WO2016115290A1 - Pharmacological modulators of gabaα receptors and their use - Google Patents
Pharmacological modulators of gabaα receptors and their use Download PDFInfo
- Publication number
- WO2016115290A1 WO2016115290A1 PCT/US2016/013318 US2016013318W WO2016115290A1 WO 2016115290 A1 WO2016115290 A1 WO 2016115290A1 US 2016013318 W US2016013318 W US 2016013318W WO 2016115290 A1 WO2016115290 A1 WO 2016115290A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- cys
- arg
- ser
- glu
- thr
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/4702—Regulators; Modulating activity
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K49/00—Preparations for testing in vivo
- A61K49/001—Preparation for luminescence or biological staining
- A61K49/0013—Luminescence
- A61K49/0017—Fluorescence in vivo
- A61K49/005—Fluorescence in vivo characterised by the carrier molecule carrying the fluorescent agent
- A61K49/0056—Peptides, proteins, polyamino acids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
Definitions
- Ionotropic ⁇ -aminobutyric acid type A (GABAA) receptors are found primarily in the central nervous system (CNS) where they mediate inhibitory post-synaptic transmission by increasing CI " conductance into the cell.
- GABAA receptor activation can be excitatory in neonatal neurons and dorsal root ganglia where intracellular CI " concentrations are high and receptor activation causes CI " efflux which in turn, depolarizes the cell.
- clinical phenotypes such as epilepsy, schizophrenia, and chronic pain can occur.
- GABAA receptors are targeted by various drugs including barbiturates, benzodiazepines, and anesthetics.
- GABAA receptors belong to the pentameric Cys-loop superfamily of ligand-gated ion channel receptors which also encompasses the nicotinic acetylcholine (nAChRs), glycine (GlyR), and serotonin (5-HT3) receptors.
- nAChRs nicotinic acetylcholine
- GlyR glycine
- 5-HT3 serotonin
- the numerous subunit isoforms al-6, ⁇ 1-3, ⁇ 1-3, ⁇ , ⁇ , ⁇ , and pl-3 that can make up a GABAA receptor create multiple potential structural arrangements.
- each subunit consists of four trans-membrane domains (TM1-4), in which TM2 delineates the axially positioned CI " channel.
- Molecules can interact with various regions within one or more subunits, resulting in a complex pharmacological landscape.
- GABA and muscimol bind at the extracellular interface between a ⁇ - and a-subunit ( ⁇ +/ ⁇ -) whereas benzodiazepines require both the a- and Y2-subunit to be pharmacologically active.
- anesthetics such as propofol most likely position themselves in transmembrane inter-subunit pockets.
- picrotoxin (PTX) is the only well-documented naturally-occurring plant toxin that is known to block the pore of GABAA receptors and is experimentally used as a chemoconvulsant to induce epileptic seizures. This is in contrast to nAChRs, where molecules isolated from plant extracts, snake and cone snail venoms have been used extensively to probe the structural and functional properties of these receptors.
- MmTXl and MmTX2 Two toxins present in Costa Rican coral snake venom, named MmTXl and MmTX2, which bind to GABAA receptors at nanomolar concentrations.
- MmTXl and MmTX2 and polypeptide homologs and variants thereof can potentiate GABAA receptor opening and accelerate desensitization when an agonist is present, possibly by interacting with the ⁇ +/ ⁇ - interface.
- the present invention provides polypeptides having GABAA modulating activity.
- the present invention provides polypeptides having GABAA modulating activity comprising the following amino acid sequence a) LTCKTCPFTTCPNSESCPGGQSICYQRKWEEHRGERIERRCVANCPAFGSHDTSLLCC TRDNCN (MmTXl) (SEQ ID NO: 1), b) a functional fragment of a); c) a functional homolog of a) or b) or functional fragment thereof; and d) a fusion polypeptide comprising an amino acid sequence of any of a) to c).
- the present invention provides polypeptides having GABAA modulating activity comprising the following amino acid sequence a) LTCKTCPFTTCPNSESCPGGQSICYQRKWEEHHGERIERRCVANCPAFGSHDTSLLCC TRDNCN (MmTX2) (SEQ ID NO: 2), b) a functional fragment of a); c) a functional homolog of a) or b) or functional fragment thereof; and d) a fusion polypeptide comprising an amino acid sequence of any of a) to c).
- the present invention provides polypeptides having GABAA modulating activity comprising the following amino acid sequence: a) Xaa Xaa Cys Lys Thr Cys Pro Phe Thr Thr Cys Pro Asn Ser Glu Ser Cys Xaa Xaa Xaa Xaa Xaa Cys Tyr Gin Arg Lys Trp Glu Glu His Arg Gly Glu Arg He Glu Arg Arg Cys Xaa Xaa Cys Pro Ala Phe Gly Ser His Asp Thr Ser Xaa Xaa Cys Cys Thr Arg Asp Asn Cys Asn (SEQ ID NO: 6), b) a functional fragment of a); c) a functional homolog of a) or b) or functional fragment thereof; and d) a fusion polypeptide comprising an amino acid sequence of any of a) to c).
- the present invention provides polypeptides having GABAA modulating activity comprising the following amino acid sequence: a) Xaa Xaa Cys Lys Thr Cys Pro Phe Thr Thr Cys Pro Asn Ser Glu Ser Cys Xaa Xaa Xaa Xaa Xaa Cys Tyr Gin Arg Lys Trp Glu Glu His His Gly Glu Arg He Glu Arg Arg Cys Xaa Xaa Cys Pro Ala Phe Gly Ser His Asp Thr Ser Xaa Xaa Cys Cys Thr Arg Asp Asn Cys Asn (SEQ ID NO: 7), b) a functional fragment of a); c) a functional homolog of a) or b) or functional fragment thereof; and d) a fusion polypeptide comprising an amino acid sequence of any of a) to c).
- the present invention provides polypeptides having GABAA modulating activity comprising the following amino acid sequence: a) Leu Thr Cys Lys Thr Cys Pro Phe Thr Thr Cys Pro Asn Ser Glu Ser Cys Pro Gly Gly Gin Ser He Cys Tyr Gin Arg Lys Trp Glu Glu His Arg Gly Glu Arg He Glu Arg Arg Cys Val Ala Asn Cys Pro Ala Phe Gly Ser His Asp Thr Leu Leu Cys Cys Thr Arg Asp Asn Cys Asn (SEQ ID NO: 8), b) a functional fragment of a); c) a functional homolog of a) or b) or functional fragment thereof; and d) a fusion polypeptide comprising an amino acid sequence of any of a) to c).
- the present invention provides polypeptides having GABAA modulating activity comprising the following amino acid sequence: a) Met Lys Cys Leu He Cys Pro Phe Thr Thr Cys Ser Gin Ser Glu Ser Cys Pro Gly Gly Gin Ser He Cys Phe Gin Arg Lys Phe Asp Asp Arg His Gly Asp Arg He Glu Arg Gly Cys Ala Val Thr Cys Pro Pro Phe Gly Ser His Asp Thr He Phe Cys Cys Ser Thr Asn Asp Cys Asn (SEQ ID NO: 9), b) a functional fragment of a); c) a functional homolog of a) or b) or functional fragment thereof; and d) a fusion polypeptide comprising an amino acid sequence of any of a) to c).
- the present invention provides polypeptides having GABAA modulating activity comprising the following amino acid sequence: a) He Glu Cys His Asn Cys Pro Phe Thr Thr Cys Gly Asn Ser Glu Ser Cys Pro Gly Gly Gin Ser He Cys Val Gin Arg Lys Leu Glu Glu Lys Lys Gly Glu Arg He Glu Arg Ser Cys Thr Asp Gly Cys Pro Gly Phe Gly Ser His Asp Thr Val Glu Cys Cys Arg He Ala Arg Cys Asn (SEQ ID NO: 10), b) a functional fragment of a); c) a functional homolog of a) or b) or functional fragment thereof; and d) a fusion polypeptide comprising an amino acid sequence of any of a) to c).
- the present invention provides polypeptides having GABAA modulating activity comprising the following amino acid sequence: a) Arg Gin Cys Tyr Thr Cys Pro Phe Thr Thr Cys His Asn Ser Glu Ser Cys Pro Gly Gly Gin Ser He Cys Tyr Gin Arg Lys Tyr Glu Glu His Arg Gly Glu Arg He Glu Arg Lys Cys Ser Leu Ser Cys Pro Ser Phe Gly Ser His Asp Thr Leu Leu Cys Cys Ala Arg Pro Lys Cys Asn (SEQ ID NO: 11), b) a functional fragment of a); c) a functional homolog of a) or b) or functional fragment thereof; and d) a fusion polypeptide comprising an amino acid sequence of any of a) to c).
- the present invention provides polypeptides having GABAA modulating activity comprising the following amino acid sequence: a) Phe Arg Cys Phe Arg Cys Pro Phe Thr Thr Cys Asn Asn Ser Glu Ser Cys Pro Gly Gly Gin Ser He Cys Tyr Gin Arg Lys Trp Glu Glu His Arg Gly Glu Arg He Glu Arg Arg Cys Val Ala Asn Cys Pro Ala Phe Gly Ser His Asp Thr Leu Leu Cys Cys Lys Arg Glu Glu Cys Asn (SEQ ID NO: 12), b) a functional fragment of a); c) a functional homolog of a) or b) or functional fragment thereof; and d) a fusion polypeptide comprising an amino acid sequence of any of a) to c).
- the present invention provides polypeptides having GABAA modulating activity comprising the following amino acid sequence: a) Leu Ser Cys Asn Thr Cys Pro Phe Thr Thr Cys Gin Asn Ser Glu Ser Cys Pro Gly Gly Gin Ser He Cys Tyr Gin Arg Lys Trp Glu Glu His Arg Gly Glu Arg He Glu Arg Arg Cys Val Ala Asn Cys Pro Ala Phe Gly Ser His Asp Thr Leu Leu Cys Cys Thr Arg Asp Asn Cys Asn (SEQ ID NO: 13), b) a functional fragment of a); c) a functional homolog of a) or b) or functional fragment thereof; and d) a fusion polypeptide comprising an amino acid sequence of any of a) to c).
- the present invention provides polypeptides having GABAA modulating activity comprising the following amino acid sequence: a) Leu Leu Cys Lys Thr Cys Pro Phe Thr Thr Cys Pro Asn Ser Glu Ser Cys Pro Gly Gly Gin Ser He Cys Tyr Gin Arg Lys Trp Glu Glu His Arg Gly Glu Arg He Glu Arg Arg Cys Val Ala Asn Cys Pro Ala Phe Gly Ser His Asp Thr Leu Leu Cys Cys Thr Arg Asp Asn Cys Asn (SEQ ID NO: 14), b) a functional fragment of a); c) a functional homolog of a) or b) or functional fragment thereof; and d) a fusion polypeptide comprising an amino acid sequence of any of a) to c).
- the present invention provides a polypeptide having GABAA modulating activity comprising the following amino acid sequence: a) Xaa Xaa Cys Lys Thr Cys Pro Phe Thr Thr Cys Pro Asn Ser Glu Ser Cys Xaa Xaa Xaa Xaa Xaa Cys Tyr Gin Arg Lys Trp Glu Glu His Arg Gly Glu Arg He Glu Arg Arg Cys Xaa Xaa Cys Pro Ala Phe Gly Ser His Asp Thr Ser Xaa Xaa Cys Cys Thr Arg Asp Asn Cys Asn (SEQ ID NO: 6); b) a functional fragment of a); c) a functional homolog of a) or b) or functional fragment thereof; and d) a fusion polypeptide comprising an amino acid sequence of any of a) to c).
- the present invention provides a polypeptide having GABAA modulating activity comprising the following amino acid sequence: a) Xaa Xaa Cys Lys Thr Cys Pro Phe Thr Thr Cys Pro Asn Ser Glu Ser Cys Xaa Xaa Xaa Xaa Xaa Cys Tyr Gin Arg Lys Trp Glu Glu His His Gly Glu Arg He Glu Arg Arg Cys Xaa Xaa Cys Pro Ala Phe Gly Ser His Asp Thr Ser Xaa Xaa Cys Cys Thr Arg Asp Asn Cys Asn (SEQ ID NO: 7); b) a functional fragment of a); c) a functional homolog of a) or b) or functional fragment thereof; and d) a fusion polypeptide comprising an amino acid sequence of any of a) to c).
- the present invention provides one or more nucleic acid sequences encoding any of the polypeptides having GABAA modulating activity or derivatives, homologues, analogues or mimetics thereof disclosed herein.
- the present invention provides a vector comprising one or more nucleic acid sequences encoding any of the polypeptides having GABAA modulating activity or derivatives, homologues, analogues or mimetics thereof disclosed herein.
- the present invention provides a composition comprising one or more polypeptides having GABAA modulating activity described herein, and at least one or more biologically active agents.
- the present invention provides a composition comprising one or more polypeptides having GABAA modulating activity described herein, and at least one or more imaging agents.
- the present invention provides methods for modulating GABAA receptors in a cell or population of cells expressing the GABAA receptor comprising contacting the cell or population of cells with an effective amount of the inventive polypeptides described herein.
- the present invention provides methods for modulating GABAA receptors in a subject suffering from a neurological disorder comprising administering to the subject a composition comprising one or more polypeptides having GABAA modulating activity described herein, and at least one or more biologically active agents.
- FIGS 1A-1C Native and recombinant MmTXl and MmTX2 are equally potent.
- 1 A Picture of the Costa Rican coral snake Micrurus mipartitus.
- IB Primary amino acid sequences of MmTXl and MmTX2. Note the different residue at position 33 (grey background).
- Figures 2A-2D Binding kinetics of rMmTX2 to SPMs.
- 2A Association kinetics of 125 I-rMmTX2 binding to SPMs. Shown are the association curves for three ligand concentrations (1, 2, and 4 nM). Lines represent a nonlinear fit with a one- phase exponential association curve providing pseudo-first order association constants (k 0 bs.) that are used in panel 2B.
- Figure represents the k 0 bs linear variation with 1, 2, and 4 nM ligand concentrations.
- Slope represents the association kinetic constant (k+i; shown in inset).
- 2C Dissociation kinetics of 125 I-rMmTX2 from SPMs.
- Line represents a nonlinear fit with a one-phase exponential decay providing the shown rate constant (k i) and a ti/ 2 of 478s ( ⁇ 8 min). 2D, Saturation binding isotherm of 125 I-rMmTX2 to SPMs. Nonspecific binding as determined in the presence of a 1000-fold excess of unlabeled rMmTX2 has been subtracted. Line represents a nonlinear fit with one class of non-interacting binding sites giving an equilibrium binding constant (Kd) of 0.51 ⁇ 0.09 nM and a maximum specific binding (Bmax) of 264 ⁇ 14 fmol/mg protein.
- Kd equilibrium binding constant
- Bmax maximum specific binding
- FIGS 3A-3C Pharmacological profiling of rMmTX2.
- 3 A Bar-plot of competition experiments between 125 I-rMmTX2 and a variety of ligands for binding to SPMs. The tested compounds are shown within the bar and their primary target is indicated on the X-axis. Concentrations used: all animal toxins 10 ⁇ , (rMmTX2 0.1 ⁇ ), glycine 1 mM, glutamate 0.1 mM, atropine 1 ⁇ , d-tubocurarine 10 ⁇ . Diagram shows that none of the tested ligands competes with 125 I-rMmTX2 for binding to SPMs.
- 3B Competition experiments of 125 I-rMmTX2 with a variety of GABAA receptor modulators for binding to SPMs. Tested compounds are listed with their corresponding symbols. Lines represent a nonlinear fit with a sigmoidal dose-response curve (variable slope; Hill Slope) to provide the EC50 values listed in the text. The only exception is picrotoxin (PTX) which increases the binding of 125 I-rMmTX2.
- PTX picrotoxin
- rMmTXl competes for binding to SPMs with [ H]muscimol.
- Figures 5A-5C Effect of rMmTXl on hippocampal GABAA receptor currents.
- 5A Potentiation of the muscimol-induced GABAA receptor current depends on rMmTXl concentration. Currents were elicited with 5 ⁇ muscimol without and with increasing rMmTXl concentrations. Membrane holding voltage was -70 mV.
- 5B Upper panel:
- FIGS. 6A-6E Effect of sMmTXl on ⁇ 1/ ⁇ 2/ ⁇ 2 GABAA receptor currents.
- 6A A muscimol concentration of 3 ⁇ activates ⁇ 1 ⁇ 2 ⁇ 2 GABAA receptors expressed in HEK293 cells (left trace) held at a membrane voltage of -70 mV.
- currents are potentiated and receptor desensitization tends to accelerate (middle trace). Partial toxin washout is shown on the right.
- 6B Expression of the ⁇ 1 ⁇ 2 ⁇ 2 receptor in Xenopus oocytes held at a membrane voltage of -70 mV.
- Protocol consists of two 30s test applications of 5 ⁇ muscimol separated by a 3 minute wash out period followed by 100 nM sMmTXl application together with 5 ⁇ muscimol.
- sMmTXl washout is slow and after three minutes, only a fraction of the receptors can be reactivated.
- available receptors activate more slowly when compared to control suggesting that toxin is still bound.
- 6C Close-up of the red and green region indicated in panel 6B normalized to the control peak (indicated with an asterisk).
- 6D When lowering the muscimol concentration to 0.3 ⁇ , a similar effect of 100 nM sMmTXl on receptor desensitization is observed.
- 6E Similar to the ⁇ 1 ⁇ 2 ⁇ 2 receptor, the a ⁇ 2-containing receptor expressed in oocytes and held at -70 mV is sensitive to 100 nM sMmTXl .
- Figures 7A-7G sMmTXl influences hippocampal network function.
- 7A 300 nM muscimol does not have a detectable effect on the frequency of Ca 2+ oscillations.
- 7B sMmTXl by itself does not affect the frequency of Ca 2+ oscillations.
- 7C when applied together with muscimol at 300 nM, sMmTXl produces a short inhibition of network Ca 2+ oscillations followed by a marked increase in spike frequency.
- 7D Quantification of figures 7A-7C represented as a percentage variation of the Ca 2+ oscillation frequency with respect to cells perfused with extracellular solution (100%, dotted line). Data are presented as mean ⁇ SEM.
- Figure 8 shows the effect of 5 ⁇ muscimol and 100 nM sMmTXl on various GABAA receptor subunit compositions.
- Protocol consists of two 30s test applications of 5 ⁇ muscimol separated by a 3 minute wash out period followed by 100 nM sMmTXl applications in concert with 5 ⁇ muscimol. Currents could not be evoked from control (uninjected) oocytes. Close-up of the red and green region indicated in the lower panels are normalized to the control peak (indicated with an asterisk).
- Figure 9 depicts the effect of sMmTXl on the ⁇ 1 ⁇ 2 ⁇ 2 receptor mutant.
- Top panel shows an amino acid sequence alignment of rat al-6 GABAA receptor subunits indicating the pharmacologically important loop-C region. Number in italic indicates amino acid position in al . Mutated residues in al are highlighted in red whereas the corresponding positions in a2-5 are displayed with a grey background. Accession numbers for sequences used are NP_899155.1, NP_001129251.1, NP_058765.3, NP_542154.3, NP_058991.1, and NP_068613.1 for al-6, respectively.
- Middle panel shows expression of the ⁇ 1 ⁇ 2 ⁇ 2 receptor in Xenopus oocytes held at a membrane voltage of -70mV.
- Protocol consists of two 30s test applications of 5 ⁇ muscimol separated by a 3 minute washout period followed by 100 nM sMmTXl application together with 5 ⁇ muscimol.
- the ⁇ 1 ⁇ 2 ⁇ 2 receptor displays a rundown that is not present with the WT receptor (indicated by a solid line and extended by a dotted trend line).
- sMmTXl still reduces the macroscopic conductance of the ⁇ 1 ⁇ 2 ⁇ 2 receptor, yet toxin washout is markedly faster when compared to WT. Rundown is indicated by the same line as in the middle panel.
- X-axis time scale is 90s.
- Figures 10A-10D show the effect of sMmTXl on hippocampal neurons.
- Graphs are presented as paired changes for each experiment (absolute numbers, left Y-axis) and also as normalized grouped changes (%, right Y-axis).
- Graphs are presented as paired changes for each experiment (absolute numbers, left Y
- Control (Ctrl) trace black represents the average of currents recorded during 3 minutes under normal extracellular Ringer solution incubation.
- the sMmTXl trace (red) is the result of averaging currents for 3 minutes after 3 minutes perfusion with ⁇ sMmTXl.
- Insets show normalized rise and decay traces which reveal no kinetic differences of Ctrl versus sMmTXl. Values are expressed as mean ⁇ SEM, pO.0001 (****).
- sMmTXl reduces the amplitude of mini inhibitory postsynaptic currents (mlPSCs) in neurons.
- Recordings were obtained in the presence of 1 ⁇ TTX, 10 ⁇ DNQX (AMPA and Kainate receptor antagonist) and 40 ⁇ APV (NMDA antagonist) to isolate mlPSCs.
- Figure shows representative mlPSCs recordings under control and toxin treated conditions showing a clear decrease in the amplitude of the events.
- D Quantification of the amplitude decrease is also shown. Data are presented as mean ⁇ SEM. (t-test:
- FIG 11 is an illustration of the sMmTXl mutations for fluorophore labeling.
- sMmTXl was mutated at 4 His, 28 Arg, and 47 Lys, as well as acetylated at the N-terminus.
- the two Lys residues of sMmTXl are mutated into 4 His, 28 Arg and 47 Ala is mutated into 47 Lys in order to add a single primary amine, which reacts with the Alexa488 TFP (tetrafluorophenyl) ester, an improvement over the succinimidyl ester (SE or NHS -ester) chemistry typically used to attach fluorophores to the primary amines of biomolecules (the acetylated N-terminus prevents reaction with the primary amine at the N-terminus) (SEQ ID NO: 21).
- Figure 12 is a CI 8 HPLC chromatogram indicating the separation of the unlabeled vs Alexa488-labeled sMmTXl-HRK (SEQ ID NO: 21) toxin.
- Figure 13 depicts the effect of the sMmTXl -HRK mutant, sMmTXl -HRK- conjugated to Alexa488, and sMmTXl-HRK unlabeled HPLC fraction on ⁇ 1 ⁇ 2 ⁇ 2 GABAA receptor currents.
- a muscimol concentration of 100 nM activates ⁇ 1 ⁇ 2 ⁇ 2 GABAA receptors expressed in Xenopus oocytes held at a membrane voltage of -70 mV.
- Toxin washout is shown on the right (in green). In the presence of 300 nM muscimol (trace below), toxin potentiating effect is diminished whereas
- Figure 14 depicts sMmTXl-HRK conjugated to Alexa488 binding to GABAA receptors in hippocampal cells.
- sMmTXl-HRK conjugated to Alexa488 was incubated for 45 minutes in culture media together with mouse hippocampal cells (E12 DIV - immature cells).
- the top figure shows neurons under white light whereas the bottom figure shows the same picture under blue light, thereby exciting the Alexa488 fluorophore.
- Toxin binding to GABAA receptors can be clearly seen as puncta along immature dendrites.
- mice While surveying the venom of Costa Rican coral snakes, the present inventors identified a major venom fraction that displayed evidence of GABAA-related toxicity in mice. Within this fraction, the polypeptides micrurotoxinl (MmTXl) and micrurotoxin2 (MmTX2) were identified. The two equally potent peptides have a primary sequence belonging to the PATE-SLURP l-LYNXl-Ly-6/neurotoxin-like family. Extensive binding and competition studies reveal that GABAA receptors are their primary target whereas nAChRs are unaffected.
- MmTXl micrurotoxinl
- MmTX2 micrurotoxin2
- the present invention provides polypeptides having GABAA modulating activity comprising the following amino acid sequence a) LTCKTCPFTTCPNSESCPGGQSICYQRKWEEHRGERIERRCVANCPAFGSHDTSLLCC TRDNCN (SEQ ID NO: 1), b) a functional fragment of a); c) a functional homolog of a) or b) or functional fragment thereof; and d) a fusion polypeptide comprising an amino acid sequence of any of a) to c).
- the present invention provides polypeptides having GABAA modulating activity comprising the following amino acid sequence a) LTCKTCPFTTCPNSESCPGGQSICYQRKWEEHHGERIERRCVANCPAFGSHDTSLLCC TRDNCN (SEQ ID NO: 2), b) a functional fragment of a); c) a functional homolog of a) or b) or functional fragment thereof; and d) a fusion polypeptide comprising an amino acid sequence of any of a) to c).
- the present invention provides polypeptides having GABAA modulating activity comprising the following amino acid sequence: a) Xaa Xaa Cys Lys Thr Cys Pro Phe Thr Thr Cys Pro Asn Ser Glu Ser Cys Xaa Xaa Xaa Xaa Xaa Cys Tyr Gin Arg Lys Trp Glu Glu His Arg Gly Glu Arg He Glu Arg Arg Cys Xaa Xaa Cys Pro Ala Phe Gly Ser His Asp Thr Ser Xaa Xaa Cys Cys Thr Arg Asp Asn Cys Asn (SEQ ID NO: 6), b) a functional fragment of a); c) a functional homolog of a) or b) or functional fragment thereof; and d) a fusion polypeptide comprising an amino acid sequence of any of a) to c).
- the present invention provides polypeptides having GABAA modulating activity comprising the following amino acid sequence: a) Xaa Xaa Cys Lys Thr Cys Pro Phe Thr Thr Cys Pro Asn Ser Glu Ser Cys Xaa Xaa Xaa Xaa Xaa Cys Tyr Gin Arg Lys Trp Glu Glu His His Gly Glu Arg He Glu Arg Arg Cys Xaa Xaa Cys Pro Ala Phe Gly Ser His Asp Thr Ser Xaa Xaa Cys Cys Thr Arg Asp Asn Cys Asn (SEQ ID NO: 7), b) a functional fragment of a); c) a functional homolog of a) or b) or functional fragment thereof; and d) a fusion polypeptide comprising an amino acid sequence of any of a) to c).
- the present invention provides polypeptides having GABAA modulating activity comprising the following amino acid sequence: a) Leu Thr Cys Lys Thr Cys Pro Phe Thr Thr Cys Pro Asn Ser Glu Ser Cys Pro Gly Gly Gin Ser He Cys Tyr Gin Arg Lys Trp Glu Glu His Arg Gly Glu Arg He Glu Arg Arg Cys Val Ala Asn Cys Pro Ala Phe Gly Ser His Asp Thr Leu Leu Cys Cys Thr Arg Asp Asn Cys Asn (SEQ ID NO: 8), b) a functional fragment of a); c) a functional homolog of a) or b) or functional fragment thereof; and d) a fusion polypeptide comprising an amino acid sequence of any of a) to c).
- the present invention provides polypeptides having GABAA modulating activity comprising the following amino acid sequence: a) Met Lys Cys Leu He Cys Pro Phe Thr Thr Cys Ser Gin Ser Glu Ser Cys Pro Gly Gly Gin Ser He Cys Phe Gin Arg Lys Phe Asp Asp Arg His Gly Asp Arg He Glu Arg Gly Cys Ala Val Thr Cys Pro Pro Phe Gly Ser His Asp Thr He Phe Cys Cys Ser Thr Asn Asp Cys Asn (SEQ ID NO: 9), b) a functional fragment of a); c) a functional homolog of a) or b) or functional fragment thereof; and d) a fusion polypeptide comprising an amino acid sequence of any of a) to c).
- the present invention provides polypeptides having GABAA modulating activity comprising the following amino acid sequence: a) He Glu Cys His Asn Cys Pro Phe Thr Thr Cys Gly Asn Ser Glu Ser Cys Pro Gly Gly Gin Ser He Cys Val Gin Arg Lys Leu Glu Glu Lys Lys Gly Glu Arg He Glu Arg Ser Cys Thr Asp Gly Cys Pro Gly Phe Gly Ser His Asp Thr Val Glu Cys Cys Arg He Ala Arg Cys Asn (SEQ ID NO: 10), b) a functional fragment of a); c) a functional homolog of a) or b) or functional fragment thereof; and d) a fusion polypeptide comprising an amino acid sequence of any of a) to c).
- the present invention provides polypeptides having GABAA modulating activity comprising the following amino acid sequence: a) Arg Gin Cys Tyr Thr Cys Pro Phe Thr Thr Cys His Asn Ser Glu Ser Cys Pro Gly Gly Gin Ser He Cys Tyr Gin Arg Lys Tyr Glu Glu His Arg Gly Glu Arg He Glu Arg Lys Cys Ser Leu Ser Cys Pro Ser Phe Gly Ser His Asp Thr Leu Leu Cys Cys Ala Arg Pro Lys Cys Asn (SEQ ID NO: 11), b) a functional fragment of a); c) a functional homolog of a) or b) or functional fragment thereof; and d) a fusion polypeptide comprising an amino acid sequence of any of a) to c).
- the present invention provides polypeptides having GABAA modulating activity comprising the following amino acid sequence: a) Phe Arg Cys Phe Arg Cys Pro Phe Thr Thr Cys Asn Asn Ser Glu Ser Cys Pro Gly Gly Gin Ser He Cys Tyr Gin Arg Lys Trp Glu Glu His Arg Gly Glu Arg He Glu Arg Arg Cys Val Ala Asn Cys Pro Ala Phe Gly Ser His Asp Thr Leu Leu Cys Cys Lys Arg Glu Glu Cys Asn (SEQ ID NO: 12), b) a functional fragment of a); c) a functional homolog of a) or b) or functional fragment thereof; and d) a fusion polypeptide comprising an amino acid sequence of any of a) to c).
- the present invention provides polypeptides having GABAA modulating activity comprising the following amino acid sequence: a) Leu Ser Cys Asn Thr Cys Pro Phe Thr Thr Cys Gin Asn Ser Glu Ser Cys Pro Gly Gly Gin Ser He Cys Tyr Gin Arg Lys Trp Glu Glu His Arg Gly Glu Arg He Glu Arg Arg Cys Val Ala Asn Cys Pro Ala Phe Gly Ser His Asp Thr Leu Leu Cys Cys Thr Arg Asp Asn Cys Asn (SEQ ID NO: 13), b) a functional fragment of a); c) a functional homolog of a) or b) or functional fragment thereof; and d) a fusion polypeptide comprising an amino acid sequence of any of a) to c).
- the present invention provides polypeptides having GABAA modulating activity comprising the following amino acid sequence: a) Leu Leu Cys Lys Thr Cys Pro Phe Thr Thr Cys Pro Asn Ser Glu Ser Cys Pro Gly Gly Gin Ser He Cys Tyr Gin Arg Lys Trp Glu Glu His Arg Gly Glu Arg He Glu Arg Arg Cys Val Ala Asn Cys Pro Ala Phe Gly Ser His Asp Thr Leu Leu Cys Cys Thr Arg Asp Asn Cys Asn (SEQ ID NO: 14), b) a functional fragment of a); c) a functional homolog of a) or b) or functional fragment thereof; and d) a fusion polypeptide comprising an amino acid sequence of any of a) to c).
- Xaa is a generic descriptor which means any amino acid.
- amino acid includes the residues of the natural a-amino acids (e.g., Ala, Arg, Asn, Asp, Cys, Glu, Gin, Gly, His, Lys, lie, Leu, Met, Phe, Pro, Ser, Thr, Trp, Tyr, and Val) in D or L form, as well as ⁇ -amino acids, synthetic and non-natural amino acids.
- a-amino acids e.g., Ala, Arg, Asn, Asp, Cys, Glu, Gin, Gly, His, Lys, lie, Leu, Met, Phe, Pro, Ser, Thr, Trp, Tyr, and Val
- Many types of amino acid residues are useful in the polypeptides and the invention is not limited to natural, genetically-encoded amino acids.
- amino acids that can be utilized in the peptides described herein can be found, for example, in Fasman, 1989, CRC Practical Handbook of Biochemistry and Molecular Biology, CRC Press, Inc., and the reference cited therein. Another source of a wide array of amino acid residues is provided by the website of RSP Amino Acids LLC.
- references herein to "derivatives” includes parts, fragments and portions of the inventive GABAergic peptides.
- a derivative also includes a single or multiple amino acid substitution, deletion and/or addition.
- Homologues include functionally, structurally or sterochemically similar peptides from venom from the same species of snake or from within the same genus or family of snake. All such homologues are contemplated by the present invention.
- Analogs and mimetics include molecules which include molecules which contain non-naturally occurring amino acids or which do not contain amino acids but nevertheless behave functionally the same as the peptide. Natural product screening is one useful strategy for identifying analogs and mimetics.
- Examples of incorporating non-natural amino acids and derivatives during peptide synthesis include, but are not limited to, use of norleucine, 4-amino butyric acid, 4-amino-3- hydroxy-5-phenylpentanoic acid, 6-aminohexanoic acid, t-butylglycine, norvaline, phenylglycine, ornithine, sarcosine, 4-amino-3-hydroxy-6-methylheptanoic acid, 2-thienyl alanine and/or D-isomers of amino acids.
- a partial list of known non-natural amino acid contemplated herein is shown in Table 1.
- Analogs of the subject peptides contemplated herein include modifications to side chains, incorporation of non-natural amino acids and/or their derivatives during peptide synthesis and the use of crosslinkers and other methods which impose conformational constraints on the peptide molecule or their analogs.
- the present invention provides a sMmTxl- HRK mutant polypeptide having GABAA modulating activity comprising the following amino acid sequence with an acetyl functional group at the N-terminus ((Acl) a)
- the carboxyl group may be modified by carbodiimide activation via O- acylisourea formation followed by subsequent derivitization, for example, to a corresponding amide.
- Sulphydryl groups may be modified by methods such as carboxymethylation with iodoacetic acid or iodoacetamide; performic acid oxidation to cysteic acid; formation of a mixed disulphides with other thiol compounds; reaction with maleimide, maleic anhydride or other substituted maleimide; formation of mercurial derivatives using 4- chloromercuribenzoate, 4-chloromercuriphenylsulphonic acid, phenylmercury chloride, 2- chloromercuri-4-nitrophenol and other mercurials; carbamoylation with cyanate at alkaline pH.
- Tryptophan residues may be modified by, for example, oxidation with N- bromosuccinimide or alkylation of the indole ring with 2-hydroxy-5-nitrobenzyl bromide or sulphenyl halides.
- Tyrosine residues on the other hand, may be altered by nitration with tetranitromethane to form a 3-nitrotyrosine derivative.
- Modification of the imidazole ring of a histidine residue may be accomplished by alkylation with iodoacetic acid derivatives or N-carbethoxylation with diethylpyrocarbonate.
- peptides can be conformationally constrained by, for example, incorporation of C a and Na-methylamino acids, introduction of double bonds between Ca and Cp atoms of amino acids and the formation of cyclic peptides or analogues by introducing covalent bonds such as forming an amide bond between the N and C termini, between two side chains or between a side chain and the N or C terminus.
- the present invention further contemplates small chemical analogs of the subject peptides capable of acting as antagonists or agonists of the GABAergic peptides of the present invention.
- Chemical analogs may not necessarily be derived from the peptides themselves but may share certain conformational similarities. Alternatively, chemical analogs may be specifically designed to mimic certain physiochemical properties of the peptides. Chemical analogs may be chemically synthesized or may be detected following, for example, natural product screening.
- compositions may be administered individually to a patient, or they may be administered in combination with other drugs, hormones, agents, and the like.
- Routes of administration of the inventive peptides include, but are not limited to intravenously, intraperitioneal, subcutaneously, intracranial, intradermal, intramuscular, intraocular, intrathecal, intracerebrally, intranasally, infusion, orally, rectally, via iv drip, patch and implant.
- the present invention provides pharmaceutical compositions comprising one or more of the inventive peptides and a pharmaceutically acceptable carrier.
- the pharmaceutical compositions also include one or more additional biologically active agents.
- the carrier can be any of those conventionally used, and is limited only by physico-chemical considerations, such as solubility and lack of reactivity with the active compound(s), and by the route of
- the carriers described herein for example, vehicles, adjuvants, excipients, and diluents, are well-known to those skilled in the art and are readily available to the public. It is preferred that the carrier be one which is chemically inert to the active agent(s), and one which has little or no detrimental side effects or toxicity under the conditions of use.
- the carriers include soluble carriers such as known buffers which can be physiologically acceptable (e.g., phosphate buffer) as well as solid compositions such as solid-state carriers or latex beads.
- the carriers or diluents used herein may be solid carriers or diluents for solid formulations, liquid carriers or diluents for liquid formulations, or mixtures thereof.
- Solid carriers or diluents include, but are not limited to, gums, starches (e.g., com starch, pregelatinized starch), sugars (e.g., lactose, mannitol, sucrose, dextrose), cellulosic materials (e.g., microcrystalline cellulose), acrylates (e.g., polymethylacrylate), calcium carbonate, magnesium oxide, talc, or mixtures thereof.
- pharmaceutically acceptable carriers may be, for example, aqueous or non-aqueous solutions, or suspensions.
- non-aqueous solvents are propylene glycol, polyethylene glycol, and injectable organic esters such as ethyl oleate.
- Aqueous carriers include, for example, water, alcoholic/aqueous solutions, cyclodextrins, emulsions or suspensions, including saline and buffered media.
- Parenteral vehicles for subcutaneous, intravenous, intraarterial, or intramuscular injection
- the biologically active agent may vary widely with the intended purpose for the composition.
- active is art-recognized and refers to any moiety that is a biologically, physiologically, or pharmacologically active substance that acts locally or systemically in a subject.
- biologically active agents that may be referred to as "drugs” are described in well-known literature references such as the Merck Index, the Physicians' Desk Reference, and The Pharmacological Basis of Therapeutics, and they include, without limitation, medicaments; vitamins; mineral supplements; substances used for the treatment, prevention, diagnosis, cure or mitigation of a disease or illness; substances which affect the structure or function of the body; or pro-drugs, which become biologically active or more active after they have been placed in a physiological environment.
- biologically active agents include, without limitation, enzymes, receptor antagonists or agonists, hormones and antibodies.
- useful biologically active agents include, for example, autonomic agents, such as
- anticholinergics antimuscarinic anticholinergics, ergot alkaloids, parasympathomimetics, cholinergic agonist parasympathomimetics, cholinesterase inhibitor parasympathomimetics, sympatholytics, a-blocker sympatholytics, sympatholytics, sympathomimetics, and adrenergic agonist sympathomimetics intravenous anesthetics, barbiturate intravenous anesthetics, benzodiazepine intravenous anesthetics, and opiate agonist intravenous anesthetics skeletal muscle relaxants, neuromuscular blocker skeletal muscle relaxants, and reverse neuromuscular blocker skeletal muscle relaxants; neurological agents, such as anticonvulsants, barbiturate anticonvulsants, benzodiazepine anticonvulsants, anti-migraine agents, anti-parkinsonian agents, anti-vertigo agents, opiate agonists, and opiate antagonists
- treat includes diagnostic and preventative as well as disorder remitative treatment.
- Neurological disorders which involve, either directly or indirectly, GABAergic function may be studied and/or treated using the peptides and pharmaceutical compositions comprising the inventive peptides.
- diseases include, but are not limited to, affective disorders such as depression, bipolar disorder, generalized anxiety disorders, epilepsy, convulsant disorders, schizophrenia, and certain pain disorders, Stiff-person syndrome (SPS), pathophysiology of the fragile X syndrome, tonic inhibition neuronal dysfunctions, Down syndrome, autism, and generalized seizures.
- affective disorders such as depression, bipolar disorder, generalized anxiety disorders, epilepsy, convulsant disorders, schizophrenia, and certain pain disorders, Stiff-person syndrome (SPS), pathophysiology of the fragile X syndrome, tonic inhibition neuronal dysfunctions, Down syndrome, autism, and generalized seizures.
- SPS Stiff-person syndrome
- inventive peptides and compositions can include imaging agents covalently linked to the peptides and compositions.
- the imaging agent is a fluorescent dye.
- the dye may be an emitter in the visible or near-infrared (NIR) spectrum.
- NIR near-infrared
- Known dyes useful in the present invention include carbocyanine, indocarbocyanine, oxacarbocyanine, thiiicarbocyanine and merocyanine, polymethine, coumarine, rhodamine, xanthene, fluorescein,
- AlexaFluor750 AlexaFluor790, Dy677, Dy676, Dy682, Dy752, Dy780, DyLight547, Dylight647, HiLyte Fluor 647, HiLyte Fluor 680, HiLyte Fluor 750, IRDye 800CW, IRDye 800RS, IRDye 700DX, ADS780WS, ADS830WS, and ADS832WS.
- polymethine cyanine dyes are small organic molecules with two aromatic nitrogen- containing heterocycles linked by a polymethine bridge and include Cy5, Cy5.5, Cy7 and their derivatives.
- Squaraines (often called Squarylium dyes) consist of an oxocyclobutenolate core with aromatic or heterocyclic components at both ends of the molecules, an example is KSQ-4-H.
- Phthalocyanines are two-dimensional 18ji-electron aromatic porphyrin derivatives, consisting of four bridged pyrrole subunits linked together through nitrogen atoms.
- BODIPY (borondipyrromethane) dyes have a general structure of 4,4'-difluoro- 4- bora-3a, 4a-diaza-s-indacene) and sharp fluorescence with high quantum yield and excellent thermal and photochemical stability.
- a prosthetic group such as N- succinimidyl-4- 18 F-fluorobenzoate ( 18 F-SFB) is necessary for labeling peptides with 18 F.
- the chelating agent is DOTA.
- the present invention provides peptides and compositions wherein the imaging agent portion comprises m In labeled DOTA which is known to be suitable for use in SPECT imaging.
- the present invention provides a peptides and compositions wherein the imaging agent comprises Gd + labeled DOTA which is known to be suitable for use in MR imaging. It is understood by those of ordinary skill in the art that other suitable radioisotopes can be substituted for m In and Gd + disclosed herein.
- nucleic acid includes “polynucleotide,” “oligonucleotide,” and “nucleic acid molecule,” and generally means a polymer of DNA or RNA, which can be single-stranded or double-stranded, synthesized or obtained (e.g., isolated and/or purified) from natural sources, which can contain natural, non-natural or altered nucleotides, and which can contain a natural, non-natural or altered internucleotide linkage, such as a phosphoroamidate linkage or a phosphorothioate linkage, instead of the phosphodiester found between the nucleotides of an unmodified oligonucleotide.
- the nucleic acid does not comprise any insertions, deletions, inversions, and/or substitutions. However, it may be suitable in some instances, as discussed herein, for the nucleic acid to comprise one or more insertions, deletions, inversions, and/or substitutions.
- the nucleic acids of the invention are recombinant.
- the term “recombinant” refers to (i) molecules that are constructed outside living cells by joining natural or synthetic nucleic acid segments to nucleic acid molecules that can replicate in a living cell, or (ii) molecules that result from the replication of those described in (i) above.
- the replication can be in vitro replication or in vivo replication.
- the present invention provides one or more non-naturally occurring cDNA sequences encoding any of the polypeptides having GABAA modulating activity or derivatives, homologues, analogues or mimetics thereof disclosed herein.
- the nucleic acids can be constructed based on chemical synthesis and/or enzymatic ligation reactions using procedures known in the art.
- a nucleic acid can be chemically synthesized using naturally occurring nucleotides or variously modified nucleotides designed to increase the biological stability of the molecules or to increase the physical stability of the duplex formed upon hybridization (e.g., phosphorothioate derivatives and acridine substituted nucleotides).
- modified nucleotides that can be used to generate the nucleic acids include, but are not limited to, 5-fluorouracil, 5-bromouracil, 5- chlorouracil, 5-iodouracil, hypoxanthine, xanthine, 4-acetylcytosine, 5- (carboxyhydroxymethyl) uracil, 5-carboxymethylaminomethyl-2-thiouridine, 5- carboxymethylaminomethyluracil, dihydrouracil, beta-D-galactosylqueosine, inosine, N 6 - isopentenyladenine, 1-methylguanine, 1 -methylinosine, 2,2-dimethylguanine, 2- methyladenine, 2-methylguanine, 3-methylcytosine, 5-methylcytosine, N 6 -substituted adenine, 7-methylguanine, 5-methylaminomethyluracil, 5-methoxyaminomethyl-2-thiouracil, beta-D-mannosyl
- the nucleic acids can be constructed based on chemical synthesis and/or enzymatic ligation reactions using procedures known in the art. See, for example, Sambrook et al. (eds.), Molecular Cloning, A Laboratory Manual, 3rd Edition, Cold Spring Harbor Laboratory Press, New York (2001) and Ausubel et al., Current Protocols in Molecular Biology, Greene Publishing Associates and John Wiley & Sons, NY (2007).
- a nucleic acid can be chemically synthesized using naturally occurring nucleotides or variously modified nucleotides designed to increase the biological stability of the molecules or to increase the physical stability of the duplex formed upon hybridization (e.g.,
- modified nucleotides that can be used to generate the nucleic acids include, but are not limited to, 5- fluorouracil, 5-bromouracil, 5-chlorouracil, 5-iodouracil, hypoxanthine, xanthine, 4- acetylcytosine, 5 -(carboxy hydroxy methyl) uracil, 5-carboxymethylaminomethyl-2- thiouridine, 5-carboxymethylaminomethyluracil, dihydrouracil, beta-D-galactosylqueosine, inosine, N6-isopentenyladenine, 1 -methylguanine, 1-methylinosine, 2,2-dimethylguanine, 2- methyladenine, 2-methylguanine, 3-methylcytosine, 5-methylcytosine, N6-substituted adenine, 7-methylguanine, 5-methylamin
- the present invention provides a vector comprising one or more nucleic acid sequences encoding any of the polypeptides having GABAA modulating activity or derivatives, homologues, analogues or mimetics thereof disclosed herein.
- nucleic acids of the invention can be incorporated into a recombinant expression vector.
- the invention provides recombinant expression vectors comprising any of the nucleic acids of the invention.
- “recombinant expression vector” means a genetically-modified oligonucleotide or polynucleotide construct that permits the expression of an mRNA, protein, polypeptide, or peptide by a host cell, when the construct comprises a nucleotide sequence encoding the mRNA, protein, polypeptide, or peptide, and the vector is contacted with the cell under conditions sufficient to have the mRNA, protein, polypeptide, or peptide expressed within the cell.
- the vectors of the invention are not naturally-occurring as a whole. However, parts of the vectors can be naturally-occurring.
- the inventive recombinant expression vectors can comprise any type of nucleotides, including, but not limited to DNA and RNA, which can be single-stranded or double-stranded, synthesized or obtained in part from natural sources, and which can contain natural, non-natural or altered nucleotides.
- the recombinant expression vectors can comprise naturally-occurring, non-naturally-occurring internucleotide linkages, or both types of linkages.
- the non-naturally occurring or altered nucleotides or internucleotide linkages do not hinder the transcription or replication of the vector.
- the recombinant expression vectors of the invention can be prepared using standard recombinant DNA techniques described in, for example, Sambrook et al., supra, and Ausubel et al., supra.
- Constructs of expression vectors, which are circular or linear, can be prepared to contain a replication system functional in a prokaryotic or eukaryotic host cell, such as Xenopus oocytes.
- Replication systems can be derived, e.g., from ColEl, 2 ⁇ plasmid, ⁇ , SV40, bovine papilloma virus, and the like.
- the recombinant expression vector comprises regulatory sequences, such as transcription and translation initiation and termination codons, which are specific to the type of host (e.g., bacterium, fungus, plant, or animal) into which the vector is to be introduced, as appropriate and taking into consideration whether the vector is DNA or RNA based.
- regulatory sequences such as transcription and translation initiation and termination codons, which are specific to the type of host (e.g., bacterium, fungus, plant, or animal) into which the vector is to be introduced, as appropriate and taking into consideration whether the vector is DNA or RNA based.
- the recombinant expression vector can include one or more marker genes, which allow for selection of transformed or transfected hosts.
- Marker genes include biocide resistance, e.g., resistance to antibiotics, heavy metals, etc., complementation in an auxotrophic host to provide prototrophy, and the like.
- Suitable marker genes for the inventive expression vectors include, for instance, LacZ, green fluorescent protein (GFP), luciferase, neomycin/G418 resistance genes, hygromycin resistance genes, histidinol resistance genes, tetracycline resistance genes, and ampicillin resistance genes.
- the heterologous nucleic acid can be a nucleic acid not normally found in the target cell, or it can be an extra copy or copies of a nucleic acid normally found in the target cell.
- exogenous and heterologous are used herein interchangeably.
- the invention further provides a host cell comprising any of the recombinant expression vectors described herein.
- the term "host cell” refers to any type of cell that can contain the inventive recombinant expression vector.
- the host cell can be an animal cell.
- the host cell is a mammalian cell.
- the host cell can be a cultured cell or a primary cell, i.e., isolated directly from an organism, e.g., a human.
- the host cell can be an adherent cell or a suspended cell, i.e., a cell that grows in suspension.
- the host cell is a human cell.
- the host cell can be of any cell type, can originate from any type of tissue, and can be of any developmental stage. Most preferably the host cells can include, for instance, muscle, lung, and brain cells, and the like.
- the host referred to in the inventive methods can be any host.
- the host is a mammal.
- the term "mammal” refers to any mammal, including, but not limited to, mammals of the order Rodentia, such as mice and hamsters, and mammals of the order Logomorpha, such as rabbits. It is preferred that the mammals are from the order Carnivora, including Felines (cats) and Canines (dogs). It is more preferred that the mammals are from the order Artiodactyla, including Bovines (cows) and Swines (pigs) or of the order Perssodactyla, including Equines (horses). It is most preferred that the mammals are of the order Primates, Ceboids, or Simoids (monkeys) or of the order Anthropoids (humans and apes). An especially preferred mammal is the human.
- the population of cells can be a heterogeneous population comprising the host cell comprising any of the recombinant expression vectors described, in addition to at least one other cell, e.g., a host cell (e.g., a lung cell), which does not comprise any of the recombinant expression vectors, or a cell other than a lung cell, e.g., a skin cell, a neutrophil, an erythrocyte, a hepatocyte, an endothelial cell, an epithelial cell, a muscle cell, a brain cell, etc.
- a host cell e.g., a lung cell
- a cell other than a lung cell e.g., a skin cell, a neutrophil, an erythrocyte, a hepatocyte, an endothelial cell, an epithelial cell, a muscle cell, a brain cell, etc.
- the population of cells can be a substantially homogeneous population, in which the population comprises mainly of host cells (e.g., consisting essentially of) comprising the recombinant expression vector.
- the population also can be a clonal population of cells, in which all cells of the population are clones of a single host cell comprising a recombinant expression vector, such that all cells of the population comprise the recombinant expression vector.
- the population of cells is a clonal population comprising host cells comprising a recombinant expression vector as described herein.
- MmTXl and MmTX2 were purified from Micrurus mipartitus venom from Costa Rica by a two-step HPLC protocol. Edman sequencing was carried out on a cysteine reduced and s-carboxymethylated derivative. Recombinant expression of
- MmTXl/2 was based on a synthetic gene and site-directed mutagenesis was executed with the quick-change mutagenesis kit (Stratagene). All constructs were sequenced (Genome express) and expressed in E. Coli HB 101 (Promega) as a fusion protein with the ZZ domain (GE Healthcare). Fusion proteins were purified on an IgG-Sepharose column (GE).
- toxin-moiety kept free from the ZZ domain using cyanogen bromide. Except where indicated, all chemicals were purchased from Sigma-Aldrich.
- sMmTXl was chemically synthesized using standard solid phase peptide synthesis methodology and Fmoc chemistry. The 5-disulfide bridges were allowed to fold in a 100 mM Tris-HCl buffer, 1 mM EDTA, pH 9.0, adding a combination of GSSG/GSH in a 1 mM/2 mM ratio and sMmTXl at a concentration of 20 ⁇ . Purification and desalting was achieved by HPLC.
- Na 125 I and [ 3 H]muscimol were obtained from PerkinElmer and isoguvacine from Peninsula laboratories. All other reagents were from Sigma-Aldrich. MmTX2 was radioactively labeled by lacto-peroxidase-catalyzed iodination with specific activities of 900 Ci/mmol routinely obtained. Synaptosome fractions (P2) of Wistar rat brains were lysed on ice by dilution into 15 volumes of hypotonic buffer, and SPMs were pelleted at 12,500 xg, 20 minutes at 5 °C.
- Binding experiments were performed in 1.5 ml tubes in buffer 10 mM Tris, 100 mM NaCl, 1 mg/ml BSA, pH 7.4, 50 ⁇ g of SPM protein. The incubations were performed at 37 °C ( 125 I-MmTX2) or 4 °C ([ 3 H]muscimol). Data analysis was performed using GraphPad PRISM ® . Data are reported as mean ⁇ SEM.
- HEK 293 cells transfected with the ⁇ 1 ⁇ 2 ⁇ 2 GABAA receptor and GFP were patch-clamped under a water-immersed 40x objective of a Zeiss Axioskop 2 FS Plus.
- Borosilicate glass capillaries were pulled (Sutter Instruments) and had a resistance of 3-5 ⁇ when filled with the internal solution.
- Membrane currents were recorded using Pulse and Patchmaster software (HEKA) in combination with an EPC-9 patch-clamp amplifier (HEKA). Data were low-pass filtered at 2.9 kHz. Only data from recordings with an access resistance ⁇ 20 ⁇ were evaluated. Data were analyzed using Fitmaster (HEKA), Igor Pro 6.03 (Wavemetrics) and Excel (Microsoft). Averaged values are given as mean ⁇ SEM.
- Hippocampal cell cultures were prepared from PI mice (C57B16J). Whole-cell patch clamp experiments were performed on hippocampal neurons (DIV 14) at room temperature (-22 °C) and the holding potential was -70 mV.
- HEK 293 cells the same extracellular solution was used without TTX, CNQX, and APV.
- the pipette solution contained (in mM): 140 CsCl, 1 CaCk, 1 MgCh, 11 EGTA, 5 HEPES; pH adjusted to 7.2 with CsOH.
- ACSF solution contained (in mM): 140 NaCl, 5 KC1, 2 CaCk, 2 MgCh, 10 HEPES, and 10 Glucose (pH 7.3 adjusted with NaOH). Recordings were performed with an Axopatch 200B amplifier equipped with Digidata 1440 and pClamp 10 (Molecular Devices).
- Rat GABAA receptor subunits were also expressed Xenopus oocytes.
- cRNA was synthesized using T7 polymerase (Life Technologies) after linearizing the DNA with appropriate restriction enzymes. Currents were studied following 1-2 days incubation after cRNA injection using two-electrode voltage-clamp recording techniques (OC-725C, Warner Instruments). Microelectrode resistances were 0.5-1 ⁇ when filled with 3 M KC1.
- Hippocampi were obtained from Sprague Dawley rat embryos at embryonic day 18. Cells were plated over coverslips coated with Laminin (Life Technologies) and poly-D-Lysine (Sigma- Aldrich). Astrocyte beds were prepared at a density of 80,000 cells/ml and cultured in DMEM (Life Technologies) with 10% Fetal Bovine Serum, 6 mM glutamine in 5% CC at 37 °C. Neurons were plated over 14 days in vitro confluent astrocyte beds at a density of 150,000 cells/ml and cultured for 3 weeks in Neurobasal supplemented with B27 and 2 mM glutamax.
- Neurons were incubated with 2 ⁇ Fluo-4 AM (Life Technologies) for 15 minutes. The images were obtained with an Olympus BX51WI microscope and a Lambda DG-4 wavelength switcher (Sutter Instruments) at 2 Hz. The recording chamber was perfused at 2 ml/min at 32 °C with ACSF. Calcium spikes were analyzed with MiniAnalysis (Synaptosoft). Statistical analysis was performed using GraphPad PRISM ® . Data was analyzed with paired Student's test.
- a BLAST search revealed that MmTXl and MmTX2 are novel members of the PATE-SLURP l-LYNXl-Ly-6/neurotoxin-like family.
- PHYLIP PATE-SLURP l-LYNXl-Ly-6/neurotoxin-like family.
- the first clade consists exclusively of toxins found in Micrurus species, with MmTXl and MmTX2 having the highest sequence identity.
- the availability of numerous three-finger snake toxin structures allowed us to reliably model MmTXl using MODELLER.
- the program selected ⁇ -bungarotoxin (PDB: 1MR6) and candoxin (PDB: 1 JGK) as templates with a good ModPipe quality score of 1.5674 (data not shown).
- PDB 1MR6
- PDB candoxin
- 1 JGK candoxin
- MmTXl can be classified as a member of the Elapid weak-toxin subgroup of which the biological activity has not yet been defined. Therefore, it is possible that other toxins within this subgroup interact with the same molecular target as MmTXl.
- MmTXl When comparing MmTXl to a-neurotoxins that specifically target nAChRs, substantial amino acid differences within the first loop are evident. However, the polar arginine (MmTXl) or histidine (MmTX2) at position 33 at the apex of the second loop is conserved. As can be seen in the crystal structure of a-cobratoxin in complex with AChBP, a structural and functional surrogate of the nAChR ligand-binding domain, the polar residue in this location comes in close contact with the receptor and may be vital for toxin activity.
- Micrurus mipartitus is a rare Costa Rican snake species which delivers small quantities of venom. Therefore, we developed a periplasmic expression system with the goal of producing large amounts of recombinant (r)MmTXl and rMmTX2.
- LD50 median lethal dose
- rMmTx2 Given its close structural relation to members of the three- finger a-neurotoxin family that bind to nAChRs, we initially investigated whether rMmTx2 competes with short- and long-chain snake a-neurotoxins (Nmm I and a-bungarotoxin) as well as marine snail a-conotoxins (Ml and IM 1) and a plant toxin (d-tubocurarine;) that target this particular receptor (Fig. 3A). Strikingly, no competition is observed suggesting that nAChRs are not the primary target of rMmTX2. In concert, we observe no flaccid paralysis when injecting rMmTX2 intravenously into mice.
- rMmTX2 does not compete with atropine, glycine, glutamate, and Fas 2 that target mAChRs, GlyRs, GluRs, and AChE, respectively.
- rMmTX2 does not displace cardiotoxin (CTX), a cytotoxic membrane-targeting peptide that also belongs to the three-finger ⁇ -neurotoxin structural family (Fig. 3A).
- CX cardiotoxin
- a binding experiment at equilibrium in the presence of a saturating PTX concentration (1 mM) (Fig. 3C).
- MmTXl influences GABAA receptor-mediated currents in hippocampal neurons.
- rMmTXl increases the amplitude of the GABAA receptor-mediated current elicited by 5 ⁇ muscimol in a dose-dependent manner (Fig. 5, Table 2).
- 0.1 ⁇ muscimol fails to elicit a detectable current (5 out of 7 neurons).
- Table 3 summarizes the factors by which the current amplitudes are potentiated by 100 nM rMmTXl in dependence of the muscimol concentration. From these data the rMmTXl -induced portion of the current amplitude was determined and plotted versus muscimol concentration which reveals that the half-maximal potentiating effect of rMmTXl is obtained at about 1 ⁇ muscimol. Altogether, our data suggest that rMmTXl potentiates GABAA receptor activation in a non-saturating concentration range of muscimol.
- sMmTXl modulates heterologously expressed GABAA receptors.
- sMmTXl Increasing concentrations of sMmTXl potentiate the GABAA receptor-mediated current amplitudes elicited by 3 ⁇ muscimol by a similar degree: at 10 nM toxin the current increases by a factor of 1.28 ⁇ 0.12, at 100 nM by 1.33 ⁇ 0.13, and at 300 nM by 1.60 ⁇ 0.11.
- Fig. 6A This trend is also visible when 100 nM rMmTXl is applied to cultured hippocampal neurons in the presence of 0.3 ⁇ muscimol (Fig. 5B).
- a tagged toxin variant may be valuable in identifying al -containing GABAA receptors in heterologous expression systems or tissues.
- future experiments will have to determine whether the al subunit is equally important for toxin binding in complex systems since context-dependent variations in pharmacological sensitivity of Cys-loop receptors have been documented.
- sMmTXl influences spontaneous hippocampal neuron activity.
- Channels were expressed in oocytes and currents were studied following 1-2 days incubation after cRNA injection (incubated at 17 °C in 96 mM NaCl, 2 mM KC1, 5 mM HEPES, 1 mM MgCh and 1.8 mM CaCh, 50 g ml gentamycin, pH 7.6 with NaOH) using two-electrode voltage-clamp recording techniques (OC-725C, Warner Instruments) with a 150 ⁇ recording chamber. Heterologous GABAA receptor manipulations were achieved using previously reported procedures. Microelectrode resistances were 0.5-1 ⁇ when filled with 3M KC1.
- the external recording solution contained (in mM) 100 NaCl, 5 HEPES, 1 MgCh and 1.8 CaCh, pH 7.6 with NaOH. All experiments were performed at room temperature (-22 °C). Off-line data analysis and statistics were performed using ClampfitlO (Molecular Devices), Excel (Microsoft Office) and Origin 8 (OriginLab).
- Hippocampi were obtained from Sprague Dawley rat embryos at embryonic day 18, treated with papain (Worthington Biochemical) and dissociated with a pipette. Cells were plated over coverslips coated with Laminin (Life Technologies) and poly-D-Lysine (Sigma- Aldrich). Astrocyte beds were prepared at a density of 80,000 cells/ml, and cultured in DMEM (Life Technologies) with 10% Fetal Bovine Serum, 6mM glutamine in 5% CC at 37 °C.
- Neurons were plated over 14 days in vitro confluent astrocyte beds at a density of 150,000 cells/ml, and cultured for 3 weeks in Neurobasal supplemented with B27 and 2 mM glutamax. Neurons were incubated with 2 ⁇ Fluo-4 AM (Life Technologies) for 15 minutes. The images were obtained with an Olympus BX51WI microscope equipped with a 40x immersion lens and a Lambda DG-4 ultra-high speed wavelength switcher (Sutter Instruments) using a CCD camera (Hamamatsu) at 2 Hz.
- the recording chamber was perfused at 2 ml/min at 32 °C with ACSF (Artificial Cerebrospinal Fluid) containing (in mM): 140 NaCl, 5 KCl, 2 CaCh, 2 MgCh, 10 HEPES, and 10 Glucose (pH 7.3 adjusted with NaOH). Muscimol and sMmTXl were prepared fresh in recording buffer at 300 nM and 100 nM respectively. Calcium spikes were analyzed with MiniAnalysis (Synaptosoft). Values were expressed as percentage variation on the average frequency of calcium spikes of treated versus control neurons. Data are presented as mean ⁇ SEM. Statistical analysis was performed using GraphPad PRISM®. Data was analyzed with paired Student's test.
- the two Lys residues of sMmTXl are mutated into 4 His, 28 Arg and 47 Ala is mutated into 47 Lys in order to add a single primary amine, which reacts with the Alexa488 TFP (tetrafiuorophenyl) ester, an improvement over the succinimidyl ester (SE or NHS-ester) chemistry typically used to attach fiuorophores to the primary amines of biomolecules (the acetylated N-terminus prevents reaction with the primary amine at the N- terminus).
- SE or NHS-ester succinimidyl ester
- the sMmTXl-HRK mutant was chemically synthesized using standard solid phase peptide synthesis methodology and Fmoc chemistry.
- the 5-disulfide bridges were allowed to fold in a 100 mM Tris-HCl buffer, 1 mM EDTA, pH 9.0, adding a combination of GSSG/GSH in a 1 mM/2 mM ratio and sMmTXl at a concentration of 20 ⁇ .
- a muscimol concentration of 100 nM activates ⁇ 1 ⁇ 2 ⁇ 2 GABAA receptors expressed in Xenopus oocytes held at a membrane voltage of -70 mV.
- 100 nM sMmTXl-HRK currents are potentiated and receptor desensitization tends to accelerate (red trace).
- Toxin washout is shown on the right (in green). In the presence of 300 nM muscimol (trace below), the toxin potentiating effect is diminished whereas desensitization effect is unaltered.
- sMmTXl-HRK conjugated to Alexa488 was incubated for 45 minutes in culture media together with mouse hippocampal cells (E12 DIV - immature cells).
- the top figure shows neurons under white light whereas the bottom figure shows the same picture under blue light, thereby exciting the Alexa488 fiuorophore.
- Toxin binding to GABAA receptors can be clearly seen as puncta along immature dendrites.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Medicinal Chemistry (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Gastroenterology & Hepatology (AREA)
- Molecular Biology (AREA)
- Zoology (AREA)
- Toxicology (AREA)
- Engineering & Computer Science (AREA)
- Animal Behavior & Ethology (AREA)
- Biomedical Technology (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Epidemiology (AREA)
- Neurosurgery (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Pharmacology & Pharmacy (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Neurology (AREA)
- Peptides Or Proteins (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Abstract
The present invention provides polypeptides and their variants and derivatives which modulate GABAA receptor function at nanomolar quantities by binding to the α+/β- subunit interface, as well as methods of making and using the same. The inventive peptides are useful for the study of neurological disease and function and can have therapeutic applications.
Description
PHARMACOLOGICAL MODULATORS OF GABAA RECEPTORS AND THEIR USE
REFERENCE TO RELATED APPLICATIONS
[0001] This application claims the benefit of U.S. Provisional Patent Application No. 62/103,669, filed on January 15, 2015, which is hereby incorporated by reference for all purposes as if fully set forth herein.
INCORPORATION-BY-REFERENCE OF MATERIAL SUBMITTED
ELECTRONICALLY
[0002] The instant application contains a Sequence Listing which has been submitted in ASCII format via EFS-Web and is hereby incorporated by reference in its entirety. Said ASCII copy, created on December 28, 2015, is named P13167-02_ST25.txt and is 12,588 bytes in size.
BACKGROUND OF THE INVENTION
[0003] Ionotropic γ-aminobutyric acid type A (GABAA) receptors are found primarily in the central nervous system (CNS) where they mediate inhibitory post-synaptic transmission by increasing CI" conductance into the cell. However, GABAA receptor activation can be excitatory in neonatal neurons and dorsal root ganglia where intracellular CI" concentrations are high and receptor activation causes CI" efflux which in turn, depolarizes the cell. When the balance between excitatory and inhibitory GABAA receptor activity is shifted due to abnormal function, clinical phenotypes such as epilepsy, schizophrenia, and chronic pain can occur. As such, GABAA receptors are targeted by various drugs including barbiturates, benzodiazepines, and anesthetics.
[0004] GABAA receptors belong to the pentameric Cys-loop superfamily of ligand-gated ion channel receptors which also encompasses the nicotinic acetylcholine (nAChRs), glycine (GlyR), and serotonin (5-HT3) receptors. The numerous subunit isoforms (al-6, β1-3, γ1-3, δ, ε, π, θ, and pl-3) that can make up a GABAA receptor create multiple potential structural arrangements. In general, each subunit consists of four trans-membrane domains (TM1-4), in which TM2 delineates the axially positioned CI" channel. Molecules can interact with various regions within one or more subunits, resulting in a complex pharmacological
landscape. For example, GABA and muscimol bind at the extracellular interface between a β- and a-subunit (β+/α-) whereas benzodiazepines require both the a- and Y2-subunit to be pharmacologically active. Conversely, anesthetics such as propofol most likely position themselves in transmembrane inter-subunit pockets. So far, picrotoxin (PTX) is the only well-documented naturally-occurring plant toxin that is known to block the pore of GABAA receptors and is experimentally used as a chemoconvulsant to induce epileptic seizures. This is in contrast to nAChRs, where molecules isolated from plant extracts, snake and cone snail venoms have been used extensively to probe the structural and functional properties of these receptors.
SUMMARY OF THE INVENTION
[0005] The present inventors discovered two toxins present in Costa Rican coral snake venom, named MmTXl and MmTX2, which bind to GABAA receptors at nanomolar concentrations. Studies with recombinant and synthetic toxin variants on hippocampal neurons and cells expressing common receptor compositions show that MmTXl and MmTX2 and polypeptide homologs and variants thereof, can potentiate GABAA receptor opening and accelerate desensitization when an agonist is present, possibly by interacting with the α+/β- interface.
[0006] In accordance with an embodiment, the present invention provides polypeptides having GABAA modulating activity.
[0007] In accordance with an embodiment, the present invention provides polypeptides having GABAA modulating activity comprising the following amino acid sequence a) LTCKTCPFTTCPNSESCPGGQSICYQRKWEEHRGERIERRCVANCPAFGSHDTSLLCC TRDNCN (MmTXl) (SEQ ID NO: 1), b) a functional fragment of a); c) a functional homolog of a) or b) or functional fragment thereof; and d) a fusion polypeptide comprising an amino acid sequence of any of a) to c).
[0008] In accordance with an embodiment, the present invention provides polypeptides having GABAA modulating activity comprising the following amino acid sequence a) LTCKTCPFTTCPNSESCPGGQSICYQRKWEEHHGERIERRCVANCPAFGSHDTSLLCC TRDNCN (MmTX2) (SEQ ID NO: 2), b) a functional fragment of a); c) a functional
homolog of a) or b) or functional fragment thereof; and d) a fusion polypeptide comprising an amino acid sequence of any of a) to c).
[0009] In yet another embodiment, the present invention provides polypeptides having GABAA modulating activity comprising the following amino acid sequence: a) Xaa Xaa Cys Lys Thr Cys Pro Phe Thr Thr Cys Pro Asn Ser Glu Ser Cys Xaa Xaa Xaa Xaa Xaa Xaa Cys Tyr Gin Arg Lys Trp Glu Glu His Arg Gly Glu Arg He Glu Arg Arg Cys Xaa Xaa Xaa Cys Pro Ala Phe Gly Ser His Asp Thr Ser Xaa Xaa Cys Cys Thr Arg Asp Asn Cys Asn (SEQ ID NO: 6), b) a functional fragment of a); c) a functional homolog of a) or b) or functional fragment thereof; and d) a fusion polypeptide comprising an amino acid sequence of any of a) to c).
[0010] In accordance with another embodiment, the present invention provides polypeptides having GABAA modulating activity comprising the following amino acid sequence: a) Xaa Xaa Cys Lys Thr Cys Pro Phe Thr Thr Cys Pro Asn Ser Glu Ser Cys Xaa Xaa Xaa Xaa Xaa Xaa Cys Tyr Gin Arg Lys Trp Glu Glu His His Gly Glu Arg He Glu Arg Arg Cys Xaa Xaa Xaa Cys Pro Ala Phe Gly Ser His Asp Thr Ser Xaa Xaa Cys Cys Thr Arg Asp Asn Cys Asn (SEQ ID NO: 7), b) a functional fragment of a); c) a functional homolog of a) or b) or functional fragment thereof; and d) a fusion polypeptide comprising an amino acid sequence of any of a) to c).
[0011] In accordance with a further embodiment, the present invention provides polypeptides having GABAA modulating activity comprising the following amino acid sequence: a) Leu Thr Cys Lys Thr Cys Pro Phe Thr Thr Cys Pro Asn Ser Glu Ser Cys Pro Gly Gly Gin Ser He Cys Tyr Gin Arg Lys Trp Glu Glu His Arg Gly Glu Arg He Glu Arg Arg Cys Val Ala Asn Cys Pro Ala Phe Gly Ser His Asp Thr Leu Leu Cys Cys Thr Arg Asp Asn Cys Asn (SEQ ID NO: 8), b) a functional fragment of a); c) a functional homolog of a) or b) or functional fragment thereof; and d) a fusion polypeptide comprising an amino acid sequence of any of a) to c).
[0012] In accordance with still another embodiment, the present invention provides polypeptides having GABAA modulating activity comprising the following amino acid sequence: a) Met Lys Cys Leu He Cys Pro Phe Thr Thr Cys Ser Gin Ser Glu Ser Cys Pro Gly Gly Gin Ser He Cys Phe Gin Arg Lys Phe Asp Asp Arg His Gly Asp Arg He Glu Arg Gly Cys Ala Val Thr Cys Pro Pro Phe Gly Ser His Asp Thr He Phe Cys Cys Ser Thr Asn Asp Cys Asn (SEQ ID NO: 9), b) a functional fragment of a); c) a functional homolog of a) or b) or
functional fragment thereof; and d) a fusion polypeptide comprising an amino acid sequence of any of a) to c).
[0013] In accordance with another embodiment, the present invention provides polypeptides having GABAA modulating activity comprising the following amino acid sequence: a) He Glu Cys His Asn Cys Pro Phe Thr Thr Cys Gly Asn Ser Glu Ser Cys Pro Gly Gly Gin Ser He Cys Val Gin Arg Lys Leu Glu Glu Lys Lys Gly Glu Arg He Glu Arg Ser Cys Thr Asp Gly Cys Pro Gly Phe Gly Ser His Asp Thr Val Glu Cys Cys Arg He Ala Arg Cys Asn (SEQ ID NO: 10), b) a functional fragment of a); c) a functional homolog of a) or b) or functional fragment thereof; and d) a fusion polypeptide comprising an amino acid sequence of any of a) to c).
[0014] In accordance with yet another embodiment, the present invention provides polypeptides having GABAA modulating activity comprising the following amino acid sequence: a) Arg Gin Cys Tyr Thr Cys Pro Phe Thr Thr Cys His Asn Ser Glu Ser Cys Pro Gly Gly Gin Ser He Cys Tyr Gin Arg Lys Tyr Glu Glu His Arg Gly Glu Arg He Glu Arg Lys Cys Ser Leu Ser Cys Pro Ser Phe Gly Ser His Asp Thr Leu Leu Cys Cys Ala Arg Pro Lys Cys Asn (SEQ ID NO: 11), b) a functional fragment of a); c) a functional homolog of a) or b) or functional fragment thereof; and d) a fusion polypeptide comprising an amino acid sequence of any of a) to c).
[0015] In accordance with a further embodiment, the present invention provides polypeptides having GABAA modulating activity comprising the following amino acid sequence: a) Phe Arg Cys Phe Arg Cys Pro Phe Thr Thr Cys Asn Asn Ser Glu Ser Cys Pro Gly Gly Gin Ser He Cys Tyr Gin Arg Lys Trp Glu Glu His Arg Gly Glu Arg He Glu Arg Arg Cys Val Ala Asn Cys Pro Ala Phe Gly Ser His Asp Thr Leu Leu Cys Cys Lys Arg Glu Glu Cys Asn (SEQ ID NO: 12), b) a functional fragment of a); c) a functional homolog of a) or b) or functional fragment thereof; and d) a fusion polypeptide comprising an amino acid sequence of any of a) to c).
[0016] In accordance with still another embodiment, the present invention provides polypeptides having GABAA modulating activity comprising the following amino acid sequence: a) Leu Ser Cys Asn Thr Cys Pro Phe Thr Thr Cys Gin Asn Ser Glu Ser Cys Pro Gly Gly Gin Ser He Cys Tyr Gin Arg Lys Trp Glu Glu His Arg Gly Glu Arg He Glu Arg Arg Cys Val Ala Asn Cys Pro Ala Phe Gly Ser His Asp Thr Leu Leu Cys Cys Thr Arg Asp Asn Cys Asn (SEQ ID NO: 13), b) a functional fragment of a); c) a functional homolog of a) or b)
or functional fragment thereof; and d) a fusion polypeptide comprising an amino acid sequence of any of a) to c).
[0017] In accordance with another embodiment, the present invention provides polypeptides having GABAA modulating activity comprising the following amino acid sequence: a) Leu Leu Cys Lys Thr Cys Pro Phe Thr Thr Cys Pro Asn Ser Glu Ser Cys Pro Gly Gly Gin Ser He Cys Tyr Gin Arg Lys Trp Glu Glu His Arg Gly Glu Arg He Glu Arg Arg Cys Val Ala Asn Cys Pro Ala Phe Gly Ser His Asp Thr Leu Leu Cys Cys Thr Arg Asp Asn Cys Asn (SEQ ID NO: 14), b) a functional fragment of a); c) a functional homolog of a) or b) or functional fragment thereof; and d) a fusion polypeptide comprising an amino acid sequence of any of a) to c).
[0018] In accordance with an embodiment, the present invention provides a polypeptide having GABAA modulating activity comprising the following amino acid sequence: a) Xaa Xaa Cys Lys Thr Cys Pro Phe Thr Thr Cys Pro Asn Ser Glu Ser Cys Xaa Xaa Xaa Xaa Xaa Xaa Cys Tyr Gin Arg Lys Trp Glu Glu His Arg Gly Glu Arg He Glu Arg Arg Cys Xaa Xaa Xaa Cys Pro Ala Phe Gly Ser His Asp Thr Ser Xaa Xaa Cys Cys Thr Arg Asp Asn Cys Asn (SEQ ID NO: 6); b) a functional fragment of a); c) a functional homolog of a) or b) or functional fragment thereof; and d) a fusion polypeptide comprising an amino acid sequence of any of a) to c).
[0019] In accordance with an embodiment, the present invention provides a polypeptide having GABAA modulating activity comprising the following amino acid sequence: a) Xaa Xaa Cys Lys Thr Cys Pro Phe Thr Thr Cys Pro Asn Ser Glu Ser Cys Xaa Xaa Xaa Xaa Xaa Xaa Cys Tyr Gin Arg Lys Trp Glu Glu His His Gly Glu Arg He Glu Arg Arg Cys Xaa Xaa Xaa Cys Pro Ala Phe Gly Ser His Asp Thr Ser Xaa Xaa Cys Cys Thr Arg Asp Asn Cys Asn (SEQ ID NO: 7); b) a functional fragment of a); c) a functional homolog of a) or b) or functional fragment thereof; and d) a fusion polypeptide comprising an amino acid sequence of any of a) to c).
[0020] In accordance with an embodiment, the present invention provides one or more nucleic acid sequences encoding any of the polypeptides having GABAA modulating activity or derivatives, homologues, analogues or mimetics thereof disclosed herein.
[0021] In accordance with another embodiment, the present invention provides a vector comprising one or more nucleic acid sequences encoding any of the polypeptides having GABAA modulating activity or derivatives, homologues, analogues or mimetics thereof disclosed herein.
[0022] In accordance with an embodiment, the present invention provides a composition comprising one or more polypeptides having GABAA modulating activity described herein, and at least one or more biologically active agents.
[0023] In accordance with an embodiment, the present invention provides a composition comprising one or more polypeptides having GABAA modulating activity described herein, and at least one or more imaging agents.
[0024] In accordance with an embodiment, the present invention provides methods for modulating GABAA receptors in a cell or population of cells expressing the GABAA receptor comprising contacting the cell or population of cells with an effective amount of the inventive polypeptides described herein.
[0025] In accordance with an embodiment, the present invention provides methods for modulating GABAA receptors in a subject suffering from a neurological disorder comprising administering to the subject a composition comprising one or more polypeptides having GABAA modulating activity described herein, and at least one or more biologically active agents.
BRIEF DESCRIPTION OF THE DRAWINGS
[0026] Figures 1A-1C: Native and recombinant MmTXl and MmTX2 are equally potent. 1 A, Picture of the Costa Rican coral snake Micrurus mipartitus. IB, Primary amino acid sequences of MmTXl and MmTX2. Note the different residue at position 33 (grey background). 1C, Competition experiments for the binding of 125I-rMmTX2 to SPMs with WT MmTXl, rMmTXl, rMmTX2, and the Ser mutant (rMmTXSer33). Lines represent a nonlinear fit with constrained 125I-rMmTX2-parameters (Kd = 0.51 nM and assay
concentration 0.2 nM). Note that WT MmTXl, rMmTXl, and rMmTX2 are equally potent in displacing 125I-rMmTX2 whereas rMmTXSer33 is ineffective.
[0027] Figures 2A-2D: Binding kinetics of rMmTX2 to SPMs. 2A, Association kinetics of 125I-rMmTX2 binding to SPMs. Shown are the association curves for three ligand concentrations (1, 2, and 4 nM). Lines represent a nonlinear fit with a one- phase exponential association curve providing pseudo-first order association constants (k0bs.) that are used in panel 2B. 2B, Figure represents the k0bs linear variation with 1, 2, and 4 nM ligand concentrations. Slope represents the association kinetic constant (k+i; shown in inset). 2C,
Dissociation kinetics of 125I-rMmTX2 from SPMs. Once the initial toxin binding is achieved, the addition of a 1000-fold excess of unlabeled rMmTX2 reveals the time-course of toxin dissociation. Line represents a nonlinear fit with a one-phase exponential decay providing the shown rate constant (k i) and a ti/2 of 478s (~8 min). 2D, Saturation binding isotherm of 125I-rMmTX2 to SPMs. Nonspecific binding as determined in the presence of a 1000-fold excess of unlabeled rMmTX2 has been subtracted. Line represents a nonlinear fit with one class of non-interacting binding sites giving an equilibrium binding constant (Kd) of 0.51 ± 0.09 nM and a maximum specific binding (Bmax) of 264 ± 14 fmol/mg protein.
[0028] Figures 3A-3C: Pharmacological profiling of rMmTX2. 3 A, Bar-plot of competition experiments between 125I-rMmTX2 and a variety of ligands for binding to SPMs. The tested compounds are shown within the bar and their primary target is indicated on the X-axis. Concentrations used: all animal toxins 10 μΜ, (rMmTX2 0.1 μΜ), glycine 1 mM, glutamate 0.1 mM, atropine 1 μΜ, d-tubocurarine 10 μΜ. Diagram shows that none of the tested ligands competes with 125I-rMmTX2 for binding to SPMs. 3B, Competition experiments of 125I-rMmTX2 with a variety of GABAA receptor modulators for binding to SPMs. Tested compounds are listed with their corresponding symbols. Lines represent a nonlinear fit with a sigmoidal dose-response curve (variable slope; Hill Slope) to provide the EC50 values listed in the text. The only exception is picrotoxin (PTX) which increases the binding of 125I-rMmTX2. 3C, Saturation binding isotherm of 125I-MmTX2 on SPMs in the absence or presence of 1 mM PTX.
[0029] Figure 4: [ H]muscimol competition with rMmTXl for binding to SPMs.
rMmTXl competes for binding to SPMs with [ H]muscimol. Line represents a nonlinear fit for the allosteric modulator with constrained [ H]muscimol parameters (Kd = 1.75 nM and assay concentration 40 nM implying that both GABA binding sites are occupied).
[0030] Figures 5A-5C: Effect of rMmTXl on hippocampal GABAA receptor currents. 5A, Potentiation of the muscimol-induced GABAA receptor current depends on rMmTXl concentration. Currents were elicited with 5 μΜ muscimol without and with increasing rMmTXl concentrations. Membrane holding voltage was -70 mV. 5B, Upper panel:
currents elicited with 100 nM muscimol (left) followed by co-application with 100 nM rMmTXl (middle), then without rMmTXl (right). Middle panel: currents elicited with 300 nM muscimol. Lower panel: currents elicited with 50 μΜ muscimol. Bars represent the duration of sample application. 5C, Left: Dependence of the GABAA receptor current amplitude on muscimol concentration. A Hill equation was fitted to the data points (filled
circles) yielding an EC50 of 4.1 μΜ and a Hill coefficient of 1.4. These data points and SEM were multiplied by the factor given in Table 3 yielding the rMmTXl -induced mean GABAA current increase (filled squares). Right: Muscimol-dependent potentiating effect of rMmTXl calculated as the toxin-induced current increase in relation to the total current amplitude. High muscimol concentrations abolish the potentiating effect with an IC50 of 1.1 μΜ.
[0031] Figures 6A-6E: Effect of sMmTXl on α1/β2/γ2 GABAA receptor currents. 6A, A muscimol concentration of 3 μΜ activates α1β2γ2 GABAA receptors expressed in HEK293 cells (left trace) held at a membrane voltage of -70 mV. When co-applying 300 nM sMmTXl, currents are potentiated and receptor desensitization tends to accelerate (middle trace). Partial toxin washout is shown on the right. 6B, Expression of the α1β2γ2 receptor in Xenopus oocytes held at a membrane voltage of -70 mV. Protocol consists of two 30s test applications of 5 μΜ muscimol separated by a 3 minute wash out period followed by 100 nM sMmTXl application together with 5 μΜ muscimol. Under control conditions, receptors desensitize with a time constant of 48 ± 5s (n = 3). In the presence of 100 nM sMmTXl the time constant is 25 ± 2s (n = 3). sMmTXl washout is slow and after three minutes, only a fraction of the receptors can be reactivated. Moreover, available receptors activate more slowly when compared to control suggesting that toxin is still bound. 6C, Close-up of the red and green region indicated in panel 6B normalized to the control peak (indicated with an asterisk). 6D, When lowering the muscimol concentration to 0.3 μΜ, a similar effect of 100 nM sMmTXl on receptor desensitization is observed. 6E, Similar to the α1β2γ2 receptor, the a^2-containing receptor expressed in oocytes and held at -70 mV is sensitive to 100 nM sMmTXl .
[0032] Figures 7A-7G: sMmTXl influences hippocampal network function. 7A, 300 nM muscimol does not have a detectable effect on the frequency of Ca2+ oscillations. 7B, sMmTXl by itself does not affect the frequency of Ca2+ oscillations. 7C, when applied together with muscimol at 300 nM, sMmTXl produces a short inhibition of network Ca2+ oscillations followed by a marked increase in spike frequency. 7D, Quantification of figures 7A-7C represented as a percentage variation of the Ca2+ oscillation frequency with respect to cells perfused with extracellular solution (100%, dotted line). Data are presented as mean ± SEM. 7E-7F, Representative traces of recordings of neurons perfused with ACSF (left) or muscimol- sMmTXl (right), under voltage- and current-clamp configuration respectively (n = 5). Zoomed-in areas indicated by the red rectangle in traces 7E and 7F are shown in red in the lower panel in each figure. 7G, Representative traces of recordings of neurons perfused
with 100 μΜ PTX under voltage- (left) and current- (right) clamp configuration respectively (n =5). Zoomed-in areas indicated by the red rectangle are shown in red in the lower panel.
[0033] Figure 8 shows the effect of 5 μΜ muscimol and 100 nM sMmTXl on various GABAA receptor subunit compositions. Expression of the various GABAA receptor compositions in Xenopus laevis oocytes held at a membrane voltage of -70mV. Protocol consists of two 30s test applications of 5 μΜ muscimol separated by a 3 minute wash out period followed by 100 nM sMmTXl applications in concert with 5 μΜ muscimol. Currents could not be evoked from control (uninjected) oocytes. Close-up of the red and green region indicated in the lower panels are normalized to the control peak (indicated with an asterisk). Experiments with subunit compositions α2β3γ2, α3β2γ2, α5β3γ2, and α1β3 suggest an important role for the al subunit in determining GABAA receptor susceptibility to sMmTXl . X-axis time scale is 90s. Representative example of 4 experiments (n=4) with each receptor composition are shown.
[0034] Figure 9 depicts the effect of sMmTXl on the α1ΕΚβ2γ2 receptor mutant. Top panel shows an amino acid sequence alignment of rat al-6 GABAA receptor subunits indicating the pharmacologically important loop-C region. Number in italic indicates amino acid position in al . Mutated residues in al are highlighted in red whereas the corresponding positions in a2-5 are displayed with a grey background. Accession numbers for sequences used are NP_899155.1, NP_001129251.1, NP_058765.3, NP_542154.3, NP_058991.1, and NP_068613.1 for al-6, respectively. Middle panel shows expression of the α1ΕΚβ2γ2 receptor in Xenopus oocytes held at a membrane voltage of -70mV. Protocol consists of two 30s test applications of 5 μΜ muscimol separated by a 3 minute washout period followed by 100 nM sMmTXl application together with 5μΜ muscimol. In contrast to experiments with the WT al-subunit (Fig. 6C), the α1ΕΚβ2γ2 receptor displays a rundown that is not present with the WT receptor (indicated by a solid line and extended by a dotted trend line).
Strikingly, 100 nM sMmTXl does not increase mutant receptor desensitization or significantly influences its response to 5 μΜ muscimol after toxin washout (n=4;
representative examples shown). In the presence of 300 nM muscimol (lower panel), sMmTXl still reduces the macroscopic conductance of the α1ΕΚβ2γ2 receptor, yet toxin washout is markedly faster when compared to WT. Rundown is indicated by the same line as in the middle panel. X-axis time scale is 90s.
[0035] Figures 10A-10D show the effect of sMmTXl on hippocampal neurons. A, Quantification of action potential (AP) properties without and in the presence of 100 nM
sMmTXl (see also Fig. 7). The frequency of APs is significantly increased by toxin treatment (p=0.0147, n=5) whereas amplitude and time-to-peak measurements do not reveal a significant change. Graphs are presented as paired changes for each experiment (absolute numbers, left Y-axis) and also as normalized grouped changes (%, right Y-axis). B,
Continuous application of 100 nM sMmTXl induces a decrease in currents elicited by 30ms puffs of 300nM muscimol. Control (Ctrl) trace (black) represents the average of currents recorded during 3 minutes under normal extracellular Ringer solution incubation. The sMmTXl trace (red) is the result of averaging currents for 3 minutes after 3 minutes perfusion with ΙΟΟηΜ sMmTXl. Insets show normalized rise and decay traces which reveal no kinetic differences of Ctrl versus sMmTXl. Values are expressed as mean ± SEM, pO.0001 (****). C, sMmTXl reduces the amplitude of mini inhibitory postsynaptic currents (mlPSCs) in neurons. Recordings were obtained in the presence of 1 μΜ TTX, 10 μΜ DNQX (AMPA and Kainate receptor antagonist) and 40μΜ APV (NMDA antagonist) to isolate mlPSCs. Events were recorded for 3 minutes in extracellular solution and then treated for 3 minutes with 300 nM muscimol and 100 nM sMmTXl before being recorded for 3 more minutes (n=3). Figure shows representative mlPSCs recordings under control and toxin treated conditions showing a clear decrease in the amplitude of the events. D, Quantification of the amplitude decrease is also shown. Data are presented as mean ± SEM. (t-test:
pO.0001 for muscimol + sMmTXl application (****).
[0036] Figure 11 is an illustration of the sMmTXl mutations for fluorophore labeling. sMmTXl was mutated at 4His, 28Arg, and 47Lys, as well as acetylated at the N-terminus. The two Lys residues of sMmTXl are mutated into 4His, 28Arg and 47 Ala is mutated into 47Lys in order to add a single primary amine, which reacts with the Alexa488 TFP (tetrafluorophenyl) ester, an improvement over the succinimidyl ester (SE or NHS -ester) chemistry typically used to attach fluorophores to the primary amines of biomolecules (the acetylated N-terminus prevents reaction with the primary amine at the N-terminus) (SEQ ID NO: 21).
[0037] Figure 12 is a CI 8 HPLC chromatogram indicating the separation of the unlabeled vs Alexa488-labeled sMmTXl-HRK (SEQ ID NO: 21) toxin.
[0038] Figure 13 depicts the effect of the sMmTXl -HRK mutant, sMmTXl -HRK- conjugated to Alexa488, and sMmTXl-HRK unlabeled HPLC fraction on α1β2γ2 GABAA receptor currents. (Top) A muscimol concentration of 100 nM activates α1β2γ2 GABAA receptors expressed in Xenopus oocytes held at a membrane voltage of -70 mV. When co- applying 100 nM sMmTXl-HRK, currents are potentiated and receptor desensitization tends
to accelerate (red trace). Toxin washout is shown on the right (in green). In the presence of 300 nM muscimol (trace below), toxin potentiating effect is diminished whereas
desensitization effect is unaltered. (Middle) Expression of the α1β2γ2 receptor in Xenopus oocytes held at a membrane voltage of -70 mV. Protocol consists of two 30-s test applications of 100 nM muscimol separated by a 3-min washout period, followed by 100 nM sMmTXl-HRK-conjugated to Alexa488 application together with 100 nM muscimol. Effect of the conjugated toxin on the receptor is reduced but toxin still binds to the receptor (see Fig. 14). (Bottom) Same protocol as above is used but with sMmTXl-HRK unlabeled HPLC fraction on α1β2γ2 GABAA receptor currents (see Fig. 12). A representative example of four recordings is shown for all traces.
[0039] Figure 14 depicts sMmTXl-HRK conjugated to Alexa488 binding to GABAA receptors in hippocampal cells. sMmTXl-HRK conjugated to Alexa488 was incubated for 45 minutes in culture media together with mouse hippocampal cells (E12 DIV - immature cells). The top figure shows neurons under white light whereas the bottom figure shows the same picture under blue light, thereby exciting the Alexa488 fluorophore. Toxin binding to GABAA receptors can be clearly seen as puncta along immature dendrites.
DETAILED DESCRIPTION OF THE INVENTION
[0040] While surveying the venom of Costa Rican coral snakes, the present inventors identified a major venom fraction that displayed evidence of GABAA-related toxicity in mice. Within this fraction, the polypeptides micrurotoxinl (MmTXl) and micrurotoxin2 (MmTX2) were identified. The two equally potent peptides have a primary sequence belonging to the PATE-SLURP l-LYNXl-Ly-6/neurotoxin-like family. Extensive binding and competition studies reveal that GABAA receptors are their primary target whereas nAChRs are unaffected. In contrast to PTX which blocks the pore at micromolar concentrations, the data show that MmTXl and MmTX2 and their variants and derivatives modulate GABAA receptor function at nanomolar quantities by binding to the α+/β- subunit interface, a novel drug binding site with promising therapeutic potential. Electrophysiological experiments with recombinantly and synthetically produced MmTXl and MmTX2 on hippocampal neurons, HEK 293 cells and Xenopus oocytes expressing common receptor compositions, suggest that these toxins modulate GABAA receptor opening as well as desensitization when co-applied with low concentrations of the agonist muscimol. The inventive peptides demonstrate for the first time
that potent and selective GABAA-receptor modulating toxins are present in snake venom and reveal the exciting prospect of discovering novel tools to study these receptors.
[0041] In accordance with an embodiment, the present invention provides polypeptides having GABAA modulating activity comprising the following amino acid sequence a) LTCKTCPFTTCPNSESCPGGQSICYQRKWEEHRGERIERRCVANCPAFGSHDTSLLCC TRDNCN (SEQ ID NO: 1), b) a functional fragment of a); c) a functional homolog of a) or b) or functional fragment thereof; and d) a fusion polypeptide comprising an amino acid sequence of any of a) to c).
[0042] In accordance with an embodiment, the present invention provides polypeptides having GABAA modulating activity comprising the following amino acid sequence a) LTCKTCPFTTCPNSESCPGGQSICYQRKWEEHHGERIERRCVANCPAFGSHDTSLLCC TRDNCN (SEQ ID NO: 2), b) a functional fragment of a); c) a functional homolog of a) or b) or functional fragment thereof; and d) a fusion polypeptide comprising an amino acid sequence of any of a) to c).
[0043] In yet another embodiment, the present invention provides polypeptides having GABAA modulating activity comprising the following amino acid sequence: a) Xaa Xaa Cys Lys Thr Cys Pro Phe Thr Thr Cys Pro Asn Ser Glu Ser Cys Xaa Xaa Xaa Xaa Xaa Xaa Cys Tyr Gin Arg Lys Trp Glu Glu His Arg Gly Glu Arg He Glu Arg Arg Cys Xaa Xaa Xaa Cys Pro Ala Phe Gly Ser His Asp Thr Ser Xaa Xaa Cys Cys Thr Arg Asp Asn Cys Asn (SEQ ID NO: 6), b) a functional fragment of a); c) a functional homolog of a) or b) or functional fragment thereof; and d) a fusion polypeptide comprising an amino acid sequence of any of a) to c).
[0044] In accordance with another embodiment, the present invention provides polypeptides having GABAA modulating activity comprising the following amino acid sequence: a) Xaa Xaa Cys Lys Thr Cys Pro Phe Thr Thr Cys Pro Asn Ser Glu Ser Cys Xaa Xaa Xaa Xaa Xaa Xaa Cys Tyr Gin Arg Lys Trp Glu Glu His His Gly Glu Arg He Glu Arg Arg Cys Xaa Xaa Xaa Cys Pro Ala Phe Gly Ser His Asp Thr Ser Xaa Xaa Cys Cys Thr Arg Asp Asn Cys Asn (SEQ ID NO: 7), b) a functional fragment of a); c) a functional homolog of a) or b) or functional fragment thereof; and d) a fusion polypeptide comprising an amino acid sequence of any of a) to c).
[0045] In accordance with a further embodiment, the present invention provides polypeptides having GABAA modulating activity comprising the following amino acid sequence: a) Leu Thr Cys Lys Thr Cys Pro Phe Thr Thr Cys Pro Asn Ser Glu Ser Cys Pro
Gly Gly Gin Ser He Cys Tyr Gin Arg Lys Trp Glu Glu His Arg Gly Glu Arg He Glu Arg Arg Cys Val Ala Asn Cys Pro Ala Phe Gly Ser His Asp Thr Leu Leu Cys Cys Thr Arg Asp Asn Cys Asn (SEQ ID NO: 8), b) a functional fragment of a); c) a functional homolog of a) or b) or functional fragment thereof; and d) a fusion polypeptide comprising an amino acid sequence of any of a) to c).
[0046] In accordance with still another embodiment, the present invention provides polypeptides having GABAA modulating activity comprising the following amino acid sequence: a) Met Lys Cys Leu He Cys Pro Phe Thr Thr Cys Ser Gin Ser Glu Ser Cys Pro Gly Gly Gin Ser He Cys Phe Gin Arg Lys Phe Asp Asp Arg His Gly Asp Arg He Glu Arg Gly Cys Ala Val Thr Cys Pro Pro Phe Gly Ser His Asp Thr He Phe Cys Cys Ser Thr Asn Asp Cys Asn (SEQ ID NO: 9), b) a functional fragment of a); c) a functional homolog of a) or b) or functional fragment thereof; and d) a fusion polypeptide comprising an amino acid sequence of any of a) to c).
[0047] In accordance with another embodiment, the present invention provides polypeptides having GABAA modulating activity comprising the following amino acid sequence: a) He Glu Cys His Asn Cys Pro Phe Thr Thr Cys Gly Asn Ser Glu Ser Cys Pro Gly Gly Gin Ser He Cys Val Gin Arg Lys Leu Glu Glu Lys Lys Gly Glu Arg He Glu Arg Ser Cys Thr Asp Gly Cys Pro Gly Phe Gly Ser His Asp Thr Val Glu Cys Cys Arg He Ala Arg Cys Asn (SEQ ID NO: 10), b) a functional fragment of a); c) a functional homolog of a) or b) or functional fragment thereof; and d) a fusion polypeptide comprising an amino acid sequence of any of a) to c).
[0048] In accordance with yet another embodiment, the present invention provides polypeptides having GABAA modulating activity comprising the following amino acid sequence: a) Arg Gin Cys Tyr Thr Cys Pro Phe Thr Thr Cys His Asn Ser Glu Ser Cys Pro Gly Gly Gin Ser He Cys Tyr Gin Arg Lys Tyr Glu Glu His Arg Gly Glu Arg He Glu Arg Lys Cys Ser Leu Ser Cys Pro Ser Phe Gly Ser His Asp Thr Leu Leu Cys Cys Ala Arg Pro Lys Cys Asn (SEQ ID NO: 11), b) a functional fragment of a); c) a functional homolog of a) or b) or functional fragment thereof; and d) a fusion polypeptide comprising an amino acid sequence of any of a) to c).
[0049] In accordance with a further embodiment, the present invention provides polypeptides having GABAA modulating activity comprising the following amino acid sequence: a) Phe Arg Cys Phe Arg Cys Pro Phe Thr Thr Cys Asn Asn Ser Glu Ser Cys Pro Gly Gly Gin Ser He Cys Tyr Gin Arg Lys Trp Glu Glu His Arg Gly Glu Arg He Glu Arg Arg
Cys Val Ala Asn Cys Pro Ala Phe Gly Ser His Asp Thr Leu Leu Cys Cys Lys Arg Glu Glu Cys Asn (SEQ ID NO: 12), b) a functional fragment of a); c) a functional homolog of a) or b) or functional fragment thereof; and d) a fusion polypeptide comprising an amino acid sequence of any of a) to c).
[0050] In accordance with still another embodiment, the present invention provides polypeptides having GABAA modulating activity comprising the following amino acid sequence: a) Leu Ser Cys Asn Thr Cys Pro Phe Thr Thr Cys Gin Asn Ser Glu Ser Cys Pro Gly Gly Gin Ser He Cys Tyr Gin Arg Lys Trp Glu Glu His Arg Gly Glu Arg He Glu Arg Arg Cys Val Ala Asn Cys Pro Ala Phe Gly Ser His Asp Thr Leu Leu Cys Cys Thr Arg Asp Asn Cys Asn (SEQ ID NO: 13), b) a functional fragment of a); c) a functional homolog of a) or b) or functional fragment thereof; and d) a fusion polypeptide comprising an amino acid sequence of any of a) to c).
[0051] In accordance with another embodiment, the present invention provides polypeptides having GABAA modulating activity comprising the following amino acid sequence: a) Leu Leu Cys Lys Thr Cys Pro Phe Thr Thr Cys Pro Asn Ser Glu Ser Cys Pro Gly Gly Gin Ser He Cys Tyr Gin Arg Lys Trp Glu Glu His Arg Gly Glu Arg He Glu Arg Arg Cys Val Ala Asn Cys Pro Ala Phe Gly Ser His Asp Thr Leu Leu Cys Cys Thr Arg Asp Asn Cys Asn (SEQ ID NO: 14), b) a functional fragment of a); c) a functional homolog of a) or b) or functional fragment thereof; and d) a fusion polypeptide comprising an amino acid sequence of any of a) to c).
[0052] As used herein, the term "Xaa" is a generic descriptor which means any amino acid.
[0053] The term, "amino acid" includes the residues of the natural a-amino acids (e.g., Ala, Arg, Asn, Asp, Cys, Glu, Gin, Gly, His, Lys, lie, Leu, Met, Phe, Pro, Ser, Thr, Trp, Tyr, and Val) in D or L form, as well as β-amino acids, synthetic and non-natural amino acids. Many types of amino acid residues are useful in the polypeptides and the invention is not limited to natural, genetically-encoded amino acids. Examples of amino acids that can be utilized in the peptides described herein can be found, for example, in Fasman, 1989, CRC Practical Handbook of Biochemistry and Molecular Biology, CRC Press, Inc., and the reference cited therein. Another source of a wide array of amino acid residues is provided by the website of RSP Amino Acids LLC.
[0054] Reference herein to "derivatives" includes parts, fragments and portions of the inventive GABAergic peptides. A derivative also includes a single or multiple amino acid
substitution, deletion and/or addition. Homologues include functionally, structurally or sterochemically similar peptides from venom from the same species of snake or from within the same genus or family of snake. All such homologues are contemplated by the present invention.
[0055] Analogs and mimetics include molecules which include molecules which contain non-naturally occurring amino acids or which do not contain amino acids but nevertheless behave functionally the same as the peptide. Natural product screening is one useful strategy for identifying analogs and mimetics.
[0056] Examples of incorporating non-natural amino acids and derivatives during peptide synthesis include, but are not limited to, use of norleucine, 4-amino butyric acid, 4-amino-3- hydroxy-5-phenylpentanoic acid, 6-aminohexanoic acid, t-butylglycine, norvaline, phenylglycine, ornithine, sarcosine, 4-amino-3-hydroxy-6-methylheptanoic acid, 2-thienyl alanine and/or D-isomers of amino acids. A partial list of known non-natural amino acid contemplated herein is shown in Table 1.
[0057] Table 1 : Non-natural Amino Acids
Non-conventional Non-conventional
amino acid Code amino acid Code
a-aminobutyric acid Abu L -N-methy lalanine Nmala
a-amino-a-methylbutyrate Mgabu L -N-methy larginine Nmarg
aminocyclopropane- Cpro L -N-methy lasparagine Nmasn
carboxylate L-N-methylaspartic acid Nmasp
aminoisobutyric acid Aib L -N-methy Icy steine Nmcys
aminonorbomyl- Norb L-N-methylglutamine Nmgln
carboxylate L-N-methylglutamic acid Nmglu
cyclohexylalanine Chexa L-N-methylhistidine Nmhis
cyclopentylalanine Cpen L-N-methylisolleucine Nmile
D -alanine Dal L -N-methy lleucine Nmleu
D-arginine Darg L -N-methy lly sine Nmlys
D-aspartic acid Dasp L -N-methy Methionine Nmmet
D -cysteine Dcys L-N-methylnorleucine Nmnle
D-glutamine Dgln L-N-methylnorvaline Nmnva
D -glutamic acid Dglu L-N-methylornithine Nmorn
D-histidine Dhis L-N-methylphenylalanine Nmphe
D-isoleucine Dile L -N-methy lproline Nmpro
D -leucine Dleu L-N-methylserine Nmser
D -lysine Dlys L-N-methylthreonine Nmthr
D -methionine Dmet L -N-methy ltry ptophan Nmt
D-ornithine Dorn L-N-methyltyrosine Nmtyr
D -phenylalanine Dphe L -N-methy lvaline Nmval
D-proline Dpro L-N-methylethylglycine Nmetg
D-serine Dser L-N-methyl-t-butylglycine Nmtbug
D-threonine Dthr L-norleucine Nle
D -tryptophan Dtrp L -norvaline Nva
D-tyrosine Dtyr a-methyl-aminoisobutyrate Maib
D-valine Dval a-methyl-Y-aminobutyrate Mgabu
D-a-methylalanine Dmala a-methylcyclohexylalanine Mchexa
D-a-methylarginine Dmarg a-methylcylcopentylalanine Mcpen
D-a-methylasparagine Dmasn a-methyl-a-napthylalanine Manap
D-a-methylaspartate Dmasp a-methy lpenicillamine Mpen
D-a-methylcysteine Dmcys N-(4-aminobutyl)glycine Nglu
D-a-methylglutamine Dmgln N-(2-anunoethyl)glycine Naeg
D-a-methvlhistidine Dmhis N-(3 -aminopropy l)glycine Norn
D-a-methvlisoleucine Dmile N-amino-a-methylbutyrate Nmaabu
D-a-methyllencine Dmleu a-napthylalanine Anap
D-a-methyllysine Dmlys N-benzylglycine Nphe
D-a-methylmetliionine Dmmet N-(2 -carbamy lethyl)glycine Ngln
D-a-methylornithine Dmorn N-(carbamylmethyl)glycine Nasn
D-a-methylphenylalanine Dmphe N-(2-caiboxyethyl)glycine Nglu
D-a-methylproline Dmpro N-(carboxymethyl)glycine Nasp
D-a-methylserine Dmser N-cyclobutylglycine Ncbut
D-a-methylthreonine Dmthr N-cycloheptylglycine Nchep
D-a-methyltryptophan Dmtrp N-cyclohexylglvcine Nchex
D-a-metlrvltvrosine Dmty N-CYclodecylglycine Ncdec
D-a-methylvaline Dmval N-cvlcododecylglycine Ncdod
D-N-methylalanine Dnmala N-CYclooctylglycine Ncoct
D-N-methylarginine Dnmarg N-cyclopropylglycine Ncpro
D-N-methylasparagine Dnmasn N-cycloundecylglycine Ncund
D-N-methylaspartate Dnmasp N-(2,2-diphenylethyl)glycine Nbhm
D-N-methylcysteine Dnmcys N-(3 ,3 -dipheny Ipropy l)glycine Nbhe
D-N-methylglutamine Dnmgln N-(3 -guanidinopropy l)gly cine Narg
D-N-methylglutamate Dnmglu N-( 1 -hydroxy ethyl)gly cine Ntlrr
D-N-methylhistidine Dnmhis N-(hydroxyethyl))glycine Nser
D-N-methvlisoleucine Dnmile N-(imidazolylethyl))glycine Nhis
D-N-methylleucine Dnmleu N-(3 -indolyly ethyl)glycine ΝΜφ
D-N-methyllysine Dnmlys N-methyl-y-aminobutyrate Nmgabu
N-methylcyclohexylalanine Nmchexa D-N-methylmethionine Dnmmet
D-N-methylornithine Dnmorn N-methylcyclopentylalanine Nmcpen
N-methylglycine Nala D-N-methylphenylalanine Dnmphe
N-methylaminoisobutyrate Nmaib D-N-methylproline Dmnpro
N-(l-methylpropyl)glycine Nile D-N-methylserine Dmnser
N-(2-methylpropyl)glycine Nleu D -N- methy lthreonine Dmntlrr
D-N-methyltryptophan Dnmtrp N-( 1 -methy lethyl)glycine Nval
D-N-methvltvrosine Dnmtvr N-methyla-napthylalanine Nmanap
D-N-methvlvaline Dnmval N-methy lpenicillamine Nmpen γ-aminobutyric acid Gabu N-(p-hydroxyphenyl)glycine Nhtyr
L-t-butylglycine Tbug N-(tlriomethyl)glycine Ncys
L-ethylglycine Etg penicillamine Pen
L-homophenylalanine Hphe L-a-methylalanine Mala
L-a-methylarginine Marg L-a-methylasparagine Masn
L-a-methylaspartate Masp L-a-methyl-t-butylglycine Mtbug
L-a-methylcysteine Mcys L-methylethylglycine Metg
L-a-methylglutamine Mgln L-a-methylglutamate Mglu
L-a-methvlhistidine Mhis L-a-methylhomophenylalanine Mhphe
L-a-methvlisoleucine Mile N-(2-methylthioethyl)glycine Nmet
L-a-methylleucine Mleu L-a-methyllysine Mlys
L-a-methy Methionine Mmet L-a-methylnorleucine Mnle
L-a-methylnorv aline Mnva L-a-methylornithine Morn
L-a-methylphenylalanine Mphe L-a-methylproline Mpro
L-a-methylserine Mser L-a-methylthreonine Mthr
L-a-methyltryptoplian Mtrp L-a-methyltyrosine Mrv r
L-a-methylvaline Mval L-N-methylhomophenylalanine Nmhphe
N-(N-(2,2-diphenylethyl) Nnbhm N-(N-(3,3-diphenylpropyl) Nnbhe carbamylmethyl)glycine carbamylmethyl)glycine
1 -carboxy-1 -(2,2-diphenyl- Nmbc
ethylamino)cyclopropane
[0058] Analogs of the subject peptides contemplated herein include modifications to side chains, incorporation of non-natural amino acids and/or their derivatives during peptide synthesis and the use of crosslinkers and other methods which impose conformational constraints on the peptide molecule or their analogs.
[0059] In accordance with an embodiment, the present invention provides a sMmTxl- HRK mutant polypeptide having GABAA modulating activity comprising the following amino acid sequence with an acetyl functional group at the N-terminus ((Acl) a)
(Acl)LTCHTCPFTTCPNSESCPGGQSICYQRRWEEHRGERIERRCVANCPKFGSHDTSL LCCTRDNCN (SEQ ID NO: 21), b) a functional fragment of a); c) a functional homolog of a) or b) or functional fragment thereof; and d) a fusion polypeptide comprising an amino acid sequence of any of a) to c).
[0060] Examples of side chain modifications contemplated by the present invention include modifications of amino groups such as by reductive alkylation by reaction with an aldehyde followed by reduction with NaBEU; amidination with methylacetimidate; acylation with acetic anhydride; carbamoylation of amino groups with cyanate; trinitrobenzylation of amino groups with 2, 4, 6-trinitrobenzene sulphonic acid (TNBS); acylation of amino groups with succinic anhydride and tetrahydrophthalic anhydride; and pyridoxylation of lysine with pyridoxal-5-phosphate followed by reduction with NaBEk
[0061] The guanidine group of arginine residues may be modified by the formation of heterocyclic condensation products with reagents such as 2,3-butanedione, phenylglyoxal and glyoxal.
[0062] The carboxyl group may be modified by carbodiimide activation via O- acylisourea formation followed by subsequent derivitization, for example, to a corresponding amide.
[0063] Sulphydryl groups may be modified by methods such as carboxymethylation with iodoacetic acid or iodoacetamide; performic acid oxidation to cysteic acid; formation of a mixed disulphides with other thiol compounds; reaction with maleimide, maleic anhydride or other substituted maleimide; formation of mercurial derivatives using 4- chloromercuribenzoate, 4-chloromercuriphenylsulphonic acid, phenylmercury chloride, 2-
chloromercuri-4-nitrophenol and other mercurials; carbamoylation with cyanate at alkaline pH.
[0064] Tryptophan residues may be modified by, for example, oxidation with N- bromosuccinimide or alkylation of the indole ring with 2-hydroxy-5-nitrobenzyl bromide or sulphenyl halides. Tyrosine residues on the other hand, may be altered by nitration with tetranitromethane to form a 3-nitrotyrosine derivative.
[0065] Modification of the imidazole ring of a histidine residue may be accomplished by alkylation with iodoacetic acid derivatives or N-carbethoxylation with diethylpyrocarbonate.
[0066] Crosslinkers can be used, for example, to stabilise 3D conformations, using homo- bifunctional crosslinkers such as the bifunctional imido esters having (CH2)n spacer groups with n=l to n=6, glutaraldehyde, N-hydroxysuccinimide esters and hetero-bifunctional reagents which usually contain an amino-reactive moiety such as N-hydroxysuccinimide and another group specific-reactive moiety such as maleimido or dithio moiety (SH) or carbodiimide (COOH). In addition, peptides can be conformationally constrained by, for example, incorporation of Ca and Na-methylamino acids, introduction of double bonds between Ca and Cp atoms of amino acids and the formation of cyclic peptides or analogues by introducing covalent bonds such as forming an amide bond between the N and C termini, between two side chains or between a side chain and the N or C terminus.
[0067] The present invention further contemplates small chemical analogs of the subject peptides capable of acting as antagonists or agonists of the GABAergic peptides of the present invention. Chemical analogs may not necessarily be derived from the peptides themselves but may share certain conformational similarities. Alternatively, chemical analogs may be specifically designed to mimic certain physiochemical properties of the peptides. Chemical analogs may be chemically synthesized or may be detected following, for example, natural product screening.
[0068] The term, "peptide," as used herein, includes a sequence of from four to 100 amino acid residues in length, preferably about 10 to 80 residues in length, more preferably, 15 to 65 residues in length, and in which the a-carboxyl group of one amino acid is joined by an amide bond to the main chain (a- or β-) amino group of the adjacent amino acid. The peptides provided herein for use in the described and claimed methods and compositions can also be cyclic.
[0069] The precise effective amount for a human subject will depend upon the severity of the subject's disease state, general health, age, weight, gender, diet, time and frequency of
administration, drug combination(s), reaction sensitivities, and tolerance or response to therapy. A routine experimentation can determine this amount and is within the judgment of the medical professional. Compositions may be administered individually to a patient, or they may be administered in combination with other drugs, hormones, agents, and the like.
[0070] Routes of administration of the inventive peptides include, but are not limited to intravenously, intraperitioneal, subcutaneously, intracranial, intradermal, intramuscular, intraocular, intrathecal, intracerebrally, intranasally, infusion, orally, rectally, via iv drip, patch and implant.
[0071] In one or more embodiments, the present invention provides pharmaceutical compositions comprising one or more of the inventive peptides and a pharmaceutically acceptable carrier. In other aspects, the pharmaceutical compositions also include one or more additional biologically active agents.
[0072] With respect to peptide compositions described herein, the carrier can be any of those conventionally used, and is limited only by physico-chemical considerations, such as solubility and lack of reactivity with the active compound(s), and by the route of
administration. The carriers described herein, for example, vehicles, adjuvants, excipients, and diluents, are well-known to those skilled in the art and are readily available to the public. It is preferred that the carrier be one which is chemically inert to the active agent(s), and one which has little or no detrimental side effects or toxicity under the conditions of use.
Examples of the carriers include soluble carriers such as known buffers which can be physiologically acceptable (e.g., phosphate buffer) as well as solid compositions such as solid-state carriers or latex beads.
[0073] The carriers or diluents used herein may be solid carriers or diluents for solid formulations, liquid carriers or diluents for liquid formulations, or mixtures thereof.
[0074] Solid carriers or diluents include, but are not limited to, gums, starches (e.g., com starch, pregelatinized starch), sugars (e.g., lactose, mannitol, sucrose, dextrose), cellulosic materials (e.g., microcrystalline cellulose), acrylates (e.g., polymethylacrylate), calcium carbonate, magnesium oxide, talc, or mixtures thereof.
[0075] For liquid formulations, pharmaceutically acceptable carriers may be, for example, aqueous or non-aqueous solutions, or suspensions. Examples of non-aqueous solvents are propylene glycol, polyethylene glycol, and injectable organic esters such as ethyl oleate. Aqueous carriers include, for example, water, alcoholic/aqueous solutions, cyclodextrins, emulsions or suspensions, including saline and buffered media.
[0076] Parenteral vehicles (for subcutaneous, intravenous, intraarterial, or intramuscular injection) include, for example, sodium chloride solution, Ringer's dextrose, dextrose and sodium chloride, lactated Ringer's and fixed oils. Formulations suitable for parenteral administration include, for example, aqueous and non-aqueous, isotonic sterile injection solutions, which can contain anti-oxidants, buffers, bacteriostats, and solutes that render the formulation isotonic with the blood of the intended recipient, and aqueous and non-aqueous sterile suspensions that can include suspending agents, solubilizers, thickening agents, stabilizers, and preservatives.
[0077] In addition, in an embodiment, the compositions comprising the inventive peptides or derivatives thereof, may further comprise binders (e.g., acacia, comstarch, gelatin, carbomer, ethyl cellulose, guar gum, hydroxypropyl cellulose, hydroxypropyl methyl cellulose, povidone), disintegrating agents (e.g., cornstarch, potato starch, alginic acid, silicon dioxide, croscarmelose sodium, crospovidone, guar gum, sodium starch glycolate), buffers (e.g., Tris-HCL, acetate, phosphate) of various pH and ionic strength, additives such as albumin or gelatin to prevent absorption to surfaces, detergents (e.g., Tween 20, Tween 80, Pluronic F68, bile acid salts), protease inhibitors, surfactants (e.g. sodium lauryl sulfate), permeation enhancers, solubilizing agents (e.g., cremophor, glycerol, polyethylene glycerol, benzlkonium chloride, benzyl benzoate, cyclodextrins, sorbitan esters, stearic acids), antioxidants (e.g., ascorbic acid, sodium metabisulfite, butylated hydroxyanisole), stabilizers (e.g., hydroxypropyl cellulose, hyroxypropylmethyl cellulose), viscosity increasing agents (e.g., carbomer, colloidal silicon dioxide, ethyl cellulose, guar gum), sweetners (e.g., aspartame, citric acid), preservatives (e.g., thimerosal, benzyl alcohol, parabens), lubricants (e.g., stearic acid, magnesium stearate, polyethylene glycol, sodium lauryl sulfate), flow-aids (e.g., colloidal silicon dioxide), plasticizers (e.g., diethyl phthalate, tri ethyl citrate), emulsifiers (e.g., carbomer, hydroxypropyl cellulose, sodium lauryl sulfate), polymer coatings (e.g., poloxamers or poloxamines), coating and film forming agents (e.g., ethyl cellulose, acrylates, polymethacrylates), and/or adjuvants.
[0078] The choice of carrier will be determined, in part, by the particular peptide containing compositions, as well as by the particular method used to administer the composition. Accordingly, there are a variety of suitable formulations of the pharmaceutical compositions of the invention. More than one route can be used to administer the
compositions of the present invention, and in certain instances, a particular route can provide a more immediate and more effective response than another route.
[0079] Injectable formulations are in accordance with the invention. The requirements for effective pharmaceutical carriers for injectable compositions are well-known to those of ordinary skill in the art (see, e.g., Pharmaceutics and Pharmacy Practice, J.B. Lippincott Company, Philadelphia, PA, Banker and Chalmers, eds., pages 238-250 (1982), mdASHP Handbook on Injectable Drugs, Trissel, 15th ed., pages 622-630 (2009)).
[0080] In accordance with an embodiment, the present invention provides a composition comprising one or more polypeptides having GABAA modulating activity described herein, and at least one or more biologically active agent.
[0081] As used herein the term "therapeutically active agent" or "biologically active agent" means an agent useful for the treatment or modulation of a disease or condition in a subject suffering therefrom. Examples of therapeutically active agents can include any drugs, peptides, siRNAs, and conjugates, known in the art for treatment of disease indications.
[0082] The biologically active agent may vary widely with the intended purpose for the composition. The term active is art-recognized and refers to any moiety that is a biologically, physiologically, or pharmacologically active substance that acts locally or systemically in a subject. Examples of biologically active agents, that may be referred to as "drugs", are described in well-known literature references such as the Merck Index, the Physicians' Desk Reference, and The Pharmacological Basis of Therapeutics, and they include, without limitation, medicaments; vitamins; mineral supplements; substances used for the treatment, prevention, diagnosis, cure or mitigation of a disease or illness; substances which affect the structure or function of the body; or pro-drugs, which become biologically active or more active after they have been placed in a physiological environment.
[0083] Further examples of biologically active agents include, without limitation, enzymes, receptor antagonists or agonists, hormones and antibodies. Specific examples of useful biologically active agents include, for example, autonomic agents, such as
anticholinergics, antimuscarinic anticholinergics, ergot alkaloids, parasympathomimetics, cholinergic agonist parasympathomimetics, cholinesterase inhibitor parasympathomimetics, sympatholytics, a-blocker sympatholytics, sympatholytics, sympathomimetics, and adrenergic agonist sympathomimetics intravenous anesthetics, barbiturate intravenous anesthetics, benzodiazepine intravenous anesthetics, and opiate agonist intravenous anesthetics skeletal muscle relaxants, neuromuscular blocker skeletal muscle relaxants, and reverse neuromuscular blocker skeletal muscle relaxants; neurological agents, such as anticonvulsants, barbiturate anticonvulsants, benzodiazepine anticonvulsants, anti-migraine
agents, anti-parkinsonian agents, anti-vertigo agents, opiate agonists, and opiate antagonists; psychotropic agents, such as antidepressants, heterocyclic antidepressants, monoamine oxidase inhibitors, selective serotonin re-uptake inhibitors, tricyclic antidepressants, antimanics, anti-psychotics, phenothiazine antipsychotics, anxiolytics, sedatives, and hypnotics, barbiturate sedatives and hypnotics, benzodiazepine anxiolytics, sedatives, and hypnotics, and psychostimulants.
[0084] Therefore, in accordance with an embodiment, the present invention provides the use of the inventive polypeptides disclosed herein, for modulating GABAA receptors in a cell or population of cells expressing the GABAA receptor comprising contacting the cell or population of cells with an effective amount of the inventive polypeptides.
[0085] In accordance with another embodiment, the present invention provides the use of the inventive polypeptides disclosed herein, for modulating GABAA receptors in a subject suffering from a neurological disorder, comprising administering to the subject, an effective amount of a composition comprising one or more polypeptides disclosed herein.
[0086] In accordance with a further embodiment, the present invention provides the use of the inventive polypeptides disclosed herein, for modulating GABAA receptors in a subject suffering from a neurological disorder, comprising administering to the subject, an effective amount of a composition comprising one or more polypeptides disclosed herein, and at least one or more biologically active agents.
[0087] The terms "treat," and "prevent" as well as words stemming therefrom, as used herein, do not necessarily imply 100% or complete treatment or prevention. Rather, there are varying degrees of treatment or prevention of which one of ordinary skill in the art recognizes as having a potential benefit or therapeutic effect.
[0088] As used herein, the term "treat," as well as words stemming therefrom, includes diagnostic and preventative as well as disorder remitative treatment.
[0089] In accordance with an embodiment, the present invention provides methods for modulating GABAA receptors in a subject suffering from a neurological disorder comprising administering to the subject a composition comprising one or more polypeptides having
GABAA modulating activity described herein, and at least one or more biologically active agents.
[0090] Neurological disorders which involve, either directly or indirectly, GABAergic function may be studied and/or treated using the peptides and pharmaceutical compositions comprising the inventive peptides. Examples of such diseases include, but are not limited to,
affective disorders such as depression, bipolar disorder, generalized anxiety disorders, epilepsy, convulsant disorders, schizophrenia, and certain pain disorders, Stiff-person syndrome (SPS), pathophysiology of the fragile X syndrome, tonic inhibition neuronal dysfunctions, Down syndrome, autism, and generalized seizures.
[0091] In accordance with an embodiment, the present invention provides methods for modulating GABAA receptors in a cell or population of cells expressing the GABAA receptor comprising contacting the cell or population of cells with an effective amount of the inventive polypeptides described herein. It is contemplated that the inventive GABAA modulating peptides and compounds will be useful in studying neurological functions in vitro and in vivo.
[0092] In some embodiments, the inventive peptides and compositions can include imaging agents covalently linked to the peptides and compositions.
[0093] In accordance with an embodiment, the present invention provides a composition comprising one or more polypeptides having GABAA modulating activity described herein, and at least one or more imaging agents.
[0094] In some embodiments, the imaging agent is a fluorescent dye. The dye may be an emitter in the visible or near-infrared (NIR) spectrum. Known dyes useful in the present invention include carbocyanine, indocarbocyanine, oxacarbocyanine, thiiicarbocyanine and merocyanine, polymethine, coumarine, rhodamine, xanthene, fluorescein,
boron-dipyrromethane (BODIPY), Cy5, Cy5.5, Cy7, VivoTag-680, VivoTag-S680, VivoTag-S750, AlexaFluor488, AlexaFluor660, AlexaFluor680, AlexaFluor700,
AlexaFluor750, AlexaFluor790, Dy677, Dy676, Dy682, Dy752, Dy780, DyLight547, Dylight647, HiLyte Fluor 647, HiLyte Fluor 680, HiLyte Fluor 750, IRDye 800CW, IRDye 800RS, IRDye 700DX, ADS780WS, ADS830WS, and ADS832WS.
[0095] Organic dyes which are active in the NIR region are known in biomedical applications. However, there are only a few NIR dyes that are readily available due to the limitations of conventional dyes, such as poor hydrophilicity and photostability, low quantum yield, insufficient stability and low detection sensitivity in biological system, etc. Significant progress has been made on the recent development of NIR dyes (including cyanine dyes, squaraine, phthalocyanines, porphyrin derivatives and BODIPY (borondipyrromethane) analogues) with much improved chemical and photostability, high fluorescence intensity and long fluorescent life. Examples of NIR dyes include cyanine dyes (also called as
polymethine cyanine dyes) are small organic molecules with two aromatic nitrogen-
containing heterocycles linked by a polymethine bridge and include Cy5, Cy5.5, Cy7 and their derivatives. Squaraines (often called Squarylium dyes) consist of an oxocyclobutenolate core with aromatic or heterocyclic components at both ends of the molecules, an example is KSQ-4-H. Phthalocyanines, are two-dimensional 18ji-electron aromatic porphyrin derivatives, consisting of four bridged pyrrole subunits linked together through nitrogen atoms. BODIPY (borondipyrromethane) dyes have a general structure of 4,4'-difluoro- 4- bora-3a, 4a-diaza-s-indacene) and sharp fluorescence with high quantum yield and excellent thermal and photochemical stability.
[0096] Other imaging agents which can be attached to the inventive peptides and compositions of the present invention include PET and SPECT imaging agents. The most widely used agents include branched chelating agents such as di-ethylene tri-amine penta- acetic acid (DTP A), l,4,7,10-tetra-azacyclododecane-l,4,7,10-tetraacetic acid (DOTA) and their analogs. Chelating agents, such as di-amine dithiols, activated mercaptoacetyl-glycyl- glycyl-gylcine (MAG3), and hydrazidonicotinamide (HYNIC), are able to chelate metals like 99mTc and 186Re. Instead of using chelating agents, a prosthetic group such as N- succinimidyl-4-18F-fluorobenzoate (18F-SFB) is necessary for labeling peptides with 18F. In accordance with an embodiment, the chelating agent is DOTA.
[0097] In accordance with an embodiment, the present invention provides a nanoplex molecule wherein the reporter portion comprises a metal isotope suitable for imaging.
Examples of isotopes useful in the present invention include Tc-94m, Tc-99m, In-111, Ga-67, Ga-68, Y-86, Y-90, Lu-177, Re-186, Re-188, Cu-64, Cu-67, Co-55, Co-57, Sc-47, Ac-225, Bi-213, Bi-212, Pb-212, Sm-153, Ho-166, or Dy-i66.
[0098] In accordance with an embodiment, the present invention provides peptides and compositions wherein the imaging agent portion comprises mIn labeled DOTA which is known to be suitable for use in SPECT imaging.
[0099] In accordance with another embodiment, the present invention provides a peptides and compositions wherein the imaging agent comprises Gd + labeled DOTA which is known to be suitable for use in MR imaging. It is understood by those of ordinary skill in the art that other suitable radioisotopes can be substituted for mIn and Gd + disclosed herein.
[0100] In accordance with an embodiment, the present invention provides one or more nucleic acid sequences encoding any of the polypeptides having GABAA modulating activity or derivatives, homologues, analogues or mimetics thereof disclosed herein.
[0101] By "nucleic acid" as used herein includes "polynucleotide," "oligonucleotide," and "nucleic acid molecule," and generally means a polymer of DNA or RNA, which can be single-stranded or double-stranded, synthesized or obtained (e.g., isolated and/or purified) from natural sources, which can contain natural, non-natural or altered nucleotides, and which can contain a natural, non-natural or altered internucleotide linkage, such as a phosphoroamidate linkage or a phosphorothioate linkage, instead of the phosphodiester found between the nucleotides of an unmodified oligonucleotide. It is generally preferred that the nucleic acid does not comprise any insertions, deletions, inversions, and/or substitutions. However, it may be suitable in some instances, as discussed herein, for the nucleic acid to comprise one or more insertions, deletions, inversions, and/or substitutions.
[0102] In an embodiment, the nucleic acids of the invention are recombinant. As used herein, the term "recombinant" refers to (i) molecules that are constructed outside living cells by joining natural or synthetic nucleic acid segments to nucleic acid molecules that can replicate in a living cell, or (ii) molecules that result from the replication of those described in (i) above. For purposes herein, the replication can be in vitro replication or in vivo replication.
[0103] In accordance with an embodiment, the present invention provides one or more non-naturally occurring cDNA sequences encoding any of the polypeptides having GABAA modulating activity or derivatives, homologues, analogues or mimetics thereof disclosed herein.
[0104] The nucleic acids can be constructed based on chemical synthesis and/or enzymatic ligation reactions using procedures known in the art. For example, a nucleic acid can be chemically synthesized using naturally occurring nucleotides or variously modified nucleotides designed to increase the biological stability of the molecules or to increase the physical stability of the duplex formed upon hybridization (e.g., phosphorothioate derivatives and acridine substituted nucleotides). Examples of modified nucleotides that can be used to generate the nucleic acids include, but are not limited to, 5-fluorouracil, 5-bromouracil, 5- chlorouracil, 5-iodouracil, hypoxanthine, xanthine, 4-acetylcytosine, 5- (carboxyhydroxymethyl) uracil, 5-carboxymethylaminomethyl-2-thiouridine, 5- carboxymethylaminomethyluracil, dihydrouracil, beta-D-galactosylqueosine, inosine, N6- isopentenyladenine, 1-methylguanine, 1 -methylinosine, 2,2-dimethylguanine, 2- methyladenine, 2-methylguanine, 3-methylcytosine, 5-methylcytosine, N6-substituted adenine, 7-methylguanine, 5-methylaminomethyluracil, 5-methoxyaminomethyl-2-thiouracil,
beta-D-mannosylqueosine, 5'-methoxycarboxymethyluracil, 5 -methoxy uracil, 2-methylthio- N6-isopentenyladenine, uracil-5-oxyacetic acid (v), wybutoxosine, pseudouracil, queosine, 2- thiocytosine, 5-methyl-2-thiouracil, 2-thiouracil, 4-thiouracil, 5-methyluracil, uracil-5- oxyacetic acid methylester, 3-(3-amino-3-N-2-carboxypropyl) uracil, and 2,6-diaminopurine. Alternatively, one or more of the nucleic acids of the invention can be purchased from companies, such as Macromolecular Resources (Fort Collins, CO) and Synthegen (Houston, TX).
[0105] The nucleic acids can be constructed based on chemical synthesis and/or enzymatic ligation reactions using procedures known in the art. See, for example, Sambrook et al. (eds.), Molecular Cloning, A Laboratory Manual, 3rd Edition, Cold Spring Harbor Laboratory Press, New York (2001) and Ausubel et al., Current Protocols in Molecular Biology, Greene Publishing Associates and John Wiley & Sons, NY (2007). For example, a nucleic acid can be chemically synthesized using naturally occurring nucleotides or variously modified nucleotides designed to increase the biological stability of the molecules or to increase the physical stability of the duplex formed upon hybridization (e.g.,
phosphorothioate derivatives and acridine substituted nucleotides). Examples of modified nucleotides that can be used to generate the nucleic acids include, but are not limited to, 5- fluorouracil, 5-bromouracil, 5-chlorouracil, 5-iodouracil, hypoxanthine, xanthine, 4- acetylcytosine, 5 -(carboxy hydroxy methyl) uracil, 5-carboxymethylaminomethyl-2- thiouridine, 5-carboxymethylaminomethyluracil, dihydrouracil, beta-D-galactosylqueosine, inosine, N6-isopentenyladenine, 1 -methylguanine, 1-methylinosine, 2,2-dimethylguanine, 2- methyladenine, 2-methylguanine, 3-methylcytosine, 5-methylcytosine, N6-substituted adenine, 7-methylguanine, 5-methylaminomethyluracil, 5-methoxyaminomethyl-2-thiouracil, beta-D-mannosylqueosine, 5'-methoxycarboxymethyluracil, 5 -methoxy uracil, 2-methylthio- N6-isopentenyladenine, uracil-5-oxy acetic acid (v), wybutoxosine, pseudouracil, queosine, 2- thiocytosine, 5-methyl-2-thiouracil, 2-thiouracil, 4-thiouracil, 5-methyluracil, uracil-5- oxyacetic acid methylester, 3-(3-amino-3-N-2-carboxypropyl) uracil, and 2,6-diaminopurine. Alternatively, one or more of the nucleic acids of the invention can be purchased from companies, such as Macromolecular Resources (Fort Collins, CO) and Synthegen (Houston, TX).
[0106] In accordance with another embodiment, the present invention provides a vector comprising one or more nucleic acid sequences encoding any of the polypeptides having
GABAA modulating activity or derivatives, homologues, analogues or mimetics thereof disclosed herein.
[0107] The nucleic acids of the invention can be incorporated into a recombinant expression vector. In this regard, the invention provides recombinant expression vectors comprising any of the nucleic acids of the invention. For purposes herein, the term
"recombinant expression vector" means a genetically-modified oligonucleotide or polynucleotide construct that permits the expression of an mRNA, protein, polypeptide, or peptide by a host cell, when the construct comprises a nucleotide sequence encoding the mRNA, protein, polypeptide, or peptide, and the vector is contacted with the cell under conditions sufficient to have the mRNA, protein, polypeptide, or peptide expressed within the cell. The vectors of the invention are not naturally-occurring as a whole. However, parts of the vectors can be naturally-occurring. The inventive recombinant expression vectors can comprise any type of nucleotides, including, but not limited to DNA and RNA, which can be single-stranded or double-stranded, synthesized or obtained in part from natural sources, and which can contain natural, non-natural or altered nucleotides. The recombinant expression vectors can comprise naturally-occurring, non-naturally-occurring internucleotide linkages, or both types of linkages. Preferably, the non-naturally occurring or altered nucleotides or internucleotide linkages do not hinder the transcription or replication of the vector.
[0108] The recombinant expression vectors of the invention can be prepared using standard recombinant DNA techniques described in, for example, Sambrook et al., supra, and Ausubel et al., supra. Constructs of expression vectors, which are circular or linear, can be prepared to contain a replication system functional in a prokaryotic or eukaryotic host cell, such as Xenopus oocytes. Replication systems can be derived, e.g., from ColEl, 2 μ plasmid, λ, SV40, bovine papilloma virus, and the like.
[0109] Desirably, the recombinant expression vector comprises regulatory sequences, such as transcription and translation initiation and termination codons, which are specific to the type of host (e.g., bacterium, fungus, plant, or animal) into which the vector is to be introduced, as appropriate and taking into consideration whether the vector is DNA or RNA based.
[0110] The recombinant expression vector can include one or more marker genes, which allow for selection of transformed or transfected hosts. Marker genes include biocide resistance, e.g., resistance to antibiotics, heavy metals, etc., complementation in an auxotrophic host to provide prototrophy, and the like. Suitable marker genes for the
inventive expression vectors include, for instance, LacZ, green fluorescent protein (GFP), luciferase, neomycin/G418 resistance genes, hygromycin resistance genes, histidinol resistance genes, tetracycline resistance genes, and ampicillin resistance genes.
[0111] The heterologous nucleic acid can be a nucleic acid not normally found in the target cell, or it can be an extra copy or copies of a nucleic acid normally found in the target cell. The terms "exogenous" and "heterologous" are used herein interchangeably.
[0112] The invention further provides a host cell comprising any of the recombinant expression vectors described herein. As used herein, the term "host cell" refers to any type of cell that can contain the inventive recombinant expression vector. The host cell can be an animal cell. Preferably, in an embodiment, the host cell is a mammalian cell. The host cell can be a cultured cell or a primary cell, i.e., isolated directly from an organism, e.g., a human. The host cell can be an adherent cell or a suspended cell, i.e., a cell that grows in suspension. Most preferably, the host cell is a human cell. The host cell can be of any cell type, can originate from any type of tissue, and can be of any developmental stage. Most preferably the host cells can include, for instance, muscle, lung, and brain cells, and the like.
[0113] The host referred to in the inventive methods can be any host. Preferably, the host is a mammal.
[0114] As used herein, the term "mammal" refers to any mammal, including, but not limited to, mammals of the order Rodentia, such as mice and hamsters, and mammals of the order Logomorpha, such as rabbits. It is preferred that the mammals are from the order Carnivora, including Felines (cats) and Canines (dogs). It is more preferred that the mammals are from the order Artiodactyla, including Bovines (cows) and Swines (pigs) or of the order Perssodactyla, including Equines (horses). It is most preferred that the mammals are of the order Primates, Ceboids, or Simoids (monkeys) or of the order Anthropoids (humans and apes). An especially preferred mammal is the human.
[0115] Also provided by the invention is a population of cells comprising at least one host cell described herein. The population of cells can be a heterogeneous population comprising the host cell comprising any of the recombinant expression vectors described, in addition to at least one other cell, e.g., a host cell (e.g., a lung cell), which does not comprise any of the recombinant expression vectors, or a cell other than a lung cell, e.g., a skin cell, a neutrophil, an erythrocyte, a hepatocyte, an endothelial cell, an epithelial cell, a muscle cell, a brain cell, etc. Alternatively, the population of cells can be a substantially homogeneous population, in which the population comprises mainly of host cells (e.g., consisting
essentially of) comprising the recombinant expression vector. The population also can be a clonal population of cells, in which all cells of the population are clones of a single host cell comprising a recombinant expression vector, such that all cells of the population comprise the recombinant expression vector. In one embodiment of the invention, the population of cells is a clonal population comprising host cells comprising a recombinant expression vector as described herein.
EXAMPLES
[0116] Purification and production of MmTXl and MmTX2.
[0117] MmTXl and MmTX2 were purified from Micrurus mipartitus venom from Costa Rica by a two-step HPLC protocol. Edman sequencing was carried out on a cysteine reduced and s-carboxymethylated derivative. Recombinant expression of
MmTXl/2 was based on a synthetic gene and site-directed mutagenesis was executed with the quick-change mutagenesis kit (Stratagene). All constructs were sequenced (Genome express) and expressed in E. Coli HB 101 (Promega) as a fusion protein with the ZZ domain (GE Healthcare). Fusion proteins were purified on an IgG-Sepharose column (GE
Healthcare) and toxin-moiety kept free from the ZZ domain using cyanogen bromide. Except where indicated, all chemicals were purchased from Sigma-Aldrich. sMmTXl was chemically synthesized using standard solid phase peptide synthesis methodology and Fmoc chemistry. The 5-disulfide bridges were allowed to fold in a 100 mM Tris-HCl buffer, 1 mM EDTA, pH 9.0, adding a combination of GSSG/GSH in a 1 mM/2 mM ratio and sMmTXl at a concentration of 20 μΜ. Purification and desalting was achieved by HPLC.
[0118] Template-based 3D modelling.
[0119] Homology modelling of MmTXl was performed with MODELLER using ModWeb Server version SNV.rl368M within ModBase. Visualisation and drawing of selected models were accomplished with UCSF Chimera.
[0120] MmTX2 iodination and pharmacological experiments.
[0121] Na125I and [3H]muscimol were obtained from PerkinElmer and isoguvacine from Peninsula laboratories. All other reagents were from Sigma-Aldrich. MmTX2 was radioactively labeled by lacto-peroxidase-catalyzed iodination with specific activities of 900 Ci/mmol routinely obtained. Synaptosome fractions (P2) of Wistar rat brains were lysed on ice by dilution into 15 volumes of hypotonic buffer, and SPMs were pelleted at
12,500 xg, 20 minutes at 5 °C. Binding experiments were performed in 1.5 ml tubes in buffer 10 mM Tris, 100 mM NaCl, 1 mg/ml BSA, pH 7.4, 50 μg of SPM protein. The incubations were performed at 37 °C (125I-MmTX2) or 4 °C ([3H]muscimol). Data analysis was performed using GraphPad PRISM®. Data are reported as mean ± SEM.
[0122] Electrophysiological recordings.
[0123] HEK 293 cells transfected with the α1β2γ2 GABAA receptor and GFP were patch-clamped under a water-immersed 40x objective of a Zeiss Axioskop 2 FS Plus.
Borosilicate glass capillaries (Harvard Apparatus) were pulled (Sutter Instruments) and had a resistance of 3-5 ΜΩ when filled with the internal solution. Membrane currents were recorded using Pulse and Patchmaster software (HEKA) in combination with an EPC-9 patch-clamp amplifier (HEKA). Data were low-pass filtered at 2.9 kHz. Only data from recordings with an access resistance <20 ΜΩ were evaluated. Data were analyzed using Fitmaster (HEKA), Igor Pro 6.03 (Wavemetrics) and Excel (Microsoft). Averaged values are given as mean ± SEM.
[0124] Hippocampal cell cultures were prepared from PI mice (C57B16J). Whole-cell patch clamp experiments were performed on hippocampal neurons (DIV 14) at room temperature (-22 °C) and the holding potential was -70 mV. The extracellular solution used in hippocampal neuron experiments contained (in mM): 143 NaCl, 5 KC1, 0.8 MgCL, 1 CaCk, 10 HEPES, 5 glucose, 0.5 μΜ TTX, 10 μΜ CNQX, and 20 μΜ APV, pH = 7.3 with NaOH. In experiments with HEK 293 cells the same extracellular solution was used without TTX, CNQX, and APV. The pipette solution contained (in mM): 140 CsCl, 1 CaCk, 1 MgCh, 11 EGTA, 5 HEPES; pH adjusted to 7.2 with CsOH. For recordings in Fig. 7, ACSF solution contained (in mM): 140 NaCl, 5 KC1, 2 CaCk, 2 MgCh, 10 HEPES, and 10 Glucose (pH 7.3 adjusted with NaOH). Recordings were performed with an Axopatch 200B amplifier equipped with Digidata 1440 and pClamp 10 (Molecular Devices). Whole-cell recordings were done using borosilicate glass pipettes (4-6 ΜΩ) filled with internal solution containing (in mM): 135 K-gluconate, 20 KC1, 10 HEPES, 4 Mg-ATP, 0.3 Na2GTP, 0.5 EGTA.
[0125] Rat GABAA receptor subunits were also expressed Xenopus oocytes. cRNA was synthesized using T7 polymerase (Life Technologies) after linearizing the DNA with appropriate restriction enzymes. Currents were studied following 1-2 days incubation after cRNA injection using two-electrode voltage-clamp recording techniques (OC-725C, Warner Instruments). Microelectrode resistances were 0.5-1 ΜΩ when filled with 3 M KC1. The
external recording solution contained (in mM) 100 NaCl, 5 HEPES, 1 MgCL and 1.8 CaCL, pH = 7.6 with NaOH. All experiments were performed at room temperature (-22 °C). Data analysis was performed using ClampfitlO (Molecular Devices), and Origin 8 (OriginLab).
[0126] Calcium imaging of hippocampal neurons.
[0127] Hippocampi were obtained from Sprague Dawley rat embryos at embryonic day 18. Cells were plated over coverslips coated with Laminin (Life Technologies) and poly-D-Lysine (Sigma- Aldrich). Astrocyte beds were prepared at a density of 80,000 cells/ml and cultured in DMEM (Life Technologies) with 10% Fetal Bovine Serum, 6 mM glutamine in 5% CC at 37 °C. Neurons were plated over 14 days in vitro confluent astrocyte beds at a density of 150,000 cells/ml and cultured for 3 weeks in Neurobasal supplemented with B27 and 2 mM glutamax. Neurons were incubated with 2 μηι Fluo-4 AM (Life Technologies) for 15 minutes. The images were obtained with an Olympus BX51WI microscope and a Lambda DG-4 wavelength switcher (Sutter Instruments) at 2 Hz. The recording chamber was perfused at 2 ml/min at 32 °C with ACSF. Calcium spikes were analyzed with MiniAnalysis (Synaptosoft). Statistical analysis was performed using GraphPad PRISM®. Data was analyzed with paired Student's test.
EXAMPLE 1
[0128] Identification of MmTXl and MmTX2 in coral snake venom.
[0129] When using competitive binding assays on the Torpedo electric organ to search for novel a- neurotoxins active on nAChRs, we identified a major but inactive venom fraction from the Costa Rican coral snake Micrurus mipartitus. However,
intracerebroventricular injection of this fraction into mice (LD5o=0.002mg/kg) resulted in periods of reduced basal activity followed by bursts of intense seizures. Intrigued by this observation, we purified this fraction and identified two components (data not shown).
Automated Edman sequencing combined with mass spectrometry revealed two amino acid sequences of 64 residues containing 10 cysteine residues each (Fig. 1A). Both peptides differ in one amino acid at position 33 with either an arginine (MmTXl, 7205.0 Da) or a histidine (MmTX2, 7186.0 Da).
[0130] A BLAST search revealed that MmTXl and MmTX2 are novel members of the PATE-SLURP l-LYNXl-Ly-6/neurotoxin-like family. When combining the BLAST output
with PHYLIP, we find a phylogeny pattern that classifies all homologous toxins into five clades (data not shown). Remarkably, the first clade consists exclusively of toxins found in Micrurus species, with MmTXl and MmTX2 having the highest sequence identity. The availability of numerous three-finger snake toxin structures allowed us to reliably model MmTXl using MODELLER. The program selected γ-bungarotoxin (PDB: 1MR6) and candoxin (PDB: 1 JGK) as templates with a good ModPipe quality score of 1.5674 (data not shown). As expected, the predicted tertiary structure of MmTXl fits within the three- fingered snake toxin family with one of the five disulfide bridges located within the first loop-finger. As such, MmTXl can be classified as a member of the Elapid weak-toxin subgroup of which the biological activity has not yet been defined. Therefore, it is possible that other toxins within this subgroup interact with the same molecular target as MmTXl. When comparing MmTXl to a-neurotoxins that specifically target nAChRs, substantial amino acid differences within the first loop are evident. However, the polar arginine (MmTXl) or histidine (MmTX2) at position 33 at the apex of the second loop is conserved. As can be seen in the crystal structure of a-cobratoxin in complex with AChBP, a structural and functional surrogate of the nAChR ligand-binding domain, the polar residue in this location comes in close contact with the receptor and may be vital for toxin activity.
EXAMPLE 2
[0131] Production of MmTXl and MmTX2.
[0132] Micrurus mipartitus is a rare Costa Rican snake species which delivers small quantities of venom. Therefore, we developed a periplasmic expression system with the goal of producing large amounts of recombinant (r)MmTXl and rMmTX2. The in vivo activity of rMmTXl and rMmTX2 was assayed using microinjections into mouse brain and resulted in a median lethal dose (LD50) of 0.027 mg/kg and 0.010 mg/kg, respectively (n = 9), a result that corresponds to that of the native fraction (LD50 = 0.002 mg/kg). Moreover, similar behavioral signs including reduced activity combined with severe seizures were noted. In contrast, rMmTXl and rMmTX2 are inactive when injected intravenously into mice at doses up to 1 mg/kg. This phenotype is markedly different from that observed when assaying a-neurotoxins which target nAChRs to produce a flaccid paralysis. As such, these results suggest that MmTXl and MmTX2 may target GABAA receptors expressed in the CNS.
[0133] In addition to establishing a recombinant expression system, we synthesized (s)MmTXl using a Fmoc strategy. Correct folding of the five disulfide bridges was achieved by using controlled redox buffering (see above: Purification and production of MmTXl and MmTX2). To verify proper toxin function, we injected sMmTXl into mouse brain and found: 1) an LD50 value similar to that of rMmTXl (0.013 mg/kg); and 2) an identical mouse behavioral phenotype. These results indicate that native, recombinant, and synthetic MmTXl/2 are equally effective in influencing their target. Next, we tested whether these toxins bind to receptors expressed in rat brain synaptic plasma membranes (SPMs).
EXAMPLE 3
[0134] Binding of rMmTXl and rMmTX2 to rat brain synaptic plasma membranes.
[0135] To assess the activity of rMmTXl and rMmTX2 in SPMs, we performed competitive binding experiments between 125I-rMmTX2 and wild-type (WT) MmTx2, rMmTxl , and rMmTx2 (Fig. 1). The equilibrium inhibition constant (Ki) of WT MmTX2 (Ki = 0.8 nM; log K = -9.09 ± 0.07) is comparable to that found for rMmTXl (K = 3.0 nM; log K = -8.52 ± 0.10) and rMmTX2 (Ki = 3.7 nM; log K = -8.44 ± 0.1 1). Moreover, no difference in Ki is observed between rMmTXl and rMmTX2. Since the arginine found in the tip of the central loop helps determine three-finger a-neurotoxin toxin activity towards nAChRs, we examined whether this amino acid position also contributes to the biological activity of rMmTx2. To this end, we mutated the endogenous histidine to the smaller polar residue serine (rMmTx2Ser33) and measured competitive binding with 125I-rMmTX2. As a result, we found that this mutation ablates rMmTx2 function suggesting that the amino acid at this position is indeed vital for rMmTx2 activity (Fig. IB).
[0136] Next, we investigated the binding rate of 125I-rMmTX2 to SPMs using
concentrations ranging from 1 to 4 nM (Fig. 2A) and fitting the data by a single exponential association curve. Plotting each observed kinetic constant against the respective 125I- rMmTx2 concentration yields a second-order kinetic constant of association (k+i) of 3.7 ± 0.5 x 106 M 1 s"1 (Fig. 2B). The dissociation process of 125I-rMmTX2 bound to SPMs was determined after the addition of a 1000-fold excess of unlabeled rMmTX2 (Fig. 2C). Fitting the data with a single exponential decay curve results in a first-order kinetic constant (k-i) of 0.0014 ± 0.0004 s_1 and a half time duration of ~8 minutes. From the ratio of both kinetic constants, we can deduce a true dissociation value (Kd = k-i/k+i) of 0.38 ± 0.05 nM. Finally,
we conducted a SPM saturation binding experiment at equilibrium using 125I-rMmTX2 concentrations up to 6 nM. Non-specific binding was determined in the presence of a 1000- fold excess of unlabeled rMmTX2 and subtracted to obtain specific binding data (Fig. 2D). The results of this experiment indicate the presence of a single class of non-interacting binding sites with a Kd of 0.51 ± 0.09 nM and a maximum capacity Bmax of 264 ± 14 fmol/mg of synaptic protein.
EXAMPLE 4
[0137] Binding of rMmTX2 to GABAA receptors in SPMs.
[0138] To identify the primary target of rMmTx2 in SPMs, we carried out competitive binding experiments with a subset of non-peptidic and peptidic modulators of nAChRs, muscarinic (m)AChRs, GABAA receptors, GlyRs, glutamate receptors (GluRs), and acetylcholinesterase (AChE). Given its close structural relation to members of the three- finger a-neurotoxin family that bind to nAChRs, we initially investigated whether rMmTx2 competes with short- and long-chain snake a-neurotoxins (Nmm I and a-bungarotoxin) as well as marine snail a-conotoxins (Ml and IM 1) and a plant toxin (d-tubocurarine;) that target this particular receptor (Fig. 3A). Strikingly, no competition is observed suggesting that nAChRs are not the primary target of rMmTX2. In concert, we observe no flaccid paralysis when injecting rMmTX2 intravenously into mice. Similarly, rMmTX2 does not compete with atropine, glycine, glutamate, and Fas 2 that target mAChRs, GlyRs, GluRs, and AChE, respectively. Finally, rMmTX2 does not displace cardiotoxin (CTX), a cytotoxic membrane-targeting peptide that also belongs to the three-finger α-neurotoxin structural family (Fig. 3A).
[0139] We next examined whether 125I-MmTX2 targets GABAA receptors in SPMs by conducting competitive binding experiments with receptor agonists, antagonists, as well as allosteric modulators (Fig. 3B). As a result, we found that the competitive GABAA receptor antagonist gabazine is the most effective in reducing 125I-MmTX2 binding to SPMs (EC50 = 0.2 μΜ; log EC50 = -6.81 ± 0.03; nH = 1.00 ± 0.07). In addition, the agonists GABA (EC50 = 2.7 μΜ; log EC50 = -5.56 ± 0.08; nH = 0.99 ± 0.18) and muscimol (EC50 = 2.1 μΜ; log EC50 = -5.67 ± 0.09; nH = 1.08 ± 0.24) reduce toxin binding to a similar extent. Moreover, the positive allosteric modulators diazepam (EC50 = 4.9 μΜ; log EC50 = -5.30 ± 0.04; nH = -0.96 ± 0.07) and pentobarbital (EC50 = 4.8 μΜ; log EC50 = -5.32 ± 0.03; nH = 0.98 ± 0.07) are
equally potent in displacing 125I-MmTX2. In contrast, the partial agonist isoguvacine (EC50 = 275 μΜ; log EC50 =-3.56 ± 0.10; nH = 1.02 ± 0.29) is the least efficient in reducing 125I- MmTX2 binding.
[0140] Surprisingly, the non-competitive channel blocker PTX (EC50 = 3.7 μΜ; log EC50 = -5.43 ± 0.07; = +1.05 ± 1.16) markedly potentiates 125I-MmTX2 binding capacity to SPMs. To distinguish between an effect of PTX on 125I-MmTX2 binding affinity and binding site capacity, we repeated a binding experiment at equilibrium in the presence of a saturating PTX concentration (1 mM) (Fig. 3C). By comparing binding isotherm constants, we find that PTX potentiates 125I-MmTX2 binding capacity without effecting toxin affinity (Kd with PTX = 0.76 ± 0.18 nM, Bmax = 532 ± 33 fmol/mg of SPM protein giving a ratio with/without PTX of 2.01). Finally, we considered if rMmTXl has an effect on [ H]muscimol binding to SPMs. Since GABAA receptors possess a high- and low-affinity muscimol binding site, we conducted this experiment at saturating concentrations (40 nM). Using a nonlinear fit for an allosteric modulator, we found that rMmTXl is able to compete with [ H]muscimol with a Kd of 4.9 ± 0.2 nM and only for about 40% of the total [ H]muscimol binding capacity (Fig. 4) suggesting that rMmTXl may only influence one muscimol binding site. Altogether, our results indicate that rMmTX2, and by extension rMmTXl, preferentially targets GABAA receptors with high affinity. Moreover, a variety of allosteric and orthosteric compounds compete with toxin binding whereas the pore-blocking molecule PTX doubles toxin binding capacity. Next, we explored toxin activity on mouse hippocampal neurons that express
GABAA receptors. Since rMmTXl, rMmTX2, and sMmTXl have comparable effects in our mouse and binding assays, we consider both toxins as well as their synthesis route to be interchangeable.
EXAMPLE 5
[0141] MmTXl influences GABAA receptor-mediated currents in hippocampal neurons.
[0142] To test the biological activity of rMmTXl on mouse brain hippocampal neurons, we first applied 100 nM in the absence of an agonist and observed no effect on GABAA receptors. In contrast, we see a potentiating effect of the toxin in the presence of 5 μΜ muscimol: rMmTXl increases the amplitude of the GABAA receptor-mediated current elicited by 5 μΜ muscimol in a dose-dependent manner (Fig. 5, Table 2). In the absence of rMmTXl, 0.1 μΜ muscimol fails to elicit a detectable current (5 out of 7 neurons).
However, we observe a CI" current of 228 ± 30 pA when 0.1 μΜ muscimol is applied together with 100 nM rMmTXl . In 3 of 7 neurons, 0.3 μΜ muscimol induces no response, whereas application of 0.3 μΜ muscimol together with 100 nM rMmTXl generates a large inward current (439 ± 51pA). In the remaining 4 out of 7 neurons, 0.3 μΜ muscimol induces a small inward current which is strongly potentiated by simultaneous application of 100 nM rMmTXl . In contrast to the potentiating effect of rMmTXl in the lower range of muscimol concentrations, we do not observe a toxin-induced potentiation at muscimol concentrations greater than 10 μΜ. Upon determining the concentration-dependence of GABAA receptor currents by muscimol alone, we find an EC50 of 4.1 μΜ and an Ϊ\Η coefficient of 1.4, which is in good agreement with reported values for GABAA receptors (5.4-24 μΜ and Ϊ\Η between 1.1 and 1.6). When surveying all muscimol concentrations tested without and in the presence of 100 nM rMmTXl, it is clear that the toxin causes GABAA receptor-mediated currents to increase up to 7-fold at low agonist concentrations whereas saturating muscimol quantities suppress toxin effects.
[0143] Table 3 summarizes the factors by which the current amplitudes are potentiated by 100 nM rMmTXl in dependence of the muscimol concentration. From these data the rMmTXl -induced portion of the current amplitude was determined and plotted versus muscimol concentration which reveals that the half-maximal potentiating effect of rMmTXl is obtained at about 1 μΜ muscimol. Altogether, our data suggest that rMmTXl potentiates GABAA receptor activation in a non-saturating concentration range of muscimol. However, an increase in inward CI" currents explains the initial rest behavior observed in mice upon toxin injection into the brain whereas the ensuing seizures resemble those observed when inhibiting GABAA receptors with PTX. To further investigate the mechanism underlying MmTXl/2 action, we tested the toxins on common GABAA receptor variants expressed in heterologous systems.
[0144] TABLE 2: Potentiation of GABAA receptor currents elicited by 5 μΜ muscimol together with increasing rMmTXl concentrations.
5 μΜ muscimol 5 μΜ muscimol 5 μΜ muscimol 5 μΜ muscimol + 1 nM rMmTXl + 10 nM rMmTXl + 100 nM rMmTXl + 300 nM rMmTXl
1.24 ± 0.07 1.22 ± 0.03 1.99 ± 0.28 1.69 ± 0.25
The factor by which the amplitudes of the GABAA currents were increased was obtained by dividing the current amplitudes elicited by 5 μΜ muscimol + rMmTXl by the control current amplitudes; mean ± SEM; n=9. p-values for 1, 10, 100, and 300 nM are 0.0077, 0.00058, 0.011, and 0.027 respectively.
[0145] TABLE 3: Potentiation of GABAA receptor currents elicited by increasing concentrations of muscimol in the presence of 100 nM rMmTXl.
Values shown are mean ± SEM.
EXAMPLE 6
[0146] sMmTXl modulates heterologously expressed GABAA receptors.
[0147] To explore the working mechanism of sMmTXl, we first assessed the effect of the toxin on HEK 293 cells transiently expressing the α1β2γ2 GABAA receptor which is abundantly found in the hippocampus. When applying 0.3 μΜ muscimol in the presence of 100 nM sMmTXl, we observe an increase in the current of α1β2γ2 receptors by a factor of 2.7 ± 0.18 (n = 5). Similar to hippocampal neurons, the current elicited by 50 μΜ muscimol is not significantly altered by the toxin and as such, the potentiating effect of sMmTXl is dependent on muscimol concentration. Increasing concentrations of sMmTXl potentiate the GABAA receptor-mediated current amplitudes elicited by 3 μΜ muscimol by a similar degree: at 10 nM toxin the current increases by a factor of 1.28 ± 0.12, at 100 nM by 1.33 ± 0.13, and at 300 nM by 1.60 ± 0.11. In addition, we also observe a speeding up of receptor desensitization (Fig. 6A). This trend is also visible when 100 nM rMmTXl is
applied to cultured hippocampal neurons in the presence of 0.3 μΜ muscimol (Fig. 5B). To examine this phenomenon further, we next expressed the α1β2γ2 GABAA receptor in Xenopus oocytes and assessed receptor desensitization during 30s toxin applications. Taking into account the complex gating mechanisms of rapidly activating GABAA receptors upon agonist application and our relatively slow gravity -fed perfusion system, we did not expect to see a toxin- induced effect on CI- influx. However, 30s toxin applications may still reveal alterations in receptor desensitization which occur at a slower rate when compared to receptor activation. Therefore, we set up a protocol consisting of two 30s test applications of 5 μΜ muscimol separated by a 3 minute wash out period. Only when both pulses generated comparable receptor activation, did we proceed with 100 nM sMmTXl application in concert with 5 μΜ muscimol. Under control conditions, α1 β2γ2 GABAA receptors desensitize slowly in oocytes (single exponential fit yields a time constant (x) of 48 ± 5s; n = 3); however, we observe a substantial increase in receptor desensitization in the presence of ΙΟΟηΜ sMmTXl (x = 25 ± 3s; n = 3). As is typical with snake neurotoxins, sMmTXl washout is very slow and after three minutes, only a fraction of the receptors can be activated again, an observation that fits well with our binding studies (Fig. 2C). When lowering the muscimol concentration to 0.3 μΜ, we observed a similar effect of 100 nM sMmTXl on receptor desensitization (Fig. 6D). Interestingly, this outcome is also achieved when expressing only the ai 2-containing receptor in oocytes (Fig. 6E), suggesting that in contrast to benzodiazepines, the j2 subunit is not required for sMmTXl efficacy. Moreover, experiments with other subunit compositions (α2β3γ2, α3β2γ2, α5β3γ2, and α1β3) expressed in oocytes suggest an important role for the al subunit in determining GABAA receptor susceptibility to sMmTXl (Fig. 8). As such, a tagged toxin variant may be valuable in identifying al -containing GABAA receptors in heterologous expression systems or tissues. However, future experiments will have to determine whether the al subunit is equally important for toxin binding in complex systems since context-dependent variations in pharmacological sensitivity of Cys-loop receptors have been documented.
[0148] Altogether, our results with heterologously expressed GABAA receptors suggest that MmTXl initially increases CI" influx leading to membrane hyperpolarization.
Hereafter, receptor desensitization is promoted which results in a substantial decrease of functioning GABAA receptors. Next, we next determined the effect of sMmTXl on a neuronal network.
EXAMPLE 7
[0149] sMmTXl influences spontaneous hippocampal neuron activity.
[0150] To assess the influence of sMmTXl on the activity of a neuronal network, we monitored Ca2+ oscillations of hippocampal neurons in culture without and in the presence of toxin. Taking into account the GABAA receptor developmental switch from excitatory to inhibitory, we used cells that were kept in culture for 3 weeks. As such, the transition to inhibitory function should be completed. Cells were incubated in Fluo-4 AM and then subjected to fluorescent time-lapse imaging to measure Ca2+ oscillations. Separate applications of 0.3 μΜ muscimol or 100 nM sMmTXl have no apparent effect on the frequency of Ca2+ spikes (Figures 7A, B, D) as compared to cells perfused with extracellular saline solution (98.0 ± 4.8%, n = 9 and 105.8 ± 4.0%, n = 9, respectively). However, co- application of 0.3 μΜ muscimol and 100 nM sMmTXl produces a short but substantial inhibition of Ca2+ oscillations, thereby supporting the observation of GABAA receptor activation which in turn inhibits network activity. Remarkably, this inhibitory period is followed by a large increase in the frequency of Ca2+ oscillations (171.7 ± 8.4%, n = 25 pO.0001) (Figures 7C, D).
[0151] Altogether, these results corroborate the hypothesis that sMmTXl activates and then desensitizes GABAA receptors as evidenced by a decrease followed by an increase in network activity. To further investigate the influence of sMmTXl on network activity effect, we recorded spontaneous electrophysiological activity in hippocampal neurons. GABAA receptor activation should translate into a decrease in network activity while
desensitization should produce an increase in excitability. Cells treated with sMmTXl show a substantial increase in the frequency of action potentials firing (Fig. 7F; n = 5).
Interestingly, most of these events occur in bursts which resemble epileptiform activity. Similarly, spontaneous presynaptic release events assessed by voltage-clamp recordings (Fig. 7E; n = 5) show a considerable increase in the duration of burst-like postsynaptic currents as compared to mostly single spontaneous events under control conditions. Moreover, each burst is followed by a silence period, as can be clearly seen by an increase in the time between firing (Figure 7E).
[0152] Finally, we examined how these observations compare to the effect of the pore- blocking PTX compound at 100 μΜ, a commonly used concentration. Although PTX also produces burst-like currents under voltage-clamp recordings (Fig. 7G), the action potential
frequency increases more dramatically when compared to sMmTXl . Moreover, these events present themselves as single action potentials or bursts with a much longer duration and a shorter silence interval (Figure 7G). Altogether, these data support the hypothesis that sMmTXl acts as an allosteric modulator of GABAA receptors and explain the intermittent seizures observed in animals upon toxin injection into the brain.
EXAMPLE 8
[0153] Electrophysiological recording from Xenopus oocytes.
[0154] Each rat GABAA receptor subunit as well as the α1ΕΚβ2γ2 mutant was expressed in Xenopus oocytes from which the vitellin membrane was removed manually. The DNA sequence of all constructs was confirmed by automated DNA sequencing before further usage. cRNA was synthesized using T7 polymerase (Life Technologies) after linearizing the DNA with appropriate restriction enzymes. Channels were expressed in oocytes and currents were studied following 1-2 days incubation after cRNA injection (incubated at 17 °C in 96 mM NaCl, 2 mM KC1, 5 mM HEPES, 1 mM MgCh and 1.8 mM CaCh, 50 g ml gentamycin, pH 7.6 with NaOH) using two-electrode voltage-clamp recording techniques (OC-725C, Warner Instruments) with a 150 μΐ recording chamber. Heterologous GABAA receptor manipulations were achieved using previously reported procedures. Microelectrode resistances were 0.5-1 ΜΩ when filled with 3M KC1. The external recording solution contained (in mM) 100 NaCl, 5 HEPES, 1 MgCh and 1.8 CaCh, pH 7.6 with NaOH. All experiments were performed at room temperature (-22 °C). Off-line data analysis and statistics were performed using ClampfitlO (Molecular Devices), Excel (Microsoft Office) and Origin 8 (OriginLab).
EXAMPLE 9
[0155] Calcium imaging of hippocampal neurons.
[0156] Hippocampi were obtained from Sprague Dawley rat embryos at embryonic day 18, treated with papain (Worthington Biochemical) and dissociated with a pipette. Cells were plated over coverslips coated with Laminin (Life Technologies) and poly-D-Lysine (Sigma- Aldrich). Astrocyte beds were prepared at a density of 80,000 cells/ml, and cultured in
DMEM (Life Technologies) with 10% Fetal Bovine Serum, 6mM glutamine in 5% CC at 37 °C. Neurons were plated over 14 days in vitro confluent astrocyte beds at a density of 150,000 cells/ml, and cultured for 3 weeks in Neurobasal supplemented with B27 and 2 mM glutamax. Neurons were incubated with 2 μΜ Fluo-4 AM (Life Technologies) for 15 minutes. The images were obtained with an Olympus BX51WI microscope equipped with a 40x immersion lens and a Lambda DG-4 ultra-high speed wavelength switcher (Sutter Instruments) using a CCD camera (Hamamatsu) at 2 Hz. The recording chamber was perfused at 2 ml/min at 32 °C with ACSF (Artificial Cerebrospinal Fluid) containing (in mM): 140 NaCl, 5 KCl, 2 CaCh, 2 MgCh, 10 HEPES, and 10 Glucose (pH 7.3 adjusted with NaOH). Muscimol and sMmTXl were prepared fresh in recording buffer at 300 nM and 100 nM respectively. Calcium spikes were analyzed with MiniAnalysis (Synaptosoft). Values were expressed as percentage variation on the average frequency of calcium spikes of treated versus control neurons. Data are presented as mean ± SEM. Statistical analysis was performed using GraphPad PRISM®. Data was analyzed with paired Student's test.
EXAMPLE 10
[0157] Creation of sMmTXl -HRK mutant.
[0158] In order to introduce only one reactive primary amine (R-NH2) per molecule, sMmTXl was mutated at 4His, 28Arg, and 47Lys, as well as acetylated at the N-terminus primary amine. Therein, the two Lys residues of sMmTXl are mutated into 4His, 28Arg and 47 Ala is mutated into 47Lys in order to add a single primary amine, which reacts with the Alexa488 TFP (tetrafiuorophenyl) ester, an improvement over the succinimidyl ester (SE or NHS-ester) chemistry typically used to attach fiuorophores to the primary amines of biomolecules (the acetylated N-terminus prevents reaction with the primary amine at the N- terminus). The sMmTXl-HRK mutant was chemically synthesized using standard solid phase peptide synthesis methodology and Fmoc chemistry. The 5-disulfide bridges were allowed to fold in a 100 mM Tris-HCl buffer, 1 mM EDTA, pH 9.0, adding a combination of GSSG/GSH in a 1 mM/2 mM ratio and sMmTXl at a concentration of 20 μΜ.
Purification and desalting were achieved by ionic exchange chromatography and C18 HPLC. Typically, the labeling reaction was achieved mixing 20 nmol of sMmTXl-HRK (146 μg) in 20 μΐ of 100 mM bicarbonate buffer at pH 8.0 with 100 μg in 10 μΐ of DMSO of Alexa488 TFP ester for 1 hour. Desalting and purification of the final product was achieving by CI 8
HPLC (Figure 12). The identity of the final product was checked by mass spectrometry (Alexa-labeled sMmTXIHRK 7857.48 Da; the observed mass difference with sMmTXl is 517.28 Da and the expected one is 517.23 Da).
[0159] Two 30-s test applications of 100 nM muscimol separated by a 3-minute washout period, followed by 100 nM sMmTXl-HRK-conjugated to Alexa488 application together with 100 nM muscimol was performed. Figure 13 depicts the effect of the sMmTXl-HRK mutant, sMmTXl-HRK-conjugated to Alexa488, and sMmTXl-HRK unlabeled HPLC fraction on α1β2γ2 GABAA receptor currents. As seen in the top figure, a muscimol concentration of 100 nM activates α1β2γ2 GABAA receptors expressed in Xenopus oocytes held at a membrane voltage of -70 mV. When co-applying 100 nM sMmTXl-HRK, currents are potentiated and receptor desensitization tends to accelerate (red trace). Toxin washout is shown on the right (in green). In the presence of 300 nM muscimol (trace below), the toxin potentiating effect is diminished whereas desensitization effect is unaltered. Expression of the α1β2γ2 receptor in Xenopus oocytes held at a membrane voltage of -70 mV (Middle). The effect of the conjugated toxin on the receptor is reduced but toxin still binds to the receptor (see Fig. 14). In the bottom figure, the same protocol as above is used, but with sMmTXl-HRK unlabeled HPLC fraction on α1β2γ2 GABAA receptor currents (see Fig. 12). A representative example of four recordings is shown for all traces.
EXAMPLE 11
[0160] sMmTXl -HRK conjugated to Alexa488 binding to GABAA receptors in hippocampal cells.
[0161] sMmTXl-HRK conjugated to Alexa488 was incubated for 45 minutes in culture media together with mouse hippocampal cells (E12 DIV - immature cells). The top figure (Fig. 14) shows neurons under white light whereas the bottom figure shows the same picture under blue light, thereby exciting the Alexa488 fiuorophore. Toxin binding to GABAA receptors can be clearly seen as puncta along immature dendrites.
[0162] All references, including publications, patent applications, and patents, cited herein are hereby incorporated by reference to the same extent as if each reference were individually and specifically indicated to be incorporated by reference and were set forth in its entirety herein.
[0163] The use of the terms "a" and "an" and "the" and similar referents in the context of describing the invention (especially in the context of the following claims) are to be construed to cover both the singular and the plural, unless otherwise indicated herein or clearly contradicted by context. The terms "comprising," "having," "including," and "containing" are to be construed as open-ended terms (i.e., meaning "including, but not limited to,") unless otherwise noted. Recitation of ranges of values herein are merely intended to serve as a shorthand method of referring individually to each separate value falling within the range, unless otherwise indicated herein, and each separate value is incorporated into the specification as if it were individually recited herein. All methods described herein can be performed in any suitable order unless otherwise indicated herein or otherwise clearly contradicted by context. The use of any and all examples, or exemplary language (e.g., "such as") provided herein, is intended merely to better illuminate the invention and does not pose a limitation on the scope of the invention unless otherwise claimed. No language in the specification should be construed as indicating any non-claimed element as essential to the practice of the invention.
[0164] Preferred embodiments of this invention are described herein, including the best mode known to the inventors for carrying out the invention. Variations of those preferred embodiments may become apparent to those of ordinary skill in the art upon reading the foregoing description. The inventors expect skilled artisans to employ such variations as appropriate, and the inventors intend for the invention to be practiced otherwise than as specifically described herein. Accordingly, this invention includes all modifications and equivalents of the subject matter recited in the claims appended hereto as permitted by applicable law. Moreover, any combination of the above-described elements in all possible variations thereof is encompassed by the invention unless otherwise indicated herein or otherwise clearly contradicted by context.
Claims
1. A polypeptide having GABAA modulating activity.
2. A polypeptide having GABAA modulating activity comprising the following amino acid sequence:
a)
LTCKTCPFTTCPNSESCPGGQSICYQRKWEEHRGERIERRCVAN CPAFGSHDTSLLCCTRDNCN (SEQ ID NO: 1);
b) a functional fragment of a);
c) a functional homolog of a) or b) or functional fragment thereof; and d) a fusion polypeptide comprising an amino acid sequence of any of a) to c).
3. A polypeptide having GABAA modulating activity comprising the following amino acid sequence:
a)
LTCKTCPFTTCPNSESCPGGQSICYQRKWEEHHGEPJERRCVAN CPAFGSHDTSLLCCTRDNCN (SEQ ID NO: 2);
b) a functional fragment of a);
c) a functional homolog of a) or b) or functional fragment thereof; and d) a fusion polypeptide comprising an amino acid sequence of any of a) to c).
4. A sMmTxl-HRK mutant polypeptide having GABAA modulating activity comprising the following amino acid sequence with an acetyl functional group at the N- terminus (Acl):
a)
(Acl)LTCHTCPFTTCPNSESCPGGQSICYQRRWEEHRGERIERRC VANCPKFGSHDTSLLCCTRDNCN (SEQ ID NO: 21);
b) a functional fragment of a);
c) a functional homolog of a) or b) or functional fragment thereof; and d) a fusion polypeptide comprising an amino acid sequence of any of a) to c).
5. A polypeptide having GABAA modulating activity comprising the following amino acid sequence:
a) Xaa Xaa Cys Lys Thr Cys Pro Phe Thr Thr Cys Pro Asn Ser Glu Ser Cys
Xaa Xaa Xaa Xaa Xaa Xaa Cys Tyr Gin Arg Lys Trp Glu Glu His Arg Gly Glu Arg He Glu Arg Arg Cys Xaa Xaa Xaa Cys Pro Ala Phe Gly Ser His Asp Thr Ser Xaa Xaa Cys Cys Thr Arg Asp Asn Cys Asn (SEQ ID NO: 6);
b) a functional fragment of a);
c) a functional homolog of a) or b) or functional fragment thereof; and d) a fusion polypeptide comprising an amino acid sequence of any of a) to c).
6. A polypeptide having GABAA modulating activity comprising the following amino acid sequence:
a) Xaa Xaa Cys Lys Thr Cys Pro Phe Thr Thr Cys Pro Asn Ser Glu Ser Cys
Xaa Xaa Xaa Xaa Xaa Xaa Cys Tyr Gin Arg Lys Trp Glu Glu His His Gly Glu Arg He Glu Arg Arg Cys Xaa Xaa Xaa Cys Pro Ala Phe Gly Ser His Asp Thr Ser Xaa Xaa Cys Cys Thr Arg Asp Asn Cys Asn (SEQ ID NO: 7);
b) a functional fragment of a);
c) a functional homolog of a) or b) or functional fragment thereof; and d) a fusion polypeptide comprising an amino acid sequence of any of a) to c).
7. A polypeptide having GABAA modulating activity comprising the following amino acid sequence:
a) Leu Thr Cys Lys Thr Cys Pro Phe Thr Thr Cys Pro Asn Ser Glu Ser Cys
Pro Gly Gly Gin Ser He Cys Tyr Gin Arg Lys Trp Glu Glu His Arg Gly Glu Arg He Glu Arg Arg Cys Val Ala Asn Cys Pro Ala Phe Gly Ser His Asp Thr Leu Leu Cys Cys Thr Arg Asp Asn Cys Asn (SEQ ID NO: 8);
b) a functional fragment of a);
c) a functional homolog of a) or b) or functional fragment thereof; and d) a fusion polypeptide comprising an amino acid sequence of any of a) to c).
8. A polypeptide having GABAA modulating activity comprising the following amino acid sequence:
a) Met Lys Cys Leu He Cys Pro Phe Thr Thr Cys Ser Gin Ser Glu Ser Cys Pro
Gly Gly Gin Ser He Cys Phe Gin Arg Lys Phe Asp Asp Arg His Gly Asp Arg He Glu Arg Gly Cys Ala Val Thr Cys Pro Pro Phe Gly Ser His Asp Thr He Phe Cys Cys Ser Thr Asn Asp Cys Asn (SEQ ID NO:
9) ;
b) a functional fragment of a);
c) a functional homolog of a) or b) or functional fragment thereof; and d) a fusion polypeptide comprising an amino acid sequence of any of a) to c).
9. A polypeptide having GABAA modulating activity comprising the following amino acid sequence:
a) He Glu Cys His Asn Cys Pro Phe Thr Thr Cys Gly Asn Ser Glu Ser Cys Pro
Gly Gly Gin Ser He Cys Val Gin Arg Lys Leu Glu Glu Lys Lys Gly Glu Arg He Glu Arg Ser Cys Thr Asp Gly Cys Pro Gly Phe Gly Ser His Asp Thr Val Glu Cys Cys Arg He Ala Arg Cys Asn (SEQ ID NO:
10) ;
b) a functional fragment of a);
c) a functional homolog of a) or b) or functional fragment thereof; and d) a fusion polypeptide comprising an amino acid sequence of any of a) to c).
10. A polypeptide having GABAA modulating activity comprising the following amino acid sequence:
a) Arg Gin Cys Tyr Thr Cys Pro Phe Thr Thr Cys His Asn Ser Glu Ser Cys
Pro Gly Gly Gin Ser He Cys Tyr Gin Arg Lys Tyr Glu Glu His Arg Gly Glu Arg He Glu Arg Lys Cys Ser Leu Ser Cys Pro Ser Phe Gly Ser His Asp Thr Leu Leu Cys Cys Ala Arg Pro Lys Cys Asn (SEQ ID NO:
11) ;
b) a functional fragment of a);
c) a functional homolog of a) or b) or functional fragment thereof; and d) a fusion polypeptide comprising an amino acid sequence of any of a) to c).
11. A polypeptide having GABAA modulating activity comprising the following amino acid sequence:
a) Phe Arg Cys Phe Arg Cys Pro Phe Thr Thr Cys Asn Asn Ser Glu Ser Cys
Pro Gly Gly Gin Ser He Cys Tyr Gin Arg Lys Trp Glu Glu His Arg Gly Glu Arg He Glu Arg Arg Cys Val Ala Asn Cys Pro Ala Phe Gly Ser His Asp Thr Leu Leu Cys Cys Lys Arg Glu Glu Cys Asn (SEQ ID NO: 12);
b) a functional fragment of a);
c) a functional homolog of a) or b) or functional fragment thereof; and d) a fusion polypeptide comprising an amino acid sequence of any of a) to c).
12. A polypeptide having GABAA modulating activity comprising the following amino acid sequence:
a) Leu Ser Cys Asn Thr Cys Pro Phe Thr Thr Cys Gin Asn Ser Glu Ser Cys
Pro Gly Gly Gin Ser He Cys Tyr Gin Arg Lys Trp Glu Glu His Arg Gly Glu Arg He Glu Arg Arg Cys Val Ala Asn Cys Pro Ala Phe Gly Ser His Asp Thr Leu Leu Cys Cys Thr Arg Asp Asn Cys Asn (SEQ ID NO: 13);
b) a functional fragment of a);
c) a functional homolog of a) or b) or functional fragment thereof; and d) a fusion polypeptide comprising an amino acid sequence of any of a) to c).
13. A polypeptide having GABAA modulating activity comprising the following amino acid sequence:
a) Leu Leu Cys Lys Thr Cys Pro Phe Thr Thr Cys Pro Asn Ser Glu Ser Cys
Pro Gly Gly Gin Ser He Cys Tyr Gin Arg Lys Trp Glu Glu His Arg Gly Glu Arg He Glu Arg Arg Cys Val Ala Asn Cys Pro Ala Phe Gly Ser His Asp Thr Leu Leu Cys Cys Thr Arg Asp Asn Cys Asn (SEQ ID NO: 14);
b) a functional fragment of a);
c) a functional homolog of a) or b) or functional fragment thereof; and d) a fusion polypeptide comprising an amino acid sequence of any of a) to c).
14. A nucleic acid sequence encoding any of the polypeptides having GABAA modulating activity or derivatives, homologues, analogues or mimetics thereof of any of claims 1 to 13.
15. A vector comprising one or more nucleic acid sequences encoding any of the polypeptides having GABAA modulating activity or derivatives, homologues, analogues or mimetics thereof of any of claims 1 to 13.
16. A composition comprising one or more polypeptides having GABAA modulating activity of any of claims 1 to 13, and at least one or more biologically active agents.
17. A composition comprising one or more polypeptides having GABAA modulating activity of any of claims 1 to 13, and at least one or more imaging agents.
18. Use of the polypeptides of any of claims 1 to 13, for modulating GABAA receptors in a cell or population of cells expressing the GABAA receptor comprising contacting the cell or population of cells with an effective amount of the polypeptides of any of claims 1 to 13.
19. Use of the polypeptides of any of claims 1 to 13, for modulating GABAA receptors in a subject suffering from a neurological disorder, comprising administering to the subject, an effective amount of a composition comprising one or more polypeptides of claims 1 to 13, and at least one or more biologically active agents.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US15/544,030 US20180009859A1 (en) | 2015-01-15 | 2016-01-14 | Pharmacological modulators of gabaa receptors and their use |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201562103669P | 2015-01-15 | 2015-01-15 | |
| US62/103,669 | 2015-01-15 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2016115290A1 true WO2016115290A1 (en) | 2016-07-21 |
Family
ID=56406358
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2016/013318 Ceased WO2016115290A1 (en) | 2015-01-15 | 2016-01-14 | Pharmacological modulators of gabaα receptors and their use |
Country Status (2)
| Country | Link |
|---|---|
| US (1) | US20180009859A1 (en) |
| WO (1) | WO2016115290A1 (en) |
Families Citing this family (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN113845424B (en) * | 2021-10-14 | 2023-09-12 | 南京医科大学 | Right-embedding alcohol ester compound and its pharmaceutical use |
Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2001016596A2 (en) * | 1999-08-31 | 2001-03-08 | Glaxo Group Limited | Screening for modulators of gaba b receptor activity |
| WO2011035192A1 (en) * | 2009-09-21 | 2011-03-24 | The Board Of Trustees Of The Leland Stanford Junior University | Antagonists of gaba-b receptors to enhance neuronal function, learning and memory |
-
2016
- 2016-01-14 WO PCT/US2016/013318 patent/WO2016115290A1/en not_active Ceased
- 2016-01-14 US US15/544,030 patent/US20180009859A1/en not_active Abandoned
Patent Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2001016596A2 (en) * | 1999-08-31 | 2001-03-08 | Glaxo Group Limited | Screening for modulators of gaba b receptor activity |
| WO2011035192A1 (en) * | 2009-09-21 | 2011-03-24 | The Board Of Trustees Of The Leland Stanford Junior University | Antagonists of gaba-b receptors to enhance neuronal function, learning and memory |
Non-Patent Citations (3)
| Title |
|---|
| OSIPOV ET AL.: "Effects of snake venom polypeptides on central nervous system", CENTRAL NERVOUS SYSTEM AGENTS IN MEDICINAL CHEMISTRY, vol. 12, no. 4, 2012, pages 315 - 328 * |
| SIGEL ET AL.: "Structure, function, and modulation of GABA(A) receptors", JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 287, no. 48, 2012, pages 40224 - 40231 * |
| YE ET AL.: "Waglerin-1 modulates y-aminobutyric acid activated current of murine hypothalamic neurons", JOURNAL OF PHARMACOLOGY AND EXPERIMENTAL THERAPEUTICS, vol. 282, no. 1, 1997, pages 74 - 80 * |
Also Published As
| Publication number | Publication date |
|---|---|
| US20180009859A1 (en) | 2018-01-11 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20220016202A1 (en) | Cartilage-homing peptides | |
| Loo et al. | Determining the structure and mechanism of the human multidrug resistance P-glycoprotein using cysteine-scanning mutagenesis and thiol-modification techniques | |
| Wagner et al. | Function and structure of heterodimeric amino acid transporters | |
| JP2023099623A (en) | Cartilage homing peptide conjugates and methods of use thereof | |
| US20230137562A1 (en) | Tau aggregation inhibitors | |
| Benoist et al. | RETRACTED: The Procognitive and Synaptogenic Effects of Angiotensin IV–Derived Peptides Are Dependent on Activation of the Hepatocyte Growth Factor/c-Met System | |
| EP2282728B1 (en) | Modulation of the Vps10p-domain receptors. | |
| JP2003507008A (en) | Regulation of human sodium channels in dorsal root ganglia | |
| KR20140027117A (en) | Water soluble membrane proteins and methods for the preparation and use thereof | |
| WO2017147379A1 (en) | Pharmacological modulators of nav1.1 voltage-gated sodium channels associated with mechanical pain | |
| JP2001522582A (en) | Cellular receptor for HIV-1 VPR essential for G2 / M phase transition of cell cycle | |
| EP2649095A2 (en) | Mimetic peptides derived from collagen type iv and their use for treating angiogenesis- and lymphangiogenesis- dependent diseases | |
| US20200216495A1 (en) | Tau aggregation peptide inhibitors | |
| Zhou et al. | HQL6 serves as a novel P2Y14 receptor antagonist to ameliorate acute gouty arthritis through inhibiting macrophage pyroptosis | |
| Ates et al. | Deficiency in the endocytic adaptor proteins PHETA1/2 impairs renal and craniofacial development | |
| Yang et al. | Design, synthesis, and activity of an α-conotoxin LtIA fluorescent analogue | |
| Trifonov et al. | Structurally simple, readily available peptidomimetic 1-benzyl-5-methyl-4-(n-octylamino) pyrimidin-2 (1 H)-one exhibited efficient cardioprotection in a myocardial ischemia (MI) mouse model | |
| WO2016115290A1 (en) | Pharmacological modulators of gabaα receptors and their use | |
| JP2024512569A (en) | Use of ADNF polypeptides in therapy | |
| Bono et al. | Recent advances in dopamine D3 receptor heterodimers: focus on dopamine D3 and D1 receptor–receptor interaction and striatal function | |
| JP4975444B2 (en) | Drug discovery target protein and target gene, and screening method | |
| Faron-Górecka et al. | Genetic variants in dopamine receptors influence on heterodimerization in the context of antipsychotic drug action | |
| JPWO2007026969A1 (en) | Drug discovery target protein and target gene, and screening method | |
| US20050154190A1 (en) | Screening method | |
| JP2025524355A (en) | Cyclic peptides with high affinity for ubiquitin and methods of using same |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 16737845 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 15544030 Country of ref document: US |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 16737845 Country of ref document: EP Kind code of ref document: A1 |
