WO2016116550A1 - An immunotoxin for use in the treatment of leishmaniasis - Google Patents

An immunotoxin for use in the treatment of leishmaniasis Download PDF

Info

Publication number
WO2016116550A1
WO2016116550A1 PCT/EP2016/051208 EP2016051208W WO2016116550A1 WO 2016116550 A1 WO2016116550 A1 WO 2016116550A1 EP 2016051208 W EP2016051208 W EP 2016051208W WO 2016116550 A1 WO2016116550 A1 WO 2016116550A1
Authority
WO
WIPO (PCT)
Prior art keywords
immunotoxin
inhibitors
cell killing
cell
component
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2016/051208
Other languages
French (fr)
Inventor
Stefan Barth
Theophilus THEPEN
Manoel BARRAL-NETTO
Aldina Barral
Johan VAN WEYENBERGH
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Fraunhofer Gesellschaft zur Foerderung der Angewandten Forschung eV
Original Assignee
Fraunhofer Gesellschaft zur Foerderung der Angewandten Forschung eV
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Fraunhofer Gesellschaft zur Foerderung der Angewandten Forschung eV filed Critical Fraunhofer Gesellschaft zur Foerderung der Angewandten Forschung eV
Priority to US15/542,549 priority Critical patent/US20170369574A1/en
Priority to BR112017014616A priority patent/BR112017014616A2/en
Publication of WO2016116550A1 publication Critical patent/WO2016116550A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/283Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against Fc-receptors, e.g. CD16, CD32, CD64
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • A61K47/6811Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a protein or peptide, e.g. transferrin or bleomycin
    • A61K47/6817Toxins
    • A61K47/6819Plant toxins
    • A61K47/6825Ribosomal inhibitory proteins, i.e. RIP-I or RIP-II, e.g. Pap, gelonin or dianthin
    • A61K47/6827Ricin A
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • A61K47/6811Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a protein or peptide, e.g. transferrin or bleomycin
    • A61K47/6817Toxins
    • A61K47/6829Bacterial toxins, e.g. diphteria toxins or Pseudomonas exotoxin A
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6849Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P33/00Antiparasitic agents
    • A61P33/02Antiprotozoals, e.g. for leishmaniasis, trichomoniasis, toxoplasmosis
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/10Transferases (2.)
    • C12N9/1048Glycosyltransferases (2.4)
    • C12N9/1077Pentosyltransferases (2.4.2)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/24Hydrolases (3) acting on glycosyl compounds (3.2)
    • C12N9/2497Hydrolases (3) acting on glycosyl compounds (3.2) hydrolysing N- glycosyl compounds (3.2.2)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y204/00Glycosyltransferases (2.4)
    • C12Y204/02Pentosyltransferases (2.4.2)
    • C12Y204/02036NAD(+)--diphthamide ADP-ribosyltransferase (2.4.2.36)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y302/00Hydrolases acting on glycosyl compounds, i.e. glycosylases (3.2)
    • C12Y302/02Hydrolases acting on glycosyl compounds, i.e. glycosylases (3.2) hydrolysing N-glycosyl compounds (3.2.2)
    • C12Y302/02022Hydrolases acting on glycosyl compounds, i.e. glycosylases (3.2) hydrolysing N-glycosyl compounds (3.2.2) rRNA N-glycosylase (3.2.2.22)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/035Fusion polypeptide containing a localisation/targetting motif containing a signal for targeting to the external surface of a cell, e.g. to the outer membrane of Gram negative bacteria, GPI- anchored eukaryote proteins
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/10Fusion polypeptide containing a localisation/targetting motif containing a tag for extracellular membrane crossing, e.g. TAT or VP22
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/55Fusion polypeptide containing a fusion with a toxin, e.g. diphteria toxin
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/70Fusion polypeptide containing domain for protein-protein interaction
    • C07K2319/74Fusion polypeptide containing domain for protein-protein interaction containing a fusion for binding to a cell surface receptor

Definitions

  • the present invention pertains to an immunotoxin for use in the treatment of leishmaniasis.
  • Leishmaniasis is a neglected infectious disease, despite the 1.5-2.0 million new cases every year and a population of 350 million at risk [ l]-[3] .
  • the causative agent is a protozoan parasite from the genus Leishmania, transmitted by bites from infected phlebotomine sand flies.
  • Cutaneous leishmaniasis (CL) is an emerging infectious disease in several countries, due to behavioural and environmental changes, as well as malnutrition and HIV co-infection [2] . Due to worldwide increasing therapeutic failure and drug resistance, as well as serious side effects of current chemotherapy, new drugs are urgently needed for CL [4] . In addition, no surrogate markers are available to monitor clinical response during often lengthy periods of treatment or to predict therapeutic failure.
  • CD64-targeted immunotoxins selectively induce apoptosis and decrease parasite survival in Leishmania-infected human macrophages in vitro.
  • CD64-immunotoxin treatment in vivo decreases lesion size, parasite load and inflammation in infected HuCD64-transgenic mice, but not control WT mice.
  • the authors conclude that the results reveal the therapeutic potential of CD64-immunotoxin treatment in cutaneous leishmaniasis, but also challenge the clinical relevance of Thl boosting, as suggested in established murine models, for therapeutic and vaccination strategies in human leishmaniasis.
  • WO 2005/052007 Al discloses a heterologous, recombinantly prepared complex which comprises at least one cytotoxic domain and at least one CD64-specific binding domain, especially of human origin, and nucleic acids and vectors coding for such a complex. It further reports about methods for influencing cell growth and the physiology of CD64-positive cells with the complex according to the invention or with vectors containing the nucleic acid coding therefore. Further vectors and hosts for producing the complex are disclosed . The disclosure further relates to the preparation and distribution of medicaments based on the complex or vectors coding therefore, for the treatment of diseases based on a pathological proliferation and/or increased activity of structurally defined cell populations. This applies, in particular, to tumour diseases, allergies, autoimmune diseases, infectious diseases, chronic inflammation or transplantations (immune suppression).
  • An object of the present invention is to provide a new therapeutic approach for treating leishmaniasis.
  • the present invention is based on the observation that monocyte CD64 (FcyRI) ex vivo expression is elevated in two independent cohorts of cutaneous leishmaniasis patients and significantly predicts therapeutic failure.
  • CD64- targeted immunotoxins composed of a receptor-specific antibody combined with a cell killing portion selectively induce apoptosis and decrease parasite survival in Leishmania-infected human macrophages.
  • In vivo immunotoxin treatment of infected HuCD64-transgenic mice decreases lesion size, parasite load and inflammation, providing proof-of-concept for targeting the pathogen by eliminating the host cell in protozoan infection.
  • the invention was verified by means of the CD64-targeting immunotoxin H22xRA composed of the H22 full length antibody chemically conjugated to the plant ribosome-inactivating protein ricin A and H22-ETA a recombinant fusion protein of H22 single-chain antibody fragment genetically fused to a mutant of Pseudomonas exotoxin A.
  • the present invention as described herein is of course not limited to the use of that specific molecule. It must be clear that the skilled person understands, that once the mechanism underlying the therapeutic approach provided by the present invention is elucidated, a plethora of potential molecules can be designed which are able to treat successfully leichmaniasis.
  • the object underlying the invention is accomplished by an immunotoxin for use in the treatment of leishmaniasis wherein the immunotoxin comprises a portion which is specifically binding to the cellular surface receptor CD64 as a component A and a cell killing portion as a component B, wherein the cell killing portion alters the function, gene expression, or viability of a cell thereby killing Leishmania-infected macrophages and by this eliminates Leishmania .
  • Necessary is the component A which binds to the CD64 receptor molecule which expression in macrophages is elevated, which are infected with Leishmania. This component must have an affinity to the CD64 molecule.
  • the present invention therefore provides an immunotoxin for use in the treatment of leishmaniasis wherein the immunotoxin comprises a portion, which is specifically binding to the cellular surface receptor CD64, and a cell killing portion .
  • the immunotoxin of the invention comprises a cell killing portion which is covalently bonded to the portion specifically binding to the cellular surface receptor CD64.
  • the immunotoxin is a recombinant protein or the portion specifically binding to the cellular surface receptor CD64 is linked directly to the cell-killing portion or linked via a linking group.
  • the portion of the immunotoxin which is specifically binding to the cellular surface receptor CD64 is selected from the group consisting of antibodies or their derivatives or fragments, synthetic peptides or molecules, ligands, receptor binding molecules, and their structural analogs, mutants or combinations thereof.
  • the term "mutanf'as used herein is well understood by the person skilled in the art. Mutants are basically proteins which are the product of mutated genes, i. e. proteins which have an altered sequence of amino acids in comparison with the wild type. The result of an amino acid exchange in the mutant may be substantially neutral i.e. without effects on the function, for example if a conservative exchange of amino acids occurs.
  • Mutant in the sense of the present invention comprises also activating mutations, change the gene product such that its effect gets stronger (enhanced activation) .
  • Methods for obtaining and identifying mutants are well known in the art, such as site directed mutagenesis in particular in combination with high-trough-put screening (HTS) .
  • structural analog as chemical compound that can be imagined to arise from another compound, if one atom or group of atoms is replaced with another atom or group of atoms. According to the invention the structural analog shall have substantially the same activity as the compound from which it has been derived .
  • small molecule is understood as a low molecular weight organic compound, typically involved in a biological process as a substrate or product typically in within a mass range of 50 - 1500 daltons (Da) .
  • Some examples of small molecules include : sugars, lipids, amino acids, fatty acids, phenolic compounds, alkaloids etc.
  • the portion, which is specifically binding to the cellular surface receptor CD64 is a recombinant molecule.
  • the cell killing portion alters the function, gene expression, or viability of a cell in particular by inactivating molecules responsible for protein biosynthesis or activating components of cell- inherent apoptosis pathways.
  • the cell killing portion is cytotoxic in particular a molecule selected from the group consisting of a member of ADP- ribosylating enzymes, such as the Pseudomonas Exotoxin A, Diphtheria-, Cholera- or the Pertussis-, Botulinumtoxin; or a member of the ribosome- inactivating proteins such as Dianthin, Saporin, Bryodin, Gelonin, Ricin, Abrin, Pokeweed Antiviral Protein (PAP) or Restrictocin; or is a member of the RNases (Phosphodiesterases) such as the Bovine seminal RNase, BovineRNase A, Bovine pancreatic RNase, Angiogenin, Eosinophil-derived Neurotoxin (EDN), Eosinophilic Cationic Protein (ECP), Onconase, or Bullfrog Lectin; or is a member of the prodrug-activ
  • derivatives in the context of proteins means covalently modified proteins, in particular amidated, alkylated, phosphorylated, acylated, glycosylated, etc. N- or C-terminally or side chain modified proteins.
  • the cell killing portion of the immunotoxin of the invention include all kinds of substances that can display proven efficacy e.g. as chemotherapeutical agents and may be selected from the group of alkylating agents (e.g.
  • cyclophosphamide cholrambucil
  • anthracyclins doxorubicin, daunomycin
  • maytansinoids maytansinoid DM 1
  • anti-metabolites plant alkaloids and terpenoids as the Vinca alkaloids (vinblastine, vincristine vinorebline, vindesin)
  • Podophyllotoxin and structural analogs hereof and taxanes paclitaxel, docetaxel, taxotere
  • topoisomerase inhibitors camptothecins
  • synthetic toxins as ellipticine analogs or snythetic analogs of tumor antibiotics as duocarmycin or CC1065, other tubulin binding agents as halichondrin B, hemiasterlins and dolastatins or analogs as monomethyl-auristatin E; component B may also be selected from the group of small molecules having cytotoxic/cytostatic activities like alkylating agents (like Cyclophosphamide, Mechlor
  • the component C regulates expression of a gene encoding the complex. It may also be used for purification of the recombinant complex or its individual components alone as A or B, or of the components together as AB. It may also contain structural subcomponents which stimulate internalization of the immunotoxin or its individual components, in particular of the cell killing portion, into a macrophage as target cell. The component C may also trigger translocation of the cell killing portion into a subcellular compartment or stimulate proteolytic removal of the portion which is specifically binding to the cellular surface receptor CD64 from the cell killing portion or trigger intracellular activation of the cell killing portion.
  • the cell killing portion is cytotoxic in particular a molecule selected from the group consisting of a member of ADP- ribosylating enzymes, such as the Pseudomonas Exotoxin A, Diphtheria-, Cholera- or the Pertussis-, Botulinumtoxin; or a member of the ribosome- inactivating proteins such as Dianthin, Saporin, Bryodin, Gelonin, Ricin, Abrin, Pokeweed Antiviral Protein (PAP) or Restrictocin; or is a member of the RNases (Phosphodiesterases) such as the Bovine seminal RNase, BovineRNase A, Bovine pancreatic RNase, Angiogenin, Eosinophil-derived Neurotoxin (EDN), Eosinophilic Cationic Protein (EC).
  • ADP- ribosylating enzymes such as the Pseudomonas Exotoxin A, Diphth
  • a single-chain variable fragment is a fusion protein of the variable regions of the heavy (V H ) and light chains (V L ) of immunoglobulins, connected with a short linker peptide of ten to about 25 amino acids.
  • the linker is usually rich in glycine for flexibility, as well as serine or threonine for solubility, and can either connect the N-terminus of the V H with the C-terminus of the V L , or vice versa.
  • This protein retains the specificity of the original immunoglobulin, despite removal of the constant regions and the introduction of the linker.
  • scFv can be created directly from subcloned heavy and light chains derived from a hybridoma.
  • ScFvs have many uses, e.g ., flow cytometry, immunohistochemistry, and as antigen-binding domains of artificial T cell receptors. Unlike monoclonal antibodies, which are often produced in mammalian cell cultures, scFvs are more often produced in bacteria cell cultures such as E. coli.
  • Figure 1 a - e show CD64-directed immunotoxins induce apoptosis in a CD64-selective manner and exert leishmanicidal activity in vitro.
  • Figure 2 a - c show CD64-directed immunotoxin demonstrates therapeutic potential in vivo.
  • Figure 3 a - d show CD64 is a biomarker for therapeutic response in cutaneous leishmaniasis. Detailed Description Of The Invention
  • E.coli BL21 Derivatives including (DE3) (F ⁇ ompT hsdSB(rB " mB “ ) gal dcm rnel31 DE3) were as host for bacterial synthesis of ETA'-, Ang-, and tau-based fusion proteins.
  • l is derived from the pET27b plasmid (Novagen, Madison, USA), and is used for N-terminal fusion of Sfi I/Not I- ligands to the modified deletion mutant of Pseudomonas aeruginosa Exotoxin
  • a plasmids were prepared by the alkaline lysis method and purified using plasmid preparation kits from Qiagen (Hilden, Germany) [7], incorporated by reference. All standard cloning procedures were carried out as described by HETK293T cells were used as host for expression of GB, GM, and Ang-based fusion proteins [8], incorporated by reference. The constrruction of pMS plasmids encoding GB-H22 has already been described [9], incorporated by reference.
  • H22(scFv)-ETA' SEQ ID NO : 1
  • H22(scFv)-Ang SEQ ID NO: 2
  • H22(scFv)- Cat AD-Ang SEQ ID NO : 3
  • H22(scFv)- Ang GGRR SEQ ID NO: 4
  • H22(scFv)- Cat AD-Ang GGRR SEQ ID NO: 5
  • H22(scFv)- catAD-GB SEQ ID NO: 6
  • H22(scFv)- C atAD-GB R2 oiK SEQ ID NO : 7
  • H22(scFv)-MAP SEQ ID NO : 8
  • fusion proteins were periplasmically expressed under osmotic stress in the presence of compatible solutes as described by Barth et al .
  • transformed bacteria were harvested 15 h after IPTG induction.
  • the bacterial pellet was resuspended in sonication-buffer (75 mM Tris/HCI (pH 8), 300 mM NaCI, 1 capsule of protease inhibitors/ 50 ml (CompleteTM, Roche Diagnostics, Mannheim, Germany), 5 mM DTT, 10 mM EDTA, 10% (v/v) glycerol) at 4° and sonicated 6 times for 30 s at 200 W.
  • sonication-buffer 75 mM Tris/HCI (pH 8), 300 mM NaCI, 1 capsule of protease inhibitors/ 50 ml (CompleteTM, Roche Diagnostics, Mannheim, Germany), 5 mM DTT, 10 mM EDTA, 10% (v/v) glycerol
  • the m22(scFv)-ETA' fusion proteins were enriched by IMAC (immobilized metal-ion affinity chromatography) using nickel- nitriloacetic chelating Sepharose (Qiagen) and SEC (size exclusion chromatography) with Bio-Prep SE- 100/17 (Biorad, Munchen, Germany) columns according to the manufacturer's instructions.
  • Recombinant Protein was eluted with PBS (pH 7.4) and 1 M NaCI, analyzed by Sodium dodecyl sulfate/polyacrylamide gel electrophoresis (SDS-PAGE), quantified by densitometry (GS-700 Imaging Densitometer; Biorad) after Coomassie staining in comparison with BSA standards and verified by Bradford assays (Biorad).
  • HEK293T cells were used as expression cell line.
  • the cells were transfected with 1 pg DNA, G B-H22(scFv) (SEQ ID NO : 9), G B R20 IK- H22(SCFV) (SEQ ID NO : 10), GM-H22(scFv) (SEQ ID NO : 11), H22(scFv)- Cat AD-GB (SEQ ID NO: 6), H22(scFv)- c at AD-GB R20 iK (SEQ ID NO : 7), H22(scFv)-Ang (SEQ ID NO : 2), H22- Cat AD-Ang (SEQ ID NO : 3), H22(scFv)-Ang GGRR (SEQ ID NO: 4), and H22(scFv)- Cat AD-Ang GGRR (SEQ ID NO : 5), according to the manufacturer's instructions using RotiFect (Roth) .
  • the used pMS plasmid contains the EGFP reporter gene so that expression of the corresponding protein could be verified by its green fluorescence via fluorescence microscopy.
  • the secreted protein was purified from the supernatant of the cells via Immobilized Metal-ion Affinity Chromatography (IMAC) and Fast Performance Liquid Chromatography (FPLC).
  • IMAC Immobilized Metal-ion Affinity Chromatography
  • FPLC Fast Performance Liquid Chromatography
  • the cleared supernatant was supplemented with 10 mM imidazole and loaded to an XK16/20 column (Amersham / GE Healthcare) containing 8 ml Sepharose 6 Fast Flow resin (Clontech / Takara).
  • the used buffers such as incubation, washing and elution buffer were described before [10], incorporated by reference.
  • the eluted protein was re-buffered into 20 mM Tris, pH 7.4, 50 mM NaCI, concentrated, aliquoted and stored at -80°C.
  • Enterokinase was added to the protein (0.02 U/pg) with 2 mM CaCI2 for 16 h incubation at 23°C.
  • the protein concentration was calculated after SDS-PAGE analysis and Coomassie staining using AIDA Image Analyzer Software (Raytest Isotopenmessgerate GmbH).
  • Monocytes were separated by adherence for 30 min, differentiated into macrophages for 7 days in RPMI + 10% FCS (Gibco-BRL) and then infected with Leishmania amazonensis (5 : 1 ratio) before immunotoxin treatment (24-48h).
  • Intracellular parasite survival was quantified by transformation of amastigotes into motile promastigotes, which were allowed to proliferate in Schneider's medium for 8 days at 23°C.
  • Apoptosis was assessed by nuclear fragmentation (Hoechst 33258 or hematoxyline/eosine staining, quantified by microscopy) and annexin V-staining (quantified by flow cytometry, FACSort, BD Biosciences).
  • both macrophage and Leishmania amastigote nuclei display nuclear fragmentation, structural degradation and loss of DNA content typical of apoptosis (arrows in Fig. le), indicating that host cell-targeting results in concurrent intracellular pathogen elimination.
  • CD64-directed immunotoxins induce apoptosis in a CD64-selective manner and exert leishmanicidal activity in vitro, a, In vitro apoptosis (quantified as % of nuclear fragmentation) of CD64 "high” (MFI > 50) and "low” (MFI ⁇ 50) monocytes from healthy donors cultured for 48 h in the presence or absence of 1, 10 or 100 ng of H22-ETA.
  • mice were treated with 10 intralesional injections of 70 ng of H22-ETA (lOul lxlO "7 M in saline) on alternate days.
  • Littermate WT mice were used as controls for non-specific effects of the immunotoxin, since murine CD64 is not recognized by the human mAb or immunotoxin.
  • Lesion size was monitored every other day from 6 to 9 weeks post-infection using a digital micrometer (series 227/201 Mitutoyo Japan). Infected ears were aseptically excised at 9 weeks postinfection, photographed, scored for inflammation in a blinded manner by a trained pathologist and homogenized in Schneider's medium.
  • Parasite load was determined using a quantitative limiting-dilution assay. Homogenates were serially diluted in Schneider's medium with 10% FCS and seeded into 96-well plates containing biphasic blood agar (Novy-Nicolle-McNeal) medium. The number of viable parasites was determined from the highest dilution at which promastigotes could be grown after up to 2 weeks of incubation at 25°C.
  • H22-ETA halted disease progression in huCD64-transgenic mice but not in WT control littermates, used as controls for possible non-specific effects of the immunotoxin.
  • CD64-directed immunotoxin demonstrates therapeutic potential in vivo.
  • whole-blood staining 50 ⁇ of whole blood was diluted with an equal volume of PBS containing 1% BSA and 0.1% sodium azide, followed by staining for 30 min on ice with fluorescein-conjugated anti-CD64 (clone 22, Immunotech-Coulter, Marseille, France; 10.1, Pharmingen, BD Biosciences, US) and lineage markers CD14 (monocytes), CD3 (T cells), CD19 (B cells), CD16b (neutrophils), CD49d (eosinophils) and CD56 (NK cells) or isotype-matched control antibodies (all from Immunotech-Coulter, Marseille, France) .
  • erythrocyte lysis whole blood lysing solution, Becton-Dickinson, San Jose, CA
  • PBMC staining cohort II
  • 200,000 mononuclear cells purified by Ficoll/Hypaque gradient centrifugation
  • M FIs in cohort II were higher in both controls and patients.
  • 10,000-20,000 events were acquired in a flow cytometer (FACSort, Becton-Dickinson) and analyzed using CellQuest software. Monocytes were gated according to their characteristic forward-scatter and side-scatter as previously described 9 and were confirmed to be CD14 + , CD3 " , CD19 " , CD16b " and CD56 " .
  • CD64 is a biomarker for therapeutic response in cutaneous leishmaniasis
  • d Normalized CD64 levels for both cohorts of CL patients classified according to therapeutic response (fast, intermediate or slow healing as described in Supplementary Methods, ANOVA p ⁇ 0.0001, post- test for linear trend p ⁇ 0.0001).

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Medicinal Chemistry (AREA)
  • Wood Science & Technology (AREA)
  • Zoology (AREA)
  • Immunology (AREA)
  • Biochemistry (AREA)
  • Molecular Biology (AREA)
  • Veterinary Medicine (AREA)
  • General Engineering & Computer Science (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Toxicology (AREA)
  • Epidemiology (AREA)
  • Biotechnology (AREA)
  • Biomedical Technology (AREA)
  • Microbiology (AREA)
  • Cell Biology (AREA)
  • Botany (AREA)
  • Biophysics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Peptides Or Proteins (AREA)
  • Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)

Abstract

An immunotoxin for use in the treatment of leishmaniasis wherein the immunotoxin comprises a portion which is specifically binding to the cellular surface receptor CD64 as a component A and a cell killing portion as a component B, wherein the cell killing portion alters the function, gene expression, or viability of a cell thereby killing Leishmania-infected macrophages and by this eliminates Leishmania.

Description

An Immunotoxin For Use In The Treatment of Leishmaniasis
The present invention pertains to an immunotoxin for use in the treatment of leishmaniasis.
Leishmaniasis is a neglected infectious disease, despite the 1.5-2.0 million new cases every year and a population of 350 million at risk [ l]-[3] . The causative agent is a protozoan parasite from the genus Leishmania, transmitted by bites from infected phlebotomine sand flies. Cutaneous leishmaniasis (CL) is an emerging infectious disease in several countries, due to behavioural and environmental changes, as well as malnutrition and HIV co-infection [2] . Due to worldwide increasing therapeutic failure and drug resistance, as well as serious side effects of current chemotherapy, new drugs are urgently needed for CL [4] . In addition, no surrogate markers are available to monitor clinical response during often lengthy periods of treatment or to predict therapeutic failure.
J . Van Weyenbergh et al . discloses in Abstract/ Cytokine 63 (2013) 243-314 that CD64-targeted immunotoxins selectively induce apoptosis and decrease parasite survival in Leishmania-infected human macrophages in vitro. CD64-immunotoxin treatment in vivo decreases lesion size, parasite load and inflammation in infected HuCD64-transgenic mice, but not control WT mice. The authors conclude that the results reveal the therapeutic potential of CD64-immunotoxin treatment in cutaneous leishmaniasis, but also challenge the clinical relevance of Thl boosting, as suggested in established murine models, for therapeutic and vaccination strategies in human leishmaniasis. WO 2005/052007 Al discloses a heterologous, recombinantly prepared complex which comprises at least one cytotoxic domain and at least one CD64-specific binding domain, especially of human origin, and nucleic acids and vectors coding for such a complex. It further reports about methods for influencing cell growth and the physiology of CD64-positive cells with the complex according to the invention or with vectors containing the nucleic acid coding therefore. Further vectors and hosts for producing the complex are disclosed . The disclosure further relates to the preparation and distribution of medicaments based on the complex or vectors coding therefore, for the treatment of diseases based on a pathological proliferation and/or increased activity of structurally defined cell populations. This applies, in particular, to tumour diseases, allergies, autoimmune diseases, infectious diseases, chronic inflammation or transplantations (immune suppression).
An object of the present invention is to provide a new therapeutic approach for treating leishmaniasis.
The present invention is based on the observation that monocyte CD64 (FcyRI) ex vivo expression is elevated in two independent cohorts of cutaneous leishmaniasis patients and significantly predicts therapeutic failure. CD64- targeted immunotoxins composed of a receptor-specific antibody combined with a cell killing portion selectively induce apoptosis and decrease parasite survival in Leishmania-infected human macrophages. In vivo immunotoxin treatment of infected HuCD64-transgenic mice decreases lesion size, parasite load and inflammation, providing proof-of-concept for targeting the pathogen by eliminating the host cell in protozoan infection. The invention was verified by means of the CD64-targeting immunotoxin H22xRA composed of the H22 full length antibody chemically conjugated to the plant ribosome-inactivating protein ricin A and H22-ETA a recombinant fusion protein of H22 single-chain antibody fragment genetically fused to a mutant of Pseudomonas exotoxin A. However to avoid any undue limitation, the present invention as described herein is of course not limited to the use of that specific molecule. It must be clear that the skilled person understands, that once the mechanism underlying the therapeutic approach provided by the present invention is elucidated, a plethora of potential molecules can be designed which are able to treat successfully leichmaniasis.
Previously, it was shown in a Tuberculosis infection model in mice, that specific in vitro elimination of mycobacteria infected Alveolar Macrophages with H22xRA immunotoxin did not lead to pathogen elimination, but rather to exacerbation of the disease, followed by death of the mice. This indicates that for Leishmania infection, the H22 based immunotoxin provides additional selectivity resulting in bringing the parasite laden monocytic cells into apoptosis, concurrently killing the intracellular parasites, without disturbing the abiding immune response, fighting the Leishmania parasite [5] incorporated by reference.
The object underlying the invention is accomplished by an immunotoxin for use in the treatment of leishmaniasis wherein the immunotoxin comprises a portion which is specifically binding to the cellular surface receptor CD64 as a component A and a cell killing portion as a component B, wherein the cell killing portion alters the function, gene expression, or viability of a cell thereby killing Leishmania-infected macrophages and by this eliminates Leishmania .
Necessary is the component A which binds to the CD64 receptor molecule which expression in macrophages is elevated, which are infected with Leishmania. This component must have an affinity to the CD64 molecule.
Furthermore a component B must be present which is able to interact after uptake by the infected cell, i.e a macrophage, with that cell and kill that cell either non specifically or by an induced cell-death . The present invention therefore provides an immunotoxin for use in the treatment of leishmaniasis wherein the immunotoxin comprises a portion, which is specifically binding to the cellular surface receptor CD64, and a cell killing portion .
In particular the immunotoxin of the invention comprises a cell killing portion which is covalently bonded to the portion specifically binding to the cellular surface receptor CD64.
In one embodiment of the invention the immunotoxin is a recombinant protein or the portion specifically binding to the cellular surface receptor CD64 is linked directly to the cell-killing portion or linked via a linking group.
In a further embodiment of the invention the portion of the immunotoxin which is specifically binding to the cellular surface receptor CD64 is selected from the group consisting of antibodies or their derivatives or fragments, synthetic peptides or molecules, ligands, receptor binding molecules, and their structural analogs, mutants or combinations thereof. The term "mutanf'as used herein is well understood by the person skilled in the art. Mutants are basically proteins which are the product of mutated genes, i. e. proteins which have an altered sequence of amino acids in comparison with the wild type. The result of an amino acid exchange in the mutant may be substantially neutral i.e. without effects on the function, for example if a conservative exchange of amino acids occurs. Mutant in the sense of the present invention comprises also activating mutations, change the gene product such that its effect gets stronger (enhanced activation) . Methods for obtaining and identifying mutants are well known in the art, such as site directed mutagenesis in particular in combination with high-trough-put screening (HTS) .
The skilled person knows the term "structural analog" as chemical compound that can be imagined to arise from another compound, if one atom or group of atoms is replaced with another atom or group of atoms. According to the invention the structural analog shall have substantially the same activity as the compound from which it has been derived .
The term "small molecule" is understood as a low molecular weight organic compound, typically involved in a biological process as a substrate or product typically in within a mass range of 50 - 1500 daltons (Da) . Some examples of small molecules include : sugars, lipids, amino acids, fatty acids, phenolic compounds, alkaloids etc.
In still another embodiment of the invention the portion, which is specifically binding to the cellular surface receptor CD64, is a recombinant molecule.
In yet another embodiment of the invention the cell killing portion alters the function, gene expression, or viability of a cell in particular by inactivating molecules responsible for protein biosynthesis or activating components of cell- inherent apoptosis pathways.
In a further embodiment of the invention the cell killing portion is cytotoxic in particular a molecule selected from the group consisting of a member of ADP- ribosylating enzymes, such as the Pseudomonas Exotoxin A, Diphtheria-, Cholera- or the Pertussis-, Botulinumtoxin; or a member of the ribosome- inactivating proteins such as Dianthin, Saporin, Bryodin, Gelonin, Ricin, Abrin, Pokeweed Antiviral Protein (PAP) or Restrictocin; or is a member of the RNases (Phosphodiesterases) such as the Bovine seminal RNase, BovineRNase A, Bovine pancreatic RNase, Angiogenin, Eosinophil-derived Neurotoxin (EDN), Eosinophilic Cationic Protein (ECP), Onconase, or Bullfrog Lectin; or is a member of the prodrug-activating enzymes such as Calicheamicin, Glucose Oxidase, Carboxypeptidase, Alkaline Phosphatase, Cytosindeaminase, β-Glucosidase, β- Glucuronidase, β-Lactamase, Nitroreductase, Thymidinkinase or Purin Nukleosid Phosphorylase; or is a member of the cathepsin protease family; or a member of the calpains; or a member of the granzymes; or a member of the microtubule- binding proteins including tau; or any derivative of the above mentioned proteins; or a combination thereof. The term "derivative" in the context of proteins means covalently modified proteins, in particular amidated, alkylated, phosphorylated, acylated, glycosylated, etc. N- or C-terminally or side chain modified proteins. In particular the cell killing portion of the immunotoxin of the invention include all kinds of substances that can display proven efficacy e.g. as chemotherapeutical agents and may be selected from the group of alkylating agents (e.g. cyclophosphamide, cholrambucil), anthracyclins (doxorubicin, daunomycin), maytansinoids (maytansinoid DM 1), anti-metabolites, plant alkaloids and terpenoids as the Vinca alkaloids (vinblastine, vincristine vinorebline, vindesin) Podophyllotoxin and structural analogs hereof and taxanes (paclitaxel, docetaxel, taxotere) or topoisomerase inhibitors (camptothecins), synthetic toxins as ellipticine analogs or snythetic analogs of tumor antibiotics as duocarmycin or CC1065, other tubulin binding agents as halichondrin B, hemiasterlins and dolastatins or analogs as monomethyl-auristatin E; component B may also be selected from the group of small molecules having cytotoxic/cytostatic activities like alkylating agents (like Cyclophosphamide, Mechlorethamine, Chlorambucil, Melphalan) or anthracyclines (like Danorubicin, Doxorubicin, Epirubicin, Idarubicin, Mitoxantrone, Valrubicin) or cytoskeletal disruptors (like Paclitaxel, Docetaxel) or Epothilones (like ) or Inhibitors of topoisomerase II (like Etoposide, Teniposide, Tafluposide) or nucleotide analogs and precursor analogs (like azacididine, azathioprine, capecitabine, cytarabine, doxofluridine, fluorouracil, gemcitabine, mercaptopurine, methotrexate, tioguanine) or peptide antibiotics (like bleomycin) or platinum-based agents (like carboplatin, cisplatin, oxaliplatin) or retinoids (like all-trans retinoic acid) or vinca alkaloids and structural analogs (like vinblastine, vincristine, vindestine, vinorelbine), beta ray emiting nuclides like Iodine-131, Yttrium-90, Lutetium- 177, from the group of Aromatase Inhibitors (like Aminoglutethimide, Anastrozole, Letrozole, Vorozole, Exemestane, 4-androstene-3,6,17-trione, l,4,6-androstatrien-3,17-dione, Formestane, Testolactone), Carbonic Anhydrase Inhibitors (like Acetazolamide, Methazolamide, Dorzolamide, Topiramate), Cholinesterase Inhibitors (Organophosphates like Metrifonate, Carbamates like Physostigmine, Neostigmine, Pyridostigmine, Ambenonium, Demarcarium, Rivastigmine, Phananthrine like Galantamine, Piperidine like Donepezil, Tacrine, Edophonium, or Phenothiazines), Cyclooxygenase Inhibitors (like Celecoxib, Rofecoxib, Etoricoxib, Acetaminophen, Diclofenac, Ibuprofen), Folic Acid Antagonists (like Methotrexate), Hydroxymethylglutaryl-CoA Reductase Inhibitors (like Atorvastatin, Cerivastatin, Fluvastatin, Lovastatin, Mevastatin, Pitavastatin, Pravastatin, Rosuvastatin, Simvastatin, Vytorin, Advicor, Caduet), Integrase Inhibitors (like Raltegravir, Elvitegravir), Lipoxygenase Inhibitors (like Zileutron), Monoamine Oxidase Inhibitors (like Isocarboxazid, Moclobemide, Phenelzine, Tranylcypromine, Selegiline, Rasagiline, Nialamide, Iproniazid, Iproclozide, Toloxatone, Linezolid, Tryptamines, Dienolide, Detxtroamphetamine), Nucleic Acid Synthesis Inhibitors, Phosphodiesterase Inhibitors (like Caffeine, Theopyline, 3-isobutyl-l-methylxanthine, Vinpocetine, EHNA, Enoximone, Lirinone, PDE3, Mesembrine, Rolipram, Ibudilast, Sildenafil, Tadalafil, Vardenafil, Udenafil, Avanafil), Protease Inhibitors (like Saquinavir, Ritonavir, Idinavir, Nelfinavir, Amprenavir, Lopinavir, Atazanavir, Fosamprenavir, Tipranavir, Darunavir), Protein Kinase Inhibitors (like Imatinib, Geftinib, Pegaptanib, Sorafenib, Dasatinib, Sunitinib, Erlotinib, Nilotinib, Lapatinib), Protein Synthesis Inhibitors (like Anisomycin, Cycloheximide, Chloramphenicol, Tetracycline, Streptomycin, Erythromycin, Puromycin, etc.), Proton Pump Inhibitors (like Omeprazole, Lansoprazole, Esomeprazole, Pantoprazole, Rabeprazole), from the group of oligonucleotides nucleic acids like small interfering RNAs (siRNAs) or a short hairpin RNA (shRNA), an antisense DNA or RNA, a double stranded RNA (dsRNA) or a micro RNA (miRNA) might be used to down-regulate specific key elements of regulative pathways within a cell.
In a particular embodiment of the immunotoxin of the invention at least one supplementary component C is additionally present. Preferably the component C regulates expression of a gene encoding the complex. It may also be used for purification of the recombinant complex or its individual components alone as A or B, or of the components together as AB. It may also contain structural subcomponents which stimulate internalization of the immunotoxin or its individual components, in particular of the cell killing portion, into a macrophage as target cell. The component C may also trigger translocation of the cell killing portion into a subcellular compartment or stimulate proteolytic removal of the portion which is specifically binding to the cellular surface receptor CD64 from the cell killing portion or trigger intracellular activation of the cell killing portion. The skilled person readily understands that component C may possess only a single one of the features as described hereinabove or combinations thereof. In a further embodiment of the invention the cell killing portion is cytotoxic in particular a molecule selected from the group consisting of a member of ADP- ribosylating enzymes, such as the Pseudomonas Exotoxin A, Diphtheria-, Cholera- or the Pertussis-, Botulinumtoxin; or a member of the ribosome- inactivating proteins such as Dianthin, Saporin, Bryodin, Gelonin, Ricin, Abrin, Pokeweed Antiviral Protein (PAP) or Restrictocin; or is a member of the RNases (Phosphodiesterases) such as the Bovine seminal RNase, BovineRNase A, Bovine pancreatic RNase, Angiogenin, Eosinophil-derived Neurotoxin (EDN), Eosinophilic Cationic Protein (ECP), Onconase, or Bullfrog Lectin; or is a member of the prodrug-activating enzymes such as Calicheamicin, Glucose Oxidase, Carboxypeptidase, Alkaline Phosphatase, Cytosindeaminase, β-Glucosidase, β- Glucuronidase, β-Lactamase, Nitroreductase, Thymidinkinase or Purin Nukleosid Phosphorylase; or is a member of the cathepsin protease family; or a member of the calpains; or a member of the granzymes; or a member of the microtubule- binding proteins including tau; or any derivative of the above mentioned proteins; or a combination thereof.
A single-chain variable fragment (scFv) is a fusion protein of the variable regions of the heavy (VH) and light chains (VL) of immunoglobulins, connected with a short linker peptide of ten to about 25 amino acids. The linker is usually rich in glycine for flexibility, as well as serine or threonine for solubility, and can either connect the N-terminus of the VH with the C-terminus of the VL, or vice versa. This protein retains the specificity of the original immunoglobulin, despite removal of the constant regions and the introduction of the linker. These molecules were created to facilitate phage display, where it is highly convenient to express the antigen-binding domain as a single peptide. As an alternative, scFv can be created directly from subcloned heavy and light chains derived from a hybridoma. ScFvs have many uses, e.g ., flow cytometry, immunohistochemistry, and as antigen-binding domains of artificial T cell receptors. Unlike monoclonal antibodies, which are often produced in mammalian cell cultures, scFvs are more often produced in bacteria cell cultures such as E. coli. [6] Figure 1 a - e show CD64-directed immunotoxins induce apoptosis in a CD64-selective manner and exert leishmanicidal activity in vitro.
Figure 2 a - c show CD64-directed immunotoxin demonstrates therapeutic potential in vivo.
Figure 3 a - d show CD64 is a biomarker for therapeutic response in cutaneous leishmaniasis. Detailed Description Of The Invention
Bacterial strains, Mammalian Cells, and plasmids
E.coli BL21 Derivatives including (DE3) (F~ ompT hsdSB(rB"mB") gal dcm rnel31 DE3) were as host for bacterial synthesis of ETA'-, Ang-, and tau-based fusion proteins. The bacterial expression vector pBMl. l is derived from the pET27b plasmid (Novagen, Madison, USA), and is used for N-terminal fusion of Sfi I/Not I- ligands to the modified deletion mutant of Pseudomonas aeruginosa Exotoxin A plasmids were prepared by the alkaline lysis method and purified using plasmid preparation kits from Qiagen (Hilden, Germany) [7], incorporated by reference. All standard cloning procedures were carried out as described by HETK293T cells were used as host for expression of GB, GM, and Ang-based fusion proteins [8], incorporated by reference. The constrruction of pMS plasmids encoding GB-H22 has already been described [9], incorporated by reference.
Construction and Expression of CD64-specific recombinant immunotoxins
After transformation into BL21 (DE3) strains, H22(scFv)-ETA' (SEQ ID NO : 1), H22(scFv)-Ang (SEQ ID NO: 2), H22(scFv)-CatAD-Ang (SEQ ID NO : 3), H22(scFv)- AngGGRR (SEQ ID NO: 4), H22(scFv)-CatAD-AngGGRR (SEQ ID NO: 5), H22(scFv)- catAD-GB (SEQ ID NO: 6), H22(scFv)-CatAD-GBR2oiK (SEQ ID NO : 7), H22(scFv)-MAP (SEQ ID NO : 8), fusion proteins were periplasmically expressed under osmotic stress in the presence of compatible solutes as described by Barth et al . 2000. Briefly, transformed bacteria were harvested 15 h after IPTG induction. The bacterial pellet was resuspended in sonication-buffer (75 mM Tris/HCI (pH 8), 300 mM NaCI, 1 capsule of protease inhibitors/ 50 ml (Complete™, Roche Diagnostics, Mannheim, Germany), 5 mM DTT, 10 mM EDTA, 10% (v/v) glycerol) at 4° and sonicated 6 times for 30 s at 200 W. The m22(scFv)-ETA' fusion proteins were enriched by IMAC (immobilized metal-ion affinity chromatography) using nickel- nitriloacetic chelating Sepharose (Qiagen) and SEC (size exclusion chromatography) with Bio-Prep SE- 100/17 (Biorad, Munchen, Germany) columns according to the manufacturer's instructions. Recombinant Protein was eluted with PBS (pH 7.4) and 1 M NaCI, analyzed by Sodium dodecyl sulfate/polyacrylamide gel electrophoresis (SDS-PAGE), quantified by densitometry (GS-700 Imaging Densitometer; Biorad) after Coomassie staining in comparison with BSA standards and verified by Bradford assays (Biorad).
HEK293T cells were used as expression cell line. The cells were transfected with 1 pg DNA, G B-H22(scFv) (SEQ ID NO : 9), G BR20IK- H22(SCFV) (SEQ ID NO : 10), GM-H22(scFv) (SEQ ID NO : 11), H22(scFv)-CatAD-GB (SEQ ID NO: 6), H22(scFv)- catAD-GBR20iK (SEQ ID NO : 7), H22(scFv)-Ang (SEQ ID NO : 2), H22-CatAD-Ang (SEQ ID NO : 3), H22(scFv)-AngGGRR (SEQ ID NO: 4), and H22(scFv)-CatAD-AngGGRR (SEQ ID NO : 5), according to the manufacturer's instructions using RotiFect (Roth) . The used pMS plasmid contains the EGFP reporter gene so that expression of the corresponding protein could be verified by its green fluorescence via fluorescence microscopy. The secreted protein was purified from the supernatant of the cells via Immobilized Metal-ion Affinity Chromatography (IMAC) and Fast Performance Liquid Chromatography (FPLC). The cleared supernatant was supplemented with 10 mM imidazole and loaded to an XK16/20 column (Amersham / GE Healthcare) containing 8 ml Sepharose 6 Fast Flow resin (Clontech / Takara). The used buffers such as incubation, washing and elution buffer were described before [10], incorporated by reference. The eluted protein was re-buffered into 20 mM Tris, pH 7.4, 50 mM NaCI, concentrated, aliquoted and stored at -80°C. For activation prior to use Enterokinase was added to the protein (0.02 U/pg) with 2 mM CaCI2 for 16 h incubation at 23°C. The protein concentration was calculated after SDS-PAGE analysis and Coomassie staining using AIDA Image Analyzer Software (Raytest Isotopenmessgerate GmbH).
In vitro cytotoxic activity
To characterize the cytotoxic activity of the recombinant anti-CD64 immunotoxins in vitro, growth inhibition of AML-derived cell lines HL-60, U937 or in vitro differentiated macrophages was documented by XTT-based colorimetric assay (see Table 1).
Figure imgf000013_0001
E.coi ~ 1 mg/l MlO una ecte
Table 1 Parasite culture, immunotoxin preparation, and in vitro assays
Leishmania amazonensis (MHOM/BR/87/BA125) cultures were maintained in vitro as proliferating promastigotes in Schneider 's insect medium (Sigma Chemical Co., St. Louis, MO), supplemented with 10% FCS at 25°C. The construction and purification of CD64-directed immunotoxins H22xRA and H22-ETA single chain Fv have been described previously [10], [11], incorporated by reference. PBMCs were isolated by Ficoll-Hypaque gradient centrifugation. Monocytes were separated by adherence for 30 min, differentiated into macrophages for 7 days in RPMI + 10% FCS (Gibco-BRL) and then infected with Leishmania amazonensis (5 : 1 ratio) before immunotoxin treatment (24-48h). Intracellular parasite survival was quantified by transformation of amastigotes into motile promastigotes, which were allowed to proliferate in Schneider's medium for 8 days at 23°C. Apoptosis was assessed by nuclear fragmentation (Hoechst 33258 or hematoxyline/eosine staining, quantified by microscopy) and annexin V-staining (quantified by flow cytometry, FACSort, BD Biosciences).
Both immunotoxins were tested using using Leishmania amazonensis-lnfected human macrophages from healthy donors, an established preclinical in vitro model. A significant time- and dose-dependent decrease in parasite survival was observed following treatment of infected macrophages with both H22xRA and H22-ETA (Fig. lc-d). This immunotoxin-induced leishmanicidal activity was associated with host cell apoptosis, as shown in Fig. le. Control cultures exhibit characteristic large pleomorphic macrophage nuclei and small elongated Leishmania amastigote nuclei in infected cells (Fig. le). Upon immunotoxin treatment, both macrophage and Leishmania amastigote nuclei display nuclear fragmentation, structural degradation and loss of DNA content typical of apoptosis (arrows in Fig. le), indicating that host cell-targeting results in concurrent intracellular pathogen elimination.
Legend to Figure 1 :
CD64-directed immunotoxins induce apoptosis in a CD64-selective manner and exert leishmanicidal activity in vitro, a, In vitro apoptosis (quantified as % of nuclear fragmentation) of CD64 "high" (MFI > 50) and "low" (MFI < 50) monocytes from healthy donors cultured for 48 h in the presence or absence of 1, 10 or 100 ng of H22-ETA. b, In vitro apoptosis (quantified as % of annexin V- positive cells by flow cytometry) of untreated CD64 "low" and IFNy-treated CD64 "high" monocytes from two healthy donors (mean ± SEM) cultured for 48 h in the presence or absence of 1, 10 or 100 ng/ml of H22xRA. In vitro survival assay of Leishmania promastigotes recovered from Leishmania amazonensis-lnfected macrophages (duplicate cultures from four normal donors, mean ± SEM) cultured for 24, 48 and 72 h in the presence or absence of c 100 ng/ml of H22-RA and d 10 and 50 ng/ml of H22-ETA. e, In vitro apoptosis visualized by Hoechst 33258 staining of uninfected and Leishmania amazonensis- infected macrophages from a representative healthy donor cultured for 48 h in the presence or absence of 50 ng/ml of H22-ETA immunotoxin (arrows indicate nuclear fragmentation and/or DNA degradation). In vivo infection and immmunotoxin treatment
Animal husbandry, experimentation and welfare complied with the International Guiding Principles for Biomedical Research Involving Animals and was approved by the Animal Care Ethics Committee from Uniklinikum Aachen. Human CD64- transgenic (described by Heijnen et al. [12], incorporated by reference) and WT C57BL6 mice were used at 8-12 weeks of age. Stationary-phase promastigotes (105 parasites in 10 μΙ of saline) of Leishmania amazonensis were inoculated into the right ear dermis using a 27.5-gauge needle. At 6 weeks post-infection, both groups of mice were treated with 10 intralesional injections of 70 ng of H22-ETA (lOul lxlO"7M in saline) on alternate days. Littermate WT mice were used as controls for non-specific effects of the immunotoxin, since murine CD64 is not recognized by the human mAb or immunotoxin. Lesion size was monitored every other day from 6 to 9 weeks post-infection using a digital micrometer (series 227/201 Mitutoyo Japan). Infected ears were aseptically excised at 9 weeks postinfection, photographed, scored for inflammation in a blinded manner by a trained pathologist and homogenized in Schneider's medium. Parasite load was determined using a quantitative limiting-dilution assay. Homogenates were serially diluted in Schneider's medium with 10% FCS and seeded into 96-well plates containing biphasic blood agar (Novy-Nicolle-McNeal) medium. The number of viable parasites was determined from the highest dilution at which promastigotes could be grown after up to 2 weeks of incubation at 25°C.
Following intradermal Leishmania amazonensis infection in the ear and lesion development, short-term intralesional treatment with H22-ETA halted disease progression in huCD64-transgenic mice but not in WT control littermates, used as controls for possible non-specific effects of the immunotoxin. As shown in Fig 2a, b, c, H22-ETA treatment caused a four-fold decrease in lesion size (p=0.0017), a three-fold decrease in inflammation score (p=0.0052), as well as a five-fold decrease in parasite load (p=0.030). Notably, only 10 intradermal injections were sufficient to achieve a significant therapeutic effect in infected mice, which ascertains the in vivo applicability of the anti-CD64 IT, since patients typically receive 1 to 3 cycles of pentavalent antimonials, i.e. 20 to 60 intravenous injections to achieve clinical cure. Legend to Figure 2
CD64-directed immunotoxin demonstrates therapeutic potential in vivo. WT and HuCD64-Tg C57BL6 mice were infected intradermal^ in the right ear with 105 Leishmania amazonensis stationary phase promastigotes. Following lesion development at 6 weeks post infection, both groups received 10 doses of 100 ng H22-ETA, intralesionally on alternate days, a, Lesion size was measured as right ear thickness, corrected for left ear values of each individual mouse (*p<0.05, **p<0.01, unpaired t test), b, Right ear inflammation was scored on a scale from 0 (absent) to 3 (severe), (**p=0.0052, Mann-Whitney test), c, Parasite load was determined by quantifying Leishmania promastigotes in serial dilutions of ear homogenates in Schneider's Insect Medium (*p=0.030, unpaired t test following log transformation).
Staining of blood cells, recruitment and follow up of patients
Peripheral blood samples (10 ml) were collected from patients and healthy controls (Salvador-Bahia urban area, no history of residence in endemic areas) by venipuncture using heparin as an anticoagulant. For whole-blood staining (cohort I), 50 μΙ of whole blood was diluted with an equal volume of PBS containing 1% BSA and 0.1% sodium azide, followed by staining for 30 min on ice with fluorescein-conjugated anti-CD64 (clone 22, Immunotech-Coulter, Marseille, France; 10.1, Pharmingen, BD Biosciences, US) and lineage markers CD14 (monocytes), CD3 (T cells), CD19 (B cells), CD16b (neutrophils), CD49d (eosinophils) and CD56 (NK cells) or isotype-matched control antibodies (all from Immunotech-Coulter, Marseille, France) . Staining was followed by fixation and erythrocyte lysis (whole blood lysing solution, Becton-Dickinson, San Jose, CA) . For PBMC staining (cohort II), 200,000 mononuclear cells (purified by Ficoll/Hypaque gradient centrifugation) were stained with the same antibody cocktails as cohort I . Since the drastic lysis and fixation step for whole blood was omitted, M FIs in cohort II were higher in both controls and patients. For each sample, 10,000-20,000 events were acquired in a flow cytometer (FACSort, Becton-Dickinson) and analyzed using CellQuest software. Monocytes were gated according to their characteristic forward-scatter and side-scatter as previously described9 and were confirmed to be CD14+, CD3", CD19", CD16b" and CD56".
Patients with cutaneous leishmaniasis from two consecutive cohorts were recruited and treated in two outpatient clinics (Jequie and Jiquiriga, Bahia State, North-East Brazil) covering the same rural area, which has a low socio-economic status and a high incidence of infection with Leishmania braziliensis. This study was approved by the Ethics Committee of the University Hospital Professor Edgard Santos (first cohort, recruitment 2000-2001, follow-up until 2005) and of the Gongalo Moniz Research Center (second cohort, recruitment 2002-2004, follow-up until 2006). Healthy controls (n =40) were analyzed in parallel within the same time frame and with the same staining protocol . Informed consent was obtained from all patients and healthy controls. A total of 53 patients provided blood samples of sufficient quality for flow cytometry analysis at the time of diagnosis with cutaneous leishmaniasis (as described9, according to characteristic lesion morphology, positive skin test, seropositivity towards Leishmania antigen and/or the presence of parasites in the lesion) . Clinical and demographic data from both cohorts are listed in Table 2. Gender Age Disease Lesion Healing Treatme
(years) duration diameter time nt cycles
(days) (cm) (days)
Cohort I 16M/5F 31.3 ± 60 ± 7 2.5 ± 0.3 99 ± 22 1.04 ±
4.3 0.04
Cohort 16M/16F 29.9 ± 37 ± 3 2.0 ± 0.2 142 ± 18 1.9 ± 0.2 II 2.8
Table 2. Clinical characteristics of cutaneous leishmaniasis patients
To take both healing time (complete cicatrisation of lesions) and drug dosage (one cycle of standard treatment equals 20 days of intravenous pentavalent antimony) into account, therapeutic response was scored on a scale of 1-3 where 1 is fast (1 cycle and < 60 d), 2 is intermediate (1-3 cycles and < 360 d) and 3 is slow or non-healing (>3 cycles or > 360 d). One patient form cohort I and five patients from cohort II did not have a complete two-year follow-up and were excluded from therapeutic response analysis.
Ex vivo expression of CD64 (FcyRI) in monocytes was significantly elevated in two independent CL cohorts. In the first cohort, CD64 mean fluorescence intensity (MFI) increased 2.4-fold in patients compared to healthy donors (p=0.0039; Fig. 3a), In the second cohort, a strikingly similar 2.7-fold increase in MFI was observed in patients vs. controls (p<0.0001; Fig. 3b). In addition, the percentage of CD64-positive cells was significantly increased in both cohorts (Supplementary Fig. 3a-b). CD64 expression was also analyzed in an additional group of 17 patients (second cohort) following standard antimonial therapy. As shown in Fig. 3c, the MFI of monocyte CD64 was reduced significantly following treatment, compared to patients before treatment (p=0.014). CD64 expression did not differ significantly between treated patients and controls (p = 0.13), indicating that increased CD64 expression at diagnosis reflects disease status and is not an intrinsic feature of leishmaniasis patients. Moreover, monocyte surface levels of CD32 (FcyRII) were not significantly different before or after treatment (p= 0.84, results not shown), indicating a selective up-regulation of CD64 during active disease in human CL. CD64 MFI positively correlated to therapeutic failure in the first cohort (Supplementary Fig. 3c, r=0.65, p=0.0018). This selective association between CD64 and therapeutic response was validated in a second larger cohort (Supplementary Fig. 3d, r =0.51, p=0.006). Since the fast, intermediate and slow/non-healing phenotypes were similarly distributed in both cohorts, a joint analysis was possible following normalization of CD64 MFI. As shown in Fig. 3d, normalized CD64 expression was strongly associated with therapeutic response (p<0.0001). Both fast vs. slow healing patients (area under the ROC curve 0.97, p=0.0004, sensitivity 95,8% (95%CI [78.9-99.9%]), specificity 83,3% (95% CI [35.9- 99.6%], likelihood ratio 5.8) and fast vs. intermediate and slow healing patients (area under the ROC curve 0.81, p=0.0003, sensitivity 66,7% (95% CI [44.7- 84,4%], specificity 90,5% (95% CI [69.6-98.8%], likelihood ratio 7.0) could be significantly discriminated through their CD64 level at diagnosis, thus authenticating its clinical value as a biomarker. Legend to Figure 3
CD64 is a biomarker for therapeutic response in cutaneous leishmaniasis, a, b, Flow cytometric analysis of ex vivo monocyte CD64 expression (as mean fluorescence intensity, MFI), in 53 cutaneous leishmaniasis (CL) patients (cohort I and II, **p=0.0039, ***p<0.0001, respectively, t test with Welch's correction) and 40 normal donors, c, Flow cytometric analysis of ex vivo monocyte CD64 expression (MFI) in CL patients before and after treatment (cohort II, *p = 0.014, t test with Welch's correction), d, Normalized CD64 levels for both cohorts of CL patients classified according to therapeutic response (fast, intermediate or slow healing as described in Supplementary Methods, ANOVA p<0.0001, post- test for linear trend p < 0.0001). This study was approved by the Ethics Committee of the University Hospital Professor Edgard Santos (first cohort, recruitment 2000-2001, follow-up until 2005) and of the Gongalo Moniz Research Center (second cohort, recruitment 2002-2004, follow-up until 2006). List of amino acid sequences (sing le letter code of amino acids)
Sequence 1 : H22(scFv)- ETA'
MKYLLPTAAAGLLLLAAQPAMAMGHHHHHHHHHHSSGHIDDDDKHMKLMAQPAMAQVQLVESGGGWQ PGRSLRLSCSSSGFIFSDNYMYWVRQAPGKGLEWVATI SDGGSYTYYPDSVKGRFTI SRDNSKNTLFL QMDSLRPEDTGVYFCARGYYRYEGAMDYWGQGTPVTVSSGGGGSGGGGSGGGGSDIQLTQSPSSLSAS VGDRVTITCKSSQSVLYSSNQKNYLAWYQQKPGKAPKLLIYWASTRESGVPSRFSGSGSGTDFTFTI S SLQPEDIATYYCHQYLSSWTFGQGTKLEIKAAAELASGGPEGGSLAALTAHQACHLPLETFTRHRQPR GWEQLEQCGYPVQRLVALYLAARLSWNQVDQVIRNALASPGSGGDLGEAIREQPEQARLALTLAAAES ERFVRQGTGNDEAGAANADVVSLTCPVAAGECAGPADSGDALLERNYPTGAEFLGDGGDVSFSTRGTQ NWTVERLLQAHRQLEERGYVFVGYHGTFLEAAQSIVFGGVRARSQDLDAIWRGFYIAGDPALAYGYAQ DQEPDARGRIRNGALLRVYVPRSSLPGFYRTGLTLAAPEAAGEVERLIGHPLPLRLDAITGPEEEGGR LETILGWPLAERTVVI PSAI PTDPRNVGGDLDPSSI PDKEQAISALPDYASQPGKPPREDLK
Sequence 2 : H22(scFv)-Ang METDTLLLWVLLLWVPGSTGDAAQPAMAQVQLVESGGGWQPGRSLRLSCSSSGFIFSDNYMYWVRQA PGKGLEWVATISDGGSYTYYPDSVKGRFTI SRDNSKNTLFLQMDSLRPEDTGVYFCARGYYRYEGAMD YWGQGTPVTVSSGGGGSGGGGSGGGGSDIQLTQSPSSLSASVGDRVTITCKSSQSVLYSSNQKNYLAW YQQKPGKAPKLLIYWASTRESGVPSRFSGSGSGTDFTFTI SSLQPEDIATYYCHQYLSSWTFGQGTKL EIKAAALESRQDNSRYTHFLTQHYDAKPQGRDDRYCESIMRRRGLTSPCKDINTFIHGNKRSIKAICE NKNGNPHRENLRISKSSFQVTTCKLHGGSPWPPCQYRATAGFRNVWACENGLPVHLDQSI FRRPAEH EFRGGPEQKLISEEDLNSAVDHHHHHH
Sequence 3 : H22(scFv)-CatAD-Ang
METDTLLLWVLLLWVPGSTGDAAQPAMAQVQLVESGGGWQPGRSLRLSCSSSGFIFSDNYMYWVRQA PGKGLEWVATISDGGSYTYYPDSVKGRFTISRDNSKNTLFLQMDSLRPEDTGVYFCARGYYRYEGAMD YWGQGTPVTVSSGGGGSGGGGSGGGGSDIQLTQSPSSLSASVGDRVTITCKSSQSVLYSSNQKNYLAW YQQKPGKAPKLLIYWASTRESGVPSRFSGSGSGTDFTFTI SSLQPEDIATYYCHQYLSSWTFGQGTKL EIKAAAGGGGSALALPLSSI FSRIGDPGGPYVHDEVDRGPPGSRQDNSRYTHFLTQHYDAKPQGRDDR YCESIMRRRGLTSPCKDINTFIHGNKRSIKAICENKNGNPHRENLRI SKSSFQVTTCKLHGGSPWPPC QYRATAGFRNWVACENGLPVHLDQSIFRRPAEHEFRGGPEQKLISEEDLNSAVDHHHHHH Sequence 4: H22(scFv)-AngGGRR
METDTLLLWVLLLWVPGSTGDAAQPAMAQVQLVESGGGWQPGRSLRLSCSSSGFIFSDNYMYWVRQA PGKGLEWVATISDGGSYTYYPDSVKGRFTI SRDNSKNTLFLQMDSLRPEDTGVYFCARGYYRYEGAMD YWGQGTPVTVSSGGGGSGGGGSGGGGSDIQLTQSPSSLSASVGDRVTITCKSSQSVLYSSNQKNYLAW YQQKPGKAPKLLIYWASTRESGVPSRFSGSGSGTDFTFTI SSLQPEDIATYYCHQYLSSWTFGQGTKL EIKAAALESRQDNSRYTHFLTQHYDAKPGGRRDRYCESIMRRRGLTSPCKDINTFIHGNKRSIKAICE NKNGNPHRENLRISKSSFQVTTCKLHGGSPWPPCQYRATAGFRNVWACENGLPVHLDQSI FRRPAEH EFRGGPEQKLISEEDLNSAVDHHHHHH
Sequence 5 : H22(scFv)-CatAD-AngGGRR METDTLLLWVLLLWVPGSTGDAAQPAMAQVQLVESGGGWQPGRSLRLSCSSSGFIFSDNYMYWVRQA PGKGLEWVATISDGGSYTYYPDSVKGRFTI SRDNSKNTLFLQMDSLRPEDTGVYFCARGYYRYEGAMD YWGQGTPVTVSSGGGGSGGGGSGGGGSDIQLTQSPSSLSASVGDRVTITCKSSQSVLYSSNQKNYLAW YQQKPGKAPKLLIYWASTRESGVPSRFSGSGSGTDFTFTI SSLQPEDIATYYCHQYLSSWTFGQGTKL EIKAAAGGGGSALALPLSSI FSRIGDPGGPYVHDEVDRGPPGSRQDNSRYTHFLTQHYDAKPGGRRDR YCESIMRRRGLTSPCKDINTFIHGNKRSIKAICENKNGNPHRENLRISKSSFQVTTCKLHGGSPWPPC QYRATAGFRNWVACENGLPVHLDQSIFRRPAEHEFRGGPEQKLISEEDLNSAVDHHHHHH
Sequence 6: H22(scFv)-CatAD-GB
METDTLLLWVLLLWVPGSTGDAAQPAMAQVQLVESGGGWQPGRSLRLSCSSSGFIFSDNYMYWVRQA PGKGLEWVATISDGGSYTYYPDSVKGRFTI SRDNSKNTLFLQMDSLRPEDTGVYFCARGYYRYEGAMD YWGQGTPVTVSSGGGGSGGGGSGGGGSDIQLTQSPSSLSASVGDRVTITCKSSQSVLYSSNQKNYLAW YQQKPGKAPKLLIYWASTRESGVPSRFSGSGSGTDFTFTI SSLQPEDIATYYCHQYLSSWTFGQGTKL EIKAAAGGGGSALALPLSSI FSRIGDPGGPYVHDEVDRGPI IGGHEAKPHSRPYMAFLMIWDQKSLKR CGGFLIRDDFVLTAAHCWGSSI VTLGAH IKEQEPTQQFIPVKRAI PHPAYNPKNFSNDIMLLQLER KAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDST IELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRYAEHHH HHH
Sequence 7 : H22(scFv)-catAD-GBR2oiK
METDTLLLWVLLLWVPGSTGDAAQPAMAQVQLVESGGGWQPGRSLRLSCSSSGFIFSDNYMYWVRQA PGKGLEWVATISDGGSYTYYPDSVKGRFTI SRDNSKNTLFLQMDSLRPEDTGVYFCARGYYRYEGAMD YWGQGTPVTVSSGGGGSGGGGSGGGGSDIQLTQSPSSLSASVGDRVTITCKSSQSVLYSSNQKNYLAW YQQKPGKAPKLLIYWASTRESGVPSRFSGSGSGTDFTFTI SSLQPEDIATYYCHQYLSSWTFGQGTKL EIKAAAGGGGSALALPLSSI FSRIGDPGGPYVHDEVDRGPI IGGHEAKPHSRPYMAFLMIWDQKSLKR CGGFLIRDDFVLTAAHCWGSSI VTLGAH IKEQEPTQQFIPVKRAI PHPAYNPKNFSNDIMLLQLER KAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDST IELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGKNNGMPPRACTKVSSFVHWIKKTMKRYAEHHH HHH
Sequence 8: H22(scFv)- MAP
HHHHHHHHHHSSGHI DDDDKHMKLMAQPAMAQVQLVESGGGVVQPGRSLRLSCSSSGFIFSDNYMYWV RQAPGKGLEWVATI SDGGSYTYYPDSVKGRFTISRDNSKNTLFLQMDSLRPEDTGVYFCARGYYRYEG AMDYWGQGTPVTVSSGGGGSGGGGSGGGGSDIQLTQSPSSLSASVGDRVTITCKSSQSVLYSSNQKNY LAWYQQKPGKAPKLLIYWASTRESGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCHQYLSSWTFGQG TKLEIKAAAMAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKAEEAGIGDTPSLEDE AAGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSS GEPPKSGDRSGYSSPGSPGTPGSRSRTPALPTPPTREPKKVAWRTPPKSPSSAKSRLQTAPVPMPDL KNVKSKIGATENLKHQPGGGKVQI INKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSK CGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHG AEIVYKSPWSGDTSPRHLSNVSSTGSI DMVDSPQLATLADEVSASLAKQGLPKKKRKV
Sequence 9: GB-H22(scFv)
HI DDDDKI IGGHEAKPHSRPYMAFLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGSSI VTLGAH IKE QEPTQQFIPVKRAIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQ TAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIV SYGRNNGMPPRACTKVSSFVHWIKKTMKRYGSKLAEHEGDAAQPAMAQVQLVESGGGWQPGRSLRLS CSSSGFIFSDNYMYWVRQAPGKGLEWVATI SDGGSYTYYPDSVKGRFTI SRDNSKNTLFLQMDSLRPE DTGVYFCARGYYRYEGAMDYWGQGTPVTVSSGGGGSGGGGSGGGGSDIQLTQSPSSLSASVGDRVTIT CKSSQSVLYSSNQKNYLAWYQQKPGKAPKLLIYWASTRESGVPSRFSGSGSGTDFTFTI SSLQPEDIA TYYCHQYLSSWTFGQGTKLEIKAAAGPHHHHHH
Sequence 10: GBR20IK-H22(SCFV)
HI DDDDKI IGGHEAKPHSRPYMAFLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGSSINVTLGAHNIKE QEPTQQFIPVKRAIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQ TAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIV SYGKNNGMPPRACTKVSSFVHWIKKTMKRYAEHEGDAAQPAMAQVQLVESGGGWQPGRSLRLSCSSS GFIFSDNYMYWVRQAPGKGLEWVATI SDGGSYTYYPDSVKGRFTISRDNSKNTLFLQMDSLRPEDTGV YFCARGYYRYEGAMDYWGQGTPVTVSSGGGGSGGGGSGGGGSDIQLTQSPSSLSASVGDRVTITCKSS QSVLYSSNQKNYLAWYQQKPGKAPKLLIYWASTRESGVPSRFSGSGSGTDFTFTI SSLQPEDIATYYC HQYLSSWTFGQGTKLEIKAAAGPHHHHHH Sequence 11 : GM-H22(scFv)
HI DDDDKI IGGREVIPHSRPYMASLQRNGSHLCGGVLVHPKWVLTAAHCLAQRMAQLRLVLGLHTLDS PGLTFHIKAAIQHPRYKPVPALENDLALLQLDGKVKPSRTIRPLALPSKRQWAAGTRCSMAGWGLTH QGGRLSRVLRELDLQVLDTRMCNNSRFWNGSLSPSMVCLAADSKDQAPCKGDSGGPLVCGKGRVLAGV LSFSSRVCTDIFKPPVATAVAPYVSWIRKVTGRSAAEHEGDAAQPAMAQVQLVESGGGVVQPGRSLRL SCSSSGFI FSDNYMYWVRQAPGKGLEWVATISDGGSYTYYPDSVKGRFTI SRDNSKNTLFLQMDSLRP EDTGVYFCARGYYRYEGAMDYWGQGTPVTVSSGGGGSGGGGSGGGGSDIQLTQSPSSLSASVGDRVTI TCKSSQSVLYSSNQKNYLAWYQQKPGKAPKLLIYWASTRESGVPSRFSGSGSGTDFTFTISSLQPEDI ATYYCHQYLSSWTFGQGTKLEIKAAAGPHHHHHH
REFERENCES
P. Desjeux, "Leishmaniasis: current situation and new perspectives.," Comp. Immunol. Microbiol. Infect. Dis. , vol. 27, no. 5, pp. 305-318, Sep. 2004.
P. Desjeux, "Leishmaniasis.," Nature reviews. Microbiology, vol . 2, no. 9, p. 692, Sep-2004.
H . W. Murray, J. D. Berman, C. R. Davies, and N . G. Saravia, "Advances in leishmaniasis.," Lancet, vol. 366, no. 9496, pp. 1561-1577, Nov. 2005. F. Modabber, P. A. Buffet, E. Torreele, G. Milon, and S. L. Croft,
"Consultative meeting to develop a strategy for treatment of cutaneous leishmaniasis. Institute Pasteur, Paris. 13-15 June, 2006.," Kinetoplastid Biol Dis, vol. 6, p. 3, 2007.
J. C. Leemans, T. Thepen, S. Weijer, S. Florquin, N . van Rooijen, J. G. van de Winkel, and T. van der Poll, "Macrophages play a dual role during pulmonary tuberculosis in mice.," J Infect Dis, vol. 191, no. 1, pp. 65-74, Jan. 2005.
E. Peterson, S. M . Owens, and R. L. Henry, "Monoclonal antibody form and function : manufacturing the right antibodies for treating drug abuse.," AAPS J, vol. 8, no. 2, pp. E383-90, 2006.
B. Matthey, A. Engert, A. Klimka, V. Diehl, and S. Barth, "A new series of pET-derived vectors for high efficiency expression of Pseudomonas exotoxin-based fusion proteins.," Gene, vol. 229, no. 1, pp. 145-153, Mar. 1999.
M . R. Green and J. Sambrook, Molecular Cloning. 2012.
B. Stahnke, T. Thepen, M. Stocker, R. Rosinke, E. Jost, R. Fischer, M . K.
Tur, and S. Barth, "Granzyme B-H22(scFv), a human immunotoxin targeting CD64 in acute myeloid leukemia of monocytic subtypes," Mol.
Cancer Ther., vol. 7, no. 9, pp. 2924-2932, Sep. 2008.
M . K. Tur, M . Huhn, T. Thepen, M . Stocker, R. Krohn, S. Vogel, E. Jost, R.
Osieka, J. G. van de Winkel, R. Fischer, R. Finnern, and S. Barth,
"Recombinant CD64-specific single chain immunotoxin exhibits specific cytotoxicity against acute myeloid leukemia cells.," Cancer Res, vol . 63, no. 23, pp. 8414-8419, Dec. 2003. [11] T. Thepen, A. J. van Vuuren, R. C. Kiekens, C. A. Damen, W. C. Vooijs, and J. G. Van De Winkel, "Resolution of cutaneous inflammation after local elimination of macrophages.," Nat. Biotechnol., vol. 18, no. 1, pp. 48-51, Jan. 2000.
[12] I. A. I. Heijnen, I. A. I. Heijnen, J. G. J. Van de Winkel, and J. G. J. Van de Winkel, "A human Fc gamma RI/CD64 transgenic model for in vivo analysis of (bispecific) antibody therapeutics.," J Hematother, vol.4, no 5, pp. 351-356, Sep. 1995.

Claims

Claims
1. An immunotoxin for use in the treatment of leishmaniasis wherein the immunotoxin comprises a portion which is specifically binding to the cellular surface receptor CD64 as a component A and a cell killing portion as a component B, wherein the cell killing portion alters the function, gene expression, or viability of a cell thereby killing Leishmania-infected macrophages and by this eliminates Leishmania.
2. The immunotoxin of claim 1 for the use of claim 1 wherein the cell killing portion is covalently bonded to the portion specifically binding to the cellular surface receptor CD64.
3. The immunotoxin of claim 1 or 2 for the use of claim 1 wherein the immunotoxin is a recombinant protein or the portion specifically binding to the cellular surface receptor CD64 is linked directly to the cell killing portion or linked via a linking group.
4. The immunotoxin of anyone of claims 1 to 3 for the use of claim 1 wherein the portion which is specifically binding to the cellular surface receptor CD64 is selected from the group consisting of antibodies or their derivatives or fragments, such as scFv fragments; synthetic peptides or molecules; ligands; receptor binding molecules, and their structural analogs; mutants or combinations thereof.
5. The immunotoxin of anyone of claims 1 to 4 for the use of claim 1 wherein the portion which is specifically binding to the cellular surface receptor CD64 is a recombinant molecule.
6. The immunotoxin of anyone of claims 1 to 5 for the use of claim 1 wherein the cell killing portion alters the function, gene expression, or viability of a cell by inactivating molecules responsible for protein biosynthesis or activating components of cell-inherent apoptosis pathways.
7. The immunotoxin of anyone of claims 1 to 6 for the use of claim 1 wherein the cell killing portion is cytotoxic in particular a molecule selected from the group consisting of a member of ADP-ribosylating enzymes, such as the Pseudomonas Exotoxin A, Diphtheria-, Cholera- or the Pertussis-, Botulinumtoxin; or a member of the ribosome-inactivating proteins such as Dianthin, Saporin, Bryodin, Gelonin, Ricin, Abrin, Pokeweed Antiviral Protein (PAP) or Restrictocin; or is a member of the RNases (Phosphodiesterases) such as the Bovine seminal RNase, BovineRNase A, Bovine pancreatic RNase, Angiogenin, Eosinophil-derived Neurotoxin (EDN), Eosinophilic Cationic Protein (ECP), Onconase, or Bullfrog Lectin; or is a member of the prodrug-activating enzymes such as Calicheamicin, Glucose Oxidase, Carboxypeptidase, Alkaline Phosphatase, Cytosindeaminase, β-Glucosidase, β-Glucuronidase, β-Lactamase, Nitroreductase, Thymidinkinase or Purin Nukleosid Phosphorylase; or is a member of the cathepsin protease family; or a member of the calpains; or a member of the granzymes; or a member of the microtubule-binding proteins including tau; or any derivative of the above mentioned proteins; or a combination thereof.
The immunotoxin of claim 7 for the use of claim 1 wherein the cell killing portion is a molecule selected from the group consisting of a member of ADP-ribosylating enzymes or a member of the ribosome-inactivating proteins.
The immunotoxin of anyone of claims 1 to 6 for the use of claim 1 wherein the cell killing portion is a small molecule selected from the group of alkylating agents (e.g. cyclophosphamide, cholrambucil), anthracyclins (doxorubicin, daunomycin), maytansinoids (maytansinoid DM 1), antimetabolites, plant alkaloids and terpenoids as the Vinca alkaloids (vinblastine, vincristine vinorebline, vindesin) Podophyllotoxin and structural analogs hereof and taxanes (paclitaxel, docetaxel, taxotere) or topoisomerase inhibitors (camptothecins), synthetic toxins as ellipticine analogs or snythetic analogs of tumor antibiotics as duocarmycin or CC1065, other tubulin binding agents as halichondrin B, hemiasterlins and dolastatins or analogs as monomethyl-auristatin E; component B may also be selected from the group of small molecules having cytotoxic/cytostatic activities like alkylating agents (like Cyclophosphamide, Mechlorethamine, Chlorambucil, Melphalan) or anthracyclines (like Danorubicin, Doxorubicin, Epirubicin, Idarubicin, Mitoxantrone, Valrubicin) or cytoskeletal disruptors (like Paclitaxel, Docetaxel) or Epothilones (like ) or Inhibitors of topoisomerase II (like Etoposide, Teniposide, Tafluposide) or nucleotide analogs and precursor analogs (like azacididine, azathioprine, capecitabine, cytarabine, doxofluridine, fluorouracil, gemcitabine, mercaptopurine, methotrexate, tioguanine) or peptide antibiotics (like bleomycin) or platinum-based agents (like carboplatin, cisplatin, oxaliplatin) or retinoids (like all-trans retinoic acid) or vinca alkaloids and structural analogs (like vinblastine, vincristine, vindestine, vinorelbine), beta ray emiting nuclides like Iodine-131, Yttrium- 90, Lutetium-177, from the group of Aromatase Inhibitors (like Aminoglutethimide, Anastrozole, Letrozole, Vorozole, Exemestane, 4- androstene-3,6,17-trione, l,4,6-androstatrien-3,17-dione, Formestane, Testolactone), Carbonic Anhydrase Inhibitors (like Acetazolamide, Methazolamide, Dorzolamide, Topiramate), Cholinesterase Inhibitors (Organophosphates like Metrifonate, Carbamates like Physostigmine, Neostigmine, Pyridostigmine, Ambenonium, Demarcarium, Rivastigmine, Phananthrine like Galantamine, Piperidine like Donepezil, Tacrine, Edophonium, or Phenothiazines), Cyclooxygenase Inhibitors (like Celecoxib, Rofecoxib, Etoricoxib, Acetaminophen, Diclofenac, Ibuprofen), Folic Acid Antagonists (like Methotrexate), Hydroxymethylglutaryl-CoA Reductase Inhibitors (like Atorvastatin, Cerivastatin, Fluvastatin, Lovastatin, Mevastatin, Pitavastatin, Pravastatin, Rosuvastatin, Simvastatin, Vytorin, Advicor, Caduet), Integrase Inhibitors (like Raltegravir, Elvitegravir), Lipoxygenase Inhibitors (like Zileutron), Monoamine Oxidase Inhibitors (like Isocarboxazid, Moclobemide, Phenelzine, Tranylcypromine, Selegiline, Rasagiline, Nialamide, Iproniazid, Iproclozide, Toloxatone, Linezolid, Tryptamines, Dienolide, Detxtroamphetamine), Nucleic Acid Synthesis Inhibitors, Phosphodiesterase Inhibitors (like Caffeine, Theopyline, 3- isobutyl-l-methylxanthine, Vinpocetine, EHNA, Enoximone, Lirinone, PDE3, Mesembrine, Rolipram, Ibudilast, Sildenafil, Tadalafil, Vardenafil, Udenafil, Avanafil), Protease Inhibitors (like Saquinavir, Ritonavir, Idinavir, Nelfinavir, Amprenavir, Lopinavir, Atazanavir, Fosamprenavir, Tipranavir, Darunavir), Protein Kinase Inhibitors (like Imatinib, Geftinib, Pegaptanib, Sorafenib, Dasatinib, Sunitinib, Erlotinib, Nilotinib, Lapatinib), Protein Synthesis Inhibitors (like Anisomycin, Cycloheximide, Chloramphenicol, Tetracycline, Streptomycin, Erythromycin, Puromycin, etc.), Proton Pump Inhibitors (like Omeprazole, Lansoprazole, Esomeprazole, Pantoprazole, Rabeprazole), from the group of oligonucleotides nucleic acids like small interfering RNAs
(siRNAs) or a short hairpin RNA (shRNA), an antisense DNA or RNA, a double stranded RNA (dsRNA) or a micro RNA (miRNA) might be used to down-regulate specific key elements of regulative pathways within a cell .
10. The immunotoxin of claim 9 for the use of claim 1 wherein the cell killing portion is a molecule selected from the group of Pseudomonas Exotoxin A or
Ricin.
11. The immunotoxin of anyone of claims 1 to 10 for the use of claim 1 having at least one supplementary component C.
12. The immunotoxin of claim 11 for the use of claim 1 wherein the component C regulates expression of a gene encoding the immunotoxin .
13. The immunotoxin according to claim 11 or 12 for the use of claim 1 wherein component C enables purification of the recombinant immunotoxin or its individual component A or B.
14. The immunotoxin according to anyone of claims 11 to 13 for the use of claim 1 wherein the component C stimulates internalization of the immunotoxin or its individual components, in particular of the cell killing portion, into a macrophage as target cell.
15. The immunotoxin according to anyone of claims 11 to 14 for the use of claim 1 wherein the component C triggers translocation of the cell killing portion into a subcellular compartment.
16. The immunotoxin according to anyone of claims 11 to 15 for the use of claim 1 wherein the component C stimulates proteolytic removal of the portion which is specifically binding to the cellular surface receptor CD64 from the cell killing portion.
17. The immunotoxin according to anyone of claims 11 to 16 for the use of claim 1 wherein the component C triggers intracellular activation of the cell killing portion.
PCT/EP2016/051208 2015-01-21 2016-01-21 An immunotoxin for use in the treatment of leishmaniasis Ceased WO2016116550A1 (en)

Priority Applications (2)

Application Number Priority Date Filing Date Title
US15/542,549 US20170369574A1 (en) 2015-01-21 2016-01-21 An immunotoxin for use in the treatment of leishmaniasis
BR112017014616A BR112017014616A2 (en) 2015-01-21 2016-01-21 immunotoxin for use in the treatment of leishmaniasis

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
EP15151876 2015-01-21
EP15151876.8 2015-01-21

Publications (1)

Publication Number Publication Date
WO2016116550A1 true WO2016116550A1 (en) 2016-07-28

Family

ID=52394934

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2016/051208 Ceased WO2016116550A1 (en) 2015-01-21 2016-01-21 An immunotoxin for use in the treatment of leishmaniasis

Country Status (3)

Country Link
US (1) US20170369574A1 (en)
BR (1) BR112017014616A2 (en)
WO (1) WO2016116550A1 (en)

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2015189427A1 (en) * 2014-06-13 2015-12-17 Curit Biotech Holding Gmbh Human cytolytic fusion proteins

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2005052007A1 (en) 2003-11-26 2005-06-09 Fraunhofer Gesellschaft zur Förderung der angewandten Forschung e.V. Recombinant anti-cd64-immunotoxins

Patent Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2005052007A1 (en) 2003-11-26 2005-06-09 Fraunhofer Gesellschaft zur Förderung der angewandten Forschung e.V. Recombinant anti-cd64-immunotoxins

Non-Patent Citations (17)

* Cited by examiner, † Cited by third party
Title
1. A. I. HEIJNEN; I. A. I. HEIJNEN; J. G. J. VAN DE WINKEL; J. G. J. VAN DE WINKEL: "A human Fc gamma RI/CD64 transgenic model for in vivo analysis of (bispecific) antibody therapeutics.", J HEMATOTHER, vol. 4, no. 5, September 1995 (1995-09-01), pages 351 - 356
B. MATTHEY; A. ENGERT; A. KLIMKA; V. DIEHL; S. BARTH: "A new series of pET-derived vectors for high efficiency expression of Pseudomonas exotoxin-based fusion proteins.", GENE, vol. 229, no. 1, March 1999 (1999-03-01), pages 145 - 153
B. STAHNKE; T. THEPEN; M. ST6CKER; R. ROSINKE; E. JOST; R. FISCHER; M. K. TUR; S. BARTH: "Granzyme B-H22(scFv), a human immunotoxin targeting CD64 in acute myeloid leukemia of monocytic subtypes", MOL. CANCER THER., vol. 7, no. 9, September 2008 (2008-09-01), pages 2924 - 2932
BETTINA STAHNKE ET AL: "Granzyme B-H22(scFv), a human immunotoxin targeting CD64 in acute myeloid leukemia of monocytic subtypes", vol. 7, no. 9, September 2008 (2008-09-01), pages 2924 - 2932, XP002692452, ISSN: 1535-7163, Retrieved from the Internet <URL:http://mct.aacrjournals.org/content/7/9/2924> [retrieved on 20150423], DOI: 10.1158/1535-7163.MCT-08-0554 *
E. PETERSON; S. M. OWENS; R. L. HENRY: "Monoclonal antibody form and function: manufacturing the right antibodies for treating drug abuse.", AAPS J, vol. 8, no. 2, 2006, pages E383 - E390
F. MODABBER; P. A. BUFFET; E. TORREELE; G. MILON; S. L. CROFT: "Consultative meeting to develop a strategy for treatment of cutaneous leishmaniasis. Institute Pasteur, Paris. 13-15 June, 2006", KINETOPLASTID BIOL DIS, vol. 6, 2007, pages 3
H. W. MURRAY; J. D. BERMAN; C. R. DAVIES; N. G. SARAVIA: "Advances in leishmaniasis.", LANCET, vol. 366, no. 9496, November 2005 (2005-11-01), pages 1561 - 1577
J. C. LEEMANS; T. THEPEN; S. WEIJER; S. FLORQUIN; N. VAN ROOIJEN; J. G. VAN DE WINKEL; T. VAN DER POLL: "Macrophages play a dual role during pulmonary tuberculosis in mice.", J INFECT DIS, vol. 191, no. 1, January 2005 (2005-01-01), pages 65 - 74
J. VAN WEYENBERGH ET AL., ABSTRACT/ CYTOKINE, vol. 63, 2013, pages 243 - 314
M. K. TUR; M. HUHN; T. THEPEN; M. ST6CKER; R. KROHN; S. VOGEL; E. JOST; R. OSIEKA; J. G. VAN DE WINKEL; R. FISCHER: "Recombinant CD64-specific single chain immunotoxin exhibits specific cytotoxicity against acute myeloid leukemia cells.", CANCER RES, vol. 63, no. 23, December 2003 (2003-12-01), pages 8414 - 8419
M. R. GREEN; J. SAMBROOK, MOLECULAR CLONING, 2012
P. DESJEUX: "Leishmaniasis", NATURE REVIEWS. MICROBIOLOGY, vol. 2, no. 9, September 2004 (2004-09-01), pages 692
P. DESJEUX: "Leishmaniasis: current situation and new perspectives.", COMP. IMMUNOL. MICROBIOL. INFECT. DIS., vol. 27, no. 5, September 2004 (2004-09-01), pages 305 - 318
T. THEPEN; A. J. VAN VUUREN; R. C. KIEKENS; C. A. DAMEN; W. C. VOOIJS; J. G. VAN DE WINKEL: "Resolution of cutaneous inflammation after local elimination of macrophages.", NAT. BIOTECHNOL., vol. 18, no. 1, January 2000 (2000-01-01), pages 48 - 51
THEPEN T ET AL: "Resolution of cutaneous inflammation after local elimination of macrophages.", NATURE BIOTECHNOLOGY JAN 2000, vol. 18, no. 1, January 2000 (2000-01-01), pages 48 - 51, XP055185670, ISSN: 1087-0156 *
TUR M K ET AL: "Recombinant CD64-specific single chain immunotoxin exhibits specific cytotoxicity against acute myeloid leukemia cells", CANCER RESEARCH, AMERICAN ASSOCIATION FOR CANCER RESEARCH, US, vol. 63, no. 23, December 2003 (2003-12-01), pages 8414 - 8419, XP002365357, ISSN: 0008-5472 *
VAN WEYENBERGH JOHAN ET AL: "Challenging the Th1 paradigm: A detrimental role for IFN-gamma and IFN-regulated CD64 in human leishmaniasis", CYTOKINE, vol. 63, no. 3, Sp. Iss. SI, September 2013 (2013-09-01), & ANNUAL JOINT CONFERENCE OF THE INTERNATIONAL-CYTOKINE-SOCIETY AND THE INTERNATIONAL-SOCIETY-FOR-INTE; SAN FRANCISCO, CA, USA; SEPTEMBER 29 -OCTOBER 03, 2013, pages 306, XP055185477 *

Also Published As

Publication number Publication date
US20170369574A1 (en) 2017-12-28
BR112017014616A2 (en) 2018-02-06

Similar Documents

Publication Publication Date Title
Morris et al. Cytokine release syndrome and associated neurotoxicity in cancer immunotherapy
KR102889007B1 (en) Blockade of cd7 expression and chimeric antigen receptors for immunotherapy of t-cell malignancies
AU2017219415B2 (en) Combination immune therapy and cytokine control therapy for cancer treatment
ES2719495T5 (en) Anti-b7-h6 antibody, fusion proteins, and methods of using the same
Zhang et al. Programmed nanocloak of commensal bacteria-derived nanovesicles amplify strong immunoreactivity against tumor growth and metastatic progression
CA2959821C (en) Compositions and methods for inducing phagocytosis of mhc class i positive cells and countering anti-cd47/sirpa resistance
Shabaneh et al. Systemically administered low-affinity HER2 CAR T cells mediate antitumor efficacy without toxicity
Soleimani Samarkhazan et al. Unveiling the potential of CLL-1: a promising target for AML therapy
JP2021090434A (en) Treatment of cancer using humanized anti-CD19 chimeric antigen receptor
JP2021512635A (en) Chimeric antigen receptor targeting the tumor microenvironment
KR20200046065A (en) Combination immunotherapy and cytokine control therapy to treat cancer
JP2021524282A (en) Receptor inhibition by phosphatase mobilization
KR20210044774A (en) Compositions and methods for immunotherapy targeting FLT3, PD-1 and/or PD-L1
Fu et al. Combination foretinib and anti-PD-1 antibody immunotherapy for colorectal carcinoma
JP2021502808A (en) LILRB4 targeting method using CAR-T cells or CAR-NK cells in the treatment of cancer
Li et al. Inhibition of the NLRP3 inflammasome activation by manoalide ameliorates experimental autoimmune encephalomyelitis pathogenesis
EP2651978B1 (en) Use of an antibody directed against a membrane protein
CN114401991A (en) anti-SIGLEC-9 compositions and methods for modulating inflammatory phenotype of myeloid cells and uses thereof
CA2903359A1 (en) Targeted modulation of macrophages
Maghazachi et al. Glatiramer acetate, dimethyl fumarate, and monomethyl fumarate upregulate the expression of CCR10 on the surface of natural killer cells and enhance their chemotaxis and cytotoxicity
EP1283719B1 (en) Apoptotic agents
Warren et al. SRF617 is a potent inhibitor of CD39 with immunomodulatory and antitumor properties
Han et al. Development of highly optimized antibody–drug conjugates against CD33 and CD123 for acute myeloid leukemia
Niesen et al. In vitro effects and ex vivo binding of an EGFR-specific immunotoxin on rhabdomyosarcoma cells
Wang et al. Autophagy-mediated NKG2D internalization impairs NK cell function and exacerbates radiation pneumonitis

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 16707640

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 15542549

Country of ref document: US

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112017014616

Country of ref document: BR

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 112017014616

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20170706

122 Ep: pct application non-entry in european phase

Ref document number: 16707640

Country of ref document: EP

Kind code of ref document: A1