WO2016103176A1 - Novel pi3k gamma inhibitor peptide for treatment of respiratory system diseases - Google Patents

Novel pi3k gamma inhibitor peptide for treatment of respiratory system diseases Download PDF

Info

Publication number
WO2016103176A1
WO2016103176A1 PCT/IB2015/059880 IB2015059880W WO2016103176A1 WO 2016103176 A1 WO2016103176 A1 WO 2016103176A1 IB 2015059880 W IB2015059880 W IB 2015059880W WO 2016103176 A1 WO2016103176 A1 WO 2016103176A1
Authority
WO
WIPO (PCT)
Prior art keywords
ρι3κγ
peptide
cftr
fusion peptide
seq
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/IB2015/059880
Other languages
French (fr)
Inventor
Emilio Hirsch
Alessandra GHIGO
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
KITHER BIOTECH Srl
Original Assignee
KITHER BIOTECH Srl
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to BR112017013453-5A priority Critical patent/BR112017013453B1/en
Priority to DK15830858.5T priority patent/DK3236983T3/en
Priority to AU2015370463A priority patent/AU2015370463B2/en
Priority to EP15830858.5A priority patent/EP3236983B1/en
Priority to PL15830858T priority patent/PL3236983T3/en
Priority to ES15830858T priority patent/ES2737227T3/en
Priority to CN201580071130.7A priority patent/CN107406488B/en
Priority to US15/539,339 priority patent/US10421794B2/en
Priority to NZ733017A priority patent/NZ733017B2/en
Application filed by KITHER BIOTECH Srl filed Critical KITHER BIOTECH Srl
Priority to CA2971121A priority patent/CA2971121C/en
Priority to RU2017124487A priority patent/RU2704826C2/en
Publication of WO2016103176A1 publication Critical patent/WO2016103176A1/en
Priority to IL253011A priority patent/IL253011B/en
Anticipated expiration legal-status Critical
Priority to US16/538,987 priority patent/US10730921B2/en
Priority to US16/911,485 priority patent/US11352400B2/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C07K14/4701Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
    • C07K14/4702Regulators; Modulating activity
    • C07K14/4703Inhibitors; Suppressors
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/005Enzyme inhibitors
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00Drugs for disorders of the respiratory system
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/10Transferases (2.)
    • C12N9/12Transferases (2.) transferring phosphorus containing groups, e.g. kinases (2.7)
    • C12N9/1205Phosphotransferases with an alcohol group as acceptor (2.7.1), e.g. protein kinases
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/10Fusion polypeptide containing a localisation/targetting motif containing a tag for extracellular membrane crossing, e.g. TAT or VP22

Definitions

  • the present description relates to a novel peptide inhibitor of ⁇ 3 ⁇ for the treatment of pathologies of the respiratory apparatus.
  • Asthma is a chronic respiratory disease characterized by inflammation, airway hyperresponsiveness (AHR) and mucosal edema, which together lead to episodic bronchoconstriction and obstruction of the airways.
  • AHR airway hyperresponsiveness
  • mucosal edema which together lead to episodic bronchoconstriction and obstruction of the airways.
  • the effectiveness of current anti-asthmatic treatments is unsatisfactory, and asthma remains an unresolved global issue.
  • the tone of the musculature of the airways is determined by a delicate balance between activation of the pro-contractile and pro-relaxation signaling pathways in smooth muscle cells. Contraction is primarily triggered by acetylcholine, the main parasympathetic neurotransmitter in the airways, which activates M3 muscarinic receptors, leading to mobilization of intracellular and extracellular calcium (Ca 2+ ) . Conversely, relaxation of the airways is achieved by catecholamine-mediated activation of ⁇ 2 ⁇ adrenergic receptors ( ⁇ 2 ⁇ ), which promote the production of cyclic AMP (cAMP) and the consequent modulation of key effectors of Ca 2+ homeostasis.
  • ⁇ 2 ⁇ catecholamine-mediated activation of ⁇ 2 ⁇ adrenergic receptors
  • cAMP cyclic AMP
  • agonists of ⁇ 2- ⁇ provide symptomatic relief of bronchospasms in patients with asthma.
  • their effectiveness is limited in time, mainly due to the desensitization of ⁇ 2- ⁇ that occurs after repeated exposure to agonists.
  • PDE4 phosphodiesterase 4
  • identifying new enzymes that regulate cAMP homeostasis, as well as novel strategies for manipulating the ⁇ 2 - ⁇ / ⁇ ? ⁇ signal transduction pathway in smooth muscle cells is desirable for treating respiratory diseases.
  • the same approach could also be used for therapeutic purposes in other pathological contexts, such as cystic fibrosis, where it is necessary to increase the levels of cAMP in the epithelial cells of the airways.
  • cAMP-dependent chloride channel cystic fibrosis transmembrane conductance regulator, CFTR
  • Mutations in the gene that encodes for this protein are the main cause of cystic fibrosis (CF) .
  • deletion of phenylalanine 508 (AF508) constitutes the most common alteration in CF patients and leads to defects in both membrane expression and opening of the channel.
  • AF508 phenylalanine 508
  • CFTR potentiators require high concentrations of intracellular cAMP to be effective. Therefore, drugs that are able to stimulate cAMP levels may constitute novel strategies to increase the effectiveness of currently available treatments, or to directly correct functional defects of CFTR in CF.
  • ⁇ 3 ⁇ phosphoinositide 3-kinase ⁇
  • AKAP anchor protein
  • PKA protein kinase A
  • PI3KY-associated PKA in turn phosphorylates and promotes the activation of the PDEs and the consequent reduction of cAMP downstream of ⁇ 2 ⁇ 3, ultimately limiting the arrhythmogenic release of Ca 2+ (2) .
  • a peptide having the ability to penetrate a cell for use as a medicament, in particular for treating respiratory diseases.
  • a different embodiment of the present invention concerns a product comprising i) a fusion peptide as defined above and ii) a potentiator of the cystic fibrosis transmembrane conductance regulator (CFTR) and/or a corrector of the cystic fibrosis transmembrane conductance regulator (CFTR) , as a combined preparation for sequential, simultaneous or separate use for treating respiratory diseases, preferably cystic fibrosis .
  • CFTR cystic fibrosis transmembrane conductance regulator
  • CFTR cystic fibrosis transmembrane conductance regulator
  • the present description provides in vitro and in vivo experimental evidence of the efficacy of treating pathologies of the respiratory system by means of administering a fusion peptide comprising residues 126- 150 of human ⁇ 3 ⁇ (SEQ ID No.: 1) or its homologs .
  • the fusion peptide of the present description is, in fact, able to inhibit the interaction between PKA and ⁇ 3 ⁇ and to consequently reduce the activity of the PDEs associated with ⁇ 3 ⁇ , increasing cAMP levels and reducing the entry of Ca 2+ through voltage-operated calcium channels (VOCCs) .
  • the fusion peptide described here increases cAMP levels in vivo in the airways and functions as a bronchodilator when administered by an intra-tracheal route to healthy and asthmatic mice.
  • the fusion peptide carries out the function of CFTR potentiator, increasing cAMP and thereby enhancing the conductance to chloride (Cl ⁇ ) of CFTR in bronchial epithelial cell lines expressing wild-type or a AF508 mutant CFTR, which is the most frequent mutation in patients with cystic fibrosis.
  • a Trojan peptide derived from ⁇ 3 ⁇ inhibits the activity of PDEs and enhances p 2 -AR/cAMP signaling in smooth muscle cells of the airways.
  • fluorescein FITC, 50 ⁇
  • hBSMCs were transfected with the FRET probe for cAMP, ICUE3 , and pre-treated with either vehicle, ⁇ 3 ⁇ inhibitory peptide or Penetratin 1 control peptide (50 uM, 30 minutes) before activation of ⁇ 2 - ⁇ 3 with isoproterenol (ISO; 100 nM) and the selective antagonist of ⁇ -AR, CGP-20712A (CGP, 100 nM) .
  • ISO isoproterenol
  • CGP-20712A CGP, 100 nM
  • the ⁇ 3 ⁇ inhibitory Trojan peptide inhibits calcium entry through the L-type channel in human smooth muscle cells of the airways.
  • the ⁇ 3 ⁇ inhibitory Trojan peptide increases cAMP levels in the airways in vivo, and attenuates airway hyperresponsiveness in healthy and asthmatic mice.
  • Airway hyperreactivity was measured as average resistance of the lung in healthy mice, anesthetized and ventilated, treated with a spray of vehicle, ⁇ 3 ⁇ inhibitory Trojan peptide (1.5 ⁇ g) or PI control peptide (equimolar amount) before exposure to increasing doses of methacholine .
  • Airway hyperresponsiveness was measured as change in tidal volume in asthmatic mice, anesthetized and ventilated, in response to methacholine (500 mg/kg, intravenously administered) .
  • the Trojan peptide derived from ⁇ 3 ⁇ increases cAMP-dependent phosphorylation and chloride conductance of wild-type CFTR.
  • the Trojan peptide derived from ⁇ 3 ⁇ increases the conductance of CFTR in airway epithelial cells with AF508 mutation.
  • FIG. 7 The PI3Ky-derived Trojan peptide reduces lung inflammation in asthmatic mice.
  • a fusion peptide comprising: i) an amino acid sequence as defined in SEQ ID No.: 1 or a related homolog having at least 90% identity with SEQ ID No.: 1, and having the ability of the sequence SEQ ID No.: 1 to inhibit the kinase-independent function of ⁇ 3 ⁇ , and ii) a peptide having the ability to penetrate a cell, for use as a medicament, in particular for treating respiratory diseases.
  • a different embodiment of the present invention concerns a product comprising i) a fusion peptide as defined above and ii) a potentiator of the cystic fibrosis transmembrane conductance regulator and/or a corrector of the cystic fibrosis transmembrane conductance regulator (CFTR) , as a combined preparation for sequential, simultaneous or separate use for treating respiratory diseases, preferably cystic fibrosis.
  • CFTR cystic fibrosis transmembrane conductance regulator
  • a product comprising a fusion peptide as defined above, a corrector of the cystic fibrosis transmembrane conductance regulator (CFTR) and a potentiator of the cystic fibrosis transmembrane conductance regulator (CFTR) as a combined preparation for sequential, simultaneous or separate use is particularly suitable for treating patients with cystic fibrosis who carry the AF508 mutation of CFTR.
  • CFTR cystic fibrosis transmembrane conductance regulator
  • CFTR cystic fibrosis transmembrane conductance regulator
  • the present description concerns the production and the therapeutic applications of a fusion peptide permeable to cell membranes, which inhibits the interaction between ⁇ 3 ⁇ and the activator of PDE, PKA.
  • the fusion peptide of the present description reduces the activity of specific PDE, enhancing the signaling of the ⁇ 2-AR/cAMP signal transduction pathway and producing cAMP-mediated pro-relaxing effects, both in smooth muscle cells of human airways and in vivo, in a preclinical model of allergic asthma.
  • the fusion peptide with ⁇ 3 ⁇ inhibitory activity enhances the same signaling pathway in epithelial cells of the respiratory tract and stimulates the cAMP-dependent opening of the wild type CFTR channel (whose nucleotide and amino acid sequences are available in the GenBank sequence database as access numbers NM_000492.3 and NP_000483.3, respectively) and of CFTR with the AF508 mutation (the sequence of this mutation is available in the GenBank sequence database as access number S64640.1), which is the main cause of cystic fibrosis.
  • results shown here demonstrate the possibility of using the fusion peptide or homologs thereof, having the ability to inhibit ⁇ 3 ⁇ , as a local therapy by inhalation, for treating respiratory diseases such as allergic asthma and cystic fibrosis.
  • the present description shows, in a completely unexpected way, that the ⁇ 3 ⁇ 126-150 peptide (SEQ ID No.: 1 - KATHRSPGQIHLVQRHPPSEESQAF) conjugated to a peptide permeable to cell membranes, such as, for example, the Penetratin 1 of Antennapedia (SEQ ID No.: 3) (3), can be used as an inhibitor of the kinase- independent function of ⁇ 3 ⁇ in vivo.
  • the ⁇ 3 ⁇ inhibitory fusion peptide penetrates smooth muscle cells of the airways and enhances the ⁇ 2-AR/cAMP signaling pathway.
  • the data show that the fusion peptide increases cAMP levels and limits airway hyperresponsiveness in a preclinical model of allergic asthma and that it efficiently reaches the lower respiratory tract when administered locally by the intra-tracheal route. These data therefore demonstrate the clinical use of a ⁇ 3 ⁇ inhibitory fusion peptide in aerosol therapy for treating respiratory diseases.
  • the current inhalation therapy for bronco- obstructive diseases is based on the use of ⁇ 2 - ⁇ agonists, such as salbutamol and formoterol and of PDE4 inhibitors, such as Roflumilast, which was recently approved for treating chronic obstructive pulmonary disease (COPD) .
  • COPD chronic obstructive pulmonary disease
  • ⁇ -AR agonists Although acute treatment with ⁇ -AR agonists produces evident clinical benefits, chronic or repeated exposure to these drugs may result in a significant reduction and/or complete loss of their effectiveness in asthmatic patients, due to the agonist-dependent desensitization of membrane ⁇ -ARs.
  • the present description provides a solution to this problem and proposes the use of an inhibitory peptide that affects the activity of the enzyme ⁇ 3 ⁇ and, as such, does not act directly on the stimulation of ⁇ 2 ⁇ , but enhances the cascade of downstream signaling events.
  • a ⁇ 3 ⁇ inhibitory peptide offers the unique opportunity to modulate ⁇ 2 ⁇ AR-dependent cAMP domains, ensuring broncho-relaxing effects similar to those mediated by ⁇ 2-AR agonists, without inducing receptor inactivation .
  • the ⁇ 3 ⁇ inhibitory peptide therefore represents a unique tool that ensures isoform-selective inhibition of PDEs and allows limiting the major side effects that are associated with non-selective inhibitors of PDE4, such as Roflumilast, arising mainly from inhibition of isoforms that are not expressed in the respiratory system.
  • PDE4 inhibitors are characterized by important pro-relaxant effects in isolated cells, they are not optimal bronchodilators in vivo, where they mainly exert anti-inflammatory functions.
  • inhibiting PDE3 and PDE4 can be additive or synergistic.
  • PDE4 and PDE3 inhibitors are ineffective if used alone, but act synergistically in inhibiting smooth muscle contraction. Therefore, inhibiting the kinase-independent activity of ⁇ 3 ⁇ provides a unique tool to simultaneously inhibit specific isoforms of PDE3 and PDE4, in particular those critically involved in regulating the contractility of the bronchial smooth muscle.
  • PDE3 and PDE4 are not only expressed in the airways, but also in the myocardium and the central nervous system, systemic inhibition of even selected isoenzymes can cause major side effects.
  • the inhibition of PDE3 and PDE4 in vivo may have pro- arrhythmogenic, pro-emetic and pro-anorexigenic effects.
  • the present description shows that the fusion peptide having the ability to inhibit the kinase- independent activity of ⁇ 3 ⁇ is therapeutically effective, and that an aerosol formulation of the ⁇ 3 ⁇ inhibitory peptide is distributed efficiently in the lower respiratory tract. Furthermore, the use of a peptide molecule provides a broader therapeutic effect/side effect profile compared to small molecules, such as PDE inhibitors, which can diffuse rapidly to other tissues outside of the respiratory system.
  • the data provided herein demonstrate that a fluorescent version of the ⁇ 3 ⁇ inhibitory peptide accumulates in the trachea and lungs following intra ⁇ tracheal administration, without reaching the myocardium and the brain.
  • an inhalation therapy based on a peptide, permeable to cell membranes, which selectively inhibits the kinase-independent activity of the ⁇ 3 ⁇ enzyme is highly effective.
  • This therapeutic approach can be used for treating different respiratory diseases, from asthma to cystic fibrosis, where agents able to increase intracellular cAMP downstream of ⁇ 2 ⁇ ARs are necessary.
  • the results presented here demonstrate that the ⁇ 3 ⁇ inhibitory peptide not only increases cAMP levels in smooth muscle, but also in the epithelial compartment of the airways, thus opening up the possibility of exploiting this compound to also stimulate the cAMP-mediated opening of the CFTR channel, which is defective in patients with cystic fibrosis.
  • the data provided here also show that inhibition of ⁇ 3 ⁇ acts synergistically with a known, clinically advanced, CFTR potentiator, VX-770, by increasing the conductance of one of the most common mutated forms of CFTR in cystic fibrosis.
  • the fusion peptide of the present description may therefore be used in combination with a potentiator of cystic fibrosis transmembrane conductance regulator (CFTR) and/or a corrector of the cystic fibrosis transmembrane conductance regulator (CFTR) , as a combined preparation for the sequential, simultaneous or separate use in treating respiratory diseases characterized by a defective cAMP-mediated opening of CFTR, such as in patients with cystic fibrosis.
  • CFTR cystic fibrosis transmembrane conductance regulator
  • CFTR cystic fibrosis transmembrane conductance regulator
  • CFTR cystic fibrosis transmembrane conductance regulator
  • CFTR cystic fibrosis transmembrane conductance regulator
  • Potentiators of the cystic fibrosis transmembrane conductance regulator (CFTR) which can be advantageously used in combination with the fusion peptide of the present description are, for example: Ivacaftor or VX-770 (N- (2, 4-Di-tert-butyl-5- hydroxyphenyl ) -1, 4-dihydro-4-ossoquinoline-3- carboxamide ) and VX-532 ( 4-Methyl-2- ( 5-phenyl-lH- pyrazol-3-yl ) -phenol ) .
  • Ivacaftor or VX-770 N- (2, 4-Di-tert-butyl-5- hydroxyphenyl ) -1, 4-dihydro-4-ossoquinoline-3- carboxamide
  • VX-532 4-Methyl-2- ( 5-phenyl-lH- pyrazol-3-yl ) -phenol
  • Correctors of the cystic fibrosis transmembrane conductance regulator (CFTR) which can be advantageously used in combination with the fusion peptide of the present description and with a potentiator of the cystic fibrosis transmembrane conductance regulator (CFTR) are for example: VX-809 (3- (6- (1- ( 2 , 2-difluorobenzo [d] [1,3] dioxol- 5yl) cyclopropanecarboxamido ) -3-methylpyridin-2- yl)benzoic acid) and VX-661 ((R)-l-(2,2- difluorobenzo [d] [1,3] dioxol-5-yl ) -N- ( 1- ( 2 , 3- dihydroxypropyl ) -6-fluoro-2- (l-hydroxy-2 methylpropan- 2-yl) -lH-indol-5-yl ) cyclopropanecarboxamide ) .
  • the molecule can be used for treating respiratory diseases, including allergic asthma, where drugs designed to increase intracellular levels of cAMP and to promote relaxation of bronchial smooth muscle are highly desirable.
  • this compound can be applied to patients with cystic fibrosis where agents that elevate cAMP concentrations are key tools to stimulate cAMP- mediated opening of defective CFTR.
  • peptide-mediated inhibition of ⁇ 3 ⁇ can be applied to all pathological conditions characterized by a hypo-functional CFTR, including COPD, where the exposure to cigarette smoke has been demonstrated to alter the activity of CFTR.
  • the fusion peptide of the present description having the ability to inhibit ⁇ 3 ⁇ is capable of exerting important anti-inflammatory actions.
  • the experimental evidence reported here demonstrates that the peptide indeed limits the peribronchial inflammation associated with allergic asthma. It is therefore evident that inhibiting the kinase-independent activity of ⁇ 3 ⁇ can provide multiple independent therapeutic benefits in treating respiratory diseases, acting at the same time as a bronchodilator, CFTR potentiator and antiinflammatory agent.
  • a fusion peptide having the sequence shown in SEQ ID No.: 2 (hereinafter also referred to as "Trojan peptide derived from ⁇ 3 ⁇ ”), comprising the amino acid sequence SEQ ID No.: 1 and a peptide penetrating the cell corresponding to the Penetratin 1 of Antennapedia (SEQ ID No.: 3, described in (3)) .
  • the scope of this description is not in any way limited to the specific sequence of the fusion peptide of SEQ ID No.: 2, since the fusion peptide of the present description can comprise i) sequences having a homology with SEQ ID No.: 1 of at least 90% and having the ability of SEQ ID No.: 1 to inhibit the kinase-independent function of ⁇ 3 ⁇ and ii) sequences of a peptide penetrating the cell, for example, selected from the polypeptide HIV-TAT, Antennapedia homeodomain peptides, also known as penetrating peptides or pAntp, R7 peptide, KALA peptide, buforin 2, MAP, transportan, transportan 10, pVEC, or MPG peptide.
  • the sequences corresponding to the polypeptides penetrating the cells mentioned above are shown in Figure 6 and specified in SEQ ID No.: 3 to 12.
  • the peptide having the ability to penetrate the cell was fused to the N-terminus of SEQ ID No.: 1. It is, however, possible to produce a fusion peptide that falls within the scope of the present description by creating a fusion of the peptide having the ability to penetrate the cell at the C-terminus of the SEQ ID No . : 1.
  • homolog peptide having at least 90% identity with SEQ ID No.: 1, to inhibit the function of AKAP of ⁇ 3 ⁇
  • a previously- described competition assay was used (1) .
  • the homolog peptide was re-suspended in phosphate-buffered saline solution (PBS) to a final concentration of 50 ⁇ or 250 uM.
  • PBS phosphate-buffered saline solution
  • HEK293 cells (ATCC Number: CRL-1573TM) were transfected, using the calcium phosphate method, with a construct made of the expression vector pcDNA3.1 (Life Technologies, Carlsbad, CA, USA; product code V790-20), in which human ⁇ 3 ⁇ cDNA was cloned (SEQ ID No.: 13) using the restriction enzymes BamHI and Xbal (New England Biolabs, Ipswich, MA, USA) .
  • the pcDNA3.1- ⁇ 3 ⁇ construct is freely available from Dr. Emilio Hirsch at the University of Turin, Turin, ITALY.
  • cells were lysed in cold lysis buffer containing 120 mmol/L NaCl, 50 mmol/L Tris-HCl (pH 8.0), complete protease inhibitors (Roche Applied Science, Indianapolis, IN) and phosphatase inhibitors (50 mmol/L sodium fluoride, 1 mmol/L sodium orthovanadate and 10 mmol/L sodium pyrophosphate) .
  • lysates were centrifuged at 13000 rpm for 10 min at 4°C and the supernatant was incubated with the peptide for 30 minutes at room temperature.
  • PKA RII regulatory subunit of PKA
  • PKA RII the regulatory subunit of PKA
  • PKA RII was immunoprecipitated by incubating the protein extract with 30 ⁇ of a 1:1 mixture of Protein A and Sepharose (Amersham Biosciences, Buckinghamshire, UK) and an anti-PKA RII C20 antibody (Santa Cruz Biotechnology Inc., Dallas, Texas, USA; product code: sc-908) for 2 h at 4°C, with shaking.
  • Immune complexes were washed extensively with lysis buffer and the association of ⁇ 3 ⁇ with PKA RII was analyzed by Western blot analysis using a monoclonal anti-PI3KY antibody (freely available from Dr. Emilio Hirsch at the University of Turin, Turin, Italy) .
  • Knock-out mice for ⁇ 3 ⁇ ( ⁇ 3 ⁇ _ ⁇ ) and knock-in mice expressing a catalytically-inactive form of ⁇ 3 ⁇ ( ⁇ 3 ⁇ ⁇ ⁇ ) were generated as previously described (4, 5) . Mutant mice were crossed with animals of a C57B1/6J genetic background for 15 generations and C57B1/6J mice were used as controls ( ⁇ 3 ⁇ + + ) . For studies of airway hyperresponsiveness in asthmatic and healthy mice, BALB/C female mice were used. For all experiments, animals between the ages of 8 and 12 weeks were used. Mice were maintained in groups, with free access to food (standard diet) and water, in a controlled system which provides a cycle of 12 hours of light and 12 hours of darkness. Animals were used according to the guidelines and institutional regulations on animal welfare, approved by the local Animal Ethics Committee. Cell culture and transfection
  • hBSMCs Human bronchial smooth muscle cells
  • DMEM Dulbecco's Modified Eagle Medium
  • FBS fetal bovine serum
  • Gibco, Carlsbad, CA penicillin/streptomycin
  • hBSMCs Human bronchial smooth muscle cells
  • ICUE3 encoding the FRET probe for cAMP
  • AMAXA Nucleofector device
  • Human airway epithelial cell lines expressing a wild-type CFTR (NuLi-1) or with the AF508 mutation (CuFi-1) were purchased from ATCC (NuLi-1 product code: ATCC® CRL-4011TM; CuFi-1 product code: ATCC® CRL-4013TM) .
  • Cells were cultured in Dulbecco's Modified Eagle Medium (DMEM, Gibco, Carlsbad, CA) supplemented with 10% fetal bovine serum (FBS), 30 ⁇ g/mL of penicillin, 100 ⁇ g/mL of streptomycin and 300 ⁇ g/mL hygromycin B (Gibco, Carlsbad, CA) .
  • DMEM Dulbecco's Modified Eagle Medium
  • FBS fetal bovine serum
  • mTSMCs murine tracheal smooth muscle cells
  • hBSMCs human bronchial smooth muscle cells
  • cells were treated with the indicated drugs/peptides and immediately lysed in cold lysis buffer containing 120 mmol/L NaCl, 50 mmol/L Tris-HCl (pH 8.0), complete protease inhibitors (Roche Applied Science, Indianapolis, IN) and phosphatase inhibitors (50 mmol/L sodium fluoride, 1 mmol/L sodium orthovanadate and 10 mmol/L sodium pyrophosphate) . After 30 min of incubation on ice, lysates were centrifuged at 13000 rpm for 10 min at 4°C and used for either Western blotting or subjected to immunoprecipitation and measurements of phosphodiesterase activity.
  • protein extracts were pre-incubated with 30 ⁇ of a 1:1 mixture of protein A or G and sepharose (Amersham Biosciences, Buckinghamshire, UK) and subsequently incubated with 20 ⁇ of a 1:1 mixture of protein A or G and sepharose and 1 mg of primary antibody for each mg of protein, for 2 hours at 4°C.
  • Immune complexes were washed extensively with lysis buffer and used for Western blotting or subjected to measurements of phosphodiesterase activity.
  • cAMP levels were performed on human bronchial smooth muscle cells (hBSMCs) that express the FRET probe ICUE3, as described previously (2) . Briefly, cells were maintained in a K + -Ringer solution containing (in mmol/L) 121.6 NaCl, 5.4 KC1, 1.8 MgCl 2 , 1.8 CaCl 2 , 4 NaHC0 3 , 0.8 NaH 2 P0 4 , 5 D-glucose, 5 sodium pyruvate, 10 HEPES, at pH 7.4.
  • FRET recordings were carried out before and after adding 100 nmol/L of isoproterenol (Iso) and 100 nmol/L of CGP-20712A (CGP) , using a SP5 Leica TCS system (Leica Microsystems Inc., Buffalo Grove, IL , USA) with an argon laser and with a 63x immersion lens.
  • Iso isoproterenol
  • CGP-20712A CGP-20712A
  • SP5 Leica TCS system Leica Microsystems Inc., Buffalo Grove, IL , USA
  • 458 and 514 nm wavelengths were used, respectively.
  • Images were acquired every 4 seconds without any media line, at a scanning speed of 400 MHz and a resolution of 512 x 512 pixels.
  • E A (i) B/A
  • a and B are the intensities of the CFP channel and FRET, respectively.
  • Phosphodiesterase activity in immunoprecipitates was measured according to the two-step method of Thompson and Appleman, as previously described (2), with minor modifications. Briefly, immunoprecipitates were assayed in a total volume of 200 ⁇ of reaction mixture containing 40 mmol/L Tris-HCl (pH 8.0), 1 mmol/L MgCl 2 , 1.4 mmol/L 2-mercapto-ethanol and 0.1 pCi of [ 3 H] cAMP (Amersham Bioscience, Buckinghamshire, UK) for 40 min at 33°C. To stop the reaction, samples were boiled at 95°C for 3 min.
  • reaction product 5 ' -AMP was then hydrolyzed by incubation of the mixture with 50 ⁇ g of snake venom from Crotalus Atrox for 15 min at 37°C (Sigma-Aldrich, St. Louis, MO) .
  • the resulting adenosine was separated by anion exchange chromatography with 400 ⁇ L of a suspension of Dowex resin AG1-X8 (Bio-Rad, Segrate, Milan, Italy) , water and 100% ethanol in equal parts.
  • the amount of radiolabeled adenosine in the supernatant was quantified by scintillation counting (Ultima Gold liquid scintillation from Perkin Elmer, Waltham, MA) .
  • Murine tracheal smooth muscle cells were cultured from explants of trachea using previously described methods with modifications. The entire trachea between the larynx and bronchi was removed and placed in a sterile Petri dish containing Hanks' s balanced salt solution at room temperature and a 2x concentration of antibiotic-antimycotic (Gibco, Carlsbad, CA, product code: 15240-062) . Using a dissecting microscope, the additional surrounding tissue was removed, the tracheal segment was divided longitudinally and cut into squares of 2-3 mm in size. All the segments of a single trachea were then placed with the inner face towards the bottom of a 60 mm sterile cell culture plate.
  • DMEM Dulbecco's Modified Eagle Medium
  • FBS FBS
  • antibiotic-antimycotic were reduced to 10% and lx, respectively.
  • Tracheal segments were removed when cells became locally confluent. Once the 60 mm plate became confluent, cells were detached by trypsinization and transferred to a single 60 mm plate. Tracheal smooth muscle cells were further subdivided for several passages in a 1:2 ratio. More than 90% of these cells were smooth muscle cells, as determined by immunofluorescence performed with an antibody specific for smooth muscle actin. All experiments were performed on confluent cells at passage 3.
  • hBSMCs were loaded with the calcium indicator
  • KCl depolarizing solution containing (in mmol/L) : 5 HEPES, 118 NaCl, 40 KCl, 2 CaCl 2 , 1 MgCl 2 , 5.5 D-glucose, at pH 7.35.
  • Calcium transients were analyzed as the ratio of fluorescence signals measured at 400 nm and 490 nm following excitation of Indo-l-AM- loaded cells at 350 nm. Experiments were recorded and analyzed with Igor® Software, using the functions added by Jason Rothman (Neuromatic, www.thinkrandom.com) .
  • Buffers were aerated with a mixture of 95% 0 2 and 5% C0 2 and the temperature was maintained at 37 °C during the experiment. Cultures were maintained at a voltage of 0 mV using an EVC4000 Multichannel V/I Clamp (World Precision Instruments, Sarasota, FL, USA) . After a stabilization period of 30 minutes, drugs were added at specific times, while the current was continuously recorded. cAMP extraction and quantification Lungs and trachea were explanted from animals following euthanasia, pulverized in liquid nitrogen and used for cold extraction of cAMP with 6% trichloroacetic acid. Samples were sonicated for 10 seconds and centrifuged at 13000 rpm at 4°C for 15 minutes.
  • hBSMCs were incubated with the Trojan peptide derived from ⁇ 3 ⁇ (SEQ ID No.: 2) conjugated to fluorescein (50 uM) or vehicle for 30 minutes, fixed with 4% paraformaldehyde (PFA) for 10 minutes and permeabilized with phosphate-buffered saline (PBS) + 0.5% Triton ( Sigma-Aldrich, St. Louis, MO) for 5 minutes at room temperature. Cells were then incubated with PBS containing 3% bovine serum albumin (BSA, Sigma-Aldrich, St.
  • BSA bovine serum albumin
  • Wild-type BALB/C mice were injected by the intra ⁇ tracheal route with 1.5 ⁇ g of the Trojan peptide derived from ⁇ 3 ⁇ conjugated to fluorescein or vehicle, in a final volume of 70 ⁇ L of PBS. After 30 minutes, animals were anesthetized, the trachea and lungs were insufflated with PBS, extracted and frozen in OCT. Cryosections of 10 microns were obtained with a Leica CM1850 cryostat (Leica Microsystems GmbH, Wetzlar, Germany) and fluorescence was acquired with a Zeiss Observer-Zl, equipped with an Apotome module (Carl Zeiss, Oberkochen, Germany) .
  • Ovalbumin 100 ⁇ g (OVA, Sigma-Aldrich, St. Louis, MO), complexed with aluminum potassium sulfate (1 mg, alum) was administered intraperitoneally (i.p.) on days 1 and 14, and intra-nasally (i.n.) (50 ⁇ g OVA in 50 ⁇ PBS) on days 14, 25, 26, and 27.
  • Control mice received i.p. injections of alum and i.n. injections of PBS only Airway hyperreactivity induced by inhaled methacholine was measured at 24 hours after the final dose of OVA (Day 28) .
  • mice sensitized to ovalbumin were anesthetized (sodium pentobarbital, 70-90 mg/kg, i.p.), tracheotomized, and connected to a FlexiVent ventilator for small animals (SCIREQ, Montreal, Quebec, Canada) .
  • SCIREQ FlexiVent ventilator for small animals
  • mice were exposed to increasing concentrations of aerosolized methacholine (10 ⁇ 9 to 10 ⁇ 4 M, final concentration) .
  • Method 2 Mice sensitized to ovalbumin were treated, by intra-tracheal instillation, with 70 ⁇ L of phosphate-buffered saline solution (PBS) containing vehicle or 150 ⁇ g of the Trojan peptide derived from ⁇ 3 ⁇ or equimolar amounts of PI control peptide. Airway hyperresponsiveness was assessed at 30 minutes after the treatment according to a previously published protocol (6) .
  • PBS phosphate-buffered saline solution
  • mice were anesthetized (sodium pentobarbital, 70-90 mg/kg, i.p.), tracheotomized, and ventilated with a positive end-inspiratory pressure of 10 cm 3 ⁇ 40, positive end-expiratory pressure (PEEP) of 3 cm H 2 0, respiratory rate of 90 breaths/min in ambient air.
  • the airway opening pressure (Pao) proximal to the endotracheal tube, and the pressure inside the chamber were measured with pressure transducers (Special Instruments, Digima Clic; Nordlingen, Germany) .
  • Gas flow was measured with a pneumotachograph (Special Instruments, Digima Clic; Nordlingen, Germany) .
  • Tidal volume was calculated as the integral of the flow signal. Variables of mechanical ventilation were recorded using the ICU-Lab software (KleisTEK Advanced Electronic Systems, Bari, Italy) . Airway hyper ⁇ reactivity was assessed as a change in tidal volume after treatment with 500 mg/kg of methacholine administered intravenously.
  • mice Wild-type BALB/C mice were treated, by intra- tracheal instillation, with 25 ⁇ g of the Trojan peptide derived from ⁇ 3 ⁇ or equimolar amounts of PI control peptide, in a final volume of 70 i of phosphate- buffered saline (PBS), before each intra-nasal administration of ovalbumin (days 14, 25, 26, and 27 of the protocol of immunization with ovalbumin) . At 24 hours after the final injection (day 28), mice were anesthetized (sodium pentobarbital, 70-90 mg/kg, i.p.) and the tracheas incised and cannulated.
  • PBS phosphate- buffered saline
  • the airways were washed with 2.5 ml of phosphate-buffered saline solution (PBS) .
  • PBS phosphate-buffered saline solution
  • the total number of cells in the bronchoalveolar lavage (BAL) was determined with a Neubauer hemocytometer .
  • a volume of 50 i of BAL was centrifuged onto cytospin glass slides at 400 rpm at room temperature for 5 minutes and stained with a Diff- Quick system (LabAids, Ronkonkoma, USA) .
  • a total of 100 cells per slide were counted and classified as neutrophils, macrophages, lymphocytes and eosinophils on the basis of morphological criteria. Erythrocytes and epithelial cells were ignored and the results were expressed as cells/ml.
  • peribronchial inflammation To assess the peribronchial inflammation, the lungs of a group of animals that had not been subjected to bronchoalveolar lavage were explanted, fixed in a solution of 4% paraformaldehyde (PFA) for 24 hours at 4°C and embedded in paraffin. Slices that were 5 ⁇ - thick, deparaffinized, stained with a hematoxylin-eosin solution (Bio-Optica, Milano, Italy) , dehydrated and mounted with glass coverslips. The extent of peribronchial inflammation was classified as follows: 0- normal; 1- few inflammatory cells; 3- a thick ring of inflammatory cells.
  • PFA paraformaldehyde
  • PAS periodic acid-Schiff' s reagent
  • PDE4B and PDE4D were immunoprecipitated as described previously (2), using polyclonal rabbit antibodies freely available from Dr. Marco Conti at the University of California San Francisco, San Francisco, CA, USA.
  • Commercial antibodies specific for PDE4B and PDE4D can be purchased from Abeam (Abeam, Cambridge, MA, USA) : anti-PDE4B product code: abl4611; anti-PDE4D product code: abl4614.
  • Rabbit polyclonal antibodies against Ca v l .2 and phospho-Ca v l .2 are freely available from Dr. William A. Catterall at the University of Washington, Seattle, WA, USA, .
  • P-PKA substrate The antibody that recognizes substrates phosphorylated by PKA (P-PKA substrate) was purchased from Cell Signaling Technology (Danvers, MA, USA; product code: # 9621) and the antibody against CFTR clone M3A7 from Millipore (Billerica, MA, USA; product code: 05-583) .
  • ICUE3-pcDNA3 was described previously (2) .
  • Isoproterenol, CGP-20712A, carbachol, Rolipram, amiloride and forskolin were all purchased from Sigma (Sigma-Aldrich, St. Louis, MO) .
  • the CFTR corrector VX- 809, the CFTR potentiator VX-770 and the CFTR inhibitor 172 were purchased from Selleckchem (Houston, TX, USA) .
  • the PI control peptide (SEQ ID No.: 3 RQIKIWFQNRRMKWKK) and the Trojan peptide derived from ⁇ 3 ⁇ (SEQ ID No . : 2
  • RQIKIWFQNRRMKWKKGKATHRSPGQIHLVQRHPPSEESQAF were synthesized by GenScript (GenScript, Piscataway, NJ, USA) and Chinapeptides (Chinapeptides Co. Ltd., Shanghai, China) .
  • a Trojan peptide derived from ⁇ 3 ⁇ enhances ⁇ 2 ⁇ AR/cAMP signaling in bronchial smooth muscle cells
  • an inhibitory fusion peptide permeable to cell membranes was obtained by binding the 126-150 domain of human ⁇ 3 ⁇ (SEQ ID No.: 1) with the Trojan peptide of Antennapedia Penetratin 1 (SEQ ID No.: 3 - Figure 1A) .
  • a version of the ⁇ 3 ⁇ inhibitory Trojan peptide labeled with fluorescein (FITC) accumulated in the cytoplasm of human bronchial smooth muscle cells (hBSMCs) at 30 minutes after incubation, showing that the inhibitor is efficiently transduced in vivo in isolated cells ( Figure IB) .
  • the ⁇ 3 ⁇ inhibitory peptide significantly reduced the catalytic activity of PDE4B and PDE4D in tracheal smooth muscle cells of wild-type mice ( ⁇ 3 ⁇ + + ) , but not of animals devoid of the enzyme ( ⁇ 3 ⁇ _ ⁇ ) ( Figure 1C) , demonstrating the ability of the peptide to selectively interfere with PI3Ky-dependent anchoring of PKA.
  • pre- treatment of hBSMCs with the ⁇ 3 ⁇ inhibitory Trojan peptide increased cAMP accumulation by 35% following stimulation of ⁇ 2- ⁇ , while cAMP levels were unchanged in cells treated with PI control peptide ( Figures ID and E) .
  • ⁇ 3 ⁇ is a key regulator of cAMP in the vicinity of these Ca 2+ channels (2) .
  • hBSMCs were exposed to a solution containing KC1, able to depolarize the membrane and, therefore, to activate VOCCs.
  • the influx of Ca 2+ induced by KC1 was completely abolished by the ⁇ 3 ⁇ inhibitory Trojan peptide, while it was unchanged in hBSMCs treated with PI control peptide or vehicle ( Figure 2A-B) .
  • a Trojan peptide that inhibits the PKA anchoring function of ⁇ 3 ⁇ constitutes a novel method for inhibiting selected PDEs and enhancing cAMP signaling downstream of ⁇ 2 - ⁇ , in smooth muscle cells.
  • a Trojan peptide derived from ⁇ 3 ⁇ limits airway hyperresponsiveness in healthy and asthmatic mice
  • FITC fluorescein (FITC) -labelled form of the peptide was instilled by the intra-tracheal route in BALB/C wild- type mice. FITC fluorescence was detected in the trachea and lungs, but not in the brain or in the myocardium, at 30 minutes after administration ( Figure 3A) ; this demonstrates that the peptide is efficiently distributed in the respiratory tract of the animals.
  • cAMP levels were 30% higher in the trachea and in the lungs of mice injected with the ⁇ 3 ⁇ inhibitory Trojan peptide compared to control animals treated with phosphate-buffered saline solution (PBS) or PI control peptide (Figure 3B) .
  • PBS phosphate-buffered saline solution
  • Figure 3B PI control peptide
  • a Trojan peptide derived from ⁇ 3 ⁇ increases cAMP levels and enhances the conductance of CFTR in bronchial epithelial cells expressing wild-type or a AF508 mutant CFTR
  • Molecules with CFTR potentiator activity are required to stimulate the opening of the defective CFTR in the treatment of cystic fibrosis (CF) .
  • CFTR-dependent currents were measured in bronchial epithelial cells expressing the mutant CFTR AF508-CFTR (CuFi-1) .
  • ⁇ 3 ⁇ inhibition synergistically increased the activity of the known CFTR potentiator, VX-770, resulting in an increase of the CFTR currents by about 5-fold more than the basal activity ( Figures 4A and B) .
  • the PI control peptide did not change the CFTR activity of in the presence of VX-770 ( Figures 4A and B) .
  • a PI3Ky-derived Trojan peptide limits lung in lammation in asthmatic mice
  • mice pre-treated with the PI control peptide before each intranasal injection of ovalbumin showed an increase in peribronchial inflammation ( Figures 7A and B) , and in the number of goblet cells, containing mucus and positive to the periodic acid-Schiff' s reagent (PAS) staining ( Figures 7A and C) , compared to control animals not sensitized to ovalbumin (naive) .
  • PES periodic acid-Schiff' s reagent
  • other leukocyte populations such as macrophages, lymphocytes and eosinophils were unchanged ( Figure 7E- F-G) .

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Organic Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Zoology (AREA)
  • Epidemiology (AREA)
  • Biochemistry (AREA)
  • Immunology (AREA)
  • Biophysics (AREA)
  • Toxicology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Wood Science & Technology (AREA)
  • Pulmonology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Biomedical Technology (AREA)
  • Biotechnology (AREA)
  • Microbiology (AREA)
  • General Engineering & Computer Science (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Peptides Or Proteins (AREA)

Abstract

Fusion peptide comprising: i) an amino acid sequence as defined in SEQ ID No.: 1 or a related homolog having at least 90% identity with SEQ ID No.: 1 and having the ability of the sequence SEQ ID No.: 1 to inhibit the kinase-independent function of ΡΙ3Κγ, and ii) a peptide having the ability to penetrate a cell.

Description

"Novel ΡΙ3Κγ inhibitor peptide for treatment of respiratory system diseases"
***
Field of the invention
The present description relates to a novel peptide inhibitor of ΡΙ3Κγ for the treatment of pathologies of the respiratory apparatus.
Background of the invention
Asthma is a chronic respiratory disease characterized by inflammation, airway hyperresponsiveness (AHR) and mucosal edema, which together lead to episodic bronchoconstriction and obstruction of the airways. The effectiveness of current anti-asthmatic treatments is unsatisfactory, and asthma remains an unresolved global issue.
The tone of the musculature of the airways is determined by a delicate balance between activation of the pro-contractile and pro-relaxation signaling pathways in smooth muscle cells. Contraction is primarily triggered by acetylcholine, the main parasympathetic neurotransmitter in the airways, which activates M3 muscarinic receptors, leading to mobilization of intracellular and extracellular calcium (Ca2+) . Conversely, relaxation of the airways is achieved by catecholamine-mediated activation of β2~ adrenergic receptors (β2~ΑΚ), which promote the production of cyclic AMP (cAMP) and the consequent modulation of key effectors of Ca2+ homeostasis. According to the pro-relaxing action of cAMP, agonists of β2-ΑΚε provide symptomatic relief of bronchospasms in patients with asthma. However, their effectiveness is limited in time, mainly due to the desensitization of β2-ΑΚε that occurs after repeated exposure to agonists. Similarly, inhibiting cAMP degradation by inhibitors of phosphodiesterase 4 (PDE4), the main enzymes responsible for cAMP hydrolysis in the airways, has been clinically tested, but displays unacceptable side effects, such as vomiting, nausea, diarrhea and weight loss, due to non-selective inhibition of PDE4 in the central nervous system.
Therefore, identifying new enzymes that regulate cAMP homeostasis, as well as novel strategies for manipulating the β2-ΑΚ/α?ΜΡ signal transduction pathway in smooth muscle cells is desirable for treating respiratory diseases. Moreover, the same approach could also be used for therapeutic purposes in other pathological contexts, such as cystic fibrosis, where it is necessary to increase the levels of cAMP in the epithelial cells of the airways.
In the respiratory epithelium, the production of cAMP downstream of β2-ΑΚΞ is necessary to ensure the opening of the cAMP-dependent chloride channel (cystic fibrosis transmembrane conductance regulator, CFTR) . Mutations in the gene that encodes for this protein are the main cause of cystic fibrosis (CF) . Among these, deletion of phenylalanine 508 (AF508) constitutes the most common alteration in CF patients and leads to defects in both membrane expression and opening of the channel. A number of CFTR corrector and potentiator drugs, which rescue the membrane expression and the cAMP-mediated opening of the channel, respectively, have been developed, but their effectiveness is unsatisfactory. In particular, CFTR potentiators require high concentrations of intracellular cAMP to be effective. Therefore, drugs that are able to stimulate cAMP levels may constitute novel strategies to increase the effectiveness of currently available treatments, or to directly correct functional defects of CFTR in CF.
Previous studies have shown that phosphoinositide 3-kinase γ (ΡΙ3Κγ) controls the compartmentalization of cAMP downstream of β2~ΑΚ. In cardiomyocytes , ΡΙ3Κγ acts as an anchor protein (AKAP) (1), which binds protein kinase A (PKA) to several isoforms of PDE3 and PDE4. PI3KY-associated PKA in turn phosphorylates and promotes the activation of the PDEs and the consequent reduction of cAMP downstream of β2~ΑΚ3, ultimately limiting the arrhythmogenic release of Ca2+ (2) . Although several inhibitors of the kinase activity of ΡΙ3Κγ have been developed, there are currently no methods for selectively interfering with the adaptor or anchor protein activity of ΡΙ3Κγ.
Summary of the Invention
Bearing in mind these premises, there is therefore a need for improved and more effective solutions for treating diseases of the respiratory system compared to the known therapies.
In accordance with the invention, the aforesaid object is achieved thanks to the solution specifically recalled in the attached claims, which constitute an integral part of the present description.
One embodiment of the present invention relates to a fusion peptide comprising:
i) an amino acid sequence as defined in SEQ ID No.:
1 or a related homolog having at least 90% identity with SEQ ID No.: 1, and having the ability of the sequence SEQ ID No.: 1 to inhibit the kinase- independent function of ΡΙ3Κγ, and
ii) a peptide having the ability to penetrate a cell, for use as a medicament, in particular for treating respiratory diseases.
A different embodiment of the present invention concerns a product comprising i) a fusion peptide as defined above and ii) a potentiator of the cystic fibrosis transmembrane conductance regulator (CFTR) and/or a corrector of the cystic fibrosis transmembrane conductance regulator (CFTR) , as a combined preparation for sequential, simultaneous or separate use for treating respiratory diseases, preferably cystic fibrosis .
The present description provides in vitro and in vivo experimental evidence of the efficacy of treating pathologies of the respiratory system by means of administering a fusion peptide comprising residues 126- 150 of human ΡΙ3Κγ (SEQ ID No.: 1) or its homologs . The fusion peptide of the present description is, in fact, able to inhibit the interaction between PKA and ΡΙ3Κγ and to consequently reduce the activity of the PDEs associated with ΡΙ3Κγ, increasing cAMP levels and reducing the entry of Ca2+ through voltage-operated calcium channels (VOCCs) . Furthermore, the fusion peptide described here increases cAMP levels in vivo in the airways and functions as a bronchodilator when administered by an intra-tracheal route to healthy and asthmatic mice. Finally, the fusion peptide carries out the function of CFTR potentiator, increasing cAMP and thereby enhancing the conductance to chloride (Cl~) of CFTR in bronchial epithelial cell lines expressing wild-type or a AF508 mutant CFTR, which is the most frequent mutation in patients with cystic fibrosis.
Brief description of the drawings
The invention will now be described in detail, purely by way of illustrative and non-limiting example, with reference to the attached figures, wherein:
- Figure 1. A Trojan peptide derived from ΡΙ3Κγ inhibits the activity of PDEs and enhances p2-AR/cAMP signaling in smooth muscle cells of the airways. A) Schematic representation of the ΡΙ3Κγ inhibitory peptide permeable to cell membranes. The 126-150 region of human ΡΙ3Κγ was fused with the sequence of Penetratin 1 of Antennapedia . B) Intracellular localization of the ΡΙ3Κγ inhibitory Trojan peptide. hBSMCs were incubated with the peptide labeled with fluorescein (FITC, 50 μΜ) and the intracellular fluorescence was analyzed after 30 minutes from the beginning of the treatment. Filamentous actin staining (left panels) and FITC fluorescence (middle panels) with relative magnification (right panels) are presented. C) Phosphodiesterase activity precipitated by anti-PDE4B and anti-PDE4D antibodies in smooth muscle cells of trachea isolated from ΡΙ3Κγ+ + and ΡΙ3Κγ_/~ animals and treated with either vehicle or the ΡΙ3Κγ inhibitory Trojan peptide (50 uM, 30 minutes; n>4 independent experiments) . D) hBSMCs were transfected with the FRET probe for cAMP, ICUE3 , and pre-treated with either vehicle, ΡΙ3Κγ inhibitory peptide or Penetratin 1 control peptide (50 uM, 30 minutes) before activation of β2-ΑΚ3 with isoproterenol (ISO; 100 nM) and the selective antagonist of βι-AR, CGP-20712A (CGP, 100 nM) . Representative FRET traces of n>3 independent experiments are presented. E) Maximum change in FRET signal (%) of the curves as measured in D. *P <0.05, **P <0.01, ***P <0.001 by one-way ANOVA followed by Bonferroni test.
- Figure 2. The ΡΙ3Κγ inhibitory Trojan peptide inhibits calcium entry through the L-type channel in human smooth muscle cells of the airways. A) Representative traces of Ca2+ transients recorded in hBSMCs pre-treated with vehicle, ΡΙ3Κγ inhibitory Trojan peptide or PI control peptide (50 uM, 30 minutes) prior to stimulation with the muscarinic agonist carbachol (Carb, 10 uM, top panel) and a depolarizing solution (40 mM KC1, bottom panel) . B) Maximum change of the fluorescence ratio of the indicator INDO-1 (AU) of the Ca2+ transients shown in A. C) cAMP-dependent phosphorylation of the Cavl .2 subunit (Ser-1928) of the L-type calcium channel (LTCC) in hBSMCs treated with the ΡΙ3Κγ inhibitory Trojan peptide or PI control peptide (50 uM, 30 minutes) . Representative images and relative quantification of n>3 independent Western blot experiments are shown. **P <0.01 and ***p <0.001 by one-way ANOVA followed by the Bonferroni test.
- Figure 3. The ΡΙ3Κγ inhibitory Trojan peptide increases cAMP levels in the airways in vivo, and attenuates airway hyperresponsiveness in healthy and asthmatic mice. A) The ΡΙ3Κγ inhibitory Trojan peptide was labeled with FITC and administered via the intra- tracheal route to mice of the BALC/c strain (1.5 μg/mouse) . The fluorescence in the lung and trachea was analyzed by confocal microscopy at 30 minutes after treatment. Control mice were instilled with an equal volume of solution used for FITC labeling. FITC fluorescence images of sections of trachea, lungs, brain and myocardium of animals treated with vehicle (upper panels) or with the ΡΙ3Κγ inhibitory Trojan peptide (lower panels) are presented. B) cAMP levels in the whole trachea (left panel) and the lungs (right panel) of mice treated as described in A. *P <0.05 and **P <0.01 by one-way ANOVA followed by Bonferroni test. C) Airway hyperreactivity was measured as average resistance of the lung in healthy mice, anesthetized and ventilated, treated with a spray of vehicle, ΡΙ3Κγ inhibitory Trojan peptide (1.5 μg) or PI control peptide (equimolar amount) before exposure to increasing doses of methacholine . *P <0.05 and **P <0.01 compared to the vehicle; #P <0.05 versus PI by two-way ANOVA followed by Bonferroni test. D) Airway hyperresponsiveness was measured as change in tidal volume in asthmatic mice, anesthetized and ventilated, in response to methacholine (500 mg/kg, intravenously administered) . Animals sensitized to ovalbumin were treated with vehicle, the ΡΙ3Κγ inhibitory Trojan peptide (150 μg) or PI control peptide (equimolar amount) for 30 minutes before administering methacholine. **P <0.01 versus the vehicle and the control peptide; ###P <0.001 versus baseline using two- way ANOVA followed by Bonferroni test.
- Figure 4. The Trojan peptide derived from ΡΙ3Κγ increases cAMP-dependent phosphorylation and chloride conductance of wild-type CFTR. A) cAMP-mediated phosphorylation of CFTR in human airway epithelial cells (NuLi-1) treated with vehicle (lane 1), PI control peptide (25 μΜ, lane 2), ΡΙ3Κγ inhibitory Trojan peptide (25 μΜ, lane 3), PDE4 inhibitor Rolipram alone (PDE4i; 10 μΜ, lane 4) or together with the Trojan peptide derived from ΡΙ3Κγ (lane 5) for 30 minutes. Representative images of Western Blot detection of CFTR immunoprecipitations and phosphorylation by PKA of n>3 independent experiments are shown. B) Representative trace of CFTR currents measured in Ussing chambers in cultures of NuLi-1 cells. The following treatments were applied at the indicated times: amiloride (inhibitor of the ENAC channel, 10 uM) , PI control peptide (30 uM) , increasing concentrations of the Trojan peptide derived from ΡΙ3Κγ (10 μΜ, 20 μΜ and 30 uM) , PDE4 inhibitor Rolipram ( PDE4 i ; 10 uM) , forskolin (FSK, 10 uM) and CFTR inhibitor 172 (CFTRi; 20 uM) .
- Figure 5. The Trojan peptide derived from ΡΙ3Κγ increases the conductance of CFTR in airway epithelial cells with AF508 mutation. A) Representative trace of CFTR currents measured in Ussing chambers in cultures of airway epithelial cells with AF508 mutation (CuFi-1), treated with the corrector VX-809 (20 μΜ; 24 hours) . The following treatments were applied at the indicated times: amiloride (inhibitor of the ENAC channel, 10 uM) , CFTR potentiator VX-770 (10 uM) , PI control peptide (10 uM) , ΡΙ3Κγ inhibitory Trojan peptide (10 uM) , forskolin (FSK, 10 uM) and CFTR inhibitor 172 (CFTRi; 20 uM) . B) Average current variations in response to the indicated treatments. **P <0.01 by one-way ANOVA followed by Bonferroni test.
- Figure 6. Sequences of penetrating polypeptides suitable for producing fusion peptides of the present description .
Figure 7. The PI3Ky-derived Trojan peptide reduces lung inflammation in asthmatic mice. A) Representative images of hematoxylin-eosin (top images) and periodic acid-Schiff' s reagent (bottom images) staining of lung sections of naive mice or mice sensitized with ovalbumin and pre-treated with the Trojan peptide derived from ΡΙ3Κγ (25 μg/mouse/inj ection) or with PI control peptide (equimolar amounts), before each intranasal administration of ovalbumin. Sections were stained with hematoxylin-eosin for analyzing the tissue morphology and the level of inflammation, and with periodic acid- Schiff's reagent to determine the presence of goblet cells. B) Semi-quantitative analysis of the degree of peribronchial inflammation in lung sections as shown in A) . C) Percentage of epithelial cells positive to the staining with periodic acid-Schiff s reagent in the epithelium of lung sections as shown in A) . D-G) Number of neutrophils (D) , macrophages (E) , lymphocytes (F) and eosinophils (G) in the bronchoalveolar lavage of mice pre-treated with the Trojan peptide derived from ΡΙ3Κγ or PI control peptide as described in A) . *P <0.05, **P <0.01 and ***P <0.001 by one-way ANOVA followed by Bonferroni test.
Detailed description of the invention
The invention will now be described in detail, purely by way of illustrative and non-limiting example, with reference to the single drawing in which an extraction system under pressure usable for the purposes of implementing the method described herein is schematically represented.
In the following description, numerous specific details are presented to provide a thorough understanding of the embodiments. The embodiments may be implemented in practice without one or more of the specific details, or with other methods, components, materials, etc. In other cases, well-known structures, materials, or operations are not shown or described in detail to avoid obscuring certain aspects of the embodiments .
Throughout the present specification, the reference to "one embodiment" or "embodiment" means that a specific feature, structure, or characteristic described in connection with the embodiment is included in at least one embodiment. Therefore, the appearance of expressions "in a certain embodiment" or "in an embodiment" in various sites throughout the present specification does not necessarily always refer to the same embodiment. Furthermore, the particular features, structures, or characteristics may be combined in any suitable manner in one or more embodiments.
The titles used here serve merely for convenience and do not interpret the object or meaning of the embodiments .
One embodiment of the present description relates to a fusion peptide comprising: i) an amino acid sequence as defined in SEQ ID No.: 1 or a related homolog having at least 90% identity with SEQ ID No.: 1, and having the ability of the sequence SEQ ID No.: 1 to inhibit the kinase-independent function of ΡΙ3Κγ, and ii) a peptide having the ability to penetrate a cell, for use as a medicament, in particular for treating respiratory diseases.
A different embodiment of the present invention concerns a product comprising i) a fusion peptide as defined above and ii) a potentiator of the cystic fibrosis transmembrane conductance regulator and/or a corrector of the cystic fibrosis transmembrane conductance regulator (CFTR) , as a combined preparation for sequential, simultaneous or separate use for treating respiratory diseases, preferably cystic fibrosis.
The use of a product comprising a fusion peptide as defined above, a corrector of the cystic fibrosis transmembrane conductance regulator (CFTR) and a potentiator of the cystic fibrosis transmembrane conductance regulator (CFTR) as a combined preparation for sequential, simultaneous or separate use is particularly suitable for treating patients with cystic fibrosis who carry the AF508 mutation of CFTR.
The present description concerns the production and the therapeutic applications of a fusion peptide permeable to cell membranes, which inhibits the interaction between ΡΙ3Κγ and the activator of PDE, PKA. The fusion peptide of the present description reduces the activity of specific PDE, enhancing the signaling of the β2-AR/cAMP signal transduction pathway and producing cAMP-mediated pro-relaxing effects, both in smooth muscle cells of human airways and in vivo, in a preclinical model of allergic asthma. Furthermore, the fusion peptide with ΡΙ3Κγ inhibitory activity enhances the same signaling pathway in epithelial cells of the respiratory tract and stimulates the cAMP-dependent opening of the wild type CFTR channel (whose nucleotide and amino acid sequences are available in the GenBank sequence database as access numbers NM_000492.3 and NP_000483.3, respectively) and of CFTR with the AF508 mutation (the sequence of this mutation is available in the GenBank sequence database as access number S64640.1), which is the main cause of cystic fibrosis.
Overall, the results shown here demonstrate the possibility of using the fusion peptide or homologs thereof, having the ability to inhibit ΡΙ3Κγ, as a local therapy by inhalation, for treating respiratory diseases such as allergic asthma and cystic fibrosis.
Although in the last decade numerous inhibitors of the kinase activity of ΡΙ3Κγ have been developed, many of which are currently in clinical development for treating neoplastic diseases, there are no methods that allow selective interference with the kinase- independent activity, or rather with the PKA- or AKAP- anchoring protein, of the enzyme.
It has been previously shown that a peptide which comprises the binding site of ΡΙ3Κγ to PKA, consisting of residues 126-150 of human ΡΙ3Κγ, displaces the interaction between the two proteins and reduces the activity of the PI3Ky-bound PDE, PDE3B, in in vitro interaction studies (1) .
The present description shows, in a completely unexpected way, that the ΡΙ3Κγ 126-150 peptide (SEQ ID No.: 1 - KATHRSPGQIHLVQRHPPSEESQAF) conjugated to a peptide permeable to cell membranes, such as, for example, the Penetratin 1 of Antennapedia (SEQ ID No.: 3) (3), can be used as an inhibitor of the kinase- independent function of ΡΙ3Κγ in vivo. The ΡΙ3Κγ inhibitory fusion peptide penetrates smooth muscle cells of the airways and enhances the β2-AR/cAMP signaling pathway. In particular, the data show that the fusion peptide increases cAMP levels and limits airway hyperresponsiveness in a preclinical model of allergic asthma and that it efficiently reaches the lower respiratory tract when administered locally by the intra-tracheal route. These data therefore demonstrate the clinical use of a ΡΙ3Κγ inhibitory fusion peptide in aerosol therapy for treating respiratory diseases.
The current inhalation therapy for bronco- obstructive diseases is based on the use of β2-ΑΚ agonists, such as salbutamol and formoterol and of PDE4 inhibitors, such as Roflumilast, which was recently approved for treating chronic obstructive pulmonary disease (COPD) .
Although acute treatment with β-AR agonists produces evident clinical benefits, chronic or repeated exposure to these drugs may result in a significant reduction and/or complete loss of their effectiveness in asthmatic patients, due to the agonist-dependent desensitization of membrane β-ARs.
The present description provides a solution to this problem and proposes the use of an inhibitory peptide that affects the activity of the enzyme ΡΙ3Κγ and, as such, does not act directly on the stimulation of β2~ΑΚ, but enhances the cascade of downstream signaling events. In this way, a ΡΙ3Κγ inhibitory peptide offers the unique opportunity to modulate β2~ AR-dependent cAMP domains, ensuring broncho-relaxing effects similar to those mediated by β2-AR agonists, without inducing receptor inactivation .
The data provided herein demonstrate that inhibiting the PKA-anchoring function of ΡΙ3Κγ only reduces the PDE activity in cells expressing ΡΙ3Κγ (ΡΙ3Κγ+/+) , but not in cells lacking the enzyme (ΡΙ3Κγ~7~ ) , thus indicating that the fusion peptide of the present description inhibits the PDEs exclusively regulated by ΡΙ3Κγ.
The ΡΙ3Κγ inhibitory peptide therefore represents a unique tool that ensures isoform-selective inhibition of PDEs and allows limiting the major side effects that are associated with non-selective inhibitors of PDE4, such as Roflumilast, arising mainly from inhibition of isoforms that are not expressed in the respiratory system.
Although PDE4 inhibitors are characterized by important pro-relaxant effects in isolated cells, they are not optimal bronchodilators in vivo, where they mainly exert anti-inflammatory functions.
The results provided herein demonstrate that the fusion peptide with the ability to inhibit the kinase- independent function of ΡΙ3Κγ, subject of the present description, has a strong bronchodilator function in vivo, in healthy animals and in a pre-clinical model of allergic asthma. These effects can be explained by the ability of the peptide to interfere with the catalytic activity of multiple PDE isoforms, not only including PDE4, but also PDE3.
In agreement with the present data, it has been shown that inhibiting PDE3 and PDE4 can be additive or synergistic. In particular, PDE4 and PDE3 inhibitors are ineffective if used alone, but act synergistically in inhibiting smooth muscle contraction. Therefore, inhibiting the kinase-independent activity of ΡΙ3Κγ provides a unique tool to simultaneously inhibit specific isoforms of PDE3 and PDE4, in particular those critically involved in regulating the contractility of the bronchial smooth muscle.
Since PDE3 and PDE4 are not only expressed in the airways, but also in the myocardium and the central nervous system, systemic inhibition of even selected isoenzymes can cause major side effects. In particular, the inhibition of PDE3 and PDE4 in vivo may have pro- arrhythmogenic, pro-emetic and pro-anorexigenic effects.
The present description shows that the fusion peptide having the ability to inhibit the kinase- independent activity of ΡΙ3Κγ is therapeutically effective, and that an aerosol formulation of the ΡΙ3Κγ inhibitory peptide is distributed efficiently in the lower respiratory tract. Furthermore, the use of a peptide molecule provides a broader therapeutic effect/side effect profile compared to small molecules, such as PDE inhibitors, which can diffuse rapidly to other tissues outside of the respiratory system.
The data provided herein demonstrate that a fluorescent version of the ΡΙ3Κγ inhibitory peptide accumulates in the trachea and lungs following intra¬ tracheal administration, without reaching the myocardium and the brain.
On the basis of these data, it is therefore possible to conclude that an inhalation therapy based on a peptide, permeable to cell membranes, which selectively inhibits the kinase-independent activity of the ΡΙ3Κγ enzyme, is highly effective. This therapeutic approach can be used for treating different respiratory diseases, from asthma to cystic fibrosis, where agents able to increase intracellular cAMP downstream of β2~ ARs are necessary.
The results presented here demonstrate that the ΡΙ3Κγ inhibitory peptide not only increases cAMP levels in smooth muscle, but also in the epithelial compartment of the airways, thus opening up the possibility of exploiting this compound to also stimulate the cAMP-mediated opening of the CFTR channel, which is defective in patients with cystic fibrosis. The data provided here also show that inhibition of ΡΙ3Κγ acts synergistically with a known, clinically advanced, CFTR potentiator, VX-770, by increasing the conductance of one of the most common mutated forms of CFTR in cystic fibrosis. These data demonstrate, for the first time, the ability of a PI3KY-inhibiting molecule to increase the activity of a known CFTR potentiator, VX-770, which is known to stimulate the conductance of different mutant forms of CFTR, with the exception of the most common mutant in cystic fibrosis, AF508.
The fusion peptide of the present description may therefore be used in combination with a potentiator of cystic fibrosis transmembrane conductance regulator (CFTR) and/or a corrector of the cystic fibrosis transmembrane conductance regulator (CFTR) , as a combined preparation for the sequential, simultaneous or separate use in treating respiratory diseases characterized by a defective cAMP-mediated opening of CFTR, such as in patients with cystic fibrosis.
The combined use of a potentiator of the cystic fibrosis transmembrane conductance regulator (CFTR) , and a corrector of the cystic fibrosis transmembrane conductance regulator (CFTR) , together with the fusion peptide of the present description, is particularly suitable for treating cystic fibrosis patients carrying the AF508 CFTR mutation, to whom administration of a CFTR corrector is necessary to allow the expression of mutant CFTR at the membrane.
Potentiators of the cystic fibrosis transmembrane conductance regulator (CFTR) , which can be advantageously used in combination with the fusion peptide of the present description are, for example: Ivacaftor or VX-770 (N- (2, 4-Di-tert-butyl-5- hydroxyphenyl ) -1, 4-dihydro-4-ossoquinoline-3- carboxamide ) and VX-532 ( 4-Methyl-2- ( 5-phenyl-lH- pyrazol-3-yl ) -phenol ) .
Correctors of the cystic fibrosis transmembrane conductance regulator (CFTR) , which can be advantageously used in combination with the fusion peptide of the present description and with a potentiator of the cystic fibrosis transmembrane conductance regulator (CFTR) are for example: VX-809 (3- (6- (1- ( 2 , 2-difluorobenzo [d] [1,3] dioxol- 5yl) cyclopropanecarboxamido ) -3-methylpyridin-2- yl)benzoic acid) and VX-661 ((R)-l-(2,2- difluorobenzo [d] [1,3] dioxol-5-yl ) -N- ( 1- ( 2 , 3- dihydroxypropyl ) -6-fluoro-2- (l-hydroxy-2 methylpropan- 2-yl) -lH-indol-5-yl ) cyclopropanecarboxamide ) .
Overall, this study demonstrates the therapeutic potential of a fusion peptide that selectively inhibits the kinase-independent activity of ΡΙ3Κγ.
The molecule can be used for treating respiratory diseases, including allergic asthma, where drugs designed to increase intracellular levels of cAMP and to promote relaxation of bronchial smooth muscle are highly desirable.
In addition, this compound can be applied to patients with cystic fibrosis where agents that elevate cAMP concentrations are key tools to stimulate cAMP- mediated opening of defective CFTR.
Furthermore, peptide-mediated inhibition of ΡΙ3Κγ can be applied to all pathological conditions characterized by a hypo-functional CFTR, including COPD, where the exposure to cigarette smoke has been demonstrated to alter the activity of CFTR.
Finally, through the functional block of PDE4, the fusion peptide of the present description having the ability to inhibit ΡΙ3Κγ is capable of exerting important anti-inflammatory actions. The experimental evidence reported here demonstrates that the peptide indeed limits the peribronchial inflammation associated with allergic asthma. It is therefore evident that inhibiting the kinase-independent activity of ΡΙ3Κγ can provide multiple independent therapeutic benefits in treating respiratory diseases, acting at the same time as a bronchodilator, CFTR potentiator and antiinflammatory agent.
Below, the invention will be described in detail, by way of non-limiting example, with reference to a fusion peptide having the sequence shown in SEQ ID No.: 2 (hereinafter also referred to as "Trojan peptide derived from ΡΙ3Κγ"), comprising the amino acid sequence SEQ ID No.: 1 and a peptide penetrating the cell corresponding to the Penetratin 1 of Antennapedia (SEQ ID No.: 3, described in (3)) .
It is clear that the scope of this description is not in any way limited to the specific sequence of the fusion peptide of SEQ ID No.: 2, since the fusion peptide of the present description can comprise i) sequences having a homology with SEQ ID No.: 1 of at least 90% and having the ability of SEQ ID No.: 1 to inhibit the kinase-independent function of ΡΙ3Κγ and ii) sequences of a peptide penetrating the cell, for example, selected from the polypeptide HIV-TAT, Antennapedia homeodomain peptides, also known as penetrating peptides or pAntp, R7 peptide, KALA peptide, buforin 2, MAP, transportan, transportan 10, pVEC, or MPG peptide. The sequences corresponding to the polypeptides penetrating the cells mentioned above are shown in Figure 6 and specified in SEQ ID No.: 3 to 12.
Moreover, in producing the Trojan peptide derived from ΡΙ3Κγ, the peptide having the ability to penetrate the cell was fused to the N-terminus of SEQ ID No.: 1. It is, however, possible to produce a fusion peptide that falls within the scope of the present description by creating a fusion of the peptide having the ability to penetrate the cell at the C-terminus of the SEQ ID No . : 1.
Materials and Methods
Determining the ability of a peptide homologous to SEQ ID No. : 1 to inhibit the kinase-independent function of ΡΙ3Κγ
To determine the ability of a homolog peptide, having at least 90% identity with SEQ ID No.: 1, to inhibit the function of AKAP of ΡΙ3Κγ, a previously- described competition assay was used (1) . The homolog peptide was re-suspended in phosphate-buffered saline solution (PBS) to a final concentration of 50 μΜ or 250 uM. HEK293 cells (ATCC Number: CRL-1573™) were transfected, using the calcium phosphate method, with a construct made of the expression vector pcDNA3.1 (Life Technologies, Carlsbad, CA, USA; product code V790-20), in which human ΡΙ3Κγ cDNA was cloned (SEQ ID No.: 13) using the restriction enzymes BamHI and Xbal (New England Biolabs, Ipswich, MA, USA) . The pcDNA3.1-ΡΙ3Κγ construct is freely available from Dr. Emilio Hirsch at the University of Turin, Turin, ITALY.
At 48 hours following transfection, cells were lysed in cold lysis buffer containing 120 mmol/L NaCl, 50 mmol/L Tris-HCl (pH 8.0), complete protease inhibitors (Roche Applied Science, Indianapolis, IN) and phosphatase inhibitors (50 mmol/L sodium fluoride, 1 mmol/L sodium orthovanadate and 10 mmol/L sodium pyrophosphate) . After 30 min of incubation on ice, lysates were centrifuged at 13000 rpm for 10 min at 4°C and the supernatant was incubated with the peptide for 30 minutes at room temperature. After incubation, the regulatory subunit of PKA (PKA RII) was immunoprecipitated by incubating the protein extract with 30 μΐ of a 1:1 mixture of Protein A and Sepharose (Amersham Biosciences, Buckinghamshire, UK) and an anti-PKA RII C20 antibody (Santa Cruz Biotechnology Inc., Dallas, Texas, USA; product code: sc-908) for 2 h at 4°C, with shaking. Immune complexes were washed extensively with lysis buffer and the association of ΡΙ3Κγ with PKA RII was analyzed by Western blot analysis using a monoclonal anti-PI3KY antibody (freely available from Dr. Emilio Hirsch at the University of Turin, Turin, Italy) .
Animals
Knock-out mice for ΡΙ3Κγ (ΡΙ3Κγ_ ~) and knock-in mice expressing a catalytically-inactive form of ΡΙ3Κγ (ΡΙ3ΚγΚΒ ΚΒ) were generated as previously described (4, 5) . Mutant mice were crossed with animals of a C57B1/6J genetic background for 15 generations and C57B1/6J mice were used as controls (ΡΙ3Κγ+ +) . For studies of airway hyperresponsiveness in asthmatic and healthy mice, BALB/C female mice were used. For all experiments, animals between the ages of 8 and 12 weeks were used. Mice were maintained in groups, with free access to food (standard diet) and water, in a controlled system which provides a cycle of 12 hours of light and 12 hours of darkness. Animals were used according to the guidelines and institutional regulations on animal welfare, approved by the local Animal Ethics Committee. Cell culture and transfection
Human bronchial smooth muscle cells (hBSMCs) were purchased from Lonza (CC-2576, Lonza Walkersville, Inc. USA), grown in Dulbecco's Modified Eagle Medium (DMEM, Gibco, Carlsbad, CA) , and supplemented with 10% fetal bovine serum (FBS) and 5 mM penicillin/streptomycin (Gibco, Carlsbad, CA) . Cells up to passage 15 were used for experiments.
Human bronchial smooth muscle cells (hBSMCs) were transfected with a plasmid encoding the FRET probe for cAMP, ICUE3 (described in the US patent US 8236523 B2 ) (2), by electroporation with a Nucleofector device (AMAXA, Gaithersburg, MD) , according to the manufacturer's protocol. Briefly, 1 x 10s cells were re-suspended in 100 μΐ of nucleofection solution (VPI- 1004, AMAXA, Gaithersburg, MD) , mixed with 1 μg of pcDNA3- ICUE3 (described in US patent US 8236523 B2), and subjected to electroporation in a nucleofection apparatus of Amaxa Biosystems (Program A-033) . Live cell imaging experiments were performed at 24 hours after transfection .
Human airway epithelial cell lines expressing a wild-type CFTR (NuLi-1) or with the AF508 mutation (CuFi-1) were purchased from ATCC (NuLi-1 product code: ATCC® CRL-4011™; CuFi-1 product code: ATCC® CRL-4013™) . Cells were cultured in Dulbecco's Modified Eagle Medium (DMEM, Gibco, Carlsbad, CA) supplemented with 10% fetal bovine serum (FBS), 30 μg/mL of penicillin, 100 μg/mL of streptomycin and 300 μg/mL hygromycin B (Gibco, Carlsbad, CA) .
Protein extraction and immunoprecipitation
For protein extraction from murine tracheal smooth muscle cells (mTSMCs) and human bronchial smooth muscle cells (hBSMCs), cells were treated with the indicated drugs/peptides and immediately lysed in cold lysis buffer containing 120 mmol/L NaCl, 50 mmol/L Tris-HCl (pH 8.0), complete protease inhibitors (Roche Applied Science, Indianapolis, IN) and phosphatase inhibitors (50 mmol/L sodium fluoride, 1 mmol/L sodium orthovanadate and 10 mmol/L sodium pyrophosphate) . After 30 min of incubation on ice, lysates were centrifuged at 13000 rpm for 10 min at 4°C and used for either Western blotting or subjected to immunoprecipitation and measurements of phosphodiesterase activity.
For immunoprecipitation assays, protein extracts were pre-incubated with 30 μΐ of a 1:1 mixture of protein A or G and sepharose (Amersham Biosciences, Buckinghamshire, UK) and subsequently incubated with 20 μΐι of a 1:1 mixture of protein A or G and sepharose and 1 mg of primary antibody for each mg of protein, for 2 hours at 4°C. Immune complexes were washed extensively with lysis buffer and used for Western blotting or subjected to measurements of phosphodiesterase activity.
FRET imaging and analysis
Measurements of cAMP levels were performed on human bronchial smooth muscle cells (hBSMCs) that express the FRET probe ICUE3, as described previously (2) . Briefly, cells were maintained in a K+-Ringer solution containing (in mmol/L) 121.6 NaCl, 5.4 KC1, 1.8 MgCl2, 1.8 CaCl2, 4 NaHC03, 0.8 NaH2P04, 5 D-glucose, 5 sodium pyruvate, 10 HEPES, at pH 7.4. FRET recordings were carried out before and after adding 100 nmol/L of isoproterenol (Iso) and 100 nmol/L of CGP-20712A (CGP) , using a SP5 Leica TCS system (Leica Microsystems Inc., Buffalo Grove, IL , USA) with an argon laser and with a 63x immersion lens. To excite CFP and YFP, 458 and 514 nm wavelengths were used, respectively. Images were acquired every 4 seconds without any media line, at a scanning speed of 400 MHz and a resolution of 512 x 512 pixels. FRET efficiency was calculated using the "Method 3" provided by the Leica wizard application for FRET imaging and sensitized emission, according to which: EA(i) = B/A, where EA(i) is the apparent FRET efficiency; A and B are the intensities of the CFP channel and FRET, respectively. For imaging in hBSMCs treated with peptides, cells expressing the FRET indicator ICUE3 were pre-incubated with 50 μΜ of the Trojan peptide derived from ΡΙ3Κγ (SEQ ID No.: 2
RQIKIWFQNRRMKWKKGKATHRSPGQIHLVQRHPPSEESQAF) or the PI control peptide (SEQ ID No.: 3 - RQIKIWFQNRRMKWKK) for 30 minutes prior to treatment with Iso and CGP . Phosphodiesterase activity assay
Phosphodiesterase activity in immunoprecipitates was measured according to the two-step method of Thompson and Appleman, as previously described (2), with minor modifications. Briefly, immunoprecipitates were assayed in a total volume of 200 μΐ of reaction mixture containing 40 mmol/L Tris-HCl (pH 8.0), 1 mmol/L MgCl2, 1.4 mmol/L 2-mercapto-ethanol and 0.1 pCi of [3H] cAMP (Amersham Bioscience, Buckinghamshire, UK) for 40 min at 33°C. To stop the reaction, samples were boiled at 95°C for 3 min. The reaction product 5 ' -AMP was then hydrolyzed by incubation of the mixture with 50 μg of snake venom from Crotalus Atrox for 15 min at 37°C (Sigma-Aldrich, St. Louis, MO) . The resulting adenosine was separated by anion exchange chromatography with 400 μL of a suspension of Dowex resin AG1-X8 (Bio-Rad, Segrate, Milan, Italy) , water and 100% ethanol in equal parts. The amount of radiolabeled adenosine in the supernatant was quantified by scintillation counting (Ultima Gold liquid scintillation from Perkin Elmer, Waltham, MA) .
Isolation of mouse tracheal smooth muscle cells Murine tracheal smooth muscle cells were cultured from explants of trachea using previously described methods with modifications. The entire trachea between the larynx and bronchi was removed and placed in a sterile Petri dish containing Hanks' s balanced salt solution at room temperature and a 2x concentration of antibiotic-antimycotic (Gibco, Carlsbad, CA, product code: 15240-062) . Using a dissecting microscope, the additional surrounding tissue was removed, the tracheal segment was divided longitudinally and cut into squares of 2-3 mm in size. All the segments of a single trachea were then placed with the inner face towards the bottom of a 60 mm sterile cell culture plate. After adherence of the explants to the plate, 2.5 ml of Dulbecco's Modified Eagle Medium (DMEM, Gibco, Carlsbad, CA) , supplemented with 20% fetal bovine serum was added to cover the explants. Explants were incubated at 37 °C in a humidified atmosphere with 95% air and 5% CO2. Three days after plating, the concentrations of FBS and antibiotic-antimycotic were reduced to 10% and lx, respectively. Tracheal segments were removed when cells became locally confluent. Once the 60 mm plate became confluent, cells were detached by trypsinization and transferred to a single 60 mm plate. Tracheal smooth muscle cells were further subdivided for several passages in a 1:2 ratio. More than 90% of these cells were smooth muscle cells, as determined by immunofluorescence performed with an antibody specific for smooth muscle actin. All experiments were performed on confluent cells at passage 3.
Measurements of calcium transients
hBSMCs were loaded with the calcium indicator
Indo-l-AM (2 uM, Invitrogen, Carlsbad, California) at 37°C for 40 minutes in the presence of PI control peptide, Trojan peptide derived from ΡΙ3Κγ or vehicle. Cells were washed with a Tyrode solution containing (in mmol/L) : 5 HEPES, 154 NaCl, 4 KC1, 2 CaCl2, 1 MgCl2, 5.5 D-glucose, at pH 7.35 and placed on an inverted microscope. Cells were kept in Tyrode solution and treated with a KCl depolarizing solution containing (in mmol/L) : 5 HEPES, 118 NaCl, 40 KCl, 2 CaCl2, 1 MgCl2, 5.5 D-glucose, at pH 7.35. Calcium transients were analyzed as the ratio of fluorescence signals measured at 400 nm and 490 nm following excitation of Indo-l-AM- loaded cells at 350 nm. Experiments were recorded and analyzed with Igor® Software, using the functions added by Jason Rothman (Neuromatic, www.thinkrandom.com) .
Measurements of chloride currents in the Ussing chamber
To measure chloride currents in normal and AF508 primary human bronchial epithelial cells, cells were cultured on 1.12 cm2 Snapwell inserts. Filters were mounted in Ussing chambers, and a chloride gradient was applied by incubating the cells in a basolateral high- chloride buffer containing (in mmol/L) : 140 NaCl, 5 KCl, 0.36 K2HP04, 0.44 KH2 PO4 , 1.3 CaCl2, 0.5 MgCl2, 4.2 NaHC03, 10 HEPES, and 10 glucose, at pH 7.4 and an apical low-chloride buffer containing (in mmol/L) : 133.3 Na-gluconate, 5 K-gluconate, 2.5 NaCl, 0.36 K2HPO4 , 0.44 KH2 PO4 , 5.7 CaCl2, 0.5 MgCl2, 4.2 NaHC03, 10 HEPES, and 10 mannitol, at pH 7.4. Buffers were aerated with a mixture of 95% 02 and 5% C02 and the temperature was maintained at 37 °C during the experiment. Cultures were maintained at a voltage of 0 mV using an EVC4000 Multichannel V/I Clamp (World Precision Instruments, Sarasota, FL, USA) . After a stabilization period of 30 minutes, drugs were added at specific times, while the current was continuously recorded. cAMP extraction and quantification Lungs and trachea were explanted from animals following euthanasia, pulverized in liquid nitrogen and used for cold extraction of cAMP with 6% trichloroacetic acid. Samples were sonicated for 10 seconds and centrifuged at 13000 rpm at 4°C for 15 minutes. Supernatants were washed four times with five volumes of diethyl ether saturated with water and lyophilized. cAMP content was detected with an Amersham cAMP BioTrak Enzymeimmunoassay System (GE Healthcare Life Sciences, Pittsburgh, USA, product code: RPN225) , according to the manufacturer's protocol.
Analysis of the transduction efficiency of the Trojan peptide derived from ΡΙ3Κγ in vivo
hBSMCs were incubated with the Trojan peptide derived from ΡΙ3Κγ (SEQ ID No.: 2) conjugated to fluorescein (50 uM) or vehicle for 30 minutes, fixed with 4% paraformaldehyde (PFA) for 10 minutes and permeabilized with phosphate-buffered saline (PBS) + 0.5% Triton ( Sigma-Aldrich, St. Louis, MO) for 5 minutes at room temperature. Cells were then incubated with PBS containing 3% bovine serum albumin (BSA, Sigma-Aldrich, St. Louis, MO) and phalloidin-Alexa 488 (1: 1000, Thermo Fisher Scientific, Waltham, MA, USA) for 30 minutes and mounted on microscope slides with ProLong® Antifade Reagent (Thermo Fisher Scientific, Waltham, MA, USA) . Red (actin) and FITC (peptide) fluorescence images were acquired with a Zeiss Observer-Zl, equipped with an Apotome module (Carl Zeiss, Oberkochen, Germany) .
Wild-type BALB/C mice were injected by the intra¬ tracheal route with 1.5 μg of the Trojan peptide derived from ΡΙ3Κγ conjugated to fluorescein or vehicle, in a final volume of 70 μL of PBS. After 30 minutes, animals were anesthetized, the trachea and lungs were insufflated with PBS, extracted and frozen in OCT. Cryosections of 10 microns were obtained with a Leica CM1850 cryostat (Leica Microsystems GmbH, Wetzlar, Germany) and fluorescence was acquired with a Zeiss Observer-Zl, equipped with an Apotome module (Carl Zeiss, Oberkochen, Germany) .
Immunization with ovalbumin
Ovalbumin (100 μg) (OVA, Sigma-Aldrich, St. Louis, MO), complexed with aluminum potassium sulfate (1 mg, alum) was administered intraperitoneally (i.p.) on days 1 and 14, and intra-nasally (i.n.) (50 μg OVA in 50 μΐ PBS) on days 14, 25, 26, and 27. Control mice received i.p. injections of alum and i.n. injections of PBS only Airway hyperreactivity induced by inhaled methacholine was measured at 24 hours after the final dose of OVA (Day 28) .
Measurement of airway reactivity
Method 1. Mice sensitized to ovalbumin were anesthetized (sodium pentobarbital, 70-90 mg/kg, i.p.), tracheotomized, and connected to a FlexiVent ventilator for small animals (SCIREQ, Montreal, Quebec, Canada) . To induce airway constriction, mice were exposed to increasing concentrations of aerosolized methacholine (10~9 to 10~4 M, final concentration) .
Method 2: Mice sensitized to ovalbumin were treated, by intra-tracheal instillation, with 70 μL of phosphate-buffered saline solution (PBS) containing vehicle or 150 μg of the Trojan peptide derived from ΡΙ3Κγ or equimolar amounts of PI control peptide. Airway hyperresponsiveness was assessed at 30 minutes after the treatment according to a previously published protocol (6) . Briefly, mice were anesthetized (sodium pentobarbital, 70-90 mg/kg, i.p.), tracheotomized, and ventilated with a positive end-inspiratory pressure of 10 cm ¾0, positive end-expiratory pressure (PEEP) of 3 cm H20, respiratory rate of 90 breaths/min in ambient air. The airway opening pressure (Pao) , proximal to the endotracheal tube, and the pressure inside the chamber were measured with pressure transducers (Special Instruments, Digima Clic; Nordlingen, Germany) . Gas flow was measured with a pneumotachograph (Special Instruments, Digima Clic; Nordlingen, Germany) . Tidal volume was calculated as the integral of the flow signal. Variables of mechanical ventilation were recorded using the ICU-Lab software (KleisTEK Advanced Electronic Systems, Bari, Italy) . Airway hyper¬ reactivity was assessed as a change in tidal volume after treatment with 500 mg/kg of methacholine administered intravenously.
Analysis of airway inflammation in asthmatic mice Wild-type BALB/C mice were treated, by intra- tracheal instillation, with 25 μg of the Trojan peptide derived from ΡΙ3Κγ or equimolar amounts of PI control peptide, in a final volume of 70 i of phosphate- buffered saline (PBS), before each intra-nasal administration of ovalbumin (days 14, 25, 26, and 27 of the protocol of immunization with ovalbumin) . At 24 hours after the final injection (day 28), mice were anesthetized (sodium pentobarbital, 70-90 mg/kg, i.p.) and the tracheas incised and cannulated. The airways were washed with 2.5 ml of phosphate-buffered saline solution (PBS) . The total number of cells in the bronchoalveolar lavage (BAL) was determined with a Neubauer hemocytometer . A volume of 50 i of BAL was centrifuged onto cytospin glass slides at 400 rpm at room temperature for 5 minutes and stained with a Diff- Quick system (LabAids, Ronkonkoma, USA) . A total of 100 cells per slide were counted and classified as neutrophils, macrophages, lymphocytes and eosinophils on the basis of morphological criteria. Erythrocytes and epithelial cells were ignored and the results were expressed as cells/ml.
To assess the peribronchial inflammation, the lungs of a group of animals that had not been subjected to bronchoalveolar lavage were explanted, fixed in a solution of 4% paraformaldehyde (PFA) for 24 hours at 4°C and embedded in paraffin. Slices that were 5 μπι- thick, deparaffinized, stained with a hematoxylin-eosin solution (Bio-Optica, Milano, Italy) , dehydrated and mounted with glass coverslips. The extent of peribronchial inflammation was classified as follows: 0- normal; 1- few inflammatory cells; 3- a thick ring of inflammatory cells.
To evaluate the presence of goblet cells, lung slices were stained with periodic acid-Schiff' s reagent (PAS) (Bio-Optica, Milano, Italy) and the percentage of PAS-positive cells was calculated by counting the number of PAS-positive epithelial cells and total epithelial cells.
Antibodies r reagents and plasmids
PDE4B and PDE4D were immunoprecipitated as described previously (2), using polyclonal rabbit antibodies freely available from Dr. Marco Conti at the University of California San Francisco, San Francisco, CA, USA. Commercial antibodies specific for PDE4B and PDE4D can be purchased from Abeam (Abeam, Cambridge, MA, USA) : anti-PDE4B product code: abl4611; anti-PDE4D product code: abl4614. Rabbit polyclonal antibodies against Cavl .2 and phospho-Cavl .2 are freely available from Dr. William A. Catterall at the University of Washington, Seattle, WA, USA, . The antibody that recognizes substrates phosphorylated by PKA (P-PKA substrate) was purchased from Cell Signaling Technology (Danvers, MA, USA; product code: # 9621) and the antibody against CFTR clone M3A7 from Millipore (Billerica, MA, USA; product code: 05-583) .
ICUE3-pcDNA3 was described previously (2) .
Isoproterenol, CGP-20712A, carbachol, Rolipram, amiloride and forskolin were all purchased from Sigma (Sigma-Aldrich, St. Louis, MO) . The CFTR corrector VX- 809, the CFTR potentiator VX-770 and the CFTR inhibitor 172 were purchased from Selleckchem (Houston, TX, USA) .
The PI control peptide (SEQ ID No.: 3 RQIKIWFQNRRMKWKK) and the Trojan peptide derived from ΡΙ3Κγ (SEQ ID No . : 2
RQIKIWFQNRRMKWKKGKATHRSPGQIHLVQRHPPSEESQAF) were synthesized by GenScript (GenScript, Piscataway, NJ, USA) and Chinapeptides (Chinapeptides Co. Ltd., Shanghai, China) .
Statistical analysis
Prism software (GraphPad Software Inc., La Jolla, CA, USA) was used for statistical analysis. P values were calculated using the Student's t test, one-way or two-way ANOVA followed by Bonferroni test, as appropriate. In all the figures, graphs represent the mean value ± standard error of at least 3 independent experiments . .Results
A Trojan peptide derived from ΡΙ3Κγ enhances β2~ AR/cAMP signaling in bronchial smooth muscle cells
Strategies to increase cAMP levels downstream of β2-ARs in bronchial smooth muscle are of great interest for treating respiratory diseases. To explore the therapeutic potential of inhibiting PI3KY-dependent β2~ AR-cAMP signaling, a peptide inhibitor of the kinase- independent activity of ΡΙ3Κγ, the sequence of which is shown in SEQ ID No.: 2, was designed. A previous study indicates that a peptide comprising the 126-150 residues of human ΡΙ3Κγ (SEQ ID No.: 1) inhibits PKA anchoring and decreases the activity of PI3Ky-bound phosphodiesterase 3B in vitro (1) . To inhibit the PKA anchoring activity of ΡΙ3Κγ in vivo, an inhibitory fusion peptide permeable to cell membranes was obtained by binding the 126-150 domain of human ΡΙ3Κγ (SEQ ID No.: 1) with the Trojan peptide of Antennapedia Penetratin 1 (SEQ ID No.: 3 - Figure 1A) . A version of the ΡΙ3Κγ inhibitory Trojan peptide labeled with fluorescein (FITC) accumulated in the cytoplasm of human bronchial smooth muscle cells (hBSMCs) at 30 minutes after incubation, showing that the inhibitor is efficiently transduced in vivo in isolated cells (Figure IB) . In addition, the ΡΙ3Κγ inhibitory peptide significantly reduced the catalytic activity of PDE4B and PDE4D in tracheal smooth muscle cells of wild-type mice (ΡΙ3Κγ+ +) , but not of animals devoid of the enzyme (ΡΙ3Κγ_ ~) (Figure 1C) , demonstrating the ability of the peptide to selectively interfere with PI3Ky-dependent anchoring of PKA. In accordance with these data, pre- treatment of hBSMCs with the ΡΙ3Κγ inhibitory Trojan peptide increased cAMP accumulation by 35% following stimulation of β2-ΑΚε, while cAMP levels were unchanged in cells treated with PI control peptide (Figures ID and E) .
Since cAMP is known to induce a decrease of intracellular levels of Ca2+ and, as a consequence, to promote smooth muscle relaxation, the ability of the ΡΙ3Κγ inhibitory Trojan peptide to modify Ca2+ concentrations in hBSMCs was analyzed. The maximum peak of Ca transients induced by the muscarinic agonist carbachol was significantly lower in hBSMCs pre-treated with the ΡΙ3Κγ inhibitor compared to cells exposed to vehicle or to PI control peptide (Figure 2A-B) . The primary mechanism by which cyclic nucleotides limit intracellular Ca2+ in smooth muscle cells is the inhibition of voltage-dependent Ca2+ channels (VOCCs) . Moreover, it has been previously demonstrated that ΡΙ3Κγ is a key regulator of cAMP in the vicinity of these Ca2+ channels (2) . To verify whether inhibiting the anchoring activity of ΡΙ3Κγ impairs the influx of Ca2+ through VOCCs, hBSMCs were exposed to a solution containing KC1, able to depolarize the membrane and, therefore, to activate VOCCs. The influx of Ca2+ induced by KC1 was completely abolished by the ΡΙ3Κγ inhibitory Trojan peptide, while it was unchanged in hBSMCs treated with PI control peptide or vehicle (Figure 2A-B) . To further support these results, the cAMP-mediated phosphorylation of the pore-forming subunit of the Ca2+ channel, Cav1.2, was found to be significantly higher in hBSMCs treated with the inhibitor of ΡΙ3Κγ compared to control cells treated with vehicle or with the PI peptide (Figure 2C) .
Overall, these data indicate that a Trojan peptide that inhibits the PKA anchoring function of ΡΙ3Κγ constitutes a novel method for inhibiting selected PDEs and enhancing cAMP signaling downstream of β2-ΑΚε, in smooth muscle cells. A Trojan peptide derived from ΡΙ3Κγ limits airway hyperresponsiveness in healthy and asthmatic mice
To determine the transduction efficiency of the ΡΙ3Κγ inhibitory peptide in vivo in the airways, a fluorescein ( FITC) -labelled form of the peptide was instilled by the intra-tracheal route in BALB/C wild- type mice. FITC fluorescence was detected in the trachea and lungs, but not in the brain or in the myocardium, at 30 minutes after administration (Figure 3A) ; this demonstrates that the peptide is efficiently distributed in the respiratory tract of the animals. In addition, cAMP levels were 30% higher in the trachea and in the lungs of mice injected with the ΡΙ3Κγ inhibitory Trojan peptide compared to control animals treated with phosphate-buffered saline solution (PBS) or PI control peptide (Figure 3B) . In agreement with an enhanced cAMP accumulation in the respiratory tract, airway hyperreactivity induced by the muscarinic agonist methacholine was significantly attenuated by the ΡΙ3Κγ inhibitory peptide, but not by the PI control peptide, in healthy mice (Figure 5C) . To verify if the intra-tracheal administration of the Trojan peptide derived from ΡΙ3Κγ suppresses the airway hyperresponsiveness associated with allergic asthma, a pre-clinical model of ovalbumin (OVA) -induced asthma was generated. The reduction of the tidal volume induced by methacholine was significantly attenuated in animals treated with the ΡΙ3Κγ inhibitory peptide compared to control mice, which received PBS or the PI peptide (Figure 3D) .
Taken together, these data demonstrate the ability of the Trojan peptide derived from ΡΙ3Κγ to increase cAMP levels in vivo in the airways and to function as a bronchodilator . A Trojan peptide derived from ΡΙ3Κγ increases cAMP levels and enhances the conductance of CFTR in bronchial epithelial cells expressing wild-type or a AF508 mutant CFTR
Subsequently, the ability of the ΡΙ3Κγ inhibitory Trojan peptide to increase cAMP levels not only in smooth muscle cells, but also in epithelial cells of the airways, was examined. For this purpose, we analyzed cAMP-mediated phosphorylation of the cystic fibrosis transmembrane conductance regulator (CFTR) , the main chloride (Cl~) channel in the epithelium of the respiratory tract, the activation of which is cAMP- dependent . CFTR phosphorylation was significantly higher in normal human bronchial epithelial cells (Nuli-1) treated with the Trojan peptide derived from ΡΙ3Κγ, compared to control cells exposed to vehicle or to PI control peptide (Figure 4A) . In particular, inhibition of the anchoring function of ΡΙ3Κγ further enhanced cAMP-dependent CFTR phosphorylation induced by a known inhibitor of PDE4 (Figure 4B) , suggesting that the ΡΙ3Κγ inhibitory peptide not only inhibits PDE4, but also other PDE isoforms known to be associated with ΡΙ3Κγ, such as PDE3 (2) .
To examine whether increased CFTR phosphorylation correlates with higher Cl~ conductance, measurements of Cl~ currents were performed in Ussing chambers in NuLi- 1 cells expressing wild-type CFTR. CFTR-dependent currents increased significantly following the application of the Trojan peptide derived from ΡΙ3Κγ, while the PI control peptide did not change the conductance (Figure 4C) . These data thus reveal a novel role for the ΡΙ3Κγ inhibitory peptide as a CFTR potentiator .
Molecules with CFTR potentiator activity are required to stimulate the opening of the defective CFTR in the treatment of cystic fibrosis (CF) . To determine if the Trojan peptide derived from ΡΙ3Κγ is able to correct the defective Cl~ conductance of the mutant CFTR, CFTR-dependent currents were measured in bronchial epithelial cells expressing the mutant CFTR AF508-CFTR (CuFi-1) . ΡΙ3Κγ inhibition synergistically increased the activity of the known CFTR potentiator, VX-770, resulting in an increase of the CFTR currents by about 5-fold more than the basal activity (Figures 4A and B) . By contrast, the PI control peptide did not change the CFTR activity of in the presence of VX-770 (Figures 4A and B) .
Overall, these data reveal a novel function for the ΡΙ3Κγ inhibitory peptide as a CFTR potentiator, which promotes cAMP-dependent opening of the wild-type channel and the mutant CFTR (AF508-CFTR) .
A PI3Ky-derived Trojan peptide limits lung in lammation in asthmatic mice
It is well known that an increase of cAMP in leukocytes promotes an anti-inflammatory response. Therefore, the ability of the PI3KY-derived Trojan peptide to increase cAMP concentrations in this cell type and, therefore, to limit the inflammation associated with chronic respiratory diseases, was evaluated. Mice pre-treated with the PI control peptide before each intranasal injection of ovalbumin showed an increase in peribronchial inflammation (Figures 7A and B) , and in the number of goblet cells, containing mucus and positive to the periodic acid-Schiff' s reagent (PAS) staining (Figures 7A and C) , compared to control animals not sensitized to ovalbumin (naive) . The Trojan peptide derived from ΡΙ3Κγ significantly reduced both the peribronchial inflammatory infiltrate (Figures 7A and B) and the number of goblet cells (Figures 7A and C) . In agreement with these results, the number of neutrophils present in the bronchoalveolar lavage was significantly lower in the animals treated with the ΡΙ3Κγ inhibitory Trojan peptide compared to controls that received the PI peptide (Figure 7D) . By contrast, other leukocyte populations such as macrophages, lymphocytes and eosinophils were unchanged (Figure 7E- F-G) .
Overall, this experimental evidence demonstrates the ability of the Trojan peptide derived from ΡΙ3Κγ to selectively inhibit the neutrophilia associated with chronic respiratory diseases, and therefore to function as an anti-inflammatory drug.
Re erences
A. Perino et al . , Mol Cell 42, 84 (Apr 8, 2011) . A. Ghigo et al . , Circulation 126, 2073 (Oct 23, 2012) .
M. Delia Peruta, C. Giagulli, C. Laudanna, A. Scarpa, C. Sorio, Mol Cancer 9, 61 (2010) .
E. Hirsch et al . , Science 287, 1049 (Feb 11, 2000) . E. Patrucco et al . , Cell 118, 375 (Aug 6, 2004) . V. Fanelli et al . , Intensive Care Med 36, 1935 (Nov, 2010) .

Claims

Claims
1. A fusion peptide comprising:
i) an amino acid sequence as defined in SEQ ID No.: 1 or a related homolog having at least 90% identity with
SEQ ID No.: 1 and having the ability of the sequence SEQ ID No.: 1 to inhibit the kinase-independent function of ΡΙ3Κγ, and
ii) a peptide having the ability to penetrate a cell.
2. Fusion peptide according to claim 1, wherein the peptide having the ability to penetrate a cell is selected from the sequences specified in SEQ ID No.: 3 to 12.
3. Fusion peptide according to claim 1 or claim 2, wherein the peptide having the ability to penetrate a cell is conjugated to the C-terminal or the N-terminal of SEQ ID No.: 1 or its homologs.
4. Fusion peptide according to any of the preceding claims for use as a medicament.
5. Fusion peptide according to any of the preceding claims for use in treating respiratory diseases, preferably bronco-obstructive diseases.
6. Fusion peptide according to claim 5, wherein the respiratory diseases are selected from allergic asthma, cystic fibrosis, and chronic obstructive pulmonary disease .
7. Fusion peptide according to any of claims 4 to 6, wherein the fusion peptide is suitable for administration by inhalation.
8. A product comprising:
i) a fusion peptide according to any of claims 1 to 3 and
ii) a potentiator of the cystic fibrosis transmembrane conductance regulator (CFTR) and/or a corrector of the cystic fibrosis transmembrane conductance regulator (CFTR) as a combined preparation for sequential, simultaneous or separate use in treating respiratory diseases, preferably bronco-obstructive diseases, more preferably cystic fibrosis.
9. Product according to claim 8, wherein the potentiator of the cystic fibrosis transmembrane conductance regulator (CFTR) is selected from VX-770 (N- (2, 4-Di-tert-butyl-5-hydroxyphenyl ) -1, 4-dihydro-4- ossoquinolin-3-carboxamide ) and VX-532 ( 4-Methyl-2- ( 5- phenyl-lH-pyrazol-3-yl ) -phenol) .
10. Product according to claim 8 or claim 9, wherein the corrector of the cystic fibrosis transmembrane conductance regulator (CFTR) is selected from VX-809 (3- (6- (1- (2, 2-difluorobenzo [d] [1,3] dioxol-5- yl) cyclopropanecarboxamido ) -3-methylpyridin-2- yl)benzoic acid) and VX-661 ((R)-l-(2,2- difluorobenzo [d] [1,3] dioxol-5-yl ) -N- ( 1- ( 2 , 3- dihydroxypropyl ) -6-fluoro-2- ( l-hydroxy-2-methylpropan- 2-yl) -lH-indol-5-yl ) cyclopropanecarboxamide) .
11. A method for treating respiratory diseases comprising the administration to a patient in need thereof at least one fusion peptide according to any of claims 1 to 3, in an amount sufficient to carry out said treatment.
12. A pharmaceutical composition comprising at least one fusion peptide according to any of claims 1 to 3 or a product according to any of claims 8 to 10 and a pharmaceutically acceptable vehicle.
PCT/IB2015/059880 2014-12-24 2015-12-22 Novel pi3k gamma inhibitor peptide for treatment of respiratory system diseases Ceased WO2016103176A1 (en)

Priority Applications (14)

Application Number Priority Date Filing Date Title
NZ733017A NZ733017B2 (en) 2015-12-22 Novel pi3k gamma inhibitor peptide for treatment of respiratory system diseases
AU2015370463A AU2015370463B2 (en) 2014-12-24 2015-12-22 Novel PI3K gamma inhibitor peptide for treatment of respiratory system diseases
EP15830858.5A EP3236983B1 (en) 2014-12-24 2015-12-22 Novel pi3k gamma inhibitor peptide for treatment of respiratory system diseases
PL15830858T PL3236983T3 (en) 2014-12-24 2015-12-22 Novel pi3k gamma inhibitor peptide for treatment of respiratory system diseases
ES15830858T ES2737227T3 (en) 2014-12-24 2015-12-22 Novel PI3K gamma inhibitor peptide for the treatment of diseases of the respiratory system
CN201580071130.7A CN107406488B (en) 2014-12-24 2015-12-22 Novel PI3Kγ inhibitor peptides for the treatment of respiratory diseases
US15/539,339 US10421794B2 (en) 2014-12-24 2015-12-22 PI3K gamma inhibitor peptide for treatment of respiratory system diseases
BR112017013453-5A BR112017013453B1 (en) 2014-12-24 2015-12-22 PRODUCT, PHARMACEUTICAL COMPOSITION AND USE OF FUSION PEPTIDE
CA2971121A CA2971121C (en) 2014-12-24 2015-12-22 Novel pi3k.gamma. inhibitor peptide for treatment of respiratory system diseases
DK15830858.5T DK3236983T3 (en) 2014-12-24 2015-12-22 HOWEVER, UNKNOWN PI3K GAMMA INHIBITOR SPEED FOR TREATMENT OF DISEASES IN THE RESPIRATORY SYSTEM
RU2017124487A RU2704826C2 (en) 2014-12-24 2015-12-22 NOVEL PEPTIDE-INHIBITOR PI3Kγ FOR TREATING RESPIRATORY DISEASES
IL253011A IL253011B (en) 2014-12-24 2017-06-19 Novel pi3k gamma inhibitor peptide for treatment of respiratory system diseases
US16/538,987 US10730921B2 (en) 2014-12-24 2019-08-13 PI3Kγ inhibitor peptide for treatment of respiratory system diseases
US16/911,485 US11352400B2 (en) 2014-12-24 2020-06-25 PI3K gamma inhibitor peptide for treatment of respiratory system diseases

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
ITTO20141105 2014-12-24
ITTO2014A001105 2014-12-24

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US15/539,339 A-371-Of-International US10421794B2 (en) 2014-12-24 2015-12-22 PI3K gamma inhibitor peptide for treatment of respiratory system diseases
US16/538,987 Continuation US10730921B2 (en) 2014-12-24 2019-08-13 PI3Kγ inhibitor peptide for treatment of respiratory system diseases

Publications (1)

Publication Number Publication Date
WO2016103176A1 true WO2016103176A1 (en) 2016-06-30

Family

ID=52577903

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/IB2015/059880 Ceased WO2016103176A1 (en) 2014-12-24 2015-12-22 Novel pi3k gamma inhibitor peptide for treatment of respiratory system diseases

Country Status (13)

Country Link
US (3) US10421794B2 (en)
EP (1) EP3236983B1 (en)
CN (2) CN113563451A (en)
AU (1) AU2015370463B2 (en)
BR (1) BR112017013453B1 (en)
DK (1) DK3236983T3 (en)
ES (1) ES2737227T3 (en)
HU (1) HUE045409T2 (en)
IL (1) IL253011B (en)
PL (1) PL3236983T3 (en)
PT (1) PT3236983T (en)
RU (1) RU2704826C2 (en)
WO (1) WO2016103176A1 (en)

Cited By (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9670163B2 (en) 2005-12-28 2017-06-06 Vertex Pharmaceuticals Incorporated Solid forms of N-[2,4-bis(1,1-dimethylethyl)-5-hydroxyphenyl]-1,4-dihydro-4-oxoquinoline-3-carboxamide
US9732080B2 (en) 2006-11-03 2017-08-15 Vertex Pharmaceuticals Incorporated Azaindole derivatives as CFTR modulators
US10071979B2 (en) 2010-04-22 2018-09-11 Vertex Pharmaceuticals Incorporated Process of producing cycloalkylcarboxamido-indole compounds
US10081621B2 (en) 2010-03-25 2018-09-25 Vertex Pharmaceuticals Incorporated Solid forms of (R)-1(2,2-difluorobenzo[D][1,3]dioxol-5-yl)-N-(1-(2,3-dihydroxypropyl)-6-fluoro-2-(1-hydroxy-2-methylpropan-2-yl)-1H-indol-5-yl)cyclopropanecarboxamide
US10206877B2 (en) 2014-04-15 2019-02-19 Vertex Pharmaceuticals Incorporated Pharmaceutical compositions for the treatment of cystic fibrosis transmembrane conductance regulator mediated diseases
IT202000012259A1 (en) * 2020-05-25 2021-11-25 Kither Biotech S R L NEW THERAPY FOR THE TREATMENT OF FIBROPROLIFERATIVE VASCULAR DISEASES
IT202300025458A1 (en) * 2023-11-29 2025-05-29 Kither Biotech S R L NON-NATURAL PEPTIDES TARGETING PI3K¿ SCAFFOLDING ACTIVITY AND THEIR THERAPEUTIC USES

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2016103176A1 (en) 2014-12-24 2016-06-30 Kither Biotech S.R.L. Novel pi3k gamma inhibitor peptide for treatment of respiratory system diseases

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2004026285A2 (en) * 2002-09-19 2004-04-01 Amgen Canada Inc. Compositions and methods for treating heart disease
WO2009100305A1 (en) * 2008-02-08 2009-08-13 Targegen Inc. Pteridine derivatives for treating respiratory disease
US8236523B2 (en) 2004-08-23 2012-08-07 The Johns Hopkins University Camp reporters and high throughput assays

Family Cites Families (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2000052467A1 (en) * 1999-03-02 2000-09-08 The University Of Dundee Methods of determining altered ndpk functions
WO2006089106A2 (en) 2005-02-17 2006-08-24 Icos Corporation Phosphoinositide 3-kinase inhibitors for inhibiting leukocyte accumulation
DE102005008921A1 (en) * 2005-02-24 2006-08-31 Boehringer Ingelheim Pharma Gmbh & Co. Kg New drugs for the treatment of respiratory diseases
SI2004654T1 (en) * 2006-04-04 2013-11-29 The Regents Of The University Of California Pyrazolopyrimidine derivatives for use as kinase antagonists
US8063012B2 (en) * 2006-09-19 2011-11-22 Phylogica Limited Neuroprotective peptide inhibitors of AP-1 signaling and uses therefor
RU2595718C2 (en) 2009-09-09 2016-08-27 Селджен Авиломикс Рисерч,Инк. Pi3-kinase inhibitors and use thereof
AU2012307159A1 (en) * 2011-09-14 2014-02-27 Abeterno Technologies Limited Intracellular cell selection
WO2016103176A1 (en) 2014-12-24 2016-06-30 Kither Biotech S.R.L. Novel pi3k gamma inhibitor peptide for treatment of respiratory system diseases

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2004026285A2 (en) * 2002-09-19 2004-04-01 Amgen Canada Inc. Compositions and methods for treating heart disease
US8236523B2 (en) 2004-08-23 2012-08-07 The Johns Hopkins University Camp reporters and high throughput assays
WO2009100305A1 (en) * 2008-02-08 2009-08-13 Targegen Inc. Pteridine derivatives for treating respiratory disease

Non-Patent Citations (17)

* Cited by examiner, † Cited by third party
Title
A. GHIGO ET AL., CIRCULATION, vol. 126, 23 October 2012 (2012-10-23), pages 2073
A. PERINO ET AL., MOL CELL, vol. 42, 8 April 2011 (2011-04-08), pages 84
CAIN ROBERT J ET AL: "Different PI 3-kinase inhibitors have distinct effects on endothelial permeability and leukocyte transmigration", INTERNATIONAL JOURNAL OF BIOCHEMISTRY AND CELL BIOLOGY, vol. 44, no. 11, 17 July 2012 (2012-07-17), pages 1929 - 1936, XP028940062, ISSN: 1357-2725, DOI: 10.1016/J.BIOCEL.2012.07.009 *
DEROSSI D (REPRINT) ET AL: "Trojan peptides: the penetratin system for intracellular delivery", TRENDS IN CELL BIOLOGY, ELSEVIER SCIENCE LTD, XX, vol. 8, no. 2, 1 February 1998 (1998-02-01), pages 84 - 87, XP002122131, ISSN: 0962-8924, DOI: 10.1016/S0962-8924(97)01214-2 *
E. HIRSCH ET AL., SCIENCE, vol. 287, 11 February 2000 (2000-02-11), pages 1049
E. PATRUCCO ET AL., CELL, vol. 118, 6 August 2004 (2004-08-06), pages 375
GHIGO ALESSANDRA ET AL: "Isoform selective phosphoinositide 3-kinase gamma and delta inhibitors and their therapeutic potential.", RECENT PATENTS ON INFLAMMATION & ALLERGY DRUG DISCOVERY JAN 2008, vol. 2, no. 1, January 2008 (2008-01-01), pages 1 - 10, XP002739134, ISSN: 1872-213X *
GHIGO ALESSANDRA ET AL: "PI3K inhibition in inflammation: Toward tailored therapies for specific diseases", BIOESSAYS, vol. 32, no. 3, March 2010 (2010-03-01), pages 185 - 196, XP002739133 *
HIRSCH E ET AL: "Taming the PI3K team to hold inflammation and cancer at bay", PHARMACOLOGY AND THERAPEUTICS, ELSEVIER, GB, vol. 118, no. 2, 1 May 2008 (2008-05-01), pages 192 - 205, XP022650580, ISSN: 0163-7258, [retrieved on 20080305], DOI: 10.1016/J.PHARMTHERA.2008.02.004 *
ITO K ET AL: "Therapeutic potential of phosphatidylinositol 3-kinase inhibitors in inflammatory respiratory disease", JOURNAL OF PHARMACOLOGY AND EXPERIMENTAL THERAPEUTICS, AMERICAN SOCIETY FOR PHARMACOLOGY AND EXPERIMENTAL THERAPEUTICS, US, vol. 321, no. 1, 1 January 2007 (2007-01-01), pages 1 - 8, XP002534044, ISSN: 0022-3565, DOI: 10.1124/JPET.106.111674 *
J. DOUKAS ET AL: "Aerosolized Phosphoinositide 3-Kinase / Inhibitor TG100-115 [3-[2,4-Diamino-6-(3-hydroxyphenyl)pteridin-7-yl]phenol] as a Therapeutic Candidate for Asthma and Chronic Obstructive Pulmonary Disease", JOURNAL OF PHARMACOLOGY AND EXPERIMENTAL THERAPEUTICS, vol. 328, no. 3, 4 December 2008 (2008-12-04), pages 758 - 765, XP055186547, ISSN: 0022-3565, DOI: 10.1124/jpet.108.144311 *
M. DELLA PERUTA; C. GIAGULLI; C. LAUDANNA; A. SCARPA; C. SORIO, MOL CANCER, vol. 9, 2010, pages 61
MARWICK JOHN A ET AL: "Phosphatidylinositol 3-kinase isoforms as targets in respiratory disease", THERAPEUTIC ADVANCES IN RESPIRATORY DISEASE,, vol. 4, no. 1, 1 February 2010 (2010-02-01), pages 19 - 34, XP009184042, ISSN: 1753-4666, DOI: 10.1177/1753465809352792 *
MOSCHOS STERGHIOS ATHANASIOS ET AL: "Lung delivery studies using siRNA conjugated to TAT(48-60) and penetratin reveal peptide induced reduction in gene expression and induction of innate immunity", BIOCONJUGATE CHEMISTRY, ACS, WASHINGTON, DC, US, vol. 18, no. 5, 1 September 2007 (2007-09-01), pages 1450 - 1459, XP002492909, ISSN: 1043-1802, DOI: 10.1021/BC070077D *
S. MYOU ET AL: "Blockade of Inflammation and Airway Hyperresponsiveness in Immune-sensitized Mice by Dominant-Negative Phosphoinositide 3-Kinase-TAT", JOURNAL OF EXPERIMENTAL MEDICINE, vol. 198, no. 10, 10 November 2003 (2003-11-10), pages 1573 - 1582, XP055186912, ISSN: 0022-1007, DOI: 10.1084/jem.20030298 *
V. FANELLI ET AL., INTENSIVE CARE MED, vol. 36, November 2010 (2010-11-01), pages 1935
VITO FANELLI ET AL: "Pulmonary-derived phosphoinositide 3-kinase gamma (PI3KÎ ) contributes to ventilator-induced lung injury and edema", INTENSIVE CARE MEDICINE, SPRINGER, BERLIN, DE, vol. 36, no. 11, 19 August 2010 (2010-08-19), pages 1935 - 1945, XP019836905, ISSN: 1432-1238 *

Cited By (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9670163B2 (en) 2005-12-28 2017-06-06 Vertex Pharmaceuticals Incorporated Solid forms of N-[2,4-bis(1,1-dimethylethyl)-5-hydroxyphenyl]-1,4-dihydro-4-oxoquinoline-3-carboxamide
US9732080B2 (en) 2006-11-03 2017-08-15 Vertex Pharmaceuticals Incorporated Azaindole derivatives as CFTR modulators
US10081621B2 (en) 2010-03-25 2018-09-25 Vertex Pharmaceuticals Incorporated Solid forms of (R)-1(2,2-difluorobenzo[D][1,3]dioxol-5-yl)-N-(1-(2,3-dihydroxypropyl)-6-fluoro-2-(1-hydroxy-2-methylpropan-2-yl)-1H-indol-5-yl)cyclopropanecarboxamide
US10071979B2 (en) 2010-04-22 2018-09-11 Vertex Pharmaceuticals Incorporated Process of producing cycloalkylcarboxamido-indole compounds
US10206877B2 (en) 2014-04-15 2019-02-19 Vertex Pharmaceuticals Incorporated Pharmaceutical compositions for the treatment of cystic fibrosis transmembrane conductance regulator mediated diseases
IT202000012259A1 (en) * 2020-05-25 2021-11-25 Kither Biotech S R L NEW THERAPY FOR THE TREATMENT OF FIBROPROLIFERATIVE VASCULAR DISEASES
WO2021239662A1 (en) 2020-05-25 2021-12-02 Kither Biotech S.R.L. Pi3k gamma inhibitor peptide for treatment of fibroproliferative vascular diseases
JP2023526814A (en) * 2020-05-25 2023-06-23 キダー バイオテック エス・アール・エル PI3Kγ inhibitory peptides for the treatment of fibroproliferative vascular disease
US20230234996A1 (en) * 2020-05-25 2023-07-27 Kither Biotech S.R.L. Pi3k gamma inhibitor peptide for treatment of fibroproliferative vascular diseases
IT202300025458A1 (en) * 2023-11-29 2025-05-29 Kither Biotech S R L NON-NATURAL PEPTIDES TARGETING PI3K¿ SCAFFOLDING ACTIVITY AND THEIR THERAPEUTIC USES
WO2025113859A1 (en) * 2023-11-29 2025-06-05 Kither Biotech S.R.L. "NON-NATURAL PEPTIDES TARGETING THE SCAFFOLD ACTIVITY OF PI3Kγ AND THERAPEUTIC USES THEREOF"

Also Published As

Publication number Publication date
PL3236983T3 (en) 2019-10-31
DK3236983T3 (en) 2019-07-15
US20190367571A1 (en) 2019-12-05
BR112017013453B1 (en) 2024-02-27
CA2971121A1 (en) 2016-06-30
IL253011A0 (en) 2017-08-31
RU2017124487A3 (en) 2019-02-28
NZ733017A (en) 2024-12-20
US11352400B2 (en) 2022-06-07
EP3236983B1 (en) 2019-04-17
US10421794B2 (en) 2019-09-24
CN113563451A (en) 2021-10-29
AU2015370463A1 (en) 2017-07-13
CN107406488B (en) 2021-08-31
US10730921B2 (en) 2020-08-04
EP3236983A1 (en) 2017-11-01
ES2737227T3 (en) 2020-01-10
AU2015370463B2 (en) 2020-12-24
US20200317740A1 (en) 2020-10-08
IL253011B (en) 2021-02-28
PT3236983T (en) 2019-07-23
CN107406488A (en) 2017-11-28
BR112017013453A2 (en) 2018-03-06
RU2704826C2 (en) 2019-10-31
HUE045409T2 (en) 2019-12-30
US20180086798A1 (en) 2018-03-29
RU2017124487A (en) 2019-01-25

Similar Documents

Publication Publication Date Title
US11352400B2 (en) PI3K gamma inhibitor peptide for treatment of respiratory system diseases
JP2000517165A (en) Novel lipid kinase
US8420780B2 (en) Mutated netrin 4, fragments thereof and uses thereof as drugs
EP3740496A1 (en) Proteinaceous molecules and uses therefor
US20070054848A1 (en) Composition and method for nerve regeneration
EP2303921A2 (en) Mutated netrin-4 proteins, fragments thereof and their uses as drugs
US20180335433A1 (en) Compositions targeting pkc-theta and uses and methods of treating pkc-theta pathologies, adverse immune responses and diseases
Lv et al. Heme oxygenase‐1 alleviates allergic airway inflammation by suppressing NF‐κB‐mediated pyroptosis of bronchial epithelial cells
CA2971121C (en) Novel pi3k.gamma. inhibitor peptide for treatment of respiratory system diseases
HK40062761A (en) NOVEL PI3Kγ INHIBITOR PEPTIDE FOR TREATMENT OF RESPIRATORY SYSTEM DISEASES
US20090131310A1 (en) Mucin3 egf-like domains
CN108026161A (en) Anti-angiogenic properties of collagen V-derived fragments
Geiger Roles of Transient Receptor Potential (TRP) cation channels in primary pulmonary fibroblasts
KR102096100B1 (en) Pharmaceutical Composition for Treating or Preventing Parkinson&#39;s Disease comprising apoptosis signal-regulating kinase 1 Phosphorylation Inhibitor
US10125183B2 (en) Decoy peptides inhibiting binding of AMIGO2 and 3-phosphoinositide-dependent kinase 1
Palloni AMPK-MEDIATED LONG-TERM REGULATION OF HCN4CONTRIBUTES TO AGE-RELATED SINUS BRADYCARDIA
Wei et al. Administration of Neuritin as a novel therapeutic strategy for autoimmune and inflammatory diseases
KR20120112196A (en) Use of hades as a negative regulator of akt
Ren A Peptide-based cAMP Elevator Inhibits Inflammation and Improves CFTR Function in Obstructive Airway disease
Buonarati Postsynaptic Ion Channel Regulation: Downstream Targets of β2AR Signaling
JP2009001521A (en) Inhibition of ErbB4 signal by receptor type protein tyrosine phosphatase Ptprz
US20170145391A1 (en) TRUNCATED VARIANT OF THE MAMMALIAN TARGET FOR RAPAMYCIN (mTOR) PROTEIN
Rohrbach Investigating The Role Of Myristoylated Alanine Rich C Kinase Substrate'S (Marcks'S) Effector Domain In Lung And Brain Cancer Biology
Ma Biophysical and Pharmacological Characterisations of Pannexin 1
US20110070234A1 (en) Np1 activity regulating elements useful for the production of drugs for the treatment or prevention of human neurodegenerative diseases, resulting drugs and use thereof

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 15830858

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2971121

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 253011

Country of ref document: IL

WWE Wipo information: entry into national phase

Ref document number: 15539339

Country of ref document: US

NENP Non-entry into the national phase

Ref country code: DE

REEP Request for entry into the european phase

Ref document number: 2015830858

Country of ref document: EP

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112017013453

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 2015370463

Country of ref document: AU

Date of ref document: 20151222

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2017124487

Country of ref document: RU

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 112017013453

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20170621

WWG Wipo information: grant in national office

Ref document number: 733017

Country of ref document: NZ