WO2016103176A1 - Novel pi3k gamma inhibitor peptide for treatment of respiratory system diseases - Google Patents
Novel pi3k gamma inhibitor peptide for treatment of respiratory system diseases Download PDFInfo
- Publication number
- WO2016103176A1 WO2016103176A1 PCT/IB2015/059880 IB2015059880W WO2016103176A1 WO 2016103176 A1 WO2016103176 A1 WO 2016103176A1 IB 2015059880 W IB2015059880 W IB 2015059880W WO 2016103176 A1 WO2016103176 A1 WO 2016103176A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- ρι3κγ
- peptide
- cftr
- fusion peptide
- seq
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/4702—Regulators; Modulating activity
- C07K14/4703—Inhibitors; Suppressors
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/005—Enzyme inhibitors
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/10—Transferases (2.)
- C12N9/12—Transferases (2.) transferring phosphorus containing groups, e.g. kinases (2.7)
- C12N9/1205—Phosphotransferases with an alcohol group as acceptor (2.7.1), e.g. protein kinases
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/10—Fusion polypeptide containing a localisation/targetting motif containing a tag for extracellular membrane crossing, e.g. TAT or VP22
Definitions
- the present description relates to a novel peptide inhibitor of ⁇ 3 ⁇ for the treatment of pathologies of the respiratory apparatus.
- Asthma is a chronic respiratory disease characterized by inflammation, airway hyperresponsiveness (AHR) and mucosal edema, which together lead to episodic bronchoconstriction and obstruction of the airways.
- AHR airway hyperresponsiveness
- mucosal edema which together lead to episodic bronchoconstriction and obstruction of the airways.
- the effectiveness of current anti-asthmatic treatments is unsatisfactory, and asthma remains an unresolved global issue.
- the tone of the musculature of the airways is determined by a delicate balance between activation of the pro-contractile and pro-relaxation signaling pathways in smooth muscle cells. Contraction is primarily triggered by acetylcholine, the main parasympathetic neurotransmitter in the airways, which activates M3 muscarinic receptors, leading to mobilization of intracellular and extracellular calcium (Ca 2+ ) . Conversely, relaxation of the airways is achieved by catecholamine-mediated activation of ⁇ 2 ⁇ adrenergic receptors ( ⁇ 2 ⁇ ), which promote the production of cyclic AMP (cAMP) and the consequent modulation of key effectors of Ca 2+ homeostasis.
- ⁇ 2 ⁇ catecholamine-mediated activation of ⁇ 2 ⁇ adrenergic receptors
- cAMP cyclic AMP
- agonists of ⁇ 2- ⁇ provide symptomatic relief of bronchospasms in patients with asthma.
- their effectiveness is limited in time, mainly due to the desensitization of ⁇ 2- ⁇ that occurs after repeated exposure to agonists.
- PDE4 phosphodiesterase 4
- identifying new enzymes that regulate cAMP homeostasis, as well as novel strategies for manipulating the ⁇ 2 - ⁇ / ⁇ ? ⁇ signal transduction pathway in smooth muscle cells is desirable for treating respiratory diseases.
- the same approach could also be used for therapeutic purposes in other pathological contexts, such as cystic fibrosis, where it is necessary to increase the levels of cAMP in the epithelial cells of the airways.
- cAMP-dependent chloride channel cystic fibrosis transmembrane conductance regulator, CFTR
- Mutations in the gene that encodes for this protein are the main cause of cystic fibrosis (CF) .
- deletion of phenylalanine 508 (AF508) constitutes the most common alteration in CF patients and leads to defects in both membrane expression and opening of the channel.
- AF508 phenylalanine 508
- CFTR potentiators require high concentrations of intracellular cAMP to be effective. Therefore, drugs that are able to stimulate cAMP levels may constitute novel strategies to increase the effectiveness of currently available treatments, or to directly correct functional defects of CFTR in CF.
- ⁇ 3 ⁇ phosphoinositide 3-kinase ⁇
- AKAP anchor protein
- PKA protein kinase A
- PI3KY-associated PKA in turn phosphorylates and promotes the activation of the PDEs and the consequent reduction of cAMP downstream of ⁇ 2 ⁇ 3, ultimately limiting the arrhythmogenic release of Ca 2+ (2) .
- a peptide having the ability to penetrate a cell for use as a medicament, in particular for treating respiratory diseases.
- a different embodiment of the present invention concerns a product comprising i) a fusion peptide as defined above and ii) a potentiator of the cystic fibrosis transmembrane conductance regulator (CFTR) and/or a corrector of the cystic fibrosis transmembrane conductance regulator (CFTR) , as a combined preparation for sequential, simultaneous or separate use for treating respiratory diseases, preferably cystic fibrosis .
- CFTR cystic fibrosis transmembrane conductance regulator
- CFTR cystic fibrosis transmembrane conductance regulator
- the present description provides in vitro and in vivo experimental evidence of the efficacy of treating pathologies of the respiratory system by means of administering a fusion peptide comprising residues 126- 150 of human ⁇ 3 ⁇ (SEQ ID No.: 1) or its homologs .
- the fusion peptide of the present description is, in fact, able to inhibit the interaction between PKA and ⁇ 3 ⁇ and to consequently reduce the activity of the PDEs associated with ⁇ 3 ⁇ , increasing cAMP levels and reducing the entry of Ca 2+ through voltage-operated calcium channels (VOCCs) .
- the fusion peptide described here increases cAMP levels in vivo in the airways and functions as a bronchodilator when administered by an intra-tracheal route to healthy and asthmatic mice.
- the fusion peptide carries out the function of CFTR potentiator, increasing cAMP and thereby enhancing the conductance to chloride (Cl ⁇ ) of CFTR in bronchial epithelial cell lines expressing wild-type or a AF508 mutant CFTR, which is the most frequent mutation in patients with cystic fibrosis.
- a Trojan peptide derived from ⁇ 3 ⁇ inhibits the activity of PDEs and enhances p 2 -AR/cAMP signaling in smooth muscle cells of the airways.
- fluorescein FITC, 50 ⁇
- hBSMCs were transfected with the FRET probe for cAMP, ICUE3 , and pre-treated with either vehicle, ⁇ 3 ⁇ inhibitory peptide or Penetratin 1 control peptide (50 uM, 30 minutes) before activation of ⁇ 2 - ⁇ 3 with isoproterenol (ISO; 100 nM) and the selective antagonist of ⁇ -AR, CGP-20712A (CGP, 100 nM) .
- ISO isoproterenol
- CGP-20712A CGP, 100 nM
- the ⁇ 3 ⁇ inhibitory Trojan peptide inhibits calcium entry through the L-type channel in human smooth muscle cells of the airways.
- the ⁇ 3 ⁇ inhibitory Trojan peptide increases cAMP levels in the airways in vivo, and attenuates airway hyperresponsiveness in healthy and asthmatic mice.
- Airway hyperreactivity was measured as average resistance of the lung in healthy mice, anesthetized and ventilated, treated with a spray of vehicle, ⁇ 3 ⁇ inhibitory Trojan peptide (1.5 ⁇ g) or PI control peptide (equimolar amount) before exposure to increasing doses of methacholine .
- Airway hyperresponsiveness was measured as change in tidal volume in asthmatic mice, anesthetized and ventilated, in response to methacholine (500 mg/kg, intravenously administered) .
- the Trojan peptide derived from ⁇ 3 ⁇ increases cAMP-dependent phosphorylation and chloride conductance of wild-type CFTR.
- the Trojan peptide derived from ⁇ 3 ⁇ increases the conductance of CFTR in airway epithelial cells with AF508 mutation.
- FIG. 7 The PI3Ky-derived Trojan peptide reduces lung inflammation in asthmatic mice.
- a fusion peptide comprising: i) an amino acid sequence as defined in SEQ ID No.: 1 or a related homolog having at least 90% identity with SEQ ID No.: 1, and having the ability of the sequence SEQ ID No.: 1 to inhibit the kinase-independent function of ⁇ 3 ⁇ , and ii) a peptide having the ability to penetrate a cell, for use as a medicament, in particular for treating respiratory diseases.
- a different embodiment of the present invention concerns a product comprising i) a fusion peptide as defined above and ii) a potentiator of the cystic fibrosis transmembrane conductance regulator and/or a corrector of the cystic fibrosis transmembrane conductance regulator (CFTR) , as a combined preparation for sequential, simultaneous or separate use for treating respiratory diseases, preferably cystic fibrosis.
- CFTR cystic fibrosis transmembrane conductance regulator
- a product comprising a fusion peptide as defined above, a corrector of the cystic fibrosis transmembrane conductance regulator (CFTR) and a potentiator of the cystic fibrosis transmembrane conductance regulator (CFTR) as a combined preparation for sequential, simultaneous or separate use is particularly suitable for treating patients with cystic fibrosis who carry the AF508 mutation of CFTR.
- CFTR cystic fibrosis transmembrane conductance regulator
- CFTR cystic fibrosis transmembrane conductance regulator
- the present description concerns the production and the therapeutic applications of a fusion peptide permeable to cell membranes, which inhibits the interaction between ⁇ 3 ⁇ and the activator of PDE, PKA.
- the fusion peptide of the present description reduces the activity of specific PDE, enhancing the signaling of the ⁇ 2-AR/cAMP signal transduction pathway and producing cAMP-mediated pro-relaxing effects, both in smooth muscle cells of human airways and in vivo, in a preclinical model of allergic asthma.
- the fusion peptide with ⁇ 3 ⁇ inhibitory activity enhances the same signaling pathway in epithelial cells of the respiratory tract and stimulates the cAMP-dependent opening of the wild type CFTR channel (whose nucleotide and amino acid sequences are available in the GenBank sequence database as access numbers NM_000492.3 and NP_000483.3, respectively) and of CFTR with the AF508 mutation (the sequence of this mutation is available in the GenBank sequence database as access number S64640.1), which is the main cause of cystic fibrosis.
- results shown here demonstrate the possibility of using the fusion peptide or homologs thereof, having the ability to inhibit ⁇ 3 ⁇ , as a local therapy by inhalation, for treating respiratory diseases such as allergic asthma and cystic fibrosis.
- the present description shows, in a completely unexpected way, that the ⁇ 3 ⁇ 126-150 peptide (SEQ ID No.: 1 - KATHRSPGQIHLVQRHPPSEESQAF) conjugated to a peptide permeable to cell membranes, such as, for example, the Penetratin 1 of Antennapedia (SEQ ID No.: 3) (3), can be used as an inhibitor of the kinase- independent function of ⁇ 3 ⁇ in vivo.
- the ⁇ 3 ⁇ inhibitory fusion peptide penetrates smooth muscle cells of the airways and enhances the ⁇ 2-AR/cAMP signaling pathway.
- the data show that the fusion peptide increases cAMP levels and limits airway hyperresponsiveness in a preclinical model of allergic asthma and that it efficiently reaches the lower respiratory tract when administered locally by the intra-tracheal route. These data therefore demonstrate the clinical use of a ⁇ 3 ⁇ inhibitory fusion peptide in aerosol therapy for treating respiratory diseases.
- the current inhalation therapy for bronco- obstructive diseases is based on the use of ⁇ 2 - ⁇ agonists, such as salbutamol and formoterol and of PDE4 inhibitors, such as Roflumilast, which was recently approved for treating chronic obstructive pulmonary disease (COPD) .
- COPD chronic obstructive pulmonary disease
- ⁇ -AR agonists Although acute treatment with ⁇ -AR agonists produces evident clinical benefits, chronic or repeated exposure to these drugs may result in a significant reduction and/or complete loss of their effectiveness in asthmatic patients, due to the agonist-dependent desensitization of membrane ⁇ -ARs.
- the present description provides a solution to this problem and proposes the use of an inhibitory peptide that affects the activity of the enzyme ⁇ 3 ⁇ and, as such, does not act directly on the stimulation of ⁇ 2 ⁇ , but enhances the cascade of downstream signaling events.
- a ⁇ 3 ⁇ inhibitory peptide offers the unique opportunity to modulate ⁇ 2 ⁇ AR-dependent cAMP domains, ensuring broncho-relaxing effects similar to those mediated by ⁇ 2-AR agonists, without inducing receptor inactivation .
- the ⁇ 3 ⁇ inhibitory peptide therefore represents a unique tool that ensures isoform-selective inhibition of PDEs and allows limiting the major side effects that are associated with non-selective inhibitors of PDE4, such as Roflumilast, arising mainly from inhibition of isoforms that are not expressed in the respiratory system.
- PDE4 inhibitors are characterized by important pro-relaxant effects in isolated cells, they are not optimal bronchodilators in vivo, where they mainly exert anti-inflammatory functions.
- inhibiting PDE3 and PDE4 can be additive or synergistic.
- PDE4 and PDE3 inhibitors are ineffective if used alone, but act synergistically in inhibiting smooth muscle contraction. Therefore, inhibiting the kinase-independent activity of ⁇ 3 ⁇ provides a unique tool to simultaneously inhibit specific isoforms of PDE3 and PDE4, in particular those critically involved in regulating the contractility of the bronchial smooth muscle.
- PDE3 and PDE4 are not only expressed in the airways, but also in the myocardium and the central nervous system, systemic inhibition of even selected isoenzymes can cause major side effects.
- the inhibition of PDE3 and PDE4 in vivo may have pro- arrhythmogenic, pro-emetic and pro-anorexigenic effects.
- the present description shows that the fusion peptide having the ability to inhibit the kinase- independent activity of ⁇ 3 ⁇ is therapeutically effective, and that an aerosol formulation of the ⁇ 3 ⁇ inhibitory peptide is distributed efficiently in the lower respiratory tract. Furthermore, the use of a peptide molecule provides a broader therapeutic effect/side effect profile compared to small molecules, such as PDE inhibitors, which can diffuse rapidly to other tissues outside of the respiratory system.
- the data provided herein demonstrate that a fluorescent version of the ⁇ 3 ⁇ inhibitory peptide accumulates in the trachea and lungs following intra ⁇ tracheal administration, without reaching the myocardium and the brain.
- an inhalation therapy based on a peptide, permeable to cell membranes, which selectively inhibits the kinase-independent activity of the ⁇ 3 ⁇ enzyme is highly effective.
- This therapeutic approach can be used for treating different respiratory diseases, from asthma to cystic fibrosis, where agents able to increase intracellular cAMP downstream of ⁇ 2 ⁇ ARs are necessary.
- the results presented here demonstrate that the ⁇ 3 ⁇ inhibitory peptide not only increases cAMP levels in smooth muscle, but also in the epithelial compartment of the airways, thus opening up the possibility of exploiting this compound to also stimulate the cAMP-mediated opening of the CFTR channel, which is defective in patients with cystic fibrosis.
- the data provided here also show that inhibition of ⁇ 3 ⁇ acts synergistically with a known, clinically advanced, CFTR potentiator, VX-770, by increasing the conductance of one of the most common mutated forms of CFTR in cystic fibrosis.
- the fusion peptide of the present description may therefore be used in combination with a potentiator of cystic fibrosis transmembrane conductance regulator (CFTR) and/or a corrector of the cystic fibrosis transmembrane conductance regulator (CFTR) , as a combined preparation for the sequential, simultaneous or separate use in treating respiratory diseases characterized by a defective cAMP-mediated opening of CFTR, such as in patients with cystic fibrosis.
- CFTR cystic fibrosis transmembrane conductance regulator
- CFTR cystic fibrosis transmembrane conductance regulator
- CFTR cystic fibrosis transmembrane conductance regulator
- CFTR cystic fibrosis transmembrane conductance regulator
- Potentiators of the cystic fibrosis transmembrane conductance regulator (CFTR) which can be advantageously used in combination with the fusion peptide of the present description are, for example: Ivacaftor or VX-770 (N- (2, 4-Di-tert-butyl-5- hydroxyphenyl ) -1, 4-dihydro-4-ossoquinoline-3- carboxamide ) and VX-532 ( 4-Methyl-2- ( 5-phenyl-lH- pyrazol-3-yl ) -phenol ) .
- Ivacaftor or VX-770 N- (2, 4-Di-tert-butyl-5- hydroxyphenyl ) -1, 4-dihydro-4-ossoquinoline-3- carboxamide
- VX-532 4-Methyl-2- ( 5-phenyl-lH- pyrazol-3-yl ) -phenol
- Correctors of the cystic fibrosis transmembrane conductance regulator (CFTR) which can be advantageously used in combination with the fusion peptide of the present description and with a potentiator of the cystic fibrosis transmembrane conductance regulator (CFTR) are for example: VX-809 (3- (6- (1- ( 2 , 2-difluorobenzo [d] [1,3] dioxol- 5yl) cyclopropanecarboxamido ) -3-methylpyridin-2- yl)benzoic acid) and VX-661 ((R)-l-(2,2- difluorobenzo [d] [1,3] dioxol-5-yl ) -N- ( 1- ( 2 , 3- dihydroxypropyl ) -6-fluoro-2- (l-hydroxy-2 methylpropan- 2-yl) -lH-indol-5-yl ) cyclopropanecarboxamide ) .
- the molecule can be used for treating respiratory diseases, including allergic asthma, where drugs designed to increase intracellular levels of cAMP and to promote relaxation of bronchial smooth muscle are highly desirable.
- this compound can be applied to patients with cystic fibrosis where agents that elevate cAMP concentrations are key tools to stimulate cAMP- mediated opening of defective CFTR.
- peptide-mediated inhibition of ⁇ 3 ⁇ can be applied to all pathological conditions characterized by a hypo-functional CFTR, including COPD, where the exposure to cigarette smoke has been demonstrated to alter the activity of CFTR.
- the fusion peptide of the present description having the ability to inhibit ⁇ 3 ⁇ is capable of exerting important anti-inflammatory actions.
- the experimental evidence reported here demonstrates that the peptide indeed limits the peribronchial inflammation associated with allergic asthma. It is therefore evident that inhibiting the kinase-independent activity of ⁇ 3 ⁇ can provide multiple independent therapeutic benefits in treating respiratory diseases, acting at the same time as a bronchodilator, CFTR potentiator and antiinflammatory agent.
- a fusion peptide having the sequence shown in SEQ ID No.: 2 (hereinafter also referred to as "Trojan peptide derived from ⁇ 3 ⁇ ”), comprising the amino acid sequence SEQ ID No.: 1 and a peptide penetrating the cell corresponding to the Penetratin 1 of Antennapedia (SEQ ID No.: 3, described in (3)) .
- the scope of this description is not in any way limited to the specific sequence of the fusion peptide of SEQ ID No.: 2, since the fusion peptide of the present description can comprise i) sequences having a homology with SEQ ID No.: 1 of at least 90% and having the ability of SEQ ID No.: 1 to inhibit the kinase-independent function of ⁇ 3 ⁇ and ii) sequences of a peptide penetrating the cell, for example, selected from the polypeptide HIV-TAT, Antennapedia homeodomain peptides, also known as penetrating peptides or pAntp, R7 peptide, KALA peptide, buforin 2, MAP, transportan, transportan 10, pVEC, or MPG peptide.
- the sequences corresponding to the polypeptides penetrating the cells mentioned above are shown in Figure 6 and specified in SEQ ID No.: 3 to 12.
- the peptide having the ability to penetrate the cell was fused to the N-terminus of SEQ ID No.: 1. It is, however, possible to produce a fusion peptide that falls within the scope of the present description by creating a fusion of the peptide having the ability to penetrate the cell at the C-terminus of the SEQ ID No . : 1.
- homolog peptide having at least 90% identity with SEQ ID No.: 1, to inhibit the function of AKAP of ⁇ 3 ⁇
- a previously- described competition assay was used (1) .
- the homolog peptide was re-suspended in phosphate-buffered saline solution (PBS) to a final concentration of 50 ⁇ or 250 uM.
- PBS phosphate-buffered saline solution
- HEK293 cells (ATCC Number: CRL-1573TM) were transfected, using the calcium phosphate method, with a construct made of the expression vector pcDNA3.1 (Life Technologies, Carlsbad, CA, USA; product code V790-20), in which human ⁇ 3 ⁇ cDNA was cloned (SEQ ID No.: 13) using the restriction enzymes BamHI and Xbal (New England Biolabs, Ipswich, MA, USA) .
- the pcDNA3.1- ⁇ 3 ⁇ construct is freely available from Dr. Emilio Hirsch at the University of Turin, Turin, ITALY.
- cells were lysed in cold lysis buffer containing 120 mmol/L NaCl, 50 mmol/L Tris-HCl (pH 8.0), complete protease inhibitors (Roche Applied Science, Indianapolis, IN) and phosphatase inhibitors (50 mmol/L sodium fluoride, 1 mmol/L sodium orthovanadate and 10 mmol/L sodium pyrophosphate) .
- lysates were centrifuged at 13000 rpm for 10 min at 4°C and the supernatant was incubated with the peptide for 30 minutes at room temperature.
- PKA RII regulatory subunit of PKA
- PKA RII the regulatory subunit of PKA
- PKA RII was immunoprecipitated by incubating the protein extract with 30 ⁇ of a 1:1 mixture of Protein A and Sepharose (Amersham Biosciences, Buckinghamshire, UK) and an anti-PKA RII C20 antibody (Santa Cruz Biotechnology Inc., Dallas, Texas, USA; product code: sc-908) for 2 h at 4°C, with shaking.
- Immune complexes were washed extensively with lysis buffer and the association of ⁇ 3 ⁇ with PKA RII was analyzed by Western blot analysis using a monoclonal anti-PI3KY antibody (freely available from Dr. Emilio Hirsch at the University of Turin, Turin, Italy) .
- Knock-out mice for ⁇ 3 ⁇ ( ⁇ 3 ⁇ _ ⁇ ) and knock-in mice expressing a catalytically-inactive form of ⁇ 3 ⁇ ( ⁇ 3 ⁇ ⁇ ⁇ ) were generated as previously described (4, 5) . Mutant mice were crossed with animals of a C57B1/6J genetic background for 15 generations and C57B1/6J mice were used as controls ( ⁇ 3 ⁇ + + ) . For studies of airway hyperresponsiveness in asthmatic and healthy mice, BALB/C female mice were used. For all experiments, animals between the ages of 8 and 12 weeks were used. Mice were maintained in groups, with free access to food (standard diet) and water, in a controlled system which provides a cycle of 12 hours of light and 12 hours of darkness. Animals were used according to the guidelines and institutional regulations on animal welfare, approved by the local Animal Ethics Committee. Cell culture and transfection
- hBSMCs Human bronchial smooth muscle cells
- DMEM Dulbecco's Modified Eagle Medium
- FBS fetal bovine serum
- Gibco, Carlsbad, CA penicillin/streptomycin
- hBSMCs Human bronchial smooth muscle cells
- ICUE3 encoding the FRET probe for cAMP
- AMAXA Nucleofector device
- Human airway epithelial cell lines expressing a wild-type CFTR (NuLi-1) or with the AF508 mutation (CuFi-1) were purchased from ATCC (NuLi-1 product code: ATCC® CRL-4011TM; CuFi-1 product code: ATCC® CRL-4013TM) .
- Cells were cultured in Dulbecco's Modified Eagle Medium (DMEM, Gibco, Carlsbad, CA) supplemented with 10% fetal bovine serum (FBS), 30 ⁇ g/mL of penicillin, 100 ⁇ g/mL of streptomycin and 300 ⁇ g/mL hygromycin B (Gibco, Carlsbad, CA) .
- DMEM Dulbecco's Modified Eagle Medium
- FBS fetal bovine serum
- mTSMCs murine tracheal smooth muscle cells
- hBSMCs human bronchial smooth muscle cells
- cells were treated with the indicated drugs/peptides and immediately lysed in cold lysis buffer containing 120 mmol/L NaCl, 50 mmol/L Tris-HCl (pH 8.0), complete protease inhibitors (Roche Applied Science, Indianapolis, IN) and phosphatase inhibitors (50 mmol/L sodium fluoride, 1 mmol/L sodium orthovanadate and 10 mmol/L sodium pyrophosphate) . After 30 min of incubation on ice, lysates were centrifuged at 13000 rpm for 10 min at 4°C and used for either Western blotting or subjected to immunoprecipitation and measurements of phosphodiesterase activity.
- protein extracts were pre-incubated with 30 ⁇ of a 1:1 mixture of protein A or G and sepharose (Amersham Biosciences, Buckinghamshire, UK) and subsequently incubated with 20 ⁇ of a 1:1 mixture of protein A or G and sepharose and 1 mg of primary antibody for each mg of protein, for 2 hours at 4°C.
- Immune complexes were washed extensively with lysis buffer and used for Western blotting or subjected to measurements of phosphodiesterase activity.
- cAMP levels were performed on human bronchial smooth muscle cells (hBSMCs) that express the FRET probe ICUE3, as described previously (2) . Briefly, cells were maintained in a K + -Ringer solution containing (in mmol/L) 121.6 NaCl, 5.4 KC1, 1.8 MgCl 2 , 1.8 CaCl 2 , 4 NaHC0 3 , 0.8 NaH 2 P0 4 , 5 D-glucose, 5 sodium pyruvate, 10 HEPES, at pH 7.4.
- FRET recordings were carried out before and after adding 100 nmol/L of isoproterenol (Iso) and 100 nmol/L of CGP-20712A (CGP) , using a SP5 Leica TCS system (Leica Microsystems Inc., Buffalo Grove, IL , USA) with an argon laser and with a 63x immersion lens.
- Iso isoproterenol
- CGP-20712A CGP-20712A
- SP5 Leica TCS system Leica Microsystems Inc., Buffalo Grove, IL , USA
- 458 and 514 nm wavelengths were used, respectively.
- Images were acquired every 4 seconds without any media line, at a scanning speed of 400 MHz and a resolution of 512 x 512 pixels.
- E A (i) B/A
- a and B are the intensities of the CFP channel and FRET, respectively.
- Phosphodiesterase activity in immunoprecipitates was measured according to the two-step method of Thompson and Appleman, as previously described (2), with minor modifications. Briefly, immunoprecipitates were assayed in a total volume of 200 ⁇ of reaction mixture containing 40 mmol/L Tris-HCl (pH 8.0), 1 mmol/L MgCl 2 , 1.4 mmol/L 2-mercapto-ethanol and 0.1 pCi of [ 3 H] cAMP (Amersham Bioscience, Buckinghamshire, UK) for 40 min at 33°C. To stop the reaction, samples were boiled at 95°C for 3 min.
- reaction product 5 ' -AMP was then hydrolyzed by incubation of the mixture with 50 ⁇ g of snake venom from Crotalus Atrox for 15 min at 37°C (Sigma-Aldrich, St. Louis, MO) .
- the resulting adenosine was separated by anion exchange chromatography with 400 ⁇ L of a suspension of Dowex resin AG1-X8 (Bio-Rad, Segrate, Milan, Italy) , water and 100% ethanol in equal parts.
- the amount of radiolabeled adenosine in the supernatant was quantified by scintillation counting (Ultima Gold liquid scintillation from Perkin Elmer, Waltham, MA) .
- Murine tracheal smooth muscle cells were cultured from explants of trachea using previously described methods with modifications. The entire trachea between the larynx and bronchi was removed and placed in a sterile Petri dish containing Hanks' s balanced salt solution at room temperature and a 2x concentration of antibiotic-antimycotic (Gibco, Carlsbad, CA, product code: 15240-062) . Using a dissecting microscope, the additional surrounding tissue was removed, the tracheal segment was divided longitudinally and cut into squares of 2-3 mm in size. All the segments of a single trachea were then placed with the inner face towards the bottom of a 60 mm sterile cell culture plate.
- DMEM Dulbecco's Modified Eagle Medium
- FBS FBS
- antibiotic-antimycotic were reduced to 10% and lx, respectively.
- Tracheal segments were removed when cells became locally confluent. Once the 60 mm plate became confluent, cells were detached by trypsinization and transferred to a single 60 mm plate. Tracheal smooth muscle cells were further subdivided for several passages in a 1:2 ratio. More than 90% of these cells were smooth muscle cells, as determined by immunofluorescence performed with an antibody specific for smooth muscle actin. All experiments were performed on confluent cells at passage 3.
- hBSMCs were loaded with the calcium indicator
- KCl depolarizing solution containing (in mmol/L) : 5 HEPES, 118 NaCl, 40 KCl, 2 CaCl 2 , 1 MgCl 2 , 5.5 D-glucose, at pH 7.35.
- Calcium transients were analyzed as the ratio of fluorescence signals measured at 400 nm and 490 nm following excitation of Indo-l-AM- loaded cells at 350 nm. Experiments were recorded and analyzed with Igor® Software, using the functions added by Jason Rothman (Neuromatic, www.thinkrandom.com) .
- Buffers were aerated with a mixture of 95% 0 2 and 5% C0 2 and the temperature was maintained at 37 °C during the experiment. Cultures were maintained at a voltage of 0 mV using an EVC4000 Multichannel V/I Clamp (World Precision Instruments, Sarasota, FL, USA) . After a stabilization period of 30 minutes, drugs were added at specific times, while the current was continuously recorded. cAMP extraction and quantification Lungs and trachea were explanted from animals following euthanasia, pulverized in liquid nitrogen and used for cold extraction of cAMP with 6% trichloroacetic acid. Samples were sonicated for 10 seconds and centrifuged at 13000 rpm at 4°C for 15 minutes.
- hBSMCs were incubated with the Trojan peptide derived from ⁇ 3 ⁇ (SEQ ID No.: 2) conjugated to fluorescein (50 uM) or vehicle for 30 minutes, fixed with 4% paraformaldehyde (PFA) for 10 minutes and permeabilized with phosphate-buffered saline (PBS) + 0.5% Triton ( Sigma-Aldrich, St. Louis, MO) for 5 minutes at room temperature. Cells were then incubated with PBS containing 3% bovine serum albumin (BSA, Sigma-Aldrich, St.
- BSA bovine serum albumin
- Wild-type BALB/C mice were injected by the intra ⁇ tracheal route with 1.5 ⁇ g of the Trojan peptide derived from ⁇ 3 ⁇ conjugated to fluorescein or vehicle, in a final volume of 70 ⁇ L of PBS. After 30 minutes, animals were anesthetized, the trachea and lungs were insufflated with PBS, extracted and frozen in OCT. Cryosections of 10 microns were obtained with a Leica CM1850 cryostat (Leica Microsystems GmbH, Wetzlar, Germany) and fluorescence was acquired with a Zeiss Observer-Zl, equipped with an Apotome module (Carl Zeiss, Oberkochen, Germany) .
- Ovalbumin 100 ⁇ g (OVA, Sigma-Aldrich, St. Louis, MO), complexed with aluminum potassium sulfate (1 mg, alum) was administered intraperitoneally (i.p.) on days 1 and 14, and intra-nasally (i.n.) (50 ⁇ g OVA in 50 ⁇ PBS) on days 14, 25, 26, and 27.
- Control mice received i.p. injections of alum and i.n. injections of PBS only Airway hyperreactivity induced by inhaled methacholine was measured at 24 hours after the final dose of OVA (Day 28) .
- mice sensitized to ovalbumin were anesthetized (sodium pentobarbital, 70-90 mg/kg, i.p.), tracheotomized, and connected to a FlexiVent ventilator for small animals (SCIREQ, Montreal, Quebec, Canada) .
- SCIREQ FlexiVent ventilator for small animals
- mice were exposed to increasing concentrations of aerosolized methacholine (10 ⁇ 9 to 10 ⁇ 4 M, final concentration) .
- Method 2 Mice sensitized to ovalbumin were treated, by intra-tracheal instillation, with 70 ⁇ L of phosphate-buffered saline solution (PBS) containing vehicle or 150 ⁇ g of the Trojan peptide derived from ⁇ 3 ⁇ or equimolar amounts of PI control peptide. Airway hyperresponsiveness was assessed at 30 minutes after the treatment according to a previously published protocol (6) .
- PBS phosphate-buffered saline solution
- mice were anesthetized (sodium pentobarbital, 70-90 mg/kg, i.p.), tracheotomized, and ventilated with a positive end-inspiratory pressure of 10 cm 3 ⁇ 40, positive end-expiratory pressure (PEEP) of 3 cm H 2 0, respiratory rate of 90 breaths/min in ambient air.
- the airway opening pressure (Pao) proximal to the endotracheal tube, and the pressure inside the chamber were measured with pressure transducers (Special Instruments, Digima Clic; Nordlingen, Germany) .
- Gas flow was measured with a pneumotachograph (Special Instruments, Digima Clic; Nordlingen, Germany) .
- Tidal volume was calculated as the integral of the flow signal. Variables of mechanical ventilation were recorded using the ICU-Lab software (KleisTEK Advanced Electronic Systems, Bari, Italy) . Airway hyper ⁇ reactivity was assessed as a change in tidal volume after treatment with 500 mg/kg of methacholine administered intravenously.
- mice Wild-type BALB/C mice were treated, by intra- tracheal instillation, with 25 ⁇ g of the Trojan peptide derived from ⁇ 3 ⁇ or equimolar amounts of PI control peptide, in a final volume of 70 i of phosphate- buffered saline (PBS), before each intra-nasal administration of ovalbumin (days 14, 25, 26, and 27 of the protocol of immunization with ovalbumin) . At 24 hours after the final injection (day 28), mice were anesthetized (sodium pentobarbital, 70-90 mg/kg, i.p.) and the tracheas incised and cannulated.
- PBS phosphate- buffered saline
- the airways were washed with 2.5 ml of phosphate-buffered saline solution (PBS) .
- PBS phosphate-buffered saline solution
- the total number of cells in the bronchoalveolar lavage (BAL) was determined with a Neubauer hemocytometer .
- a volume of 50 i of BAL was centrifuged onto cytospin glass slides at 400 rpm at room temperature for 5 minutes and stained with a Diff- Quick system (LabAids, Ronkonkoma, USA) .
- a total of 100 cells per slide were counted and classified as neutrophils, macrophages, lymphocytes and eosinophils on the basis of morphological criteria. Erythrocytes and epithelial cells were ignored and the results were expressed as cells/ml.
- peribronchial inflammation To assess the peribronchial inflammation, the lungs of a group of animals that had not been subjected to bronchoalveolar lavage were explanted, fixed in a solution of 4% paraformaldehyde (PFA) for 24 hours at 4°C and embedded in paraffin. Slices that were 5 ⁇ - thick, deparaffinized, stained with a hematoxylin-eosin solution (Bio-Optica, Milano, Italy) , dehydrated and mounted with glass coverslips. The extent of peribronchial inflammation was classified as follows: 0- normal; 1- few inflammatory cells; 3- a thick ring of inflammatory cells.
- PFA paraformaldehyde
- PAS periodic acid-Schiff' s reagent
- PDE4B and PDE4D were immunoprecipitated as described previously (2), using polyclonal rabbit antibodies freely available from Dr. Marco Conti at the University of California San Francisco, San Francisco, CA, USA.
- Commercial antibodies specific for PDE4B and PDE4D can be purchased from Abeam (Abeam, Cambridge, MA, USA) : anti-PDE4B product code: abl4611; anti-PDE4D product code: abl4614.
- Rabbit polyclonal antibodies against Ca v l .2 and phospho-Ca v l .2 are freely available from Dr. William A. Catterall at the University of Washington, Seattle, WA, USA, .
- P-PKA substrate The antibody that recognizes substrates phosphorylated by PKA (P-PKA substrate) was purchased from Cell Signaling Technology (Danvers, MA, USA; product code: # 9621) and the antibody against CFTR clone M3A7 from Millipore (Billerica, MA, USA; product code: 05-583) .
- ICUE3-pcDNA3 was described previously (2) .
- Isoproterenol, CGP-20712A, carbachol, Rolipram, amiloride and forskolin were all purchased from Sigma (Sigma-Aldrich, St. Louis, MO) .
- the CFTR corrector VX- 809, the CFTR potentiator VX-770 and the CFTR inhibitor 172 were purchased from Selleckchem (Houston, TX, USA) .
- the PI control peptide (SEQ ID No.: 3 RQIKIWFQNRRMKWKK) and the Trojan peptide derived from ⁇ 3 ⁇ (SEQ ID No . : 2
- RQIKIWFQNRRMKWKKGKATHRSPGQIHLVQRHPPSEESQAF were synthesized by GenScript (GenScript, Piscataway, NJ, USA) and Chinapeptides (Chinapeptides Co. Ltd., Shanghai, China) .
- a Trojan peptide derived from ⁇ 3 ⁇ enhances ⁇ 2 ⁇ AR/cAMP signaling in bronchial smooth muscle cells
- an inhibitory fusion peptide permeable to cell membranes was obtained by binding the 126-150 domain of human ⁇ 3 ⁇ (SEQ ID No.: 1) with the Trojan peptide of Antennapedia Penetratin 1 (SEQ ID No.: 3 - Figure 1A) .
- a version of the ⁇ 3 ⁇ inhibitory Trojan peptide labeled with fluorescein (FITC) accumulated in the cytoplasm of human bronchial smooth muscle cells (hBSMCs) at 30 minutes after incubation, showing that the inhibitor is efficiently transduced in vivo in isolated cells ( Figure IB) .
- the ⁇ 3 ⁇ inhibitory peptide significantly reduced the catalytic activity of PDE4B and PDE4D in tracheal smooth muscle cells of wild-type mice ( ⁇ 3 ⁇ + + ) , but not of animals devoid of the enzyme ( ⁇ 3 ⁇ _ ⁇ ) ( Figure 1C) , demonstrating the ability of the peptide to selectively interfere with PI3Ky-dependent anchoring of PKA.
- pre- treatment of hBSMCs with the ⁇ 3 ⁇ inhibitory Trojan peptide increased cAMP accumulation by 35% following stimulation of ⁇ 2- ⁇ , while cAMP levels were unchanged in cells treated with PI control peptide ( Figures ID and E) .
- ⁇ 3 ⁇ is a key regulator of cAMP in the vicinity of these Ca 2+ channels (2) .
- hBSMCs were exposed to a solution containing KC1, able to depolarize the membrane and, therefore, to activate VOCCs.
- the influx of Ca 2+ induced by KC1 was completely abolished by the ⁇ 3 ⁇ inhibitory Trojan peptide, while it was unchanged in hBSMCs treated with PI control peptide or vehicle ( Figure 2A-B) .
- a Trojan peptide that inhibits the PKA anchoring function of ⁇ 3 ⁇ constitutes a novel method for inhibiting selected PDEs and enhancing cAMP signaling downstream of ⁇ 2 - ⁇ , in smooth muscle cells.
- a Trojan peptide derived from ⁇ 3 ⁇ limits airway hyperresponsiveness in healthy and asthmatic mice
- FITC fluorescein (FITC) -labelled form of the peptide was instilled by the intra-tracheal route in BALB/C wild- type mice. FITC fluorescence was detected in the trachea and lungs, but not in the brain or in the myocardium, at 30 minutes after administration ( Figure 3A) ; this demonstrates that the peptide is efficiently distributed in the respiratory tract of the animals.
- cAMP levels were 30% higher in the trachea and in the lungs of mice injected with the ⁇ 3 ⁇ inhibitory Trojan peptide compared to control animals treated with phosphate-buffered saline solution (PBS) or PI control peptide (Figure 3B) .
- PBS phosphate-buffered saline solution
- Figure 3B PI control peptide
- a Trojan peptide derived from ⁇ 3 ⁇ increases cAMP levels and enhances the conductance of CFTR in bronchial epithelial cells expressing wild-type or a AF508 mutant CFTR
- Molecules with CFTR potentiator activity are required to stimulate the opening of the defective CFTR in the treatment of cystic fibrosis (CF) .
- CFTR-dependent currents were measured in bronchial epithelial cells expressing the mutant CFTR AF508-CFTR (CuFi-1) .
- ⁇ 3 ⁇ inhibition synergistically increased the activity of the known CFTR potentiator, VX-770, resulting in an increase of the CFTR currents by about 5-fold more than the basal activity ( Figures 4A and B) .
- the PI control peptide did not change the CFTR activity of in the presence of VX-770 ( Figures 4A and B) .
- a PI3Ky-derived Trojan peptide limits lung in lammation in asthmatic mice
- mice pre-treated with the PI control peptide before each intranasal injection of ovalbumin showed an increase in peribronchial inflammation ( Figures 7A and B) , and in the number of goblet cells, containing mucus and positive to the periodic acid-Schiff' s reagent (PAS) staining ( Figures 7A and C) , compared to control animals not sensitized to ovalbumin (naive) .
- PES periodic acid-Schiff' s reagent
- other leukocyte populations such as macrophages, lymphocytes and eosinophils were unchanged ( Figure 7E- F-G) .
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Organic Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Zoology (AREA)
- Epidemiology (AREA)
- Biochemistry (AREA)
- Immunology (AREA)
- Biophysics (AREA)
- Toxicology (AREA)
- Gastroenterology & Hepatology (AREA)
- Wood Science & Technology (AREA)
- Pulmonology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Biomedical Technology (AREA)
- Biotechnology (AREA)
- Microbiology (AREA)
- General Engineering & Computer Science (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
Abstract
Description
Claims
Priority Applications (14)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| NZ733017A NZ733017B2 (en) | 2015-12-22 | Novel pi3k gamma inhibitor peptide for treatment of respiratory system diseases | |
| AU2015370463A AU2015370463B2 (en) | 2014-12-24 | 2015-12-22 | Novel PI3K gamma inhibitor peptide for treatment of respiratory system diseases |
| EP15830858.5A EP3236983B1 (en) | 2014-12-24 | 2015-12-22 | Novel pi3k gamma inhibitor peptide for treatment of respiratory system diseases |
| PL15830858T PL3236983T3 (en) | 2014-12-24 | 2015-12-22 | Novel pi3k gamma inhibitor peptide for treatment of respiratory system diseases |
| ES15830858T ES2737227T3 (en) | 2014-12-24 | 2015-12-22 | Novel PI3K gamma inhibitor peptide for the treatment of diseases of the respiratory system |
| CN201580071130.7A CN107406488B (en) | 2014-12-24 | 2015-12-22 | Novel PI3Kγ inhibitor peptides for the treatment of respiratory diseases |
| US15/539,339 US10421794B2 (en) | 2014-12-24 | 2015-12-22 | PI3K gamma inhibitor peptide for treatment of respiratory system diseases |
| BR112017013453-5A BR112017013453B1 (en) | 2014-12-24 | 2015-12-22 | PRODUCT, PHARMACEUTICAL COMPOSITION AND USE OF FUSION PEPTIDE |
| CA2971121A CA2971121C (en) | 2014-12-24 | 2015-12-22 | Novel pi3k.gamma. inhibitor peptide for treatment of respiratory system diseases |
| DK15830858.5T DK3236983T3 (en) | 2014-12-24 | 2015-12-22 | HOWEVER, UNKNOWN PI3K GAMMA INHIBITOR SPEED FOR TREATMENT OF DISEASES IN THE RESPIRATORY SYSTEM |
| RU2017124487A RU2704826C2 (en) | 2014-12-24 | 2015-12-22 | NOVEL PEPTIDE-INHIBITOR PI3Kγ FOR TREATING RESPIRATORY DISEASES |
| IL253011A IL253011B (en) | 2014-12-24 | 2017-06-19 | Novel pi3k gamma inhibitor peptide for treatment of respiratory system diseases |
| US16/538,987 US10730921B2 (en) | 2014-12-24 | 2019-08-13 | PI3Kγ inhibitor peptide for treatment of respiratory system diseases |
| US16/911,485 US11352400B2 (en) | 2014-12-24 | 2020-06-25 | PI3K gamma inhibitor peptide for treatment of respiratory system diseases |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| ITTO20141105 | 2014-12-24 | ||
| ITTO2014A001105 | 2014-12-24 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US15/539,339 A-371-Of-International US10421794B2 (en) | 2014-12-24 | 2015-12-22 | PI3K gamma inhibitor peptide for treatment of respiratory system diseases |
| US16/538,987 Continuation US10730921B2 (en) | 2014-12-24 | 2019-08-13 | PI3Kγ inhibitor peptide for treatment of respiratory system diseases |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2016103176A1 true WO2016103176A1 (en) | 2016-06-30 |
Family
ID=52577903
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/IB2015/059880 Ceased WO2016103176A1 (en) | 2014-12-24 | 2015-12-22 | Novel pi3k gamma inhibitor peptide for treatment of respiratory system diseases |
Country Status (13)
| Country | Link |
|---|---|
| US (3) | US10421794B2 (en) |
| EP (1) | EP3236983B1 (en) |
| CN (2) | CN113563451A (en) |
| AU (1) | AU2015370463B2 (en) |
| BR (1) | BR112017013453B1 (en) |
| DK (1) | DK3236983T3 (en) |
| ES (1) | ES2737227T3 (en) |
| HU (1) | HUE045409T2 (en) |
| IL (1) | IL253011B (en) |
| PL (1) | PL3236983T3 (en) |
| PT (1) | PT3236983T (en) |
| RU (1) | RU2704826C2 (en) |
| WO (1) | WO2016103176A1 (en) |
Cited By (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US9670163B2 (en) | 2005-12-28 | 2017-06-06 | Vertex Pharmaceuticals Incorporated | Solid forms of N-[2,4-bis(1,1-dimethylethyl)-5-hydroxyphenyl]-1,4-dihydro-4-oxoquinoline-3-carboxamide |
| US9732080B2 (en) | 2006-11-03 | 2017-08-15 | Vertex Pharmaceuticals Incorporated | Azaindole derivatives as CFTR modulators |
| US10071979B2 (en) | 2010-04-22 | 2018-09-11 | Vertex Pharmaceuticals Incorporated | Process of producing cycloalkylcarboxamido-indole compounds |
| US10081621B2 (en) | 2010-03-25 | 2018-09-25 | Vertex Pharmaceuticals Incorporated | Solid forms of (R)-1(2,2-difluorobenzo[D][1,3]dioxol-5-yl)-N-(1-(2,3-dihydroxypropyl)-6-fluoro-2-(1-hydroxy-2-methylpropan-2-yl)-1H-indol-5-yl)cyclopropanecarboxamide |
| US10206877B2 (en) | 2014-04-15 | 2019-02-19 | Vertex Pharmaceuticals Incorporated | Pharmaceutical compositions for the treatment of cystic fibrosis transmembrane conductance regulator mediated diseases |
| IT202000012259A1 (en) * | 2020-05-25 | 2021-11-25 | Kither Biotech S R L | NEW THERAPY FOR THE TREATMENT OF FIBROPROLIFERATIVE VASCULAR DISEASES |
| IT202300025458A1 (en) * | 2023-11-29 | 2025-05-29 | Kither Biotech S R L | NON-NATURAL PEPTIDES TARGETING PI3K¿ SCAFFOLDING ACTIVITY AND THEIR THERAPEUTIC USES |
Families Citing this family (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2016103176A1 (en) | 2014-12-24 | 2016-06-30 | Kither Biotech S.R.L. | Novel pi3k gamma inhibitor peptide for treatment of respiratory system diseases |
Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2004026285A2 (en) * | 2002-09-19 | 2004-04-01 | Amgen Canada Inc. | Compositions and methods for treating heart disease |
| WO2009100305A1 (en) * | 2008-02-08 | 2009-08-13 | Targegen Inc. | Pteridine derivatives for treating respiratory disease |
| US8236523B2 (en) | 2004-08-23 | 2012-08-07 | The Johns Hopkins University | Camp reporters and high throughput assays |
Family Cites Families (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2000052467A1 (en) * | 1999-03-02 | 2000-09-08 | The University Of Dundee | Methods of determining altered ndpk functions |
| WO2006089106A2 (en) | 2005-02-17 | 2006-08-24 | Icos Corporation | Phosphoinositide 3-kinase inhibitors for inhibiting leukocyte accumulation |
| DE102005008921A1 (en) * | 2005-02-24 | 2006-08-31 | Boehringer Ingelheim Pharma Gmbh & Co. Kg | New drugs for the treatment of respiratory diseases |
| SI2004654T1 (en) * | 2006-04-04 | 2013-11-29 | The Regents Of The University Of California | Pyrazolopyrimidine derivatives for use as kinase antagonists |
| US8063012B2 (en) * | 2006-09-19 | 2011-11-22 | Phylogica Limited | Neuroprotective peptide inhibitors of AP-1 signaling and uses therefor |
| RU2595718C2 (en) | 2009-09-09 | 2016-08-27 | Селджен Авиломикс Рисерч,Инк. | Pi3-kinase inhibitors and use thereof |
| AU2012307159A1 (en) * | 2011-09-14 | 2014-02-27 | Abeterno Technologies Limited | Intracellular cell selection |
| WO2016103176A1 (en) | 2014-12-24 | 2016-06-30 | Kither Biotech S.R.L. | Novel pi3k gamma inhibitor peptide for treatment of respiratory system diseases |
-
2015
- 2015-12-22 WO PCT/IB2015/059880 patent/WO2016103176A1/en not_active Ceased
- 2015-12-22 BR BR112017013453-5A patent/BR112017013453B1/en active IP Right Grant
- 2015-12-22 DK DK15830858.5T patent/DK3236983T3/en active
- 2015-12-22 CN CN202110455414.3A patent/CN113563451A/en active Pending
- 2015-12-22 ES ES15830858T patent/ES2737227T3/en active Active
- 2015-12-22 PT PT15830858T patent/PT3236983T/en unknown
- 2015-12-22 PL PL15830858T patent/PL3236983T3/en unknown
- 2015-12-22 CN CN201580071130.7A patent/CN107406488B/en active Active
- 2015-12-22 HU HUE15830858A patent/HUE045409T2/en unknown
- 2015-12-22 US US15/539,339 patent/US10421794B2/en active Active
- 2015-12-22 AU AU2015370463A patent/AU2015370463B2/en active Active
- 2015-12-22 RU RU2017124487A patent/RU2704826C2/en active
- 2015-12-22 EP EP15830858.5A patent/EP3236983B1/en active Active
-
2017
- 2017-06-19 IL IL253011A patent/IL253011B/en active IP Right Grant
-
2019
- 2019-08-13 US US16/538,987 patent/US10730921B2/en active Active
-
2020
- 2020-06-25 US US16/911,485 patent/US11352400B2/en active Active
Patent Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2004026285A2 (en) * | 2002-09-19 | 2004-04-01 | Amgen Canada Inc. | Compositions and methods for treating heart disease |
| US8236523B2 (en) | 2004-08-23 | 2012-08-07 | The Johns Hopkins University | Camp reporters and high throughput assays |
| WO2009100305A1 (en) * | 2008-02-08 | 2009-08-13 | Targegen Inc. | Pteridine derivatives for treating respiratory disease |
Non-Patent Citations (17)
| Title |
|---|
| A. GHIGO ET AL., CIRCULATION, vol. 126, 23 October 2012 (2012-10-23), pages 2073 |
| A. PERINO ET AL., MOL CELL, vol. 42, 8 April 2011 (2011-04-08), pages 84 |
| CAIN ROBERT J ET AL: "Different PI 3-kinase inhibitors have distinct effects on endothelial permeability and leukocyte transmigration", INTERNATIONAL JOURNAL OF BIOCHEMISTRY AND CELL BIOLOGY, vol. 44, no. 11, 17 July 2012 (2012-07-17), pages 1929 - 1936, XP028940062, ISSN: 1357-2725, DOI: 10.1016/J.BIOCEL.2012.07.009 * |
| DEROSSI D (REPRINT) ET AL: "Trojan peptides: the penetratin system for intracellular delivery", TRENDS IN CELL BIOLOGY, ELSEVIER SCIENCE LTD, XX, vol. 8, no. 2, 1 February 1998 (1998-02-01), pages 84 - 87, XP002122131, ISSN: 0962-8924, DOI: 10.1016/S0962-8924(97)01214-2 * |
| E. HIRSCH ET AL., SCIENCE, vol. 287, 11 February 2000 (2000-02-11), pages 1049 |
| E. PATRUCCO ET AL., CELL, vol. 118, 6 August 2004 (2004-08-06), pages 375 |
| GHIGO ALESSANDRA ET AL: "Isoform selective phosphoinositide 3-kinase gamma and delta inhibitors and their therapeutic potential.", RECENT PATENTS ON INFLAMMATION & ALLERGY DRUG DISCOVERY JAN 2008, vol. 2, no. 1, January 2008 (2008-01-01), pages 1 - 10, XP002739134, ISSN: 1872-213X * |
| GHIGO ALESSANDRA ET AL: "PI3K inhibition in inflammation: Toward tailored therapies for specific diseases", BIOESSAYS, vol. 32, no. 3, March 2010 (2010-03-01), pages 185 - 196, XP002739133 * |
| HIRSCH E ET AL: "Taming the PI3K team to hold inflammation and cancer at bay", PHARMACOLOGY AND THERAPEUTICS, ELSEVIER, GB, vol. 118, no. 2, 1 May 2008 (2008-05-01), pages 192 - 205, XP022650580, ISSN: 0163-7258, [retrieved on 20080305], DOI: 10.1016/J.PHARMTHERA.2008.02.004 * |
| ITO K ET AL: "Therapeutic potential of phosphatidylinositol 3-kinase inhibitors in inflammatory respiratory disease", JOURNAL OF PHARMACOLOGY AND EXPERIMENTAL THERAPEUTICS, AMERICAN SOCIETY FOR PHARMACOLOGY AND EXPERIMENTAL THERAPEUTICS, US, vol. 321, no. 1, 1 January 2007 (2007-01-01), pages 1 - 8, XP002534044, ISSN: 0022-3565, DOI: 10.1124/JPET.106.111674 * |
| J. DOUKAS ET AL: "Aerosolized Phosphoinositide 3-Kinase / Inhibitor TG100-115 [3-[2,4-Diamino-6-(3-hydroxyphenyl)pteridin-7-yl]phenol] as a Therapeutic Candidate for Asthma and Chronic Obstructive Pulmonary Disease", JOURNAL OF PHARMACOLOGY AND EXPERIMENTAL THERAPEUTICS, vol. 328, no. 3, 4 December 2008 (2008-12-04), pages 758 - 765, XP055186547, ISSN: 0022-3565, DOI: 10.1124/jpet.108.144311 * |
| M. DELLA PERUTA; C. GIAGULLI; C. LAUDANNA; A. SCARPA; C. SORIO, MOL CANCER, vol. 9, 2010, pages 61 |
| MARWICK JOHN A ET AL: "Phosphatidylinositol 3-kinase isoforms as targets in respiratory disease", THERAPEUTIC ADVANCES IN RESPIRATORY DISEASE,, vol. 4, no. 1, 1 February 2010 (2010-02-01), pages 19 - 34, XP009184042, ISSN: 1753-4666, DOI: 10.1177/1753465809352792 * |
| MOSCHOS STERGHIOS ATHANASIOS ET AL: "Lung delivery studies using siRNA conjugated to TAT(48-60) and penetratin reveal peptide induced reduction in gene expression and induction of innate immunity", BIOCONJUGATE CHEMISTRY, ACS, WASHINGTON, DC, US, vol. 18, no. 5, 1 September 2007 (2007-09-01), pages 1450 - 1459, XP002492909, ISSN: 1043-1802, DOI: 10.1021/BC070077D * |
| S. MYOU ET AL: "Blockade of Inflammation and Airway Hyperresponsiveness in Immune-sensitized Mice by Dominant-Negative Phosphoinositide 3-Kinase-TAT", JOURNAL OF EXPERIMENTAL MEDICINE, vol. 198, no. 10, 10 November 2003 (2003-11-10), pages 1573 - 1582, XP055186912, ISSN: 0022-1007, DOI: 10.1084/jem.20030298 * |
| V. FANELLI ET AL., INTENSIVE CARE MED, vol. 36, November 2010 (2010-11-01), pages 1935 |
| VITO FANELLI ET AL: "Pulmonary-derived phosphoinositide 3-kinase gamma (PI3KÎ ) contributes to ventilator-induced lung injury and edema", INTENSIVE CARE MEDICINE, SPRINGER, BERLIN, DE, vol. 36, no. 11, 19 August 2010 (2010-08-19), pages 1935 - 1945, XP019836905, ISSN: 1432-1238 * |
Cited By (11)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US9670163B2 (en) | 2005-12-28 | 2017-06-06 | Vertex Pharmaceuticals Incorporated | Solid forms of N-[2,4-bis(1,1-dimethylethyl)-5-hydroxyphenyl]-1,4-dihydro-4-oxoquinoline-3-carboxamide |
| US9732080B2 (en) | 2006-11-03 | 2017-08-15 | Vertex Pharmaceuticals Incorporated | Azaindole derivatives as CFTR modulators |
| US10081621B2 (en) | 2010-03-25 | 2018-09-25 | Vertex Pharmaceuticals Incorporated | Solid forms of (R)-1(2,2-difluorobenzo[D][1,3]dioxol-5-yl)-N-(1-(2,3-dihydroxypropyl)-6-fluoro-2-(1-hydroxy-2-methylpropan-2-yl)-1H-indol-5-yl)cyclopropanecarboxamide |
| US10071979B2 (en) | 2010-04-22 | 2018-09-11 | Vertex Pharmaceuticals Incorporated | Process of producing cycloalkylcarboxamido-indole compounds |
| US10206877B2 (en) | 2014-04-15 | 2019-02-19 | Vertex Pharmaceuticals Incorporated | Pharmaceutical compositions for the treatment of cystic fibrosis transmembrane conductance regulator mediated diseases |
| IT202000012259A1 (en) * | 2020-05-25 | 2021-11-25 | Kither Biotech S R L | NEW THERAPY FOR THE TREATMENT OF FIBROPROLIFERATIVE VASCULAR DISEASES |
| WO2021239662A1 (en) | 2020-05-25 | 2021-12-02 | Kither Biotech S.R.L. | Pi3k gamma inhibitor peptide for treatment of fibroproliferative vascular diseases |
| JP2023526814A (en) * | 2020-05-25 | 2023-06-23 | キダー バイオテック エス・アール・エル | PI3Kγ inhibitory peptides for the treatment of fibroproliferative vascular disease |
| US20230234996A1 (en) * | 2020-05-25 | 2023-07-27 | Kither Biotech S.R.L. | Pi3k gamma inhibitor peptide for treatment of fibroproliferative vascular diseases |
| IT202300025458A1 (en) * | 2023-11-29 | 2025-05-29 | Kither Biotech S R L | NON-NATURAL PEPTIDES TARGETING PI3K¿ SCAFFOLDING ACTIVITY AND THEIR THERAPEUTIC USES |
| WO2025113859A1 (en) * | 2023-11-29 | 2025-06-05 | Kither Biotech S.R.L. | "NON-NATURAL PEPTIDES TARGETING THE SCAFFOLD ACTIVITY OF PI3Kγ AND THERAPEUTIC USES THEREOF" |
Also Published As
| Publication number | Publication date |
|---|---|
| PL3236983T3 (en) | 2019-10-31 |
| DK3236983T3 (en) | 2019-07-15 |
| US20190367571A1 (en) | 2019-12-05 |
| BR112017013453B1 (en) | 2024-02-27 |
| CA2971121A1 (en) | 2016-06-30 |
| IL253011A0 (en) | 2017-08-31 |
| RU2017124487A3 (en) | 2019-02-28 |
| NZ733017A (en) | 2024-12-20 |
| US11352400B2 (en) | 2022-06-07 |
| EP3236983B1 (en) | 2019-04-17 |
| US10421794B2 (en) | 2019-09-24 |
| CN113563451A (en) | 2021-10-29 |
| AU2015370463A1 (en) | 2017-07-13 |
| CN107406488B (en) | 2021-08-31 |
| US10730921B2 (en) | 2020-08-04 |
| EP3236983A1 (en) | 2017-11-01 |
| ES2737227T3 (en) | 2020-01-10 |
| AU2015370463B2 (en) | 2020-12-24 |
| US20200317740A1 (en) | 2020-10-08 |
| IL253011B (en) | 2021-02-28 |
| PT3236983T (en) | 2019-07-23 |
| CN107406488A (en) | 2017-11-28 |
| BR112017013453A2 (en) | 2018-03-06 |
| RU2704826C2 (en) | 2019-10-31 |
| HUE045409T2 (en) | 2019-12-30 |
| US20180086798A1 (en) | 2018-03-29 |
| RU2017124487A (en) | 2019-01-25 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US11352400B2 (en) | PI3K gamma inhibitor peptide for treatment of respiratory system diseases | |
| JP2000517165A (en) | Novel lipid kinase | |
| US8420780B2 (en) | Mutated netrin 4, fragments thereof and uses thereof as drugs | |
| EP3740496A1 (en) | Proteinaceous molecules and uses therefor | |
| US20070054848A1 (en) | Composition and method for nerve regeneration | |
| EP2303921A2 (en) | Mutated netrin-4 proteins, fragments thereof and their uses as drugs | |
| US20180335433A1 (en) | Compositions targeting pkc-theta and uses and methods of treating pkc-theta pathologies, adverse immune responses and diseases | |
| Lv et al. | Heme oxygenase‐1 alleviates allergic airway inflammation by suppressing NF‐κB‐mediated pyroptosis of bronchial epithelial cells | |
| CA2971121C (en) | Novel pi3k.gamma. inhibitor peptide for treatment of respiratory system diseases | |
| HK40062761A (en) | NOVEL PI3Kγ INHIBITOR PEPTIDE FOR TREATMENT OF RESPIRATORY SYSTEM DISEASES | |
| US20090131310A1 (en) | Mucin3 egf-like domains | |
| CN108026161A (en) | Anti-angiogenic properties of collagen V-derived fragments | |
| Geiger | Roles of Transient Receptor Potential (TRP) cation channels in primary pulmonary fibroblasts | |
| KR102096100B1 (en) | Pharmaceutical Composition for Treating or Preventing Parkinson's Disease comprising apoptosis signal-regulating kinase 1 Phosphorylation Inhibitor | |
| US10125183B2 (en) | Decoy peptides inhibiting binding of AMIGO2 and 3-phosphoinositide-dependent kinase 1 | |
| Palloni | AMPK-MEDIATED LONG-TERM REGULATION OF HCN4CONTRIBUTES TO AGE-RELATED SINUS BRADYCARDIA | |
| Wei et al. | Administration of Neuritin as a novel therapeutic strategy for autoimmune and inflammatory diseases | |
| KR20120112196A (en) | Use of hades as a negative regulator of akt | |
| Ren | A Peptide-based cAMP Elevator Inhibits Inflammation and Improves CFTR Function in Obstructive Airway disease | |
| Buonarati | Postsynaptic Ion Channel Regulation: Downstream Targets of β2AR Signaling | |
| JP2009001521A (en) | Inhibition of ErbB4 signal by receptor type protein tyrosine phosphatase Ptprz | |
| US20170145391A1 (en) | TRUNCATED VARIANT OF THE MAMMALIAN TARGET FOR RAPAMYCIN (mTOR) PROTEIN | |
| Rohrbach | Investigating The Role Of Myristoylated Alanine Rich C Kinase Substrate'S (Marcks'S) Effector Domain In Lung And Brain Cancer Biology | |
| Ma | Biophysical and Pharmacological Characterisations of Pannexin 1 | |
| US20110070234A1 (en) | Np1 activity regulating elements useful for the production of drugs for the treatment or prevention of human neurodegenerative diseases, resulting drugs and use thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 15830858 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2971121 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 253011 Country of ref document: IL |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 15539339 Country of ref document: US |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| REEP | Request for entry into the european phase |
Ref document number: 2015830858 Country of ref document: EP |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112017013453 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 2015370463 Country of ref document: AU Date of ref document: 20151222 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2017124487 Country of ref document: RU Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 112017013453 Country of ref document: BR Kind code of ref document: A2 Effective date: 20170621 |
|
| WWG | Wipo information: grant in national office |
Ref document number: 733017 Country of ref document: NZ |