12. The composition of claim 1, wherein the composition is incorporated into a structure.
13. The composition of claim 12, wherein the structure is a mesh, film, fiber or a combination thereof.
14. The composition of claim 12, wherein the structure is coated with a protein.
15. The composition of claim 12, wherein the structure is coupled with DNA.
16. The composition of claim 14, wherein the protein promotes angiogenesis.
17. The composition of claim 14, wherein the protein activates a signaling pathway.
18. The composition of claim 17, wherein the signaling pathway is the VEGF signaling pathway.
19. The composition of claim 1, wherein the Ubx protein is selected from the group consisting of the full length protein, SEQ ID NO: 1, SEQ ID NO:2, SEQ IS NO:3 and SEQ ID NO: 4.
20. The composition of claim 1, wherein the Ubx protein is selected from the group consisting of the combination of SEQ ID NO: 1 and SEQ ID NO: 2 and the combination of the SEQ ID NO:3 and SEQ ID NO:4.
PCT/US2016/013977 2015-01-19 2016-01-20 Functionalized protein-based materials and their uses Ceased WO2016118538A1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US15/544,216 US10947282B2 (en) 2015-01-19 2016-01-20 Functionalized protein-based materials and their uses

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201562105132P 2015-01-19 2015-01-19
US62/105,132 2015-01-19

Publications (1)

Publication Number Publication Date
WO2016118538A1 true WO2016118538A1 (en) 2016-07-28

Family

ID=56417661

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2016/013977 Ceased WO2016118538A1 (en) 2015-01-19 2016-01-20 Functionalized protein-based materials and their uses

Country Status (2)

Country Link
US (1) US10947282B2 (en)
WO (1) WO2016118538A1 (en)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20180124219A (en) * 2017-05-11 2018-11-21 서울대학교산학협력단 Self assembly nanostructure of organic semiconductor and method for preparing the same

Families Citing this family (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2010057032A2 (en) * 2008-11-14 2010-05-20 The Texas A & M University System Self-assembly of protein-based biomaterials with multiple morphologies
US12344638B2 (en) * 2019-04-02 2025-07-01 Bondwell Technologies Lp Functionalized UBX protein materials for enhanced purification of antibodies
JP2024505555A (en) 2021-02-02 2024-02-06 ボンドウェル テクノロジーズ エルピー Protein-based materials for biocatalysis

Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20030027751A1 (en) * 2001-04-10 2003-02-06 Genvec, Inc. VEGF fusion proteins
US20040029280A1 (en) * 1997-03-14 2004-02-12 Selective Genetics, Inc. Viral vectors with modified tropism
US20100143436A1 (en) * 2008-11-14 2010-06-10 Bondos Sarah E Self-assembly of protein-based biomaterials with multiple morphologies
US20130302400A1 (en) * 2012-04-04 2013-11-14 Daniel C. Maneval Combination therapy with an anti-hyaluronan agent and therapeutic agent

Patent Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20040029280A1 (en) * 1997-03-14 2004-02-12 Selective Genetics, Inc. Viral vectors with modified tropism
US20030027751A1 (en) * 2001-04-10 2003-02-06 Genvec, Inc. VEGF fusion proteins
US20100143436A1 (en) * 2008-11-14 2010-06-10 Bondos Sarah E Self-assembly of protein-based biomaterials with multiple morphologies
US20130302400A1 (en) * 2012-04-04 2013-11-14 Daniel C. Maneval Combination therapy with an anti-hyaluronan agent and therapeutic agent

Non-Patent Citations (5)

* Cited by examiner, † Cited by third party
Title
CROSS ET AL.: "FGF and VEGF function in angiogenesis: signalling pathways, biological responses and therapeutic inhibition.", TRENDS PHARMACOL SCI., vol. 22, no. 4, 2001, pages 201 - 207 *
DATABASE NCBI [o] 23 February 1997 (1997-02-23), "PIR_B27867, homeotic protein Ultrabithorax - fruit fly (Drosophila melanogaster) (fragment).", Database accession no. B27867. *
DATABASE UniProtKB [o] 28 November 2006 (2006-11-28), "UniProtKB_Q964V4, Ubx protein.", Database accession no. Q964V4 *
ENDRIZZI ET AL.: "Specific covalent immobilization of proteins through dityrosine cross-links.", LANGMUIR., vol. 22, no. 26, 2006, pages 11305 - 11310 *
PASSNER ET AL.: "Structure of a DNA-bound Ultrabithorax-Extradenticle homeodomain complex.", NATURE, vol. 397, no. 6721, 1999, pages 714 - 719 *

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20180124219A (en) * 2017-05-11 2018-11-21 서울대학교산학협력단 Self assembly nanostructure of organic semiconductor and method for preparing the same
KR102015805B1 (en) 2017-05-11 2019-08-29 서울대학교산학협력단 Self assembly nanostructure of organic semiconductor and method for preparing the same

Also Published As

Publication number Publication date
US10947282B2 (en) 2021-03-16
US20180222949A1 (en) 2018-08-09

Similar Documents

Publication Publication Date Title
Wang et al. Protein‐engineered functional materials
Dhavalikar et al. Review of integrin‐targeting biomaterials in tissue engineering
Katyal et al. Recent trends in peptide and protein-based hydrogels
Rahmany et al. Biomimetic approaches to modulate cellular adhesion in biomaterials: A review
Sakiyama-Elbert et al. Functional biomaterials: design of novel biomaterials
US10947282B2 (en) Functionalized protein-based materials and their uses
Loo et al. Self‐assembled proteins and peptides as scaffolds for tissue regeneration
Acosta et al. Elastin‐like recombinamers: deconstructing and recapitulating the functionality of Extracellular Matrix proteins using recombinant protein polymers
Girotti et al. Recombinant technology in the development of materials and systems for soft‐tissue repair
DiMarco et al. Multifunctional materials through modular protein engineering
Kielty et al. Applying elastic fibre biology in vascular tissue engineering
Zisch et al. Covalently conjugated VEGF–fibrin matrices for endothelialization
Ratner et al. Biomaterials: where we have been and where we are going
Annabi et al. Elastomeric recombinant protein-based biomaterials
Lynn Peeling back the layers: controlled erosion and triggered disassembly of multilayered polyelectrolyte thin films
Mardilovich et al. Biomimetic peptide− amphiphiles for functional biomaterials: the role of GRGDSP and PHSRN
Fernandes et al. Extracellular matrix and tissue engineering applications
Di Foggia et al. Self-assembling peptides for biomedical applications: IR and Raman spectroscopies for the study of secondary structure
Park et al. In situ SVVYGLR peptide conjugation into injectable gelatin-poly (ethylene glycol)-tyramine hydrogel via enzyme-mediated reaction for enhancement of endothelial cell activity and neo-vascularization
Joddar et al. Biological modifications of materials surfaces with proteins for regenerative medicine
Murschel et al. Coiled-coil-mediated grafting of bioactive vascular endothelial growth factor
AU2006347951A1 (en) Multilayer films, coatings and microcapsules comprising polypeptides
CN105873594A (en) Cross-linked nodular elastin-containing material
Lee et al. Engineered phage matrix stiffness-modulating osteogenic differentiation
Ito et al. Bio-orthogonal and combinatorial approaches for the design of binding growth factors

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 16740615

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 16740615

Country of ref document: EP

Kind code of ref document: A1