WO2016100985A2 - Chimeric antigen receptors and methods of use thereof - Google Patents

Chimeric antigen receptors and methods of use thereof Download PDF

Info

Publication number
WO2016100985A2
WO2016100985A2 PCT/US2015/067225 US2015067225W WO2016100985A2 WO 2016100985 A2 WO2016100985 A2 WO 2016100985A2 US 2015067225 W US2015067225 W US 2015067225W WO 2016100985 A2 WO2016100985 A2 WO 2016100985A2
Authority
WO
WIPO (PCT)
Prior art keywords
amino acid
cells
seq
cell
cdrs
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2015/067225
Other languages
French (fr)
Other versions
WO2016100985A3 (en
Inventor
Wayne A. Marasco
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Dana Farber Cancer Institute Inc
Original Assignee
Dana Farber Cancer Institute Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to JP2017532639A priority Critical patent/JP2018504894A/en
Priority to IL320860A priority patent/IL320860A/en
Priority to IL302660A priority patent/IL302660B2/en
Priority to AU2015364245A priority patent/AU2015364245B2/en
Priority to IL252295A priority patent/IL252295B2/en
Priority to EP15828615.3A priority patent/EP3233900A2/en
Priority to CN201580069023.0A priority patent/CN108064252A/en
Application filed by Dana Farber Cancer Institute Inc filed Critical Dana Farber Cancer Institute Inc
Priority to RU2017125531A priority patent/RU2017125531A/en
Priority to US15/537,779 priority patent/US20170362297A1/en
Priority to CA2968412A priority patent/CA2968412A1/en
Priority to KR1020267003069A priority patent/KR20260038272A/en
Priority to KR1020177020045A priority patent/KR102923234B1/en
Priority to BR112017013176-5A priority patent/BR112017013176A2/en
Publication of WO2016100985A2 publication Critical patent/WO2016100985A2/en
Publication of WO2016100985A3 publication Critical patent/WO2016100985A3/en
Anticipated expiration legal-status Critical
Priority to AU2020204373A priority patent/AU2020204373B2/en
Priority to US16/986,913 priority patent/US12195514B2/en
Priority to AU2022200257A priority patent/AU2022200257B2/en
Priority to JP2022011441A priority patent/JP7548950B2/en
Priority to AU2024200592A priority patent/AU2024200592B2/en
Priority to JP2024147204A priority patent/JP7833003B2/en
Priority to US18/970,194 priority patent/US20250243259A1/en
Ceased legal-status Critical Current

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503—Immunoglobulin superfamily
    • C07K14/7051—T-cell receptor (TcR)-CD3 complex
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503—Immunoglobulin superfamily
    • C07K14/70521—CD28, CD152
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503—Immunoglobulin superfamily
    • C07K14/70535—Fc-receptors, e.g. CD16, CD32, CD64 (CD2314/705F)
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70578—NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2827—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against B7 molecules, e.g. CD80, CD86
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K19/00—Hybrid peptides, i.e. peptides covalently bound to nucleic acids, or non-covalently bound protein-protein complexes
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622—Single chain antibody (scFv)
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/02—Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment

Definitions

  • the present invention relates generally to chimeric antigen receptor cells for and methods of using same for treatment cancer and other disorders.
  • T lymphocytes recognize specific antigens through interaction of the T cell receptor (TCR) with short peptides presented by major histocompatibility complex (MHC) class I or II molecules.
  • TCR T cell receptor
  • MHC major histocompatibility complex
  • APCs professional antigen-presenting cells
  • TCR activation in the absence of co-stimulation can result in unresponsiveness and clonal anergy.
  • APCs professional antigen-presenting cells
  • Chimeric antigen receptors have been constructed that consist of binding domains derived from natural ligands or antibodies specific for cell-surface components of the TCR-associated CD3 complex. Upon antigen binding, such chimeric antigen receptors link to endogenous signaling pathways in the effector cell and generate activating signals similar to those initiated by the TCR complex. Since the first reports on chimeric antigen receptors, this concept has steadily been refined and the molecular design of chimeric receptors has been optimized. Aided by advances in recombinant antibody technology, chimeric antigen receptors targeted to a wide variety of antigens on the surface of cancer cells and of cells infected by human immunodeficiency virus (HIV) have been generated.
  • HIV human immunodeficiency virus
  • the invention provides a chimeric antigen receptor (CAR) having an intracellular signaling domain, a transmembrane domain and an extracellular domain.
  • CAR chimeric antigen receptor
  • the transmembrane domain further includes a stalk region positioned between the extracellular domain and the transmembrane domain.
  • the transmembrane domain includes CD28.
  • the CAR further includes one or more additional costimulatory molecules positioned between the transmembrane domain and the intracellular signaling domain.
  • the costimulatory molecules is CD28, 4-1BB, ICOS, or OX40.
  • the intracellular signaling domain is for example a CD3 zeta chain.
  • the extracellular domain is an antibody such as a Fab or a scFV. Preferably the antibody is specific for BCMA, CA-9, CD 138, CCR4, or the influenza virus.
  • nucleic acids encoding the CAR of the invention further including a nucleic acid encoding a polypeptide positioned after the intracellular signaling domain.
  • the polypeptide is an antibody such as scFV.
  • the antibody is specific for CCR4, PD-1, PDL-1, PD-L2, CXCR4, or GITR.
  • the invention provides a genetically engineered cell which express and bear on the cell surface membrane the chimeric antigen receptor of the invention.
  • the cell is a T-cell or an NK cell.
  • the T cell is CD4 + or CD8 + .
  • the cell is a mixed population of CD4 + and CD8 cells + .
  • the cell is further engineered to express and secrete a polypeptide such as for example an antibody.
  • FIG. 1 ADCC of CAIX-specific Abs. 1 ⁇ g/ml C AlX-specific scFv-Fc minibodies were added to the target tumor cells in the presence of human PBMC (E:T 25: 1). Similar results were obtained in 2 experiments. Irrelevant anti-SARS scFv-Fc (11 A) and anti-CCR4 scFv-Fc (48) minibodies were used as negative controls. A, CAIX+ sk-rc-09 cells; B, CAIX+ sk-rc-52 cells; C, CAIX- sk-rc-59 cells.
  • FIG. 1 Construction and expression of CAIX-specific CARs.
  • the 1 st generation CAR, scFv-CD8-TCR ⁇ (CD8 CAR), is composed of a specific anti-CAIX scFv that is coupled to truncated human CD8a extracellular domain, hinge (H), transmembrane (TM) and intracellular regions, then to the signaling domain of human TCRC.
  • the 2 nd generation CAR, scFv-CD28-TCRC (CD28 CAR), contains anti- CAIX scFv fused with human CD28 extracellular, TM and intracellular signaling domain to TCR ⁇ .
  • Both anti-CAIX CARs were cloned into a bicistronic self-inactivating (SIN) lentiviral vector with expression driven by an internal eFl-a promoter.
  • the CAR control construct contains an irrelevant anti-HIV CCR5 specific A8 scFv substitution.
  • anti-CAIX scFv CARs were stained with CAIX-Fc fusion protein and C9-tag (TETSQVAPA) was stained with 1D4 antibody.
  • LAK only were served as unstained cell control (i) or stained with 2 nd antibody (ii. PE-anti-human IgG and iii. APC-anti-mouse IgG) were used as staining controls.
  • FIG. 3 Effector functions of CAIX-specific CARTs.
  • FIG. 4 Clonal expansion of CART cells after tumor contact.
  • B Clonal enrichment. In tumor stimulation experiments, cultures from CART-and LAK cells were assayed on one week and two weeks by flow cytometry for expression of CART and T-cell subset. One representative of two results is shown.
  • Fig. 5 Regression of established human RCC xenografts by CART cells.
  • FIG. 6 In vivo anti-tumor activity of CAR+ T-cells.
  • A. Expression of ZsGreen by CART cells is shown in upper panel. CART cells were pre-stained with Far Red dye, cytospun and examined by fluorescent microscopy ⁇ lower panel).
  • the higher magnification view ⁇ middle and lower panels of sections a and b in upper panel) shows the locations of granzyme B+ T cells (shown by arrows) and the corresponding H&E slide shows the tumor necrosis (shown by n).
  • Granzyme B+ T cells are distributed at the edge of tumor ⁇ middle panel) and inside the tumor ⁇ lower panel).
  • Figure 9 Low background staining of granzyme B in CAIX- sk-rc-59 tumors treated with LAK cells.
  • FIG. 10 Positive control of granzyme B staining was performed on sk-rc-52 tumors which was local injected with G36 CD28z CART cells (left) and tumor morphology was shown in H&E (right).
  • FIG. 11 Expression of aCAIX CAR and aPD-Ll scFv-Fc transiently transfected 293T cells.
  • 10 6 of 293T cells were transfected with or without lentiviral pHAGE-EFlaG36-C9tag-CD28-CD3zeta-IRES-anti-PDLl scFv-Fc (IgG4)-WPRE or the control pHAGE-EFla-A716-C9tag-CD28-CD3zeta-IRES-ZsGreen-WPRE plasmids.
  • Cells and supernatant were harvested at 24 and 48 hours post transfection. Left, purified
  • CAIX(ECD)-Fc-Biotin and Streptavidin-APC were used for cell staining and flow cytometry analysis. Right, total human IgG in supematant was quantitated with human IgG quantification kit.
  • FIG. 12 (A) Total PBMCs from 4 donors were stimulated with 50 ng/ml SEB and treated with 10 ug/ml anti-PDLl (#42) sIgG4 or anti-influenza sIgG4. Restoration of IFNy production (upper) or TNFa production (lower) was measured. (B) Parental anti- CCR4 antibody, cl567IgG, inhibited chemotaxis of Tregs to CCL22. (C) CD4 + CD25 " T cells were CFSE-labeled, incubated with Tregs at 10: 1 ratio, and then stimulated with anti- CCR4 mAb and control mAb in the presence of anti-CD3/28 co-stimulation.
  • the CFSE-labeled Teffs were harvested and CFSE intensity was analyzed by flow cytometry. The proliferation of Teffs were only observed when the coculture incubated with anti-GITR mAb. Right, IFNy production in the same cultures was further measured by MSD.
  • CFSE-labeled Teffs (5x10 4 ) and unlabeled Tregs (5x10 3 ) were co-incubated with 20 ⁇ g/ml PHA in 96-well plates for 5 days.
  • the CFSE-labeled Teffs were harvested and CFSE intensity was analyzed by flow cytometry. Teffs were proliferated after 5-day incubation with PHA, but not in the
  • Teff/Treg coculture Left, IFNy production in the same cultures was measured by MSD.
  • Figure 13 is an illustration showing different CART configurations according to the invention.
  • Figure 14 is an illustration showing different armed CART configurations according to the invention.
  • Figure 15 is a further illustration showing different armed CART configurations according to the invention.
  • FIG 16 is a series of illustrations and graphs indicating chimeric antigen receptors (CAR) constructs for CD8+ T cell transduction.
  • CAR chimeric antigen receptors
  • the second cassette after the Internal Ribosome Entry Site (IRES) sequence, is responsible by coding the soluble Anti-PD-Ll IgGl or IgG4 isotypes or the Anti-Severe Acute respiratory syndrome (SARS) coronavirus IgGl.
  • IRS Internal Ribosome Entry Site
  • SARS Anti-Severe Acute respiratory syndrome coronavirus IgGl.
  • the pHAGE vectors were transfected together with the packaging plasmids (Gag, Rev, Tat and VSVG) into 293T LentiX cells using Polyethyleneimine. The viruses were harvested two days after transfection, purified and concentrated using LentiX
  • T cells were transduced with the lentiviruses to generate Anti-CAIX CART Cells, which are able to recognize CAIX positive RCC, and also release Anti-PD-Ll IgGl or IgG4 in the tumor microenvironment to block PD-1/PD-L1 -induced T cell exhaustion.
  • C Percentage of CART cells 14 days after transduction, representing the stable long-term expression of CAR by the integrated lentiviruses in CD8+T cells.
  • the CD8+ T cells were selected using DynabeadsTM CD8 Positive isolation Kit (Life Technologies) and activated with DynabeadsTM Human T Cell Activator CD3/CD28 (Life Technologies) in the presence of IL-21 50U/mL. IL-21 was added to the medium every 2 days. After 14 days, the CART cells were incubated with human CAIX-Fc or BCMA-Fc, followed by incubation with an APC conjugated anti-human Fc IgG and analyzed by FACS.
  • the CD8+ CART cells were previously cultivated for five days after transduction with Anti CAIX CAR able to express anti-PD-Ll IgGl (AntiCAIX/Anti -PD-Ll IgGl), IgG4 (Anti-CAIX/ Anti-PD-Ll IgG4) or a unspecific Anti-SARS Ab (Anti-CAIX/Anti SARS IgGl) or Anti-BCMA CAR (negative control) able to express an unspecific anti-SARS Ab (Anti-BCMA/ Anti SARS IgGl) and activated with DynabeadsTM Human T Activator CD3/CD28 (Life Technologies) in the presence of IL-21 50U/mL.
  • the beads were removed and the CART cells were cultured with skrc52 CAIX+ PD-Ll - and IL-21 (50 U/mL), which was added to the medium every 2 days for 21 days.
  • the results represent the average ⁇ SD of three donors in duplicate.
  • FIG 17 is a series of graphs that illustrate CART cell effector function.
  • A Viability of Skrc59 CAIX+/ PD-Ll + cells or
  • B Skrc52 CAIX-/ PD-Ll - cells incubated overnight (O.N.) with CART cells Anti-CAIX/Anti-PD-Ll IgGl, Anti-CAIX/Anti-PD-Ll IgG4, Anti-CAIX/Anti SARS IgGl or Anti-BCMA/Anti SARS IgGl.
  • MTT Molecular ProbesTM
  • the IFNy secretion was evaluated using the Human IFNy ELISA Ready-SET-Go Kit (eBiosciencesTM). *P ⁇ 0.05 for all CART cells compared to Anti-BCMA/ Anti-SARS IgGl.
  • G Ab-dependent cell- mediated cytotoxicity of skrc59 CAIX+/PD-L1+ or
  • H skrc52 CAIX-/PD-L1- after incubation with the supernatant (SN) of CART cells containing 500 ng/mL of the Anti-PD- Ll IgGl, Anti-PD-Ll IgG4 or the Anti-SARS IgGl .
  • CART cells were incubated for six days with DynabeadsTM Human T Activator CD3/CD28 (Life Technologies) in the presence of IL-21 50U/mL. After 7 days, the medium containing the mAbs was harvested NK cells were purified using an EasySepTM Human NK Cell Enrichment Kit (StemCell 1M Technologies). RCC cell lines Skrc59 CAIX+ PD-L1+ and Skrc52 CAIX- PD-L1- were used as target cells and plated at 1.5 ⁇ 10 3 /well in a 96-well plate.
  • RCC cells were incubated for 1 hour, 37°C, with 50 of the CART cells supernatant adjusted for 500 ng/mL of the respective Ab Anti-PD-Ll IgGl, Anti-PD-Ll IgG4 or Anti-SARS IgGl. After the incubation, the cells were washed with medium and incubated with 12.5: 1, 25: 1 or 50: 1 NK cells for 4h, 37°C. Culture supernatants were harvested by centrifugation and LDH measured in the supernatant by CytoTox 96® Non- Radioactive Cytotoxicity Assay (PromegaTM) at 490 nm. These results represent the average ⁇ SD of three donors in duplicate.
  • Figure 18 is a series of graphs that depict CART cells expression of exhaustion markers.
  • the CD8+ CART cells were selected using DynabeadsTM CD8 Positive isolation Kit (Life Technologies), activated with DynabeadsTM Human T Activator CD3/CD28 (Life Technologies) and transduced with the following CARs: Anti-CAIX/Anti-PD-Ll IgGl, Anti-CAIX/Anti-PD-Ll IgG4, Anti- CAIX/Anti SARS IgGl or Anti-BCMA/Anti SARS IgGl. These cells were cultured in the presence of IL-21 50U/mL and DynabeadsTM Human T Activator CD3/CD28 for five days.
  • FIG 19 is a series of images and graphs that depict the effect that CART cells have in an orthotopic model of human RCC.
  • the tumor bioluminescence was quantified after 5 minutes of luciferin IP injection using IVIS.
  • (B) Imaging of the tumors after excision at day 30. Scale bar 1 cm.
  • FIG. 20 is a series of graphs and histological images that depict antitumor activity from CART cells.
  • TIL tumor infiltrating lymphocytes
  • the kidney tumors from all mice were divided in two parts and one of them was fragmented in small pieces and digested with collagenase and DNAse to extraction of TIL.
  • the CART cells were analyzed for the exhaustion markers PD-1, Tim-3 and Lag3. *P ⁇ 0.05 compared with untransduced, Anti-BCMA/Anti SARS IgGl CAR and Anti-CAIX/Anti-SARS IgGl .
  • the tissue sections were incubated for 45 minutes with the rabbit anti human Ki67 polyclonal Ab 1 :2000 (Vector, VP-K451), mouse anti -human PD- Ll mAb 10.4 ⁇ g/mL (Clone 405.9A11) developed by Dr. Gordon Freeman (Boston, MA), biotinylated CAIX-Fc protein 17 ⁇ g/mL (produced in our lab), rabbit anti human granzyme B polyclonal Ab (Abeam, ab4059) 1 : 100 or rabbit anti-human NC AM (CD56) mAb 1 : 100 (Abeam, abl 33345), followed by secondary HRP conjugated anti -rabbit Ab or HRP-Avidin.
  • the rabbit anti human Ki67 polyclonal Ab 1 :2000 Vector, VP-K451
  • mouse anti -human PD- Ll mAb 10.4 ⁇ g/mL (Clone 405.9A11) developed by Dr. Gordon Freeman (Boston
  • the slides were developed using 3,3'-diaminobenzidine (DAB) and counterstained with hematoxylin.
  • DAB 3,3'-diaminobenzidine
  • the images were obtained in an Olympus BX51 microscopy using a DP71 digital camera (Olympus) and analyzed in the DP Controller Software (OlympusTM).
  • the scale bars represent the magnification of the images of each column [500 ⁇ (40X), 100 ⁇ (200X) or 50 ⁇ (400X)].
  • C A series of graphs present percentage quantification of TIL staining positive for Granzyme B, PD-L1-IHC, and Ki67. Also presented in (C) is a Ki67- DAB Pixel count of TILs.
  • Figure 21 is a series of graphs that depict the evaluation of IL-2 versus IL-21 to CD8+ CART cells proliferation.
  • a and B Proliferation of CART transduced cells in the presence of IL-2 or IL-21 evaluated 48h, 72h and 120h after transduction with lentiviruses.
  • A Anti-CAIX CART cells or
  • B Unspecific Anti-BCMA CART cells (both with ZsGreen in the second cassette).
  • the CD8+ T cells were selected using DynabeadsTM CD8 Positive isolation Kit (Life Technologies) and activated with DynabeadsTM Human T Activator CD3/CD28 (Life Technologies) in the presence of IL2 or IL-21 50U/mL (PeprotechTM).
  • the CART cells transduction was evaluated by ZsGreen expression using FACS. The data represents the average ⁇ SD of two donors. *p ⁇ 0.05 comparing IL-21 with non treated control (Ctr); **p ⁇ 0.05 comparing IL21 with IL-2.
  • C and D Viability of RCC cells treated with CD8+ CART cells cultivated in the presence of IL-2 or IL-21. The viability was evaluated by MTT after an overnight incubation of CART cells Anti-BCMA, Anti-CAIX or Untransduced T cells with (C) Skrc-59 CAIX+/PD-L1+ and (F) Skrc-52 CAIX-/PD-L1- RCC cells.
  • the CART cells were previously cultivated in the presence of IL2 or IL-21 50U/mL for 120 hours. These results represent the average ⁇ SD of two donors in triplicate. *P ⁇ 0.05 comparing Anti-CAIX CAR with Anti-BCMA CAR or untransduced T cells.
  • FIG 22 is a series of flow cytometry graphs that depict the expression of PD-1 and CAIX in the renal cell carcinoma (RCC) lines.
  • A Negative control
  • B Skrc52 CAIX- PD-L1-
  • C Skrc52 CAIX+ PD-L1-
  • D Skrc59 CAIX+ PD-L1+.
  • the cells were stained with Anti-human CAIX antibody developed with APC-Anti-human Fc IgG and Biotinylated Anti human PD-L1 antibody developed with PE-Avidin. The analysis was performed by FACS.
  • FIG. 23 is a series of graphs that depict the characterization of CART cells.
  • A Proliferation of total CD8+ T cells two or four days after transduction Anti CAIX C AR/Anti-PD-L 1 IgGl), (Anti-CAIX CAR/ Anti -PD-L 1 IgG4), Anti-CAIX CAR/ Anti SARS IgGl) or Anti-BCMA CAR/Anti SARS IgGl).
  • the CD8+ T cells were selected using DynabeadsTM CD8 Positive isolation Kit (Life Technologies) and activated with DynabeadsTM Human T Activator CD3/CD28 (Life Technologies) in the presence of IL-21 50U/mL. IL-21 was added to the medium every 2 days.
  • the proliferation was evaluated by FACS using Counting Beads (Molecular Probes).
  • B Concentration of CAR-transduced T cells two and four days after transduction. The CART cells were incubated with human CAIX-Fc or BCMA-Fc, followed by incubation with an APC conjugated anti -human Fc IgG and analyzed by FACS.
  • C Percentage of CART cells 2 and 4 days after transduction. The results represent the average ⁇ SD of three donors in duplicate.
  • Figure 24 is a series of graphs that depict the effect that CART cells have in an orthotopic model of human RCC.
  • the tumor bioluminescence was quantified after 5 minutes of luciferin IP injection using IVIS. In the Day 17, more 2.5x106 CART cells were injected. *P ⁇ 0.05 compared to anti-BCMA CART cells. **P ⁇ 0.05 compared to untransduced T cells, ***P ⁇ 0.05 compared to Anti- CAIX/Anti-SARS IgGl. (B) Percentage of T cells in the mice blood after 8 days of treatment. *P ⁇ 0.05 compared to untransduced T cells. **P ⁇ 0.05 compared to all Anti- CAIX CARs. The red blood cells were lysed with ACK Lysing Buffer (LonzaTM) and the remaining cells were stained with Pacific Blue conjugated Anti-human CD45 and analyzed by FACS.
  • TIL tumor infiltrating lymphocytes
  • FIGs 25A and 25B are a series of graphs and histological images that depict Human natural killer (NK) cells in the tumors treated with Anti-CAIX CART cells releasing anti-PD-Ll IgGl Ab.
  • A Percentage of CD56+ cells (NK marker) in the tumors. Two mice of each group were injected with 4.5x106 NK cells one day before the euthanasia. The kidney tumors from all mice were divided in two parts and one of them was fragmented in small pieces and digested with collagenase and DNAse to extraction of NK. NK cells present in the tumor were stained with APC-Anti-CD56 Ab and analyzed by FACS.
  • the slides were developed using 3,3'-diaminobenzidine (DAB) and counterstained with hematoxylin.
  • DAB 3,3'-diaminobenzidine
  • the images were obtained in an Olympus BX51 microscopy using a DP71 digital camera (Olympus) and analyzed in the DP Controller Software (Olympus).
  • the quantification was performed using the IHC Profiler Plugin of ImageJ Software (23).
  • the scale bars represent the magnification of the images (400X). *P ⁇ 0.05 compared with untransduced, **P ⁇ 0.05 compared with untransduced and Anti- BCMA/Anti-SARS IgGl .
  • the present invention relates to a chimeric antigen receptor (CAR) particularly adapted to immune cells used in immunotherapy.
  • CAR chimeric antigen receptor
  • a double immunotherapeutic strategy is described based on the blocking of T cell exhaustion using anti-PD-Ll antibodies secreted by targeted anti- CAIX CAR T cells combined in a single lentivirus construct for improving cancer treatment.
  • An emerging mechanism associated with the progression of RCC and other tumors is the immune checkpoint pathway, which consists in cellular interactions that prevent excessive activation of T cells under normal conditions, allowing T cell function in a self-limited manner.
  • immune checkpoint pathway As an evasion mechanism, many tumors are able to stimulate the expression of immune checkpoint molecules, resulting in an anergic phenotype of T cells that cannot restrain tumor progression.
  • Emerging clinical data highlight the importance of one inhibitory ligand and receptor pair as an immune checkpoint: the programmed death- ligand 1 (PD-L1 ; B7-H1 and CD274) and programmed death receptor-1 (PD-1; CD279), in preventing killing of cancer cells by cytotoxic T-lymphocytes.
  • PDl receptor is expressed by many cell types like T cells, B cells, Natural Killer cells (NK) and host tissues.
  • Tumors and Antigen-presenting cells (APC) expressing PD-L1 can block T cell receptor (TCR) signaling of cytotoxic T-lymphocytes through binding to receptor PD-1, decreasing the production of cytokines and T cell proliferation.
  • TCR T cell receptor
  • PD-L1 overexpression can be found in many tumor types and may also mediate an immunosuppressive function through its interaction with other proteins, including CD80 (B7.1), blocking its ability to activate T cells through binding to CD28.
  • CAR tumor-directed chimeric antigen receptors
  • CARTS lymphocytes
  • a single CAR targets two or more antigens.
  • the CARTS are further modified to express and secrete one or more polypeptides, such as for example an antibody or a cytokine.
  • Such CARTS are referred to herein as armed CARTS. Armed CARTS allow for simultaneous secretion of the polypeptide locally at the targeted site (i.e., tumor site).
  • a modified TCR called chimeric antigen receptor (CAR) containing single chain variable antibody fragment (scFv) previously selected by high affinity against a specific tumor associated antigen is a powerful new approach against cancer.
  • the scFv presented in the CAR is linked to an intracellular signaling block that includes CD3 ⁇ to induce T cell activation followed by antigen binding.
  • This structure is characteristic for first-generation CARs, which were improved to second- and generation CARs that link the signaling co- stimulatory endodomains of CD28, 4-1BB, or OX40 to CD3 or 3 rd -generation CARs that links two elements to CD3 ⁇ in tandem.
  • CART cells antigen-presenting cells
  • the lymphocytes include a receptor that is chimeric, non- natural and engineered at least in part by the hand of man.
  • the engineered chimeric antigen receptor has one, two, three, four, or more components, and in some embodiments the one or more components facilitate targeting or binding of the lymphocyte to one or more tumor antigen-comprising cancer cells.
  • the CAR according to the invention generally comprises at least one transmembrane polypeptide comprising at least one extracellular ligand-biding domain and; one transmembrane polypeptide comprising at least one intracellular signaling domain; such that the polypeptides assemble together to form a Chimeric Antigen Receptor.
  • extracellular ligand-binding domain is defined as an oligo- or polypeptide that is capable of binding a ligand.
  • the domain will be capable of interacting with a cell surface molecule.
  • the extracellular ligand- binding domain may be chosen to recognize a ligand that acts as a cell surface marker on target cells associated with a particular disease state.
  • the extracellular ligand-binding domain can comprise an antigen binding domain derived from an antibody against an antigen of the target.
  • the antigen of the target can be a tumor-associated surface antigen, such as ErbB2 (HER2/neu), carcinoembryonic antigen (CEA), epithelial cell adhesion molecule (EpCAM), epidermal growth factor receptor (EGFR), EGFR variant III (EGFRvIII), CD 19, CD20, CD30, CD40, disialoganglioside GD2, ductal-epithelial mucine, gp36, TAG-72, glycosphingolipids, glioma-associated antigen, .beta.
  • HER2/neu tumor-associated surface antigen
  • CEA carcinoembryonic antigen
  • EpCAM epithelial cell adhesion molecule
  • EGFR epidermal growth factor receptor
  • EGFR variant III EGFRvIII
  • CD19 CD20, CD30, CD40, disialoganglioside GD2, ductal-epithelial mucine, gp36, TAG-72, glycosphingolipids
  • the CAR is specific for BMC A, CAIX, CCR4, PD-L1, PD-L2, PD1, Glucocorticoid-Induced Tumor Necrosis Factor Receptors (GITR), Severe acute respiratory syndrome (SARS), influenza, flavivirus or Middle East Respiratory Syndrome (MERS).
  • GITR Tumor Necrosis Factor Receptors
  • SARS Severe acute respiratory syndrome
  • influenza influenza
  • flavivirus or Middle East Respiratory Syndrome MERS
  • said extracellular ligand-binding domain is a single chain antibody fragment (scFv) comprising the light (VL) and the heavy (VH) variable fragment of a target antigen specific monoclonal antibody joined by a flexible linker.
  • scFv single chain antibody fragment
  • said scFv antibody is specific for BMCA, CAIX, CCR4, PD-L1, PD-L2, PD1, GITR, SARS, influenza, flavivirus or MERS.
  • Exemplary antibodies useful in constructing the CAR according to the invention includes antibodies disclosed in for example: WO/2005/060520 , WO/2006/089141, WO/2007/065027, WO/2009/086514, WO/2009/079259, WO/2011/153380,
  • Exemplary anti-PDLl antibodies include antibodies having containing a VH nucleotide sequence having SEQ ID NO: 1485 and a VL nucleotide sequence having SEQ ID NO: 1487; a VH nucleotide sequence having SEQ ID NO: 1485 and a VL nucleotide sequence having SEQ ID NO: 1487; a VH nucleotide sequence having SEQ ID NO: 1489 and a VL nucleotide sequence having SEQ ID NO: 1491 ; a VH nucleotide sequence having SEQ ID NO: 1493 and a VL nucleotide sequence having SEQ ID NO: 1495; a VH nucleotide sequence having SEQ ID NO: 1497 and a VL nucleotide sequence having SEQ ID NO: 1499; a VH nucleotide sequence having SEQ ID NO: 1501 and a VL nucleotide sequence having SEQ ID NO: 1503; a VH nucleotide
  • Exemplary anti-PDLl antibodies include antibodies having containing a VH amino acid sequence having SEQ ID NO: 970 and a VL amino acid sequence having SEQ ID NO: 971; a VH amino acid having SEQ ID NO: 1486 and a VL polypeptide sequence having SEQ ID NO: 1488 a VH amino acid having SEQ ID NO: 1490 and a VL polypeptide sequence having SEQ ID NO: 1492 a VH amino acid having SEQ ID NO: 1494 and a VL polypeptide sequence having SEQ ID NO: 1496 a VH amino acid having SEQ ID NO: 1498 and a VL polypeptide sequence having SEQ ID NO: 1500 a VH amino acid having SEQ ID NO: 1502 and a VL polypeptide sequence having SEQ ID NO: 1504 a VH amino acid having SEQ ID NO: 1506 and a VL polypeptide sequence having SEQ ID NO: 1508 a VH amino acid having SEQ ID NO: 1510 and a VL polypeptid
  • the anti-PDLl antibodies have a heavy chain with three CDRs including the amino acid sequences SEQ ID NO: 1541, 1554, 1569 respectively and a light chain with three CDRs including the amino acid sequences 1584, 1599, 1610 respectively; or a heavy chain with three CDRs comprising the amino acid sequences 1543,
  • Exemplary SARS neutralizing antibodies include antibodies having containing a VH nucleotide sequence having SEQ ID NO: 1626 and a VL nucleotide sequence having SEQ ID NO: 1628; a VH nucleotide sequence having SEQ ID NO: 1630 and a VL nucleotide sequence having SEQ ID NO: 1639; a VH nucleotide sequence having SEQ ID NO: 1634 and a VL nucleotide sequence having SEQ ID NO: 1640; a VH nucleotide sequence having SEQ ID NO: 1632 and a VL nucleotide sequence having SEQ ID NO: 1641 ; a VH nucleotide sequence having SEQ ID NO: 1633 and a VL nucleotide sequence having SEQ ID NO: 1642; a VH nucleotide sequence having SEQ ID NO: 1634 and a VL nucleotide sequence having SEQ ID NO: 1643; a VH nucleotide sequence
  • Exemplary anti-CXCR4 antibody include antibodies having a VH amino acid sequence having SEQ ID NO: 771 and a VL amino acid sequence having SEQ ID NO: 779; a VH amino acid sequence having SEQ ID NO: 772 and a VL amino acid sequence having SEQ ID NO: 780; a VH amino acid sequence having SEQ ID NO: 773 and a VL amino acid sequence having SEQ ID NO: 781; a VH amino acid sequence having SEQ ID NO: 774 and a VL amino acid sequence having SEQ ID NO: 782; a VH amino acid sequence having SEQ ID NO: 775 and a VL amino acid sequence having SEQ ID NO: 783; a VH amino acid sequence having SEQ ID NO: 776 and a VL amino acid sequence having SEQ ID NO: 784; a VH amino acid sequence having SEQ ID NO: 777 and a VL amino acid sequence having SEQ ID NO: 785; or a VH amino acid sequence having SEQ ID NO: 7
  • the anti-CXCR4 antibodies have a heavy chain with three CDRs including the amino acid sequences SEQ ID NO: 803, 804, 805 respectively and a light chain with three CDRs including the amino acid sequences 806, 807, 808 respectively; or a heavy chain with three CDRs comprising the amino acid sequences 809, 810, 811, respectively and a light chain with three CDRs comprising the amino acid sequences 812, 813, 814, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 815, 816, 817 respectively and a light chain with three CDRs comprising the amino acid sequences 818, 819, 820 respectively; or a heavy chain with three CDRs comprising the amino acid sequences 827, 828, 829 respectively and a light chain with three CDRs comprising the amino acid sequences 830, 831, 832 respectively; or a heavy chain with three CDRs comprising the amino acid sequences 833, 834, 835
  • Exemplary anti-CA IX antibodies include antibodies having containing a VH amino acid sequence having SEQ ID NO: 845 and a VL amino acid sequence having SEQ ID NO: 846; a VH amino acid sequence having SEQ ID NO: 847 and a VL amino acid sequence having SEQ ID NO: 868; a VH amino acid sequence having SEQ ID NO: 848 and a VL amino acid sequence having SEQ ID NO: 869; a VH amino acid sequence having SEQ ID NO: 849 and a VL amino acid sequence having SEQ ID NO: 870; a VH amino acid sequence having SEQ ID NO: 850 and a VL amino acid sequence having SEQ ID NO: 871; a VH amino acid sequence having SEQ ID NO: 851 and a VL amino acid sequence having SEQ ID NO: 872; a VH amino acid sequence having SEQ ID NO: 852 and a VL amino acid sequence having SEQ ID NO NO:
  • the anti-CA IX antibodies have a heavy chain with three CDRs including the amino acid sequences SEQ ID NO: 803, 804, 805 respectively and a light chain with three CDRs including the amino acid sequences 806, 807, 808 respectively; or a heavy chain with three CDRs comprising the amino acid sequences 899, 915, 909 and a light chain with three CDRs comprising the amino acid sequences 905, 906, 952 or a heavy chain with three CDRs comprising the amino acid sequences 899, 915, 909 and a light chain with three CDRs comprising the amino acid sequences 935, 943, 953 or a heavy chain with three CDRs comprising the amino acid sequences 899, 915, 909 and a light chain with three CDRs comprising the amino acid sequences 935, 906, 954 or a heavy chain with three CDRs comprising the amino acid sequences 910, 916, 923 and a light chain with three CDRs comprising the amino acid
  • CCR4 CC-CHEMOKINE RECEPTOR 4
  • Exemplary CC-chemokine receptor 4 (CCR4) antibodies include antibodies having containing a VH nucleotide sequence having SEQ ID NO: 969 and a VL nucleotide sequence having SEQ ID NO: 971 ; a VH nucleotide sequence having SEQ ID NO: 969 and a VL nucleotide sequence having SEQ ID NO: 972.
  • Exemplary CCR4 antibodies include antibodies having containing a VH amino acid sequence having SEQ ID NO: 970 and a VL amino acid sequence having SEQ ID NO: 971.
  • the CCR4 antibodies have a heavy chain with three CDRs including the amino acid sequences SEQ ID NO: 973, 974, 975 respectively and a light chain with three CDRs including the amino acid sequences 976, 977, 978 respectively.
  • Exemplary anti-Middle East Respiratory Syndrome coronavirus (MERS-CoV) antibody include antibodies having a VH nucleotide sequence having SEQ ID NO: 677and a VL nucleotide sequence having SEQ ID NO:679; a VH nucleotide sequence having SEQ ID NO: 681and a VL nucleotide sequence having SEQ ID NO:683; a VH nucleotide sequence having SEQ ID NO: 685and a VL nucleotide sequence having SEQ ID NO:687; a VH nucleotide sequence having SEQ ID NO: 689and a VL nucleotide sequence having SEQ ID NO:692; a VH nucleotide sequence having SEQ ID NO: 693and a VL nucleotide sequence having SEQ ID NO: 695; a VH nucleotide sequence having SEQ ID NO: 697and a VL nucleotide sequence having SEQ ID NO: 6
  • Exemplary anti-Middle East Respiratory Syndrome coronavirus (MERS-CoV) antibody include antibodies having a VH amino acid sequence SEQ ID NO: 678 and a VL amino acid sequence having SEQ ID NO: 680; a VH amino acid sequence SEQ ID NO: 682 and a VL amino acid sequence having SEQ ID NO: 684; a VH amino acid sequence SEQ ID NO: 686 and a VL amino acid sequence having SEQ ID NO: 688; a VH amino acid sequence SEQ ID NO: 690 and a VL amino acid sequence having SEQ ID NO: 692; a VH amino acid sequence SEQ ID NO: 694 and a VL amino acid sequence having SEQ ID NO: 696; a VH amino acid sequence SEQ ID NO: 698 and a VL amino acid sequence having SEQ ID NO: 700; and a VH amino acid sequence SEQ ID NO: 702 and a VL amino acid sequence having SEQ ID NO: 704.
  • the anti-Middle East Respiratory Syndrome coronavirus (MERS-CoV) antibody has a heavy chain with three CDRs including the amino acid sequences of 705, 706, and 707 and a light chain with three CDRs including the amino acid sequences 722, 723, and 724; a heavy chain with three CDRs including the amino acid sequences of 708, 709, and 710 and a light chain with three CDRs including the amino acid sequences 725, 726, and 727; a heavy chain with three CDRs including the amino acid sequences of 711, 712, and 713 and a light chain with three CDRs including the amino acid sequences 728, 729, and 730; a heavy chain with three CDRs including the amino acid sequences of 711, 735, and 715 and a light chain with three CDRs including the amino acid sequences 731, 732, and 733; a heavy chain with three CDRs including the amino acid sequences of 711, 735, and 715
  • Exemplary anti-human GITR antibody include antibodies having a VH nucleotide sequence having SEQ ID NO: 1361 and a VL nucleotide sequence having SEQ ID NO: 1363; a VH nucleotide sequence having SEQ ID NO: 1365 and a VL nucleotide sequence having SEQ ID NO: 1367; a VH nucleotide sequence having SEQ ID NO: 1369 and a VL nucleotide sequence having SEQ ID NO: 1371 ; a VH nucleotide sequence having SEQ ID NO: 1381 and a VL nucleotide sequence having SEQ ID NO: 1375; a VH nucleotide sequence having SEQ ID NO: 1377 and a VL nucleotide sequence having SEQ ID NO: 1379; a VH nucleotide sequence having SEQ ID NO: 1381 and a VL nucleotide sequence having SEQ ID NO: 1383; a VH nucleotide sequence having SEQ
  • Exemplary anti-human GITR antibody include antibodies having a VH amino acid sequence having SEQ ID NO: 1362 and a VL amino acid sequence having SEQ ID NO: 1364; a VH amino acid having SEQ ID NO: 1366 and a VL polypeptide sequence having SEQ ID NO: 1368; a VH amino acid sequence having SEQ ID NO: 1371 and a VL amino acid sequence having SEQ ID NO: 1372; a VH amino acid sequence having SEQ ID NO: 1382 and a VL amino acid sequence having SEQ ID NO: 1376; a VH nucleotide sequence having SEQ ID NO: 1378 and a VL nucleotide sequence having SEQ ID NO: 1380; a VH amino acid having SEQ ID NO: 1382 and a VL polypeptide sequence having SEQ ID NO: 1384; a VH amino acid sequence having SEQ ID NO: 1386 and a VL amino acid sequence having SEQ ID NO: 1388; a VH amino acid sequence having SEQ ID NO
  • the anti-human GITR antibody has a heavy chain with three CDRs including the amino acid sequences 1405, 1406, and 1407 and a light chain with three CDRs including the amino acid sequencesl408, 1409, and 1410 respectively; a heavy chain with three CDRs including the amino acid sequences 1411, 1412, and 1413 and a light chain with three CDRs including the amino acid sequences 1414, 1415, and 1416 respectively; a heavy chain with three CDRs including the amino acid sequences 1417, 1418, and 1419 and a light chain with three CDRs including the amino acid sequences 1420, 1421, and 1422 respectively; a heavy chain with three CDRs including the amino acid sequences 1423, 1424, and 1425 and a light chain with three CDRs including the amino acid sequences 1426, 1427, and 1428 respectively; a heavy chain with three CDRs including the amino acid sequences 1429, 1430, and 1431 and a light chain with three CDRs including the
  • Exemplary anti-West Nile virus envelope protein E (WNE) antibody include antibodies having a VH nucleotide sequence having a VH amino acid sequence having SEQ ID NO: 1224 and a VL amino acid sequence having SEQ ID NO: 1226.
  • Exemplary anti-West Nile virus envelope protein E (WNE) antibody include antibodies having a VH nucleotide sequence having SEQ ID NO: 1225 and a VL nucleotide sequence having SEQ ID NO: 1227.
  • the anti-West Nile virus envelope protein E (WNE) antibody has a heavy chain with three CDRs including the amino acid sequences 1244, 1245, and 1246 and a light chain with three CDRs including the amino acid sequences 1247, 1248, and 1249 respectively.
  • Exemplary anti-CC-chemokine receptor 4 (CCR4) antibody include antibodies having a VH nucleotide sequence having SEQ ID NO: 1329 and a VL nucleotide sequence having SEQ ID NO: 1331; a VH nucleotide sequence having SEQ ID NO: 1333 and a V L nucleotide sequence having SEQ ID NO: 1335; a VH nucleotide sequence having SEQ ID NO: 1337 and a VL nucleotide sequence having SEQ ID NO: 1192; a VH nucleotide sequence having SEQ ID NO: 1341 and a VL nucleotide sequence having SEQ ID NO: 1343; or a VH nucleotide sequence having SEQ ID NO: 1357 and a VL nucleotide sequence having SEQ ID NO: 1359.
  • Exemplary anti-CC-chemokine receptor 4 (CCR4) antibody include antibodies having a VH amino acid sequence having SEQ ID NO: 1330 and a VL amino acid sequence having SEQ ID NO: 1332; a V H amino acid sequence having SEQ ID NO: 1334 and a V L amino acid sequence having SEQ ID NO: 1336; a VH amino acid sequence having SEQ ID NO: 1338 and a VL amino acid sequence having SEQ ID NO: 1340; a VH amino acid sequence having SEQ ID NO: 1342 and a VL amino acid sequence having SEQ ID NO: 1344; or a VH amino acid sequence having SEQ ID NO: 1358 and a VL amino acid sequence having SEQ ID NO: 1360.
  • the anti-CC-chemokine receptor 4 (CCR4) antibody has a heavy chain with three CDRs including the amino acid sequences 1203, 1208, and 1211 and a light chain with three CDRs including the amino acid sequences 1207, 1209, and 1216 respectively; or a heavy chain with three CDRs including the amino acid sequences 1204, 1208, and 1212 and a light chain with three CDRs including the amino acid sequences
  • Exemplary anti-human immunoglobulin heavy chain variable region germline gene VHl-69 antibody include antibodies having a VH nucleotide sequence having SEQ ID NO: 1153 and a VL nucleotide sequence having SEQ ID NO: 1155; or a VH nucleotide sequence having SEQ ID NO: 1163 and a VL nucleotide sequence having SEQ ID NO:
  • Exemplary anti-human immunoglobulin heavy chain variable region germline gene VHl-69 antibody include antibodies having a VH amino acid sequence having SEQ ID NO: 1154 and a VL amino acid sequence having SEQ ID NO: 1156; or a VH amino acid sequence having SEQ ID NO: 1164 and a VL amino acid sequence having SEQ ID NO: 1156.
  • the anti-human immunoglobulin heavy chain variable region germline gene VHl-69 antibody has a heavy chain with three CDRs including the amino acid sequences 1157, 1158, and 1159 and a light chain with three CDRs including the amino acid sequences 1160, 1161, and 1162 respectively.
  • Exemplary anti-influenza antibody include antibodies having a VH nucleotide sequence having SEQ ID NO: 981 and a VL nucleotide sequence having SEQ ID NO: 983; a VH nucleotide sequence having SEQ ID NO: 985 and a VL nucleotide sequence having SEQ ID NO: 989; a VH nucleotide sequence having SEQ ID NO: 987 and a VL nucleotide sequence having SEQ ID NO: 991; a VH nucleotide sequence having SEQ ID NO: 993 and a VL nucleotide sequence having SEQ ID NO: 997; a VH nucleotide sequence having SEQ ID NO: 995 and a VK nucleotide sequence having SEQ ID NO: 999; a VH nucleotide sequence having SEQ ID NO: 1001 and a VL nucleotide sequence having SEQ ID NO: 1005; a VH nucleotide sequence having
  • Exemplary anti-influenza antibody include antibodies having a VH amino acid sequence having SEQ ID NO: 982 and a VL amino acid sequence having SEQ ID NO: 984; a VH amino acid sequence having SEQ ID NO: 986 and a VL amino acid sequence having SEQ ID NO: 988; a VH amino acid sequence having SEQ ID NO: 986 and a VL amino acid sequence having SEQ ID NO: 990; a VH amino acid sequence having SEQ ID NO: 992 and a VL amino acid sequence having SEQ ID NO: 994; a VH amino acid sequence having SEQ ID NO: 992 and a VK amino acid sequence having SEQ ID NO: 996; a VH amino acid sequence having SEQ ID NO: 998 and a VL amino acid sequence having SEQ ID NO: 1000; a VH amino acid sequence having SEQ ID NO: 998 and a VL amino acid sequence having SEQ ID NO: 1002; a VH amino acid sequence having SEQ ID NO: 1004 and
  • the anti-influenza antibody has a heavy chain with three CDRs including the amino acid sequences of 1023, 1031, and 1039 and a light chain with three CDRs including the amino acid sequences 1047, 1059, and 1071 ; a heavy chain with three CDRs including the amino acid sequences of 1023, 1032, and 1040 and a light chain with three CDRs including the amino acid sequences 1048, 1060, and 1072; a heavy chain with three CDRs including the amino acid sequences of 1025, 1032, and 1040 and a light chain with three CDRs including the amino acid sequences 1057, 1069, and 1081 ; a heavy chain with three CDRs including the amino acid sequences of 1026, 1033, and 1041 and a light chain with three CDRs including the amino acid sequences 1049, 1061, and 1073; a heavy chain with three CDRs including the amino acid sequences of 1026, 1033, and 1041 and a light chain with three CDRs including the amino acid
  • Exemplary anti-influenza antibodies include antibodies having containing a VH nucleotide sequence having SEQ ID NO: 397 and a VL nucleotide sequence having SEQ ID NO: 398; a VH nucleotide sequence having SEQ ID NO: 399 and a VL nucleotide sequence having SEQ ID NO:400; a VH nucleotide sequence having SEQ ID NO: 401 and a V L nucleotide sequence having SEQ ID NO: 402; a VH nucleotide sequence having SEQ ID NO: 403 and a VL nucleotide sequence having SEQ ID NO: 404; or a VH nucleotide sequence having SEQ ID NO: 405 and a VL nucleotide sequence having SEQ ID NO:406; or a VH nucleotide sequence having SEQ ID NO: 407 and a VL nucleotide sequence having SEQ ID NO:408; or a VH nucleo
  • Exemplary anti-influenza antibodies antibody include antibodies having containing a VH amino acid sequence having SEQ ID NO: 469 and a VL amino acid sequence having SEQ ID NO: 470; a VH amino acid having SEQ ID NO: 471 and a V L polypeptide sequence having SEQ ID NO:472; a VH amino acid sequence having SEQ ID NO: 473 and a VL amino acid sequence having SEQ ID NO: 474; a VH amino acid sequence having SEQ ID NO: 475 and a VL amino acid sequence having SEQ ID NO: 476; or a VH nucleotide sequence having SEQ ID NO: 477 and a VL nucleotide sequence having SEQ ID NO:478; a VH amino acid sequence having SEQ ID NO: 479 and a VL amino acid sequence having SEQ ID NO: 480; a VH amino acid sequence having SEQ ID NO: 481 and a VL amino acid sequence having SEQ ID NO: 482; a VH amino amino acid sequence
  • the anti-influenza antibodies antibody has a heavy chain with three CDRs including the amino acid sequences SEQ ID NO: 1, 37, 73 respectively and a light chain with three CDRs including the amino acid sequences 109, 145, 181 respectively; or a heavy chain with three CDRs comprising the amino acid sequences 2, 38, 74 respectively and a light chain with three CDRs comprising the amino acid sequences 110, 146, 182, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 3, 39, 75 respectively and a light chain with three CDRs comprising the amino acid sequences 111, 147, 183, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 4, 40, 76 respectively and a light chain with three CDRs comprising the amino acid sequences 112, 148, 184, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 5, 41, 77 respectively and a light chain with three CDRs comprising the
  • anti-influenza antibodies include those having the amino acid or nucleic acid sequences shown in the below Table 1.
  • V H chain of 3114 (SEQ ID NO: 1665)
  • V L chain of 3114 (SEQ ID NO: 1667) AATTTTATGCTGACTCAGCCACCCTCAGCGTCTGGGACCCCCGGGCAGAGGGTCACCATCTCTTGC TCTGGAAGCAGCTCCAACATCGGAGGTAATACTGTACACTGGTTCCAGCAGCTCCCAGGAACGGCC CCCAAACTCCTCATCTATACTAATAGTCTGCGGCCCTCAGGGGTCCCTGACCGATTCTCTGGCTCC AAGTCTGGCACCTCAGCCTCCCTGGCCATCAGTGGGCTCCAGTCTGAGGATGAGGCTGATTATTAC TGTGCAGCATGGGATGACAGCCTAAATGGTCAGGTGTTCGGCGGAGGGACCAAGCTGACCGTCCTA
  • V H chain of 3114 (SEQ ID NO: 1666)
  • V L chain of 3114 (SEQ ID NO: 1668)
  • V L chain of 3I14V L D94N (SEQ ID NO: 1669)
  • V L chain of 3I14V L D94N (SEQ ID NO: 1670)
  • binding domain than scFv can also be used for predefined targeting of lymphocytes, such as camelid single-domain antibody fragments or receptor ligands, antibody binding domains, antibody hypervariable loops or CDRs as non limiting examples.
  • said transmembrane domain further comprises a stalk region between said extracellular ligand-binding domain and said transmembrane domain.
  • the term "stalk region" used herein generally means any oligo- or polypeptide that functions to link the transmembrane domain to the extracellular ligand-binding domain. In particular, stalk region are used to provide more flexibility and accessibility for the extracellular ligand-binding domain.
  • a stalk region may comprise up to 300 amino acids, preferably 10 to 100 amino acids and most preferably 25 to 50 amino acids.
  • Stalk region may be derived from all or part of naturally occurring molecules, such as from all or part of the extracellular region of CD8, CD4 or CD28, or from all or part of an antibody constant region.
  • the stalk region may be a synthetic sequence that corresponds to a naturally occurring stalk sequence, or may be an entirely synthetic stalk sequence.
  • said stalk region is a part of human CD8 alpha chain
  • the signal transducing domain or intracellular signaling domain of the CAR of the invention is responsible for intracellular signaling following the binding of extracellular ligand binding domain to the target resulting in the activation of the immune cell and immune response.
  • the signal transducing domain is responsible for the activation of at least one of the normal effector functions of the immune cell in which the CAR is expressed.
  • the effector function of a T cell can be a cytolytic activity or helper activity including the secretion of cytokines.
  • the term "signal transducing domain” refers to the portion of a protein which transduces the effector signal function signal and directs the cell to perform a specialized function.
  • Signal transduction domain comprises two distinct classes of cytoplasmic signaling sequence, those that initiate antigen-dependent primary activation, and those that act in an antigen-independent manner to provide a secondary or co-stimulatory signal.
  • Primary cytoplasmic signaling sequence can comprise signaling motifs which are known as immunoreceptor tyrosine-based activation motifs of ITAMs.
  • ITAMs are well defined signaling motifs found in the intracytoplasmic tail of a variety of receptors that serve as binding sites for syk/zap70 class tyrosine kinases.
  • Examples of IT AM used in the invention can include as non limiting examples those derived from TCR zeta, FcR gamma, FcR beta, FcR epsilon, CD3 gamma, CD3 delta, CD3 epsilon, CD5, CD22, CD79a, CD79b and CD66d.
  • the signaling transducing domain of the CAR can comprise the CD3 zeta signaling domain, or the intracytoplasmic domain of the Fc epsilon RI beta or gamma chains.
  • the signaling is provided by CD3 zeta together with co-stimulation provided by CD28 and a tumor necrosis factor receptor (TNFr), such as 4- IBB or OX40), for example.
  • TNFr tumor necrosis factor receptor
  • the intracellular signaling domain of the CAR of the present invention comprises a co-stimulatory signal molecule.
  • the intracellular signaling domain contains 2, 3, 4 or more co-stimulatory molecules in tandem.
  • a co-stimulatory molecule is a cell surface molecule other than an antigen receptor or their ligands that is required for an efficient immune response.
  • Co-stimulatory ligand refers to a molecule on an antigen presenting cell that specifically binds a cognate co-stimulatory molecule on a T-cell, thereby providing a signal which, in addition to the primary signal provided by, for instance, binding of a TCR/CD3 complex with an MHC molecule loaded with peptide, mediates a T cell response, including, but not limited to, proliferation activation, differentiation and the like.
  • a co-stimulatory ligand can include but is not limited to CD7, B7-1 (CD80), B7-2 (CD86), PD-Ll, PD-L2, 4- 1BBL, OX40L, inducible costimulatory ligand (ICOS-L), intercellular adhesion molecule (ICAM, CD30L, CD40, CD70, CD83, HLA-G, MICA, M1CB, HVEM, lymphotoxin beta receptor, 3/TR6, ILT3, ILT4, an agonist or antibody that binds Toll ligand receptor and a ligand that specifically binds with B7-H3.
  • a co-stimulatory ligand also encompasses, inter alia, an antibody that specifically binds with a co-stimulatory molecule present on a T cell, such as but not limited to, CD27, CD28, 4-IBB, OX40, CD30, CD40, PD-1, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LTGHT, NKG2C, B7-H3, a ligand that specifically binds with CD83.
  • an antibody that specifically binds with a co-stimulatory molecule present on a T cell such as but not limited to, CD27, CD28, 4-IBB, OX40, CD30, CD40, PD-1, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LTGHT, NKG2C, B7-H3, a ligand that specifically binds with CD83.
  • a "co-stimulatory molecule” refers to the cognate binding partner on a T-cell that specifically binds with a co-stimulatory ligand, thereby mediating a co-stimulatory response by the cell, such as, but not limited to proliferation.
  • Co-stimulatory molecules include, but are not limited to an MHC class 1 molecule, BTLA and Toll ligand receptor.
  • costimulatory molecules include CD27, CD28, CD8, 4-IBB (CD137), OX40, CD30, CD40, PD-1, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, B7-H3 and a ligand that specifically binds with CD83 and the like.
  • said signal transducing domain is a TNFR-associated Factor 2 (TRAF2) binding motifs, intracytoplasmic tail of costimulatory TNFR member family.
  • Cytoplasmic tail of costimulatory TNFR family member contains TRAF2 binding motifs consisting of the major conserved motif (P/S/A)X(Q/E)E) or the minor motif (PXQXXD), wherein X is any amino acid.
  • TRAF proteins are recruited to the intracellular tails of many TNFRs in response to receptor trimerization.
  • transmembrane polypeptides comprise the ability to be expressed at the surface of an immune cell, in particular lymphocyte cells or Natural killer (NK) cells, and to interact together for directing cellular response of immune cell against a predefined target cell.
  • the different transmembrane polypeptides of the CAR of the present invention comprising an extracellular ligand-biding domain and/or a signal transducing domain interact together to take part in signal transduction following the binding with a target ligand and induce an immune response.
  • the transmembrane domain can be derived either from a natural or from a synthetic source.
  • the transmembrane domain can be derived from any membrane-bound or transmembrane protein.
  • amino acid sequence functional variants of the polypeptide can be prepared by mutations in the DNA which encodes the polypeptide.
  • Such variants or functional variants include, for example, deletions from, or insertions or substitutions of, residues within the amino acid sequence. Any combination of deletion, insertion, and substitution may also be made to arrive at the final construct, provided that the final construct possesses the desired activity, especially to exhibit a specific anti-target cellular immune activity.
  • the functionality of the CAR of the invention within a host cell is detectable in an assay suitable for demonstrating the signaling potential of said CAR upon binding of a particular target.
  • this assay allows the detection of a signaling pathway, triggered upon binding of the target, such as an assay involving measurement of the increase of calcium ion release, intracellular tyrosine phosphorylation, inositol phosphate turnover, or interleukin (IL) 2, interferon .gamma., GM-CSF, IL-3, IL-4 production thus effected.
  • IL interleukin
  • Embodiments of the invention include cells that express a CAR (i.e, CARTS).
  • the cell may be of any kind, including an immune cell capable of expressing the CAR for cancer therapy or a cell, such as a bacterial cell, that harbors an expression vector that encodes the CAR.
  • the terms "cell,” “cell line,” and “cell culture” may be used interchangeably. All of these terms also include their progeny, which is any and all subsequent generations. It is understood that all progeny may not be identical due to deliberate or inadvertent mutations.
  • host cell refers to a eukaryotic cell that is capable of replicating a vector and/or expressing a heterologous gene encoded by a vector.
  • a host cell can, and has been, used as a recipient for vectors.
  • a host cell may be "transfected” or “transformed,” which refers to a process by which exogenous nucleic acid is transferred or introduced into the host cell.
  • a transformed cell includes the primary subject cell and its progeny.
  • engineered” and “recombinant” cells or host cells are intended to refer to a cell into which an exogenous nucleic acid sequence, such as, for example, a vector, has been introduced.
  • a host cell is a T cell, including a cytotoxic T cell (also known as TC, Cytotoxic T Lymphocyte, CTL, T-Killer cell, cytolytic T cell, CD8+ T-cells or killer T cell); NK cells and NKT cells are also encompassed in the invention.
  • cytotoxic T cell also known as TC, Cytotoxic T Lymphocyte, CTL, T-Killer cell, cytolytic T cell, CD8+ T-cells or killer T cell
  • NK cells and NKT cells are also encompassed in the invention.
  • Some vectors may employ control sequences that allow it to be replicated and/or expressed in both prokaryotic and eukaryotic cells.
  • control sequences that allow it to be replicated and/or expressed in both prokaryotic and eukaryotic cells.
  • One of skill in the art would further understand the conditions under which to incubate all of the above described host cells to maintain them and to permit replication of a vector.
  • techniques and conditions that would allow large-scale production of vectors, as well as production of the nucleic acids encoded by vectors and their cognate polypeptides, proteins, or peptides.
  • the cells can be autologous cells, syngeneic cells, allogenic cells and even in some cases, xenogeneic cells.
  • the invention further includes CARTS that are modified to secrete one or more polypeptides.
  • the polypeptide can be for example an antibody or cytokine.
  • the antibody is specific for CAIX, GITR, PD-Ll, PD-L2.
  • Armed CART can be constructed by including a nucleic acid encoding the polypeptide of interest after the intracellular signaling domain.
  • a nucleic acid encoding the polypeptide of interest after the intracellular signaling domain.
  • IRES internal ribosome entry site
  • the methods and compositions presented herein provide a target-specific Anti-CAIX CAR T cell of second generation armed with the power to secrete anti-PD-Ll IgGs in the RCC milieu to combat T cell exhaustion.
  • the human Anti- CAIX CAR containing the CD28 co-stimulatory domain was chosen based in its killing activity and low immunogenicity in human cRCC xenografts in mice.
  • the Anti-CAIX CART cells-secreting Anti-PD-Ll IgGl or IgG4 was extensively compared with an unrelated Anti-BCMA CAR or with an Anti-CAIX CAR, both secreting an irrelevant Anti- S ARS IgGl .
  • Anti-CAIX CART cells have capacity to undergo clonal expansion when in contact with CAIX+ RCC cells, and were also activated, releasing high levels of IFND and IL-2, which could improve tumor suppression. These Anti-CAIX CART cells are also able to secrete high levels of Anti-PD-Ll IgGl or IgG4 and these antibodies can interact specifically with PD-Ll, inducing downregulation of the exhaustion markers PD-1, Tim-3 and Lag-3 in vitro and in vivo.
  • Anti-PD-Ll antibodies secreted in the tumor microenvironment are able to revert T cell exhaustion, facilitating the Anti-CAIX CART cells antitumor activity.
  • These Anti-CAIX CART cells mainly the ones secreting anti-PD-Ll, are also able to diminish the proliferation of CAIX+ RCC cells, resulting in a slow tumor growth and small tumor size and weight in an orthotopic NSG mice model of RCC.
  • Anti-CAIX CART cell secreting the IgGl isotype of Anti- PD-Ll was also able to induce ADCC in vitro and increased the number of human NK cells infiltrating the tumor site in vivo.
  • the human NK cells were injected only in 2 mice of each group, two days before their euthanasia to determine the NK cells capacity to recognize the IgGl isotype of the Anti-PD-Ll in vivo, which was attested.
  • the injection of human NK cells was not made in the beginning of the treatment once our previous experience with this mice model showed that these cells last only for a few days in their blood
  • the injection of CART cells into mice was performed without the addition of interleukins to avoid their influence in the therapeutic effect of CART cells alone.
  • CART cells can be maintained with the use of cytokines such as, for example, IL-2, IL-4, IL-7, IL-9, IL-15 and IL-21.
  • cytokines such as, for example, IL-2, IL-4, IL-7, IL-9, IL-15 and IL-21.
  • Cytokines sharing the yc receptor like IL-2, IL-4, IL-7, IL-9, IL-15 and IL-21 are important for the development and maintenance of memory T cells.
  • IL-21 promote a less differentiated phenotype, associated with an enrichment of tumor-specific CD8 T cells, with increased anti-tumor effect in a mouse melanoma model when compared to IL-2 or IL-15.
  • CART cells are maintained with IL-21.
  • CAIX is a consistent marker for development of cancer targeted systemic therapies due to it overexpression in many tumors, remarkably in cRCC, but it is also expressed physiologically in a few tissues.
  • the anti-CAIX scFv in the CAR recognizes the catalytic domain of CAIX, located in the central portion of the protein, which could increase its specificity to sites of higher expression of CAIX.
  • CD28 is replaced by 41BB in the CAR constructs.
  • T cell exhaustion is common in cancer and these T cells present low capacities of proliferation and cytokine production associated with high apoptosis rate and expression of inhibitory receptors like PD-1, Tim-3 and Lag3.
  • New strategies for preventing T cell exhaustion include of PD-1/PD-L1 axis.
  • Expression vectors that encode the CARs can be introduced as one or more DNA molecules or constructs, where there may be at least one marker that will allow for selection of host cells that contain the construct(s).
  • the constructs can be prepared in conventional ways, where the genes and regulatory regions may be isolated, as appropriate, ligated, cloned in an appropriate cloning host, analyzed by restriction or sequencing, or other convenient means. Particularly, using PCR, individual fragments including all or portions of a functional unit may be isolated, where one or more mutations may be introduced using "primer repair", ligation, in vitro mutagenesis, etc., as appropriate. The construct(s) once completed and demonstrated to have the appropriate sequences may then be introduced into the CTL by any convenient means.
  • the constructs may be integrated and packaged into non-replicating, defective viral genomes like Adenovirus, Adeno-associated virus (AAV), or Herpes simplex virus (HSV) or others, including retroviral vectors or lentiviral vectors, for infection or transduction into cells.
  • the constructs may include viral sequences for transfection, if desired.
  • the construct may be introduced by fusion, electroporation, biolistics, transfection, lipofection, or the like.
  • the host cells may be grown and expanded in culture before introduction of the construct(s), followed by the appropriate treatment for introduction of the construct(s) and integration of the construct(s). The cells are then expanded and screened by virtue of a marker present in the construct.
  • markers that may be used successfully include hprt, neomycin resistance, thymidine kinase, hygromycin resistance, etc.
  • homologous recombination one may use either .OMEGA, or O-vectors. See, for example, Thomas and Capecchi, Cell (1987) 51, 503-512; Mansour, et al, Nature (1988) 336, 348-352; and Joyner, et al, Nature (1989) 338, 153-156.
  • the constructs may be introduced as a single DNA molecule encoding at least the CAR and optionally another gene, or different DNA molecules having one or more genes.
  • Other genes include genes that encode therapeutic molecules or suicide genes, for example.
  • the constructs may be introduced simultaneously or consecutively, each with the same or different markers.
  • Vectors containing useful elements such as bacterial or yeast origins of replication, selectable and/or amplifiable markers, promoter/enhancer elements for expression in prokaryotes or eukaryotes, etc. that may be used to prepare stocks of construct DNAs and for carrying out transfections are well known in the art, and many are commercially available.
  • the cells according to the invention can be used for treating cancer, viral infections or autoimmune disorders in a patient in need thereof.
  • said isolated cell according to the invention can be used in the manufacture of a medicament for treatment of a cancer, viral infections of autoimmune disorders, in a patient in need thereof.
  • the present invention relies on methods for treating patients in need thereof, said method comprising at least one of the following steps: (a) providing a chimeric antigen receptor cells according to the invention and (b) administrating the cells to said patient.
  • Said treatment can be ameliorating, curative or prophylactic. It may be either part of an autologous immunotherapy or part of an allogenic immunotherapy treatment.
  • autologous it is meant that cells, cell line or population of cells used for treating patients are originating from said patient or from a Human Leucocyte Antigen (HLA) compatible donor.
  • HLA Human Leucocyte Antigen
  • allogeneic is meant that the cells or population of cells used for treating patients are not originating from said patient but from a donor.
  • the invention is particularly suited for allogenic immunotherapy, insofar as it enables the transformation of T-cells, typically obtained from donors, into non-alloreactive cells. This may be done under standard protocols and reproduced as many times as needed.
  • the resulted modified T cells may be pooled and administrated to one or several patients, being made available as an "off the shelf therapeutic product.
  • Cancers that can be used with the disclosed methods are described in the previous section. Said treatment can be used to treat patients diagnosed with cancer, viral infection, autoimmune disorders or Graft versus Host Disease (GvHD). Cancers that may be treated include tumors that are not vascularized, or not yet substantially vascularized, as well as vascularized tumors.
  • the cancers may comprise nonsolid tumors (such as hematological tumors, for example, leukemias and lymphomas) or may comprise solid tumors.
  • Types of cancers to be treated with the CARs of the invention include, but are not limited to, carcinoma, blastoma, and sarcoma, and certain leukemia or lymphoid malignancies, benign and malignant tumors, and malignancies e.g., sarcomas, carcinomas, and melanomas.
  • carcinoma a malignant neoplasm originating from a malignant neoplasm originating from tumors.
  • sarcomas e.g., sarcomas, carcinomas, and melanomas.
  • adult tumors/cancers and pediatric tumors/cancers are also included.
  • It can be a treatment in combination with one or more therapies against cancer selected from the group of antibodies therapy, chemotherapy, cytokines therapy, dendritic cell therapy, gene therapy, hormone therapy, laser light therapy and radiation therapy.
  • said treatment can be administrated into patients undergoing an immunosuppressive treatment.
  • the present invention preferably relies on cells or population of cells, which have been made resistant to at least one immunosuppressive agent due to the inactivation of a gene encoding a receptor for such immunosuppressive agent.
  • the immunosuppressive treatment should help the selection and expansion of the T-cells according to the invention within the patient.
  • the cell compositions of the present invention are administered to a patient in conjunction with (e.g., before, simultaneously or following) bone marrow transplantation, T cell ablative therapy using either chemotherapy agents such as, fludarabine, external-beam radiation therapy (XRT), cyclophosphamide, or antibodies such as OKT3 or CAM PATH.
  • chemotherapy agents such as, fludarabine, external-beam radiation therapy (XRT), cyclophosphamide, or antibodies such as OKT3 or CAM PATH.
  • the cell compositions of the present invention are administered following B-cell ablative therapy such as agents that react with CD20, e.g., Rituxan.
  • subjects may undergo standard treatment with high dose chemotherapy followed by peripheral blood stem cell
  • modified cells are administered before or following surgery.
  • Said modified cells obtained by any one of the methods described here can be used in a particular aspect of the invention for treating patients in need thereof against Host versus Graft (HvG) rejection and Graft versus Host Disease (GvHD); therefore in the scope of the present invention is a method of treating patients in need thereof against Host versus Graft (HvG) rejection and Graft versus Host Disease (GvHD) comprising treating said patient by administering to said patient an effective amount of modified cells comprising inactivated TCR alpha and/or TCR beta genes.
  • the invention is particularly suited for allogenic immunotherapy, insofar as it enables the transformation of T-cells, typically obtained from donors, into non-alloreactive cells. This may be done under standard protocols and reproduced as many times as needed.
  • the resulted modified T cells may be pooled and administrated to one or several patients, being made available as an "off the shelf therapeutic product.
  • the cells may be introduced into a host organism, e.g. a mammal, in a wide variety of ways.
  • the cells may be introduced at the site of the tumor, in specific embodiments, although in alternative embodiments the cells hone to the cancer or are modified to hone to the cancer.
  • the number of cells that are employed will depend upon a number of circumstances, the purpose for the introduction, the lifetime of the cells, the protocol to be used, for example, the number of administrations, the ability of the cells to multiply, the stability of the recombinant construct, and the like.
  • the cells may be applied as a dispersion, generally being injected at or near the site of interest.
  • the cells may be in a physiologically-acceptable medium.
  • the cells are encapsulated to inhibit immune recognition and placed at the site of the tumor.
  • the cells may be administered as desired. Depending upon the response desired, the manner of administration, the life of the cells, the number of cells present, various protocols may be employed. The number of administrations will depend upon the factors described above at least in part.
  • compositions described herein may be administered to a patient subcutaneously, intradermaly, intratumorally, intranodally, intramedullary, intramuscularly, by intravenous or
  • the cell compositions of the present invention are preferably administered by intravenous injection.
  • the administration of the cells or population of cells can consist of the administration of 10 4 -10 9 cells per kg body weight, preferably 10 5 to 10 6 cells/kg body weight including all integer values of cell numbers within those ranges.
  • the cells or population of cells can be administrated in one or more doses.
  • said effective amount of cells are administrated as a single dose.
  • said effective amount of cells are administrated as more than one dose over a period time.
  • Timing of administration is within the judgment of managing physician and depends on the clinical condition of the patient.
  • the cells or population of cells may be obtained from any source, such as a blood bank or a donor. While individual needs vary, determination of optimal ranges of effective amounts of a given cell type for a particular disease or conditions within the skill of the art.
  • An effective amount means an amount which provides a therapeutic or prophylactic benefit.
  • the dosage administrated will be dependent upon the age, health and weight of the recipient, kind of concurrent treatment, if any, frequency of treatment and the nature of the effect desired.
  • the CARs of the present invention may be expressed from an expression vector. Recombinant techniques to generate such expression vectors are well known in the art.
  • vector is used to refer to a carrier nucleic acid molecule into which a nucleic acid sequence can be inserted for introduction into a cell where it can be replicated.
  • a nucleic acid sequence can be "exogenous,” which means that it is foreign to the cell into which the vector is being introduced or that the sequence is homologous to a sequence in the cell but in a position within the host cell nucleic acid in which the sequence is ordinarily not found.
  • Vectors include plasmids, cosmids, viruses (bacteriophage, animal viruses, and plant viruses), and artificial chromosomes (e.g., YACs).
  • expression vector refers to any type of genetic construct comprising a nucleic acid coding for a RNA capable of being transcribed. In some cases, RNA molecules are then translated into a protein, polypeptide, or peptide. In other cases, these sequences are not translated, for example, in the production of antisense molecules or ribozymes.
  • Expression vectors can contain a variety of "control sequences,” which refer to nucleic acid sequences necessary for the transcription and possibly translation of an operably linked coding sequence in a particular host cell.
  • control sequences refer to nucleic acid sequences necessary for the transcription and possibly translation of an operably linked coding sequence in a particular host cell.
  • vectors and expression vectors may contain nucleic acid sequences that serve other functions as well and are described infra.
  • a “promoter” is a control sequence that is a region of a nucleic acid sequence at which initiation and rate of transcription are controlled. It may contain genetic elements at which regulatory proteins and molecules may bind, such as RNA polymerase and other transcription factors, to initiate the specific transcription a nucleic acid sequence.
  • the phrases "operatively positioned,” “operatively linked,” “under control,” and “under transcriptional control” mean that a promoter is in a correct functional location and/or orientation in relation to a nucleic acid sequence to control transcriptional initiation and/or expression of that sequence.
  • a promoter generally comprises a sequence that functions to position the start site for RNA synthesis.
  • the best known example of this is the TATA box, but in some promoters lacking a TATA box, such as, for example, the promoter for the mammalian terminal deoxynucleotidyl transferase gene and the promoter for the SV40 late genes, a discrete element overlying the start site itself helps to fix the place of initiation. Additional promoter elements regulate the frequency of transcriptional initiation. Typically, these are located in the region 30 110 bp upstream of the start site, although a number of promoters have been shown to contain functional elements downstream of the start site as well.
  • a coding sequence "under the control of a promoter, one positions the 5' end of the transcription initiation site of the transcriptional reading frame "downstream" of (i.e., 3' of) the chosen promoter.
  • the "upstream” promoter stimulates transcription of the DNA and promotes expression of the encoded RNA.
  • the spacing between promoter elements frequently is flexible, so that promoter function is preserved when elements are inverted or moved relative to one another.
  • the spacing between promoter elements can be increased to 50 bp apart before activity begins to decline.
  • individual elements can function either cooperatively or independently to activate transcription.
  • a promoter may or may not be used in conjunction with an "enhancer,” which refers to a cis-acting regulatory sequence involved in the transcriptional activation of a nucleic acid sequence.
  • a promoter may be one naturally associated with a nucleic acid sequence, as may be obtained by isolating the 5 prime' non-coding sequences located upstream of the coding segment and/or exon. Such a promoter can be referred to as "endogenous.”
  • an enhancer may be one naturally associated with a nucleic acid sequence, located either downstream or upstream of that sequence.
  • a recombinant or heterologous promoter refers to a promoter that is not normally associated with a nucleic acid sequence in its natural environment.
  • a recombinant or heterologous enhancer refers also to an enhancer not normally associated with a nucleic acid sequence in its natural environment.
  • promoters or enhancers may include promoters or enhancers of other genes, and promoters or enhancers isolated from any other virus, or prokaryotic or eukaryotic cell, and promoters or enhancers not "naturally occurring," i.e., containing different elements of different transcriptional regulatory regions, and/or mutations that alter expression.
  • promoters that are most commonly used in recombinant DNA construction include the lactamase (penicillinase), lactose and tryptophan (trp) promoter systems.
  • sequences may be produced using recombinant cloning and/or nucleic acid amplification technology, including PCR.TM., in connection with the compositions disclosed herein (see U.S. Pat. Nos. 4,683,202 and 5,928,906, each incorporated herein by reference).
  • control sequences that direct transcription and/or expression of sequences within non-nuclear organelles such as mitochondria, chloroplasts, and the like, can be employed as well.
  • promoter and/or enhancer that effectively directs the expression of the DNA segment in the organelle, cell type, tissue, organ, or organism chosen for expression.
  • Those of skill in the art of molecular biology generally know the use of promoters, enhancers, and cell type combinations for protein expression, (see, for example Sambrook et al. 1989, incorporated herein by reference).
  • the promoters employed may be constitutive, tissue-specific, inducible, and/or useful under the appropriate conditions to direct high level expression of the introduced DNA segment, such as is advantageous in the large-scale production of recombinant proteins and/or peptides.
  • the promoter may be heterologous or endogenous.
  • any promoter/enhancer combination could also be used to drive expression.
  • Use of a T3, T7 or SP6 cytoplasmic expression system is another possible embodiment.
  • Eukaryotic cells can support cytoplasmic transcription from certain bacterial promoters if the appropriate bacterial polymerase is provided, either as part of the delivery complex or as an additional genetic expression construct.
  • tissue-specific promoters or elements as well as assays to characterize their activity, is well known to those of skill in the art.
  • a specific initiation signal also may be required for efficient translation of coding sequences. These signals include the ATG initiation codon or adjacent sequences. Exogenous translational control signals, including the ATG initiation codon, may need to be provided.
  • ATG initiation codon may need to be provided.
  • IVS internal ribosome entry sites
  • Vectors can include a multiple cloning site (MCS), which is a nucleic acid region that contains multiple restriction enzyme sites, any of which can be used in conjunction with standard recombinant technology to digest the vector.
  • MCS multiple cloning site
  • Restriction enzyme digestion refers to catalytic cleavage of a nucleic acid molecule with an enzyme that functions only at specific locations in a nucleic acid molecule. Many of these restriction enzymes are commercially available. Use of such enzymes is widely understood by those of skill in the art.
  • a vector is linearized or fragmented using a restriction enzyme that cuts within the MCS to enable exogenous sequences to be ligated to the vector.
  • “Ligation” refers to the process of forming phosphodi ester bonds between two nucleic acid fragments, which may or may not be contiguous with each other. Techniques involving restriction enzymes and ligation reactions are well known to those of skill in the art of recombinant technology. [000166] Splicing sites, termination signals, origins of replication, and selectable markers may also be employed.
  • a plasmid vector is contemplated for use to transform a host cell.
  • plasmid vectors containing replicon and control sequences which are derived from species compatible with the host cell are used in connection with these hosts.
  • the vector ordinarily carries a replication site, as well as marking sequences which are capable of providing phenotypic selection in transformed cells.
  • E. coli is often transformed using derivatives of pBR322, a plasmid derived from an E. coli species.
  • pBR322 contains genes for ampicillin and tetracycline resistance and thus provides easy means for identifying transformed cells.
  • the pBR plasmid, or other microbial plasmid or phage must also contain, or be modified to contain, for example, promoters which can be used by the microbial organism for expression of its own proteins.
  • phage vectors containing replicon and control sequences that are compatible with the host microorganism can be used as transforming vectors in connection with these hosts.
  • the phage lambda GEM.TM. 11 may be utilized in making a recombinant phage vector which can be used to transform host cells, such as, for example, E. coli LE392.
  • Further useful plasmid vectors include pIN vectors (Inouye et al, 1985); and pGEX vectors, for use in generating glutathione S transferase (GST) soluble fusion proteins for later purification and separation or cleavage.
  • GST glutathione S transferase
  • Other suitable fusion proteins are those with galactosidase, ubiquitin, and the like.
  • Bacterial host cells for example, E. coli, comprising the expression vector, are grown in any of a number of suitable media, for example, LB.
  • suitable media for example, LB.
  • the expression of the recombinant protein in certain vectors may be induced, as would be understood by those of skill in the art, by contacting a host cell with an agent specific for certain promoters, e.g., by adding IPTG to the media or by switching incubation to a higher temperature. After culturing the bacteria for a further period, generally of between 2 and 24 h, the cells are collected by centrifugation and washed to remove residual media.
  • Components of the present invention may be a viral vector that encodes one or more CARs of the invention.
  • Non-limiting examples of virus vectors that may be used to deliver a nucleic acid of the present invention are described below.
  • a particular method for delivery of the nucleic acid involves the use of an adenovirus expression vector.
  • adenovirus vectors are known to have a low capacity for integration into genomic DNA, this feature is counterbalanced by the high efficiency of gene transfer afforded by these vectors.
  • "Adenovirus expression vector” is meant to include those constructs containing adenovirus sequences sufficient to (a) support packaging of the construct and (b) to ultimately express a tissue or cell specific construct that has been cloned therein.
  • Knowledge of the genetic organization or adenovirus, a 36 kb, linear, double stranded DNA virus allows substitution of large pieces of adenoviral DNA with foreign sequences up to 7 kb (Grunhaus and Horwitz, 1992).
  • the nucleic acid may be introduced into the cell using adenovirus assisted transfection. Increased transfection efficiencies have been reported in cell systems using adenovirus coupled systems (Kelleher and Vos, 1994; Cotten et al, 1992; Curiel, 1994).
  • Adeno associated virus (AAV) is an attractive vector system for use in the cells of the present invention as it has a high frequency of integration and it can infect nondividing cells, thus making it useful for delivery of genes into mammalian cells, for example, in tissue culture (Muzyczka, 1992) or in vivo.
  • AAV has a broad host range for infectivity (Tratschin et al, 1984; Laughlin et al, 1986; Lebkowski et al, 1988; McLaughlin et al., 1988). Details concerning the generation and use of rAAV vectors are described in U.S. Pat. Nos. 5,139,941 and 4,797,368, each incorporated herein by reference.
  • Retroviruses are useful as delivery vectors because of their ability to integrate their genes into the host genome, transferring a large amount of foreign genetic material, infecting a broad spectrum of species and cell types and of being packaged in special cell lines (Miller, 1992).
  • a nucleic acid e.g., one encoding the desired sequence
  • a packaging cell line containing the gag, pol, and env genes but without the LTR and packaging components is constructed (Mann et al, 1983).
  • Retroviral vectors are able to infect a broad variety of cell types. However, integration and stable expression require the division of host cells (Paskind et al, 1975).
  • Lentiviruses are complex retroviruses, which, in addition to the common retroviral genes gag, pol, and env, contain other genes with regulatory or structural function. Lentiviral vectors are well known in the art (see, for example, Naldini et al, 1996; Zufferey et al, 1997; Blomer et al, 1997; U.S. Pat. Nos. 6,013,516 and 5,994,136). Some examples of lentivirus include the Human Immunodeficiency Viruses: HIV-1, HIV-2 and the Simian Immunodeficiency Virus: SIV. Lentiviral vectors have been generated by multiply attenuating the HIV virulence genes, for example, the genes env, vif, vpr, vpu and nef are deleted making the vector biologically safe.
  • Recombinant lentiviral vectors are capable of infecting non-dividing cells and can be used for both in vivo and ex vivo gene transfer and expression of nucleic acid sequences.
  • recombinant lentivirus capable of infecting a non-dividing cell wherein a suitable host cell is transfected with two or more vectors carrying the packaging functions, namely gag, pol and env, as well as rev and tat is described in U.S. Pat. No. 5,994,136, incorporated herein by reference.
  • One may target the recombinant virus by linkage of the envelope protein with an antibody or a particular ligand for targeting to a receptor of a particular cell-type.
  • a sequence (including a regulatory region) of interest into the viral vector, along with another gene which encodes the ligand for a receptor on a specific target cell, for example, the vector is now target-specific.
  • viral vectors may be employed as vaccine constructs in the present invention.
  • Vectors derived from viruses such as vaccinia virus (Ridgeway, 1988; Baichwal and Sugden, 1986; Coupar et al, 1988), Sindbis virus, cytomegalovirus and herpes simplex virus may be employed. They offer several attractive features for various mammalian cells (Friedmann, 1989; Ridgeway, 1988; Baichwal and Sugden, 1986; Coupar et al., 1988; Horwich et al, 1990).
  • a nucleic acid to be delivered may be housed within an infective virus that has been engineered to express a specific binding ligand.
  • the virus particle will thus bind specifically to the cognate receptors of the target cell and deliver the contents to the cell.
  • a novel approach designed to allow specific targeting of retrovirus vectors was developed based on the chemical modification of a retrovirus by the chemical addition of lactose residues to the viral envelope. This modification can permit the specific infection of hepatocytes via sialoglycoprotein receptors.
  • Suitable methods for nucleic acid delivery for transfection or transformation of cells are known to one of ordinary skill in the art. Such methods include, but are not limited to, direct delivery of DNA such as by ex vivo transfection, by injection, and so forth.
  • cells may be stably or transiently transformed.
  • Kits of the Invention Any of the compositions described herein may be comprised in a kit.
  • one or more cells for use in cell therapy and/or the reagents to generate one or more cells for use in cell therapy that harbors recombinant expression vectors may be comprised in a kit.
  • the kit components are provided in suitable container means.
  • kits may be packaged either in aqueous media or in lyophilized form.
  • the container means of the kits will generally include at least one vial, test tube, flask, bottle, syringe or other container means, into which a component may be placed, and preferably, suitably aliquoted. Where there are more than one component in the kit, the kit also will generally contain a second, third or other additional container into which the additional components may be separately placed. However, various combinations of components may be comprised in a vial.
  • the kits of the present invention also will typically include a means for containing the components in close confinement for commercial sale. Such containers may include injection or blow molded plastic containers into which the desired vials are retained.
  • the liquid solution is an aqueous solution, with a sterile aqueous solution being particularly ueful.
  • the container means may itself be a syringe, pipette, and/or other such like apparatus, from which the formulation may be applied to an infected area of the body, injected into an animal, and/or even applied to and/or mixed with the other components of the kit.
  • kits may be provided as dried powder(s).
  • the powder can be reconstituted by the addition of a suitable solvent.
  • the solvent may also be provided in another container means.
  • kits may also comprise a second container means for containing a sterile, pharmaceutically acceptable buffer and/or other diluent.
  • kits that are to be used for cell therapy are provided in a kit, and in some cases the cells are essentially the sole component of the kit.
  • the kit may comprise reagents and materials to make the desired cell.
  • the reagents and materials include primers for amplifying desired sequences, nucleotides, suitable buffers or buffer reagents, salt, and so forth, and in some cases the reagents include vectors and/or DNA that encodes a CAR as described herein and/or regulatory elements therefor.
  • the apparatus may be a syringe, scalpel, and so forth.
  • the kit in addition to cell therapy embodiments, also includes a second cancer therapy, such as chemotherapy, hormone therapy, and/or immunotherapy, for example.
  • a second cancer therapy such as chemotherapy, hormone therapy, and/or immunotherapy, for example.
  • the kit(s) may be tailored to a particular cancer for an individual and comprise respective second cancer therapies for the individual.
  • an "anti-cancer” agent is capable of negatively affecting cancer in a subject, for example, by killing cancer cells, inducing apoptosis in cancer cells, reducing the growth rate of cancer cells, reducing the incidence or number of metastases, reducing tumor size, inhibiting tumor growth, reducing the blood supply to a tumor or cancer cells, promoting an immune response against cancer cells or a tumor, preventing or inhibiting the progression of cancer, or increasing the lifespan of a subject with cancer. More generally, these other compositions would be provided in a combined amount effective to kill or inhibit proliferation of the cell.
  • This process may involve contacting the cancer cells with the expression construct and the agent(s) or multiple factor(s) at the same time. This may be achieved by contacting the cell with a single composition or pharmacological formulation that includes both agents, or by contacting the cell with two distinct compositions or formulations, at the same time, wherein one composition includes the expression construct and the other includes the second agent(s).
  • Tumor cell resistance to chemotherapy and radiotherapy agents represents a major problem in clinical oncology.
  • One goal of current cancer research is to find ways to improve the efficacy of chemo- and radiotherapy by combining it with other therapies.
  • cell therapy could be used similarly in conjunction with chemotherapeutic, radiotherapeutic, or immunotherapeutic intervention, as well as pro-apoptotic or cell cycle regulating agents.
  • the present inventive therapy may precede or follow the other agent treatment by intervals ranging from minutes to weeks.
  • the other agent and present invention are applied separately to the individual, one would generally ensure that a significant period of time did not expire between the time of each delivery, such that the agent and inventive therapy would still be able to exert an advantageously combined effect on the cell.
  • Cancer therapies also include a variety of combination therapies with both chemical and radiation based treatments.
  • Combination chemotherapies include, for example, abraxane, altretamine, docetaxel, herceptin, methotrexate, novantrone, zoladex, cisplatin (CDDP), carboplatin, procarbazine, mechlorethamine, cyclophosphamide, camptothecin, ifosfamide, melphalan, chlorambucil, busulfan, nitrosurea, dactinomycin, daunorubicin, doxorubicin, bleomycin, plicomycin, mitomycin, etoposide (VP 16), tamoxifen, raloxifene, estrogen receptor binding agents, taxol, gemcitabien, navelbine, farnesyl-protein tansferase inhibitors, transplatinum, 5-fluorouracil, vincristin, vinblastin and methot
  • chemotherapy for the individual is employed in conjunction with the invention, for example before, during and/or after administration of the invention
  • DNA damaging factors include what are commonly known as .gamma. -rays, X-rays, and/or the directed delivery of radioisotopes to tumor cells.
  • Other forms of DNA damaging factors are also contemplated such as microwaves and UV -irradiation. It is most likely that all of these factors effect a broad range of damage on DNA, on the precursors of DNA, on the replication and repair of DNA, and on the assembly and maintenance of chromosomes.
  • Dosage ranges for X-rays range from daily doses of 50 to 200 roentgens for prolonged periods of time (3 to 4 wk), to single doses of 2000 to 6000 roentgens.
  • Dosage ranges for radioisotopes vary widely, and depend on the half-life of the isotope, the strength and type of radiation emitted, and the uptake by the neoplastic cells.
  • contacted and “exposed,” when applied to a cell are used herein to describe the process by which a therapeutic construct and a chemotherapeutic or radiotherapeutic agent are delivered to a target cell or are placed in direct juxtaposition with the target cell.
  • both agents are delivered to a cell in a combined amount effective to kill the cell or prevent it from dividing.
  • Immunotherapeutics generally rely on the use of immune effector cells and molecules to target and destroy cancer cells.
  • the immune effector may be, for example, an antibody specific for some marker on the surface of a tumor cell.
  • the antibody alone may serve as an effector of therapy or it may recruit other cells to actually effect cell killing.
  • the antibody also may be conjugated to a drug or toxin (chemotherapeutic, radionuclide, ricin A chain, cholera toxin, pertussis toxin, etc.) and serve merely as a targeting agent.
  • the effector may be a lymphocyte carrying a surface molecule that interacts, either directly or indirectly, with a tumor cell target.
  • Various effector cells include cytotoxic T cells and NK cells.
  • Immunotherapy other than the inventive therapy described herein could thus be used as part of a combined therapy, in conjunction with the present cell therapy.
  • the general approach for combined therapy is discussed below.
  • the tumor cell must bear some marker that is amenable to targeting, i.e., is not present on the majority of other cells. Many tumor markers exist and any of these may be suitable for targeting in the context of the present invention.
  • Common tumor markers include PD-1, PD-L1, CTLA4, carcinoembryonic antigen, prostate specific antigen, urinary tumor associated antigen, fetal antigen, tyrosinase (p97), gp68, TAG-72, HMFG, Sialyl Lewis Antigen, MucA, MucB, PLAP, estrogen receptor, laminin receptor, erb B and pl55.
  • the secondary treatment is a gene therapy in which a therapeutic polynucleotide is administered before, after, or at the same time as the present invention clinical embodiments.
  • a variety of expression products are encompassed within the invention, including inducers of cellular proliferation, inhibitors of cellular proliferation, or regulators of programmed cell death.
  • Curative surgery is a cancer treatment that may be used in conjunction with other therapies, such as the treatment of the present invention, chemotherapy, radiotherapy, hormonal therapy, gene therapy, immunotherapy and/or alternative therapies.
  • Curative surgery includes resection in which all or part of cancerous tissue is physically removed, excised, and/or destroyed.
  • Tumor resection refers to physical removal of at least part of a tumor.
  • treatment by surgery includes laser surgery, cryosurgery, electrosurgery, and miscopically controlled surgery (Mohs' surgery). It is further contemplated that the present invention may be used in conjunction with removal of superficial cancers, precancers, or incidental amounts of normal tissue.
  • a cavity may be formed in the body.
  • Treatment may be accomplished by perfusion, direct injection or local application of the area with an additional anti-cancer therapy.
  • Such treatment may be repeated, for example, every 1, 2, 3, 4, 5, 6, or 7 days, or every 1, 2, 3, 4, and 5 weeks or every 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 months.
  • These treatments may be of varying dosages as well.
  • agents may be used in combination with the present invention to improve the therapeutic efficacy of treatment.
  • additional agents include immunomodulatory agents, agents that affect the upregulation of cell surface receptors and GAP junctions, cytostatic and differentiation agents, inhibitors of cell adhesion, or agents that increase the sensitivity of the hyperproliferative cells to apoptotic inducers.
  • Immunomodulatory agents include tumor necrosis factor; interferon alpha, beta, and gamma; IL-2 and other cytokines; F42K and other cytokine analogs; or MIP-1, MlP-lbeta, MCP-1, RANTES, and other chemokines. It is further contemplated that the upregulation of cell surface receptors or their ligands such as Fas/Fas ligand, DR4 or DR5/TRAIL would potentiate the apoptotic inducing abililties of the present invention by establishment of an autocrine or paracrine effect on hyperproliferative cells.
  • cytostatic or differentiation agents can be used in combination with the present invention to improve the anti-hyerproliferative efficacy of the treatments.
  • Inhibitors of cell adhesion are
  • cell adhesion inhibitors are focal adhesion kinase (FAKs) inhibitors and Lovastatin. It is further contemplated that other agents that increase the sensitivity of a hyperproliferative cell to apoptosis, such as the antibody c225, could be used in combination with the present invention to improve the treatment efficacy.
  • FAKs focal adhesion kinase
  • Lovastatin Lovastatin
  • Human C AIX+ renal cell carcinoma cell lines sk-rc-52, sk-rc-09 and CAIX- sk-rc-59 were obtained from Dr. Gerd Ritter, Memorial Sloan-Kettering Cancer Center, New York. They were cultured at 37°C with 5% CO 2 in R- 10 complete medium containing RPMI 1640 medium (Life Technologies) supplemented with 10% FCS, 2 mmol/L L-glutamine, 100 U/ml penicillin, and 100 ⁇ g/ml streptomycin (Sigma).
  • Primary human T cells were maintained in R-10 with 10% human serum and 100 IU/ml recombinant human interleukin 2 (IL-2) (Chiron).
  • IL-2 human interleukin 2
  • Human embryonic kidney cell line 293T (ATCC) and mouse fibroblast NIH3T3 cells (ATCC) were grown in D-10 complete medium (Life Technologies) containing DMEM medium with 10% FCS, 100 U/ml penicillin, and 100 ⁇ g/ml streptomycin (Sigma).
  • Leukopacks obtained from the blood bank of the Children's Hospital Boston were collected from healthy volunteers with written informed consent.
  • Human ccRCC cell lines were obtained from Dr. Gerd Ritter (Memorial Sloan-Kettering Cancer Center, New York). These cells were cultivated in RPMI 1640 Medium (Life Technologies) supplemented with 10 % (v/v) heat-inactivated fetal bovine serum (FBS, Gibco), 100 IU/ml penicillin and 100 ug/ml streptomycin. 293T (CRL-11268, ATCC) and Lenti-X 293T (Clontech) cells were grown in DMEM Medium (Life Technologies).
  • the Skrc52 cells were selected for CAIX-/PD-L1- and CAIX+/PD-L1- cell populations by Fluorescence activated cell sorting (FACS) sorting. Skrc59 cells were engineered to express high levels of human CAIX and CAIX+/PD-L1+ were selected by FACS sorting.
  • the anti-PD-Ll antibody (Ab) used to construct the CART cells was previously selected using a 27-billion-member human scFv phage display library against a full length PD-L1 in the form of paramagnetic proteoliposomes (manuscript in preparation).
  • the DNA sequences that encoded the anti-PD-Ll scFv (Clone 42)-Fc IgGl or IgG4 were codon optimized and synthesized (Genewiz) containing the restriction sites for 5' Ndel and 3' Clal to allow further scFv-Fc cloning to replace ZsGreen in the lentiviral vector pHAGE-elFa signal-scFvG36 (anti-CAIX)-C9TAG-linker-CD28-CD3C-IRES-ZsGreen (e.g. CD28z).
  • This anti-CAIX original vector was previously constructed and published (21).
  • the DNA sequence that coded for the anti-SARS scFv was amplified by PCR from the plasmid pHAGE CMV-Anti-SARS (11 A) scFv-Fc- CD28-gp41-IRES-ZsGreen to insert the restriction sites for 5' Mlul and 3' Xbal for further cloning using the MM forward primer 5' TCG ACG CGT GAG GTG CAG CTG GTG CAG T 3' and Xbal reverse primer 5' TCC TCTAGA CAG GAC GGT GAC CTT GGT CC 3'.
  • the final pHAGE-elFa-scFv G36 (anti-CAIX)-C9TAG-linker-CD28-CD3C-IRES-anti- SARS (11 A) IgGl was used as one of the negative controls.
  • Anti-CAIX CAR able to express anti-PD-Ll IgGl (anti-CAIX/anti-PD-Ll IgGl), anti- CAIX CAR able to express anti-PD-Ll IgG4 (anti-CAIX/ anti-PD-Ll IgG4), anti-CAIX CAR able to express an irrelevant anti-SARS Ab (anti-CAIX/anti-SARS IgGl) and anti- BCMA CAR able to express an irrelevant anti-SARS Ab (anti-BCMA/anti-SARS IgGl).
  • CAIX-specific scFv antibodies were isolated from a non-immune human scFv phage library as previously reported and submitted to GenBank with accession numbers of GQ903548-GQ903561 23 .
  • scFv-coding DNA fragments from the pFarber phagemid were digested with SflllNotl sites and subcloned into the mammalian expression vector pcDNA3.1-F105L-hinge-stuffer which has a human IgGl F105 leader sequence and the human IgGl hinge-CH2-CH3 Fc portion to express scFv-Fc antibodies.
  • Plasmids of scFv-Fc were transiently transfected into 293T cells by lipofectamine 2000 (Invitrogen), and expressed antibodies were purified using Sepharose protein A beads (Amersham Bioscience).
  • CAIX Specific binding to CAIX was tested by staining with phage scFv antibodies or scFv converted into scFv-Fc format antibodies by incubation with CAIX-expressing 293T and sk-rc-52 cell lines, and with CAIX negative 293T and sk-rc-59 cell lines.
  • irrelevant anti-HIV CCR5 antibody (clone A8) 25 or anti-SARS antibody (11 A) 24 and fluorescently conjugated secondary antibodies alone were used as negative controls.
  • the amino acid sequence of human CD8a is 71 residues in length, consisting of 47 (aa 137 - 183), 23 (aa 184 - 206), and 2 (aa 207 - 208) residues of the CD8a extracellular and hinge, transmembrane, and cytoplasmic domains, respectively.
  • the CD28 sequence in P28z is 107 residues in length, consisting of 40 (aa 114 - 153), 23 (aa 154 - 176), and 44 (aa 177 - 220) residues of the CD28 extracellular, transmembrane, and cytoplasmic domains respectively.
  • the human CD3 ⁇ intracellular domain common to both CARs consists of 112 amino acids (aa 52-163).
  • the nucleic acid sequence encoding an internal C9-tag (a nine-amino acid peptide of human rhodopsin, TETSQVAPA) with a GGGGS linker was amplified by PCR and was fused upstream with CD8-TCR ⁇ and CD28-TCR ⁇ sequences with 5' Notl site and 3' Pad sites.
  • the primers used for cloning chimeric TCR ⁇ constructs are 5' TAG GGC GCG GCC GCa acc gag acc age cag gtg gcg ccc gec GGG GGA GGA GGC AGC CCC ACC ACG ACG CCA GCG CCG CGA 3' (forward primer for CD8 construct where italic is the Notl site, upper case is the C9 tag sequence, and underlining indicates the GGGGS linker), 5' TAG GGC GCG GCC GCa acc gag acc age cag gtg gcg cc gec GGC GGA GGA GGC AGC ATT GAA GTT ATG TAT CCT CCT CCT 3' (forward primer for CD28 construct) and reverse primer for both constructs CTA GCC ⁇ TAA , ⁇ GCG AGG AGG GGG CAG GGC CTG CAT, italic is Pac I site.
  • anti-CAIX scFv (clone G36) and anti-CCR5 scFv (clone A8, as irrelevant scFv control) antibody fragments were cloned to replace anti-CXCR4 scFv at SfillNotl sites to create CAIX-specific chimeric TCR constructs.
  • the lentivirus vector pHAGE-CMV-DsRed-IRES-ZsGreen, and four HIV helper plasmids pHDM-Hgpm2 (HIV gag-pol), pMD-tat, pRC/CMV-rev, and an Env VSV-G pseudotype were obtained from Dr. Richard Mulligan, of the Virus Production Core at The Harvard Gene Therapy Initiative in Boston.
  • the CMV promoter in pHAGE-CMV-IRES- ZsGreen was replaced by an EFla promoter derived from the pSIN lentivirus vector at SpellNotl sites.
  • Lentivirus was produced by five plasmid transient transfection into 293T cells using lipofectamine 2000 as per the manufacturer's instructions (Invitrogen). Cells were prepared for 80% confluence in 15 cm Petri dishes (Nalge Nunc) and transfected with 30 ⁇ g of total plasmid DNA. The ratio of vector plasmids (pHDM-Hgpm2 (HIV gag-pol): pMD-tat: pRC/CMV- rev: Env VSV-G pseudotype) was 20: 1 : 1 : 1 :2.
  • virus supernatant was harvested on day 3, filtrated through a 0.45 ⁇ filter, and concentrated by ultracentrifugation (Beckman Coulter, Fullerton, CA) for 90 minutes at 16,500 rpm (48,960 x g, Beckman SW28 rotor) and 4°C.
  • the virus pellets were resuspended in R-10 medium and kept frozen at -80°C.
  • Lentiviruses were produced by transient transfection of five plasmids into 293T cells using Polyethyleneimine (PEI). Briefly, each 80% confluent 293T cells in 15 cm plate (Nalge Nunc) was transfected with 30 ⁇ g of total five plasmids, being 5 ⁇ g of each structural plasmid pHDH-Hgpm2 (HIV gag-pol), pMD-tat; pRC/CMV-rev and Env VSV-G, and 10 ⁇ g of the main plasmid codifying the CAR (anti-CAIX/anti-PD-Ll IgGl, anti-CAIX/anti-PD-Ll IgG4, anti-CAIX/anti SARS IgGl or anti-BCMA/anti SARS IgGl). The virus supernatant was concentrated using Lenti-X Concentrator (Clontech), following the manufacturer instructions, and kept frozen at -80°C.
  • Human PBMCs were isolated by ficoll density gradient separation and were activated with 2 ⁇ g/ml PHA (Sigma) plus 100 IU/ml human IL-2 for 4 days.
  • the cells were infected with two or three rounds of lentivirus transduction at multiplicity of infection (MOI) of 10-20 in the presence of 10 ⁇ g/ml DEAE.
  • MOI multiplicity of infection
  • the Dynabeads for CD8 Positive Isolation were used to isolate CD8 positive cells from PBMCs, which were cultured in RPMI 1640 medium (Life Technologies) with 10% heat inactivated fetal bovine serum, 20mM HEPES, 100 IU/ml penicillin and 100 ⁇ g/ml streptomycin and 50 IU/mL of IL-21 (Peprotech) was added in the medium every 2 days.
  • the assays performed to determine if IL-2 or IL-21 were the best cytokine to induce anti-CAIX CART cells proliferation were performed with 50 IU/mL of each cytokine.
  • the CD8+ T cells were activated with Dynabeads Human T- Activator CD3/CD28 (Life Technologies) using a ratio of 1 : 1.
  • the cells were transduced with the Lentiviruses at a multiplicity of infection of 20 and 10 ⁇ g/mL of Diethylaminoethyl. All the assays were performed in triplicate and using T cells from three different healthy donors.
  • Flow cytometric analysis Transduction efficiency of human primary T cells was assessed by expression of a reporter gene (ZsGreen).
  • the CAIX-Fc protein was expressed from a pcDNA3.1 plasmid that encoded amino acids 38-397 of CAIX followed by human IgGl hinge, CH2 and CH3 domains, the CAIX signal peptide (aa 1-37) was replaced with Ig leader sequence.
  • Expression of scFv(G250) on transduced T cells was tested by staining the cells with 1 ⁇ g CAIX-Fc protein, and then APC-conjugated mouse anti-human IgG antibody (Jackson ImmunoResearch).
  • TETSQVAPA internal rhodopsin nonapeptide C9 tag of the scFv domain of TCR constructs on transduced T cells was detected by staining with 5 ⁇ g mouse 1D4 antibody followed by APC-conjugated goat anti-mouse IgG antibody (Jackson ImmunoResearch).
  • the subsets of human cells in culture during clonal expansion experiment were stained with fluorescence conjugated mouse anti-human antibodies (Invitrogen) against CD3 (clone S4.1), CD4 (clone S3.5) or CD8 (clone 3B5). In all cell staining, five hundred thousand cells were stained with antibodies at recommended concentration according to company's instruction. The matched isotype control antibodies for each sample were used and the cells were analyzed using a FACSCalibur cytometer (Becton-Dickinson).
  • transduction of 293T cells or CD8+T cells was confirmed by FACS analysis of the anti-CAIX or anti-BCMA expression.
  • the cells were stained with 10 ⁇ g/mL of human CAIX-Fc produced in our lab or human BCMA-mouse-Fc (AB Bioscience) and then developed with 1 :250 APC-conjugated mouse anti-human IgG Ab (Southern Biotech) or goat-anti mouse IgG Ab (Biolegend), respectively.
  • CountBrightTM Absolute Counting Beads was used for the proliferation and clonal expansion assays.
  • Lymphocytes collected from the in vivo assay were stained with FITC-conjugated anti-human PD-1, PE-conjugated anti-human Tim3, PerCP/Cy5.5-conjugated anti-human Lag3 antibodies (Biolegend) and Pacific Blue-conjugated anti-human CD45 and and analyzed by FACS.
  • TIL Lymphocytes
  • FITC-conjugated anti-human PD-1 PE-conjugated anti-human Tim3, PerCP/Cy5.5-conjugated anti-human Lag3 antibodies
  • Pacific Blue-conjugated anti-human CD45 Pacific Blue-conjugated anti-human
  • ADCC and cytotoxicity assay of lentivirus transduced T cells were performed using the DELFIA EuTDA Cytotoxicity kit (Perkin Elmer, Boston, MA) in accordance with the manufacturer's instructions. Briefly, target tumor cells were labeled with a fluorescent ligand (BATDA) for 30 minutes at 37 °C and 1 x 10 4 labeled cells were loaded per well in 96-well U-bottom plate.
  • BATDA fluorescent ligand
  • ADCC antibody-dependent cellular cytotoxicity
  • a panel of anti-CAIX scFv-Fc antibodies or irrevelant scFv-Fc antibody at a concentration of 1 ⁇ g/ml or 5 ⁇ g/ml was added separately.
  • the assay was set up with ratios of effector cells (human PBMC) to target cells (E:T) at 50: 1, 25: 1 and 12.5: 1.
  • T cell cytoxicity assay different ratios of effector cells (nontransduced or transduced T cells) to target cells (E:T) were prepared (100: 1, 50: 1 and 25: 1).
  • the culture was incubated for 4 hours in humidified 5% C0 2 at 37°C. After the plate was spun for 5 minutes at 500x g, 20 ⁇ of supernatant was transferred to a flat-bottom plate. 200 ⁇ of Europium solution was added and the fluorescence released from the cells was read by fiuorometer (VictorTM, PerkinElmer).
  • the control for spontaneous release was prepared by culturing the labeling cells only and the control for maximum release was made by adding lysis buffer (kit provided) to the labeling cells.
  • ELISA cytokine secretion
  • RCC cell lines sk-rc-52 (CAIX+) or sk-rc-59 (CAIX-) were seeded overnight at 1 x 10 6 per well in a 24-well plate, followed by 1 x 10 6 untransduced or transduced T cells.
  • T cells were washed with PBS twice to remove human IL-2. After overnight incubation, the supernatant was harvested and analyzed for IL-2 and IFN- ⁇ by ELISA (e-Bioscience).
  • IFN- ⁇ ELISPOT assay a membrane was developed using AEC substrate solution and the number of spots was counted by ELISPOT plate reader (C.T.L. Cellular Technology).
  • Immunodetection was performed using the ECL Plus Western blotting detection system (GE Healthcare, Piscataway, NJ) and x-ray film exposure.
  • Tumor cells were irradiated (3,000 rads) and seeded at 2.5 x 10 5 per well. T cells were added at 1 x 10 6 in culture medium containing R-10 plus 100 IU/ml human IL-2 for a week culture. T cells were split to maintain suitable density and re-stimulated with tumor cells weekly. The number of T cells was counted every 3 or 4 days for 2 weeks. The percentage expression of ZsGreen by transduced T cells and T cell subsets were determined weekly by fluorescence-activated cell sorting (FACS). For cytokine secretion studies after tumor cell contact, T cells that were in contact with irradiated tumor cells for one or two weeks were washed, incubated with fresh tumor cells overnight and culture supernatants were collected after 24 hrs for analysis.
  • FACS fluorescence-activated cell sorting
  • Skrc52 CAIX+/PD-L1- and Skrc52 CAIX-/PD-L1- cells were irradiated with 3,000 rads and seeded at 2.5xl0 5 per well.
  • lxlO 6 T cells were added at the culture medium containing 50 IU/ml human IL-21 every two days. T cells were split to maintain suitable density and re-stimulated with tumor cells weekly. T cell number was counted once a week for 3 weeks by FACS.
  • ADCC assay RCC cells were incubated for 1 hour, 37oC with 50 of the CART cells supernatant adjusted for 500 ng/mL of the respective Ab Anti-PD-Ll IgGl, Anti-PD-Ll IgG4 or Anti-SARS IgGl. The cells were then incubated with 12.5: 1, 25: 1 or 50: 1 NK cells for 4h, 37 oC, Lactate dehydrogenase (LDH) was measured in the supernatant by CytoTox 96® Non-Radioactive Cytotoxicity Assay (Promega).
  • LDH Lactate dehydrogenase
  • ELISA assays to detect IL-2 and IFN released by functional CART cells For analysis of cytokine secretion, 2.5x103 RCC cells Skrc59 CAIX+/PD-L1+ or Skrc52 CAIX-/PD-Ll-were seeded in 96 wells plates ON, followed by 5: 1, 25: 1 and 50: 1 CAR transduced T cells addition and incubation ON. The supernatant was removed and analyzed for IL-2 and IFNy secretion using the Human IFNy or Human IL-2 ELISA Ready-SET-Go Kit (eBioscience).
  • the tumor BLI was quantified after 7, 14, 23 and 30 days of CART cells injection. A second injection of 2.5xl0 6 CAR or untransduced T cells was made on day 17.
  • mice were sacrificed at 30 days post tumor engraftment by standard C02 inhalation, and tumors were harvested and weighted.
  • the kidney tumors from all mice were divided in two equal parts and one of them was fragmented in small pieces and digested with collagenase 0.5U/mL and DNAse 1.0 mg/mLto TIL extraction, which were analyzed for the expression of the exhaustion markers and the percentage of CART cells by FACS.
  • the other part was fixed in 10% buffered formaldehyde, and submitted to
  • mice of each group were injected with 4.5x106 NK cells 2 days before the euthanasia.
  • NK cells present in the tumor were stained with APC-Anti-CD56 Ab and analyzed by FACS. Animal experiments were performed in accordance with the guidelines of the DFCI Animal Care Committee.
  • Tumor establishment and T cell therapy due to immune- rejection of sk-rc-52 in 6-8 week-old female BALB/c nude mice and to accelerate in vivo growth properties, five million cells were subcutaneously inoculated into the mice, harvested, and expanded in vitro. The cell line was then passaged two more times in nude mice and the passaged cells were expanded for further experiments (subclone 4-1). For the therapeutic experiments, 5 million sk-rc-59 and 7.5 million passaged sk-rc-52 cells were subcutaneously inoculated on opposing flanks into nude mice to yield comparable tumor growth rates.
  • mice After 7 days, tumors grew to the size of ⁇ 6 mm, and 50 million nontransduced or transduced T cells were injected intravenously. The mice were also treated with 20,000 IU human IL-2 by peritoneal injection every two days. Tumor size was measured by caliper in two dimensions and the mean of two tumor diameter was reported here. Animal experiments were performed in accordance with the guidelines of the Dana Farber Cancer Institute Animal Care Committee. Mice were sacrificed when tumors reached 15-mm diameter or 2,000 mm 3 and tumors were harvested.
  • tumors were prepared for frozen sections for ApopTag Peroxidase In Situ Apoptosis Detection kit (Millipore). Cryosections were incubated with TdT enzyme (Millipore) for 1 hour. Rabbit anti-DIG (Dako) was added and incubated for 30 minutes and then Cy 3 -conjugated anti- rabbit antibody (Invitrogen) was added and incubated for 30 minutes. Sections were mounted with DAPI antifade mounting medium and fluorescent images were examined using confocal microscopy.
  • the fixed tumors were paraffin-embedded, sectioned at four- micrometer, placed on slides and prepared for IHQ.
  • the tissues were stained with the anti human: Ki67 (Vector, VP-K451), PD-L1 (Clone 405.9A11, produced in Dr. Gordon Freeman's lab), granzyme B (Abeam, ab4059) or NCAM (CD56) (Abeam, abl33345) antibodies, followed by secondary HRP conjugated anti -rabbit Ab or HRP-Avidin.
  • Ki67 Vector, VP-K451
  • PD-L1 Cell 405.9A11
  • granzyme B Abeam, ab4059
  • NCAM CD56
  • HRP-Avidin secondary HRP conjugated anti -rabbit Ab or HRP-Avidin.
  • the slides were developed using DAB and counterstained with hematoxylin.
  • the images were obtained in an Olympus BX51 microscopy using a DP71 digital camera (Olympus) and analyzed in the DP Controller Software (Olympus).
  • the image quantification was performed using the IHC Profiler Plugin of ImageJ Software as described in Varghese F, Bukhari AB, Malhotra R, De A.
  • IHC Profiler an open source plugin for the quantitative evaluation and automated scoring of immunohistochemistry images of human tissue samples. PloS one. 2014;9:e96801.
  • EXAMPLE 2 ADCC MEDIATED KILLING OF ANTI-CAIX ANTIBODIES AND
  • CAIX-specific chimeric receptors Two generations of anti-CAIX CARs were constructed: 1 st generation G36 CD8 CAR, with scFvG36 linked to CD8, truncated extracellular, hinge, and transmembrane domains plus signaling domain of TCR ⁇ (G36-CD8z). To deliver costimulatory signals, 2 nd generation CD28 CAR was generated, consisting of scFvG36 fused to truncated extracellular, transmembrane and intracellular domains of CD28 plus signaling domain of ⁇ (G36- CD28z) (Fig. 2A).
  • Irrelevant 2 nd generation CD28 CAR was made by using anti-HIV CCR5 (clone A8) scFv instead 15 .
  • human rhodopsin C9 tag were inserted between the scFv and CD8 or CD28 domains, respectively and ZsGreen was expressed after the IRES sequence.
  • High concentrations of viral stocks were obtained at comparable levels among the different constructs that were tested by cotransfection of vector plasmids into 293T cells (data not shown).
  • PHA mitogen was used to stimulate peripheral blood lymphocytes for 3 days.
  • Concentrated lentivirus supernatants were used to infect human primary T cells in the presence of cationic reagent DEAE as it increased the transduction rate of 1.5-2x fold as compared with polybrene (data not shown).
  • the transduction rate of primary T cells ranged from 17% to 45% by ZsGreen expression in FACS analysis.
  • a representative experiment showing ZsGreen expression in circa 25% by primary CART cells following lentivirus transduction is shown in Fig. 2B, left column.
  • CAIX-Fc fusion protein can bind to the G36-CD8z and -CD28z CART cells but not to control A8-CD28z CART cells (Fig 2B, middle column).
  • C9-tag expression was only detected at circa one- third the level of the CAIX-Fc protein (Fig 2B, right column) which is likely related to the finding that mAb 1D4 preferentially recognizes the rhodopsin nonapeptide C9 when presented as a carboxy -terminal verses internal polypeptide sequence (data not shown).
  • Transduced cells that were cultured in vitro for 6 weeks maintained their expression of ZsGreen.
  • EXAMPLE 3 ENHANCED CYTOKINE SECRETION BY TRANSDUCED T CELLS ON
  • both 1 st and 2 nd generation G36 expressing CART cells showed elevated levels of cytokine secretion with 2 nd generation G36-CD28z CART cells secreting higher amounts of type I cytokines which reflects their higher activation status compared to 1 st generation G36-CD8z CART cells.
  • G36-CD28z CART cells secreted 6.5X, 2.3X and 4X more IL-2, IFNy and IL-17, respectively than G36-CD8z CART cells.
  • Specificity of cytokine secretion induction by the two G36 CART cells is seen by their minimal stimulation with CAIX- sk- rc-59 cells.
  • G36-CD28z CART cells became high capacity IFN- y producing cells (Fig 3B).
  • G36-CD28z CART cells produced 6 times more spots than seen for G36-CD8z CART cells upon interaction with CAIX+ sk-rc 52 tumor cells and 12 times more spots than seen after interaction with CAIX- sk-rc-59 tumor cells.
  • G36-CD28z CART cells had a higher amount of granzyme B-secreting spots after contact with CAIX+ tumors as compared with G36-CD8z CART cells and control T cells.
  • EXAMPLE 4 SPECIFIC CYTOTOXICITY VIA CAR SIGNALING IN TRANSDUCED T CELLS.
  • An in vitro cytotoxicity assay was established to further evaluate the killing activity of the different G36 CART cells. Using different ratios of effector-to-target, G36-CD28z CART cells and its' twice in vivo passaged subclone 4-1 exhibited the highest amount of cytolysis of CAIX+ tumor sk-rc-52 (Fig 3C).
  • G36-CD28z CART cells showed 2-3 fold higher cytotoxicity than G36-CD8z CART cells and with low ratio of 5: 1, G36-CD28z CART cells showed 8-9 fold higher lysis than G36-CD8z CART cells.
  • G36-CD8z CART cells still exhibited good cytotoxicity with up to more than 60% tumor lysis using 100: 1 of E:T ratio.
  • Irrelevant A8-CD28z CART cells and control T cell LAK showed the background non-specific tumor lysis with around 20% lysis when using the highest 100: 1 of E:T ratio.
  • transduced and untransduced T cells showed background lysis.
  • Proliferating T cells were also harvested to examine their enrichment on CAIX+ tumor cell contact.
  • CAIX- tumor contact there was no change in the percentage of any CART cells within the population.
  • CAIX+ sk-rc-52 tumor cells there was enrichment in both populations of G36 CART cells.
  • G36-CD28z CART cells the positive population was enriched from 18% on day 0 to 52% on day 8 to 88% on day 16.
  • Expression of G36-CD8z CART cells was enriched from 19% on day 0 (same levels at T cells only) to 32% on day 8, and to 72% on day 16.
  • No expansion of A8-CD28z CART cells was seen over the two week study (Fig. 4B). The percentage of CD8 cells remained constant throughout the 16 day study under all conditions (Fig 4C).
  • EXAMPLE 6 PERSISTENT EFFECTOR FUNCTION OF CART CELLS AFTER RE- CONTACT WITH TUMOR.
  • EXAMPLE 7 SUPPRESSION OF ESTABLISHED TUMOR BY CART CELLS.
  • G36-CD28z CART cell treated mice showed statistically significant reduction in size compared to no T-cell treated mice at every time point that was examined over the 25 day study (Fig. 5).
  • G36-CD28z CART treatment also led to a greater reduction in tumor size than seen with A8-CD28z CART cell and LAK treated mice on day 7 (p ⁇ 0.05) and on day 25 (p ⁇ 0.00 ⁇ ), as calculated by two-tailed t test.
  • tumor size of G36-CD28z CART cell treated mice was significant smaller than that of no T-cell treated mice through the 29 day experiment.
  • G36-CD28z CART cell treated mice also had smaller tumors than were seen with A8 CD28z CART cell and LAK treated mice on day 8 to day 26 with p ⁇ 0.0 ⁇ and on day 29 with /K0.001 (Fig. 5).
  • Partial regression of CAIX+ tumor was considered when the tumor size was smaller than 30% volume of control CAIX- tumor in a same mouse receiving the same T- cell. Partial tumor regression was observed in a high percentage of cases using G36-CD28z CART cells (10 out of 15, (67%)), but only infrequently in irrelevant target A8-CD28z CART cells (1 out of 15, (7%)) and in activated T cell LAKs (2 out of 15, (13%)) (Table 2). Frequency of partial regression response was found to be statistically significant for mice treated with G36-CD28z CART cells versus control A8-CD28z CART cells and LAKs at /? ⁇ 0.001 and /? ⁇ 0.005, respectively by Fisher test.
  • EXAMPLE 8 IN SITU CYTOTOXICITY BY CART CELLS.
  • EXAMPLE 9 ANTI-CARBONIC ANHYDRASE IX CHIMERIC ANTIGEN RECEPTOR T
  • Anti-CAIX CART cells-secreting anti-PD-Ll antibodies can diminish T cell exhaustion in vitro.
  • a circa 50% decrease in the exhaustion markers Lag-3, Tim3 and PD-1 was found in the anti-PD-Ll IgGl and IgG4 anti-CAIX CART groups ( Figures 18 A, 18B and 18C, respectively) after induction of exhaustion compared to the parental anti-CAIX or irrelevant anti-BCMA CART cells.
  • the killing activity of anti-CAIX CART cells without anti-PD-Ll was retested over Skrc59 CAIX+/PD-L1+ cells.
  • the anti-CAIX CART cells had lost their killing activity against CAIX+/PD- L1+ RCC in vitro to a level that was similar to the irrelavent CAR group, establishing that the anti-CAIX CART cells became anergic.
  • the RCC viability diminished 25- 50% for the anti-CAIX CAR anti-PD-Ll IgGl and IgG4 CART groups, thereby providing evidence that the checkpoint blockade elicited by the presence of sectreted anti-PD-Ll IgGs can lead to diminished T cell exhaustion.
  • Anti-CAIX CART cells secreting anti-PD-Ll antibodies can further decrease tumor growth in an orthotopic mouse model of human RCC NSG mice were used to establish an orthotopic RCC model by injecting Skrc-59 CAIX+PD-Ll+luciferase+ positive RCC cells under the kidney capsule followed by i.v. injection of 1.0x107 CART or untransduced T cells (Day 0) and repeat treatment on Day 17 with a lower dose (2.5xl0 6 ) of the same cells.
  • Ki67 expression decreased significantly in the Anti- CAIX/ Anti-PD-Ll IgG-secreting groups, as we can visualize in the total DAB pixel count graph, however when the intensity among the positive nuclei staining (Ki67 IHC quantification graph) was evaluated, we can note that the Anti-CAIX/ Anti-PD-Ll IgG4 presented the lowest intensity of Ki67 expression ( Figures 20B and 20C).
  • Anti-CAIX CART cells secreting anti-PD-Ll IgGl antibodies can recruit NK cells to the tumor.
  • the tumors of the mice treated with Anti-CAIX/ Anti-PD-Ll IgGl that received an injection of NK cells 2 days before the euthanasia showed the presence of 40% more NK cells inside the tumor, when compared with Anti-BCMA/Anti-SARS IgGl, as detected by Anti-CD56 staining by FACS ( Figure 25A).
  • the increase in NK cells in the Anti-CAIX/Anti-PD-Ll IgGl group was also detected and quantified by IHC ( Figure 25B). Very few NK cells were also detected in the groups treated with CART cells secreting an unspecific IgGl Ab.
  • Frigola X Inman BA, Lohse CM, Krco CJ, Cheville JC, Thompson RH et al. Identification of a soluble form of B7-H1 that retains immunosuppressive activity and is associated with aggressive renal cell carcinoma. Clin Cancer Res 2011 ; 17(7): 1915-23.
  • CD28 outperforms combined CD28-OX40 "super-stimulation".
  • Pardoll DM The blockade of immune checkpoints in cancer immunotherapy. Nature reviews Cancer. 2012; 12:252-64.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Immunology (AREA)
  • Biochemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Medicinal Chemistry (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biophysics (AREA)
  • Zoology (AREA)
  • Cell Biology (AREA)
  • Toxicology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Animal Behavior & Ethology (AREA)
  • Engineering & Computer Science (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Epidemiology (AREA)
  • Biomedical Technology (AREA)
  • Materials For Medical Uses (AREA)
  • Biotechnology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Wood Science & Technology (AREA)
  • Microbiology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Pharmacology & Pharmacy (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Engineering & Computer Science (AREA)
  • Hematology (AREA)

Abstract

The present invention provides chimeric antigen receptors, cells expressing same and methods of using same for treatment various disorders such as cancer.

Description

CHIMERIC ANTIGEN RECEPTORS AND METHODS OF USE
THEREOF
RELATED APPLICATIONS
[0001] This application claims priority to, and the benefit of U.S. Provisional
Application number 62/094,625 filed on December 19, 2014, and U.S. Provisional Application number 62/252,083 filed on November 6, 2015, the contents of each of which are hereby incorporated in their entireties.
INCORPORATION-BY-REFERENCE OF SEQUENCE LISTING
[0002] The contents of the text file named, "Omnibus Sequence Listing for filing with DFCI-102_001WO_ST25", which was created on December 21, 2015, are hereby incorporated by reference in their entirety.
FIELD OF THE INVENTION
[0003] The present invention relates generally to chimeric antigen receptor cells for and methods of using same for treatment cancer and other disorders.
GOVERNMENT INTEREST
[0004] This invention was made with government support under [ ] awarded by the []. The government has certain rights in the invention.
BACKGROUND OF THE INVENTION
[0005] T lymphocytes recognize specific antigens through interaction of the T cell receptor (TCR) with short peptides presented by major histocompatibility complex (MHC) class I or II molecules. For initial activation and clonal expansion, naive T cells are dependent on professional antigen-presenting cells (APCs) that provide additional co- stimulatory signals. TCR activation in the absence of co-stimulation can result in unresponsiveness and clonal anergy. To bypass immunization, different approaches for the derivation of cytotoxic effector cells with grafted recognition specificity have been developed. Chimeric antigen receptors (CARs) have been constructed that consist of binding domains derived from natural ligands or antibodies specific for cell-surface components of the TCR-associated CD3 complex. Upon antigen binding, such chimeric antigen receptors link to endogenous signaling pathways in the effector cell and generate activating signals similar to those initiated by the TCR complex. Since the first reports on chimeric antigen receptors, this concept has steadily been refined and the molecular design of chimeric receptors has been optimized. Aided by advances in recombinant antibody technology, chimeric antigen receptors targeted to a wide variety of antigens on the surface of cancer cells and of cells infected by human immunodeficiency virus (HIV) have been generated.
SUMMARY OF THE INVENTION
[0006] In various aspects the invention provides a chimeric antigen receptor (CAR) having an intracellular signaling domain, a transmembrane domain and an extracellular domain.
[0007] In some aspects the transmembrane domain further includes a stalk region positioned between the extracellular domain and the transmembrane domain. The transmembrane domain includes CD28. In another aspect the CAR further includes one or more additional costimulatory molecules positioned between the transmembrane domain and the intracellular signaling domain. The costimulatory molecules is CD28, 4-1BB, ICOS, or OX40. The intracellular signaling domain is for example a CD3 zeta chain. The extracellular domain is an antibody such as a Fab or a scFV. Preferably the antibody is specific for BCMA, CA-9, CD 138, CCR4, or the influenza virus.
[0008] Also included in the invention are nucleic acids encoding the CAR of the invention further including a nucleic acid encoding a polypeptide positioned after the intracellular signaling domain. The polypeptide is an antibody such as scFV. Preferably, the antibody is specific for CCR4, PD-1, PDL-1, PD-L2, CXCR4, or GITR. Also provided by the invention are vector including the nucleic acid according to the invention and cells including the vectors.
[0009] In yet a further aspect the invention provides a genetically engineered cell which express and bear on the cell surface membrane the chimeric antigen receptor of the invention. The cell is a T-cell or an NK cell. The T cell is CD4+ or CD8+. The cell is a mixed population of CD4+ and CD8 cells+. The cell is further engineered to express and secrete a polypeptide such as for example an antibody. [00010] Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention pertains. Although methods and materials similar or equivalent to those described herein can be used in the practice of the present invention, suitable methods and materials are described below. All publications, patent applications, patents, and other references mentioned herein are expressly incorporated by reference in their entirety. In cases of conflict, the present specification, including definitions, will control. In addition, the materials, methods, and examples described herein are illustrative only and are not intended to be limiting.
[00011] Other features and advantages of the invention will be apparent from and encompassed by the following detailed description and claims.
BRIEF DESCRIPTION OF THE DRAWINGS
[00012] Figure 1. ADCC of CAIX-specific Abs. 1 μg/ml C AlX-specific scFv-Fc minibodies were added to the target tumor cells in the presence of human PBMC (E:T 25: 1). Similar results were obtained in 2 experiments. Irrelevant anti-SARS scFv-Fc (11 A) and anti-CCR4 scFv-Fc (48) minibodies were used as negative controls. A, CAIX+ sk-rc-09 cells; B, CAIX+ sk-rc-52 cells; C, CAIX- sk-rc-59 cells.
[00013] Fig. 2. Construction and expression of CAIX-specific CARs. A.
Construction: The 1st generation CAR, scFv-CD8-TCR ζ (CD8 CAR), is composed of a specific anti-CAIX scFv that is coupled to truncated human CD8a extracellular domain, hinge (H), transmembrane (TM) and intracellular regions, then to the signaling domain of human TCRC. The 2nd generation CAR, scFv-CD28-TCRC (CD28 CAR), contains anti- CAIX scFv fused with human CD28 extracellular, TM and intracellular signaling domain to TCRζ. Both anti-CAIX CARs were cloned into a bicistronic self-inactivating (SIN) lentiviral vector with expression driven by an internal eFl-a promoter. The CAR control construct contains an irrelevant anti-HIV CCR5 specific A8 scFv substitution. B. FACS analysis: Reporter gene ZsGreen was used to quantitate primary T cell transduction efficiency by the lentiviral CAR constructs. In addition, anti-CAIX scFv CARs were stained with CAIX-Fc fusion protein and C9-tag (TETSQVAPA) was stained with 1D4 antibody. Untransduced activated T-cells, LAK only were served as unstained cell control (i) or stained with 2nd antibody (ii. PE-anti-human IgG and iii. APC-anti-mouse IgG) were used as staining controls. C. Western blot: Molecular sizes of monomer/dimer structures of anti-CAIX (clone G36) CD28 and annti-CCR5 (clone A8) CD28 CARs, as well as endogenous TCRζ chain of untransduced T cells were indicated.
[00014] Fig. 3. Effector functions of CAIX-specific CARTs. A. Cytokine secretion. Anti-CAIX CART, irrelevant CART or activated control T cells (LAK) were cocultivated overnight with kidney cancer cell lines sk-rc-52 (CAIX+) and sk-rc-59 (CAIX-) for cytokine production. One representative out of 2-3 results is shown. B. ELISPOT. G36 CART or control A8 CART cells were added to tumor cells overnight. IFN-γ or granzyme B secreting T cells detected by ELISPOT. Similar results were obtained in 2-3 experiments. C. Specific anti-tumor cytotoxicity of CAIX-specific CART cells, control A8 CART cells or LAK cells were incubated in a 4-hour cytotoxicity assay at different amounts of target tumor cell at the ratios as indicated. One out of two experiments is shown. Clone 4-1 is a in vivo passaged subclone of sk-rc-52.
[00015] Fig. 4. Clonal expansion of CART cells after tumor contact. A. Proliferation. CAR-transduced T cells or untransduced T cells (LAK) were plated with irradiated tumor cells (CAIX+ sk-rc-52 & CAIX- sk-rc-59) weekly at three different ratios of tumor to T cells as indicated. Number of T cells was counted every 3-4 days in triplicate from two separate wells. Similar results were obtained in two experiments. B. Clonal enrichment. In tumor stimulation experiments, cultures from CART-and LAK cells were assayed on one week and two weeks by flow cytometry for expression of CART and T-cell subset. One representative of two results is shown.
[00016] Fig. 5. Regression of established human RCC xenografts by CART cells.
Athymic null mice were inoculated subcutaneously with 7.5 x 106 sk-rc-52 and 5 x 106 sk- rc-59 RCC tumor cells at left and right flank respectively. After 6 days of tumor implantation, mice were injected i.v. with 50 x 106 G36 CD28 CART cells, A8 CD28 CART cells (> 20% CAR+), LAK, or PBS alone. High dose of IL-2 (1 x 105 U/ml) was injected every 2-3 days. Tumor size was measured by caliper every 2-3 days. Experiment 1, n = 7 & Experiment 2, n = 8. Tumor size of these two experiments was shown separately. +, /?<0.05; *, p< 0.01 ; **^ p< 0.001 in groups of G36 Tandem treated mice versus control no T cell treated mice in these two trials. Other statistic calculations are reported in the text.
[00017] Fig. 6. In vivo anti-tumor activity of CAR+ T-cells. A. Expression of ZsGreen by CART cells is shown in upper panel. CART cells were pre-stained with Far Red dye, cytospun and examined by fluorescent microscopy {lower panel). B. In situ staining of G36 CD28 CART cells in regressing tumor. CART-cells were i.v. injected into RCC established mice and tumor tissue was collected on day 1-3. Confocal microscopy was used to measure apoptosis of tumor cells by TUNNEL assay with PE-Cy5 dye (shown as red). Transduced T cells were shown by ZsGreen. Nuclei were counterstained with DPAI. Two representative slides were shown to indicate the apoptosis of tumor cells at the edge of tumor {upper panel) and inside the tumor bed {middle panel), respectively. The magnified image {lower panel) demonstrates CART cells interacted with multiple tumors while a few surrounding tumor cells were dying. C. Granzyme B+ T cells and tumor necrosis. After the treatment with CART cells, the regressing CAIX+ sk-rc-52 tumors were stained by granzyme B antibody (brown) and H&E. The higher magnification view {middle and lower panels of sections a and b in upper panel) shows the locations of granzyme B+ T cells (shown by arrows) and the corresponding H&E slide shows the tumor necrosis (shown by n).
Granzyme B+ T cells are distributed at the edge of tumor {middle panel) and inside the tumor {lower panel).
[00018] Figure 7. CAIX- sk-rc-52 tumors treated with control LAK cells showed negative granzyme B staining (left) {upper panel) and the corresponding histology was shown in H&E (right).
[00019] Figure 8. Low background staining of granzyme B in CAIX- sk-rc-59 tumors treated with G36 CD28z CART cells
[00020] Figure 9. Low background staining of granzyme B in CAIX- sk-rc-59 tumors treated with LAK cells.
[00021] Figure 10. Positive control of granzyme B staining was performed on sk-rc-52 tumors which was local injected with G36 CD28z CART cells (left) and tumor morphology was shown in H&E (right).
[00022] Figure 11 Expression of aCAIX CAR and aPD-Ll scFv-Fc transiently transfected 293T cells. 106 of 293T cells were transfected with or without lentiviral pHAGE-EFlaG36-C9tag-CD28-CD3zeta-IRES-anti-PDLl scFv-Fc (IgG4)-WPRE or the control pHAGE-EFla-A716-C9tag-CD28-CD3zeta-IRES-ZsGreen-WPRE plasmids. Cells and supernatant were harvested at 24 and 48 hours post transfection. Left, purified
CAIX(ECD)-Fc-Biotin and Streptavidin-APC were used for cell staining and flow cytometry analysis. Right, total human IgG in supematant was quantitated with human IgG quantification kit.
[00023] Figure 12 (A) Total PBMCs from 4 donors were stimulated with 50 ng/ml SEB and treated with 10 ug/ml anti-PDLl (#42) sIgG4 or anti-influenza sIgG4. Restoration of IFNy production (upper) or TNFa production (lower) was measured. (B) Parental anti- CCR4 antibody, cl567IgG, inhibited chemotaxis of Tregs to CCL22. (C) CD4+CD25" T cells were CFSE-labeled, incubated with Tregs at 10: 1 ratio, and then stimulated with anti- CCR4 mAb and control mAb in the presence of anti-CD3/28 co-stimulation. After 3 and 7 days cells were harvested and analyzed by flow cytometry. The percentage of cells was calculated among the fluorescence positive CD4+CD25" T and counting beads. The percent proliferation was normalized to CD4+CD25" T effector cells at Day 0. The data shown were calculated from two independent experiments. Bars represent mean ± S.D.. (D) IFNy ELISpot analysis of mAb2-3 and control antibody treated CD4+CD25" Teff cells. Data represents the quantification from three separate experiments using three individual donor bloods. (E) Left, CFSE-labeled Teffs (5xl04) and unlabeled Tregs (5xl03) were co- incubated with 20 μg/ml PHA in 96-well plates for 5 days. The CFSE-labeled Teffs were harvested and CFSE intensity was analyzed by flow cytometry. The proliferation of Teffs were only observed when the coculture incubated with anti-GITR mAb. Right, IFNy production in the same cultures was further measured by MSD. CFSE-labeled Teffs (5x104) and unlabeled Tregs (5x103) were co-incubated with 20 μg/ml PHA in 96-well plates for 5 days. The CFSE-labeled Teffs were harvested and CFSE intensity was analyzed by flow cytometry. Teffs were proliferated after 5-day incubation with PHA, but not in the
Teff/Treg coculture. Left, IFNy production in the same cultures was measured by MSD.
[00024] Figure 13 is an illustration showing different CART configurations according to the invention.
[00025] Figure 14 is an illustration showing different armed CART configurations according to the invention.
[00026] Figure 15 is a further illustration showing different armed CART configurations according to the invention.
[00027] Figure 16 is a series of illustrations and graphs indicating chimeric antigen receptors (CAR) constructs for CD8+ T cell transduction. (A) Schematic representation of second generation pHAGE lentiviral vectors containing CD28 as a co-stimulatory domain. The anti-carbonic anhydrase IX (CAIX) or the Anti-B-cell maturation antigen (BCMA) scFv (as a negative control) were inserted after the elFa promoter, in order to express the CAR binding domain. The second cassette, after the Internal Ribosome Entry Site (IRES) sequence, is responsible by coding the soluble Anti-PD-Ll IgGl or IgG4 isotypes or the Anti-Severe Acute respiratory syndrome (SARS) coronavirus IgGl. To produce the lentiviruses, the pHAGE vectors were transfected together with the packaging plasmids (Gag, Rev, Tat and VSVG) into 293T LentiX cells using Polyethyleneimine. The viruses were harvested two days after transfection, purified and concentrated using LentiX
Concentrator (Clontech™), according to the manufacturer instructions. LTR: long terminal repeat, elFa: eukaryotic initiation factor alpha, scFv: single-chain variable fragment, C9 TAG: C9 peptide TETSQVAPA, IRES: Internal Ribosome Entry Site, WPRE: Woodchuck Hepatitis Virus Posttranscriptional Regulatory Element. (B) T cells were transduced with the lentiviruses to generate Anti-CAIX CART Cells, which are able to recognize CAIX positive RCC, and also release Anti-PD-Ll IgGl or IgG4 in the tumor microenvironment to block PD-1/PD-L1 -induced T cell exhaustion. (C) Percentage of CART cells 14 days after transduction, representing the stable long-term expression of CAR by the integrated lentiviruses in CD8+T cells. The CD8+ T cells were selected using Dynabeads™ CD8 Positive isolation Kit (Life Technologies) and activated with Dynabeads™ Human T Cell Activator CD3/CD28 (Life Technologies) in the presence of IL-21 50U/mL. IL-21 was added to the medium every 2 days. After 14 days, the CART cells were incubated with human CAIX-Fc or BCMA-Fc, followed by incubation with an APC conjugated anti-human Fc IgG and analyzed by FACS. (D) Concentration of IgG secreted to the medium of transduced T cells evaluated by Human IgG ELISA Quantitation Set (Bethyl Laboratories). (E) Concentration of Anti-PD-Ll antibodies in the supernatant of 293T Cells transduced with lentiviruses containing Anti-CAIX or Anti-BCMA CAR and Anti-PD-Ll IgGl, Anti- PD-Ll IgG4 or unspecific Anti-SARS IgGl sequences. The antibodies in the supernatant were purified with Protein A sepharose beads (GE Healthcare) and biotinylated using the EZ-Link Sulfo-NHS-LC-Biotin (Thermo Scientific™). These antibodies were incubated with 5 μg/mL of human PD-L1 pre-immobilized in the 96 wells MaxiSorp plate (Nunc™). The biotinylated antibodies were detected by incubation with streptavidin-HRP for lh and developed with TMB. The absorbance was read at λ=450 nm. *P<0.001 compared to Anti BCMA/Anti SARS IgGl and Anti-CAIX/Anti-SARS IgGl . **P<0.05 compared to Anti- CAIX/Anti-PD-Ll IgGl. (F and G) Clonal Expansion of CD8+ CART cells. (F)
Concentration of CART cells versus days in the presence of skrc-52 CAIX+/PD-L1- cells. *P<0.05 comparing all CARS to Anti-BCMA/ Anti-SARS IgGl. (G) Percentage of transduced T cells versus days in the presence of skrc-52 CAIX positive cells. *P<0.05 comparing all CARS to Anti-BCMA/ Anti-SARS IgGl. The CD8+ CART cells were previously cultivated for five days after transduction with Anti CAIX CAR able to express anti-PD-Ll IgGl (AntiCAIX/Anti -PD-Ll IgGl), IgG4 (Anti-CAIX/ Anti-PD-Ll IgG4) or a unspecific Anti-SARS Ab (Anti-CAIX/Anti SARS IgGl) or Anti-BCMA CAR (negative control) able to express an unspecific anti-SARS Ab (Anti-BCMA/ Anti SARS IgGl) and activated with Dynabeads™ Human T Activator CD3/CD28 (Life Technologies) in the presence of IL-21 50U/mL. The beads were removed and the CART cells were cultured with skrc52 CAIX+ PD-Ll - and IL-21 (50 U/mL), which was added to the medium every 2 days for 21 days. The results represent the average ± SD of three donors in duplicate.
[00028] Figure 17 is a series of graphs that illustrate CART cell effector function. (A) Viability of Skrc59 CAIX+/ PD-Ll + cells or (B) Skrc52 CAIX-/ PD-Ll - cells incubated overnight (O.N.) with CART cells Anti-CAIX/Anti-PD-Ll IgGl, Anti-CAIX/Anti-PD-Ll IgG4, Anti-CAIX/Anti SARS IgGl or Anti-BCMA/Anti SARS IgGl. These CART cells were used 4 days after lentiviral transduction. The cell viability was evaluated by MTT (Molecular Probes™). *P<0.05 for all CART cells compared to Anti BCMA/Anti SARS IgGl (C) IL2 released by CART cells after overnight contact with Skrc59 CAIX+/ PD-L1+ cells or (D) Skrc52 CAIX-/PD-L1- cells. The IL-2 secretion was evaluated using the Human IL-2 ELISA Ready-SET-Go Kit (eBioscience™). *P<0.001 for all CART cells compared to Anti BCMA/Anti SARS IgGl. (E) IFNy released by CART cells after overnight contact with Skrc59 CAIX+/ PD-Ll + or (F) Skrc52 CAIX-/ PD-Ll- cells. The IFNy secretion was evaluated using the Human IFNy ELISA Ready-SET-Go Kit (eBiosciences™). *P<0.05 for all CART cells compared to Anti-BCMA/ Anti-SARS IgGl. (G) Ab-dependent cell- mediated cytotoxicity of skrc59 CAIX+/PD-L1+ or (H) skrc52 CAIX-/PD-L1- after incubation with the supernatant (SN) of CART cells containing 500 ng/mL of the Anti-PD- Ll IgGl, Anti-PD-Ll IgG4 or the Anti-SARS IgGl . To obtain the antibodies, CART cells were incubated for six days with Dynabeads™ Human T Activator CD3/CD28 (Life Technologies) in the presence of IL-21 50U/mL. After 7 days, the medium containing the mAbs was harvested NK cells were purified using an EasySep™ Human NK Cell Enrichment Kit (StemCell1M Technologies). RCC cell lines Skrc59 CAIX+ PD-L1+ and Skrc52 CAIX- PD-L1- were used as target cells and plated at 1.5 χ 103/well in a 96-well plate. RCC cells were incubated for 1 hour, 37°C, with 50 of the CART cells supernatant adjusted for 500 ng/mL of the respective Ab Anti-PD-Ll IgGl, Anti-PD-Ll IgG4 or Anti-SARS IgGl. After the incubation, the cells were washed with medium and incubated with 12.5: 1, 25: 1 or 50: 1 NK cells for 4h, 37°C. Culture supernatants were harvested by centrifugation and LDH measured in the supernatant by CytoTox 96® Non- Radioactive Cytotoxicity Assay (Promega™) at 490 nm. These results represent the average ± SD of three donors in duplicate.
[00029] Figure 18 is a series of graphs that depict CART cells expression of exhaustion markers. (A) Lag3, (B) Tim3 and (C) PD-1 expression. *P<0.05 compared to Anti- CAIX/Anti-SARS IgGl and Anti-BCMA/ Anti-SARS IgGl . The CD8+ CART cells were selected using Dynabeads™ CD8 Positive isolation Kit (Life Technologies), activated with Dynabeads™ Human T Activator CD3/CD28 (Life Technologies) and transduced with the following CARs: Anti-CAIX/Anti-PD-Ll IgGl, Anti-CAIX/Anti-PD-Ll IgG4, Anti- CAIX/Anti SARS IgGl or Anti-BCMA/Anti SARS IgGl. These cells were cultured in the presence of IL-21 50U/mL and Dynabeads™ Human T Activator CD3/CD28 for five days. After this period the CART cells were co-cultured with Skrc-59 CAIX+ PD-L1+ for 2 days in order to stimulate exhaustion. CART cells were stained with FITC-conjugated anti- human PD-1, PE-conjugated anti-human Tim3 and PerCP/Cy5.5 anti-human Lag3 and analyzed by FACS. (D) Viability of Skrc59 CAIX positive/ PD-L1 positive cells after incubation with exhausted CART cells. The cell viability was evaluated by MTT
(Molecular Probes). *P<0.05 compared to both Anti-CAIX/Anti-SARS IgGl and Anti- BCMA/ Anti-SARS IgGl. **P<0.05 compared to Anti-CAIX/Anti-PD-Ll IgGl . These results represent the average ± SD of three donors.
[00030] Figure 19 is a series of images and graphs that depict the effect that CART cells have in an orthotopic model of human RCC. (A) NSG Mice (N=35) were injected with 5.0x104 skrc-59 CAIX positive, PD-L1 positive and luciferase positive RCC cells. After a week, the mice were injected with 1.0x107 CART or untransduced T cells IV (Day 0). The CART cells were previously transduced with the following lentiviral sequences: Anti- BCMA CAR/Anti-SARS IgGl, Anti-CAIX CAR/Anti SARS IgGl, Anti-CAIX CAR/ Anti- PD-Ll IgGl and Anti-CAIX CAR/ Anti-PD-Ll IgG4 (N=6 mice per group). The tumor bioluminescence was quantified after 5 minutes of luciferin IP injection using IVIS. A. Imaging of the tumors before CART injection (Day 0), and after 7, 14, 23 and 30 days after first CART cells injection. A second injection of 2.5x106 cells was made on day 17. (B) Imaging of the tumors after excision at day 30. Scale bar= 1 cm. (C) Tumor growth curve. *P<0.05 when Anti-PD-Ll IgGl and IgG4 groups were compared to Anti-BCMA/Anti- SARS IgGl and **P<0.05 when Anti-PD-Ll IgGl and IgG4 groups were compared to Anti-CAIX/Anti-SARS IgGl . (D) Tumor weight after 30 days of treatment. *P<0.05 compared with Anti-BCMA/Anti SARS IgGl CAR, **P<0.05 compared with Anti- CAIX/Anti-SARS IgGl.
[00031] Figure 20 is a series of graphs and histological images that depict antitumor activity from CART cells. (A) Expression of exhaustion markers in tumor infiltrating lymphocytes (TIL). The kidney tumors from all mice were divided in two parts and one of them was fragmented in small pieces and digested with collagenase and DNAse to extraction of TIL. The CART cells were analyzed for the exhaustion markers PD-1, Tim-3 and Lag3. *P<0.05 compared with untransduced, Anti-BCMA/Anti SARS IgGl CAR and Anti-CAIX/Anti-SARS IgGl . (B) Detection of Ki67 as a tumor cell proliferation marker and granzyme B to analyze CART cells activity in the tissue. Four-micrometer sections of formalin-fixed, paraffin-embedded tissues were dewaxed and rehydrated in a decreasing ethanol series. Endogenous peroxidase activity was quenched using 3% hydrogen peroxide. The antigen retrieval was performed using pressure cooker in citrate buffer (pH=6.0) for 45 seconds at 123oC , 15 PSI. The tissue sections were incubated for 45 minutes with the rabbit anti human Ki67 polyclonal Ab 1 :2000 (Vector, VP-K451), mouse anti -human PD- Ll mAb 10.4 μg/mL (Clone 405.9A11) developed by Dr. Gordon Freeman (Boston, MA), biotinylated CAIX-Fc protein 17 μg/mL (produced in our lab), rabbit anti human granzyme B polyclonal Ab (Abeam, ab4059) 1 : 100 or rabbit anti-human NC AM (CD56) mAb 1 : 100 (Abeam, abl 33345), followed by secondary HRP conjugated anti -rabbit Ab or HRP-Avidin. The slides were developed using 3,3'-diaminobenzidine (DAB) and counterstained with hematoxylin. The images were obtained in an Olympus BX51 microscopy using a DP71 digital camera (Olympus) and analyzed in the DP Controller Software (Olympus™). The scale bars represent the magnification of the images of each column [500μιη (40X), 100 μιτι (200X) or 50 μιτι (400X)].(C) A series of graphs present percentage quantification of TIL staining positive for Granzyme B, PD-L1-IHC, and Ki67. Also presented in (C) is a Ki67- DAB Pixel count of TILs.
[00032] Figure 21 is a series of graphs that depict the evaluation of IL-2 versus IL-21 to CD8+ CART cells proliferation. A and B. Proliferation of CART transduced cells in the presence of IL-2 or IL-21 evaluated 48h, 72h and 120h after transduction with lentiviruses. (A) Anti-CAIX CART cells or (B) Unspecific Anti-BCMA CART cells (both with ZsGreen in the second cassette). The CD8+ T cells were selected using Dynabeads™ CD8 Positive isolation Kit (Life Technologies) and activated with Dynabeads™ Human T Activator CD3/CD28 (Life Technologies) in the presence of IL2 or IL-21 50U/mL (Peprotech™). The CART cells transduction was evaluated by ZsGreen expression using FACS. The data represents the average ± SD of two donors. *p<0.05 comparing IL-21 with non treated control (Ctr); **p<0.05 comparing IL21 with IL-2. C and D. Viability of RCC cells treated with CD8+ CART cells cultivated in the presence of IL-2 or IL-21. The viability was evaluated by MTT after an overnight incubation of CART cells Anti-BCMA, Anti-CAIX or Untransduced T cells with (C) Skrc-59 CAIX+/PD-L1+ and (F) Skrc-52 CAIX-/PD-L1- RCC cells. The CART cells were previously cultivated in the presence of IL2 or IL-21 50U/mL for 120 hours. These results represent the average ± SD of two donors in triplicate. *P<0.05 comparing Anti-CAIX CAR with Anti-BCMA CAR or untransduced T cells.
[00033] Figure 22 is a series of flow cytometry graphs that depict the expression of PD-1 and CAIX in the renal cell carcinoma (RCC) lines. (A) Negative control, (B) Skrc52 CAIX- PD-L1-, (C) Skrc52 CAIX+ PD-L1-, (D) Skrc59 CAIX+ PD-L1+. The cells were stained with Anti-human CAIX antibody developed with APC-Anti-human Fc IgG and Biotinylated Anti human PD-L1 antibody developed with PE-Avidin. The analysis was performed by FACS.
[00034] Figure 23 is a series of graphs that depict the characterization of CART cells. (A) Proliferation of total CD8+ T cells two or four days after transduction Anti CAIX C AR/Anti-PD-L 1 IgGl), (Anti-CAIX CAR/ Anti -PD-L 1 IgG4), Anti-CAIX CAR/ Anti SARS IgGl) or Anti-BCMA CAR/Anti SARS IgGl). The CD8+ T cells were selected using Dynabeads™ CD8 Positive isolation Kit (Life Technologies) and activated with Dynabeads™ Human T Activator CD3/CD28 (Life Technologies) in the presence of IL-21 50U/mL. IL-21 was added to the medium every 2 days. The proliferation was evaluated by FACS using Counting Beads (Molecular Probes). (B) Concentration of CAR-transduced T cells two and four days after transduction. The CART cells were incubated with human CAIX-Fc or BCMA-Fc, followed by incubation with an APC conjugated anti -human Fc IgG and analyzed by FACS. (C) Percentage of CART cells 2 and 4 days after transduction. The results represent the average ± SD of three donors in duplicate.
[00035] Figure 24 is a series of graphs that depict the effect that CART cells have in an orthotopic model of human RCC. (A) Comparison of tumor size detected by
bioluminescence versus days among the CART cells groups. NSG Mice (N=35) were injected in the renal capsule with 5.0x104 skrc-59 CAIX+, PD-L1+ and luciferase + RCC cells. After a week, the mice were injected with 1.0x107 CART or untransduced T cells IV. The CART cells were previously transduced with the following lentiviral sequences: Anti- BCMA CAR/Anti-SARS IgGl, Anti-CAIX CAR/Anti SARS IgGl, Anti-CAIX CAR/ Anti- PD-Ll IgGl and Anti-CAIX CAR/ Anti-PD-Ll IgG4 (N=6 mice per group). The tumor bioluminescence was quantified after 5 minutes of luciferin IP injection using IVIS. In the Day 17, more 2.5x106 CART cells were injected. *P<0.05 compared to anti-BCMA CART cells. **P<0.05 compared to untransduced T cells, ***P<0.05 compared to Anti- CAIX/Anti-SARS IgGl. (B) Percentage of T cells in the mice blood after 8 days of treatment. *P<0.05 compared to untransduced T cells. **P<0.05 compared to all Anti- CAIX CARs. The red blood cells were lysed with ACK Lysing Buffer (Lonza™) and the remaining cells were stained with Pacific Blue conjugated Anti-human CD45 and analyzed by FACS. (C) Total tumor infiltrating lymphocytes (TIL) after 30 days of treatment with CART cells. The tumors and kidney from all mice were divided in two parts and one of them was fragmented in small pieces and digested with collagenase and DNAse to extraction of TIL. The cells were stained with Pacific Blue conjugated Anti-human CD45 and analyzed by FACS.
[00036] Figures 25A and 25B are a series of graphs and histological images that depict Human natural killer (NK) cells in the tumors treated with Anti-CAIX CART cells releasing anti-PD-Ll IgGl Ab. (A) Percentage of CD56+ cells (NK marker) in the tumors. Two mice of each group were injected with 4.5x106 NK cells one day before the euthanasia. The kidney tumors from all mice were divided in two parts and one of them was fragmented in small pieces and digested with collagenase and DNAse to extraction of NK. NK cells present in the tumor were stained with APC-Anti-CD56 Ab and analyzed by FACS.
*P<0.05. (B) CD56+ cells into the excised tumors detected by IHC and quantified using IHC Profiler Plugin of ImageJ Software. Four-micrometer sections of formalin-fixed, paraffin-embedded tissues were dewaxed and rehydrated in a decreasing ethanol series. Endogenous peroxidase activity was quenched using 3% hydrogen peroxide. The antigen retrieval was performed using pressure cooker in citrate buffer (pH=6.0) for 45 seconds at 123oC , 15 PSI. The tissue sections were incubated for 45 minutes with the rabbit anti- human CD56 mAb 1 : 100 (Abeam, abl33345), followed by secondary HRP conjugated anti- rabbit or anti-mouse Ab. The slides were developed using 3,3'-diaminobenzidine (DAB) and counterstained with hematoxylin. The images were obtained in an Olympus BX51 microscopy using a DP71 digital camera (Olympus) and analyzed in the DP Controller Software (Olympus). The quantification was performed using the IHC Profiler Plugin of ImageJ Software (23). The scale bars represent the magnification of the images (400X). *P<0.05 compared with untransduced, **P<0.05 compared with untransduced and Anti- BCMA/Anti-SARS IgGl .
DETAILED DESCRIPTION OF THE INVENTION
[00037] The present invention relates to a chimeric antigen receptor (CAR) particularly adapted to immune cells used in immunotherapy.
[00038] In one embodiment, a double immunotherapeutic strategy is described based on the blocking of T cell exhaustion using anti-PD-Ll antibodies secreted by targeted anti- CAIX CAR T cells combined in a single lentivirus construct for improving cancer treatment.
[00039] An emerging mechanism associated with the progression of RCC and other tumors is the immune checkpoint pathway, which consists in cellular interactions that prevent excessive activation of T cells under normal conditions, allowing T cell function in a self-limited manner. As an evasion mechanism, many tumors are able to stimulate the expression of immune checkpoint molecules, resulting in an anergic phenotype of T cells that cannot restrain tumor progression. Emerging clinical data highlight the importance of one inhibitory ligand and receptor pair as an immune checkpoint: the programmed death- ligand 1 (PD-L1 ; B7-H1 and CD274) and programmed death receptor-1 (PD-1; CD279), in preventing killing of cancer cells by cytotoxic T-lymphocytes. PDl receptor is expressed by many cell types like T cells, B cells, Natural Killer cells (NK) and host tissues. Tumors and Antigen-presenting cells (APC) expressing PD-L1 can block T cell receptor (TCR) signaling of cytotoxic T-lymphocytes through binding to receptor PD-1, decreasing the production of cytokines and T cell proliferation. PD-L1 overexpression can be found in many tumor types and may also mediate an immunosuppressive function through its interaction with other proteins, including CD80 (B7.1), blocking its ability to activate T cells through binding to CD28.
[00040] Genetic engineering of human lymphocytes to express tumor-directed chimeric antigen receptors (CAR) can produce antitumor effector cells that bypass tumor immune escape mechanisms that are due to abnormalities in protein-antigen processing and presentation. Moreover, these transgenic receptors can be directed to tumor-associated antigens that are not protein-derived. In certain embodiments of the invention there are lymphocytes (CARTS) that are modified to comprise at least a CAR, and in particular embodiments of the invention a single CAR targets two or more antigens. In preferred embodiments, the CARTS are further modified to express and secrete one or more polypeptides, such as for example an antibody or a cytokine. Such CARTS are referred to herein as armed CARTS. Armed CARTS allow for simultaneous secretion of the polypeptide locally at the targeted site (i.e., tumor site).
[00041] A modified TCR called chimeric antigen receptor (CAR) containing single chain variable antibody fragment (scFv) previously selected by high affinity against a specific tumor associated antigen is a powerful new approach against cancer. The scFv presented in the CAR is linked to an intracellular signaling block that includes CD3ζ to induce T cell activation followed by antigen binding. This structure is characteristic for first-generation CARs, which were improved to second- and generation CARs that link the signaling co- stimulatory endodomains of CD28, 4-1BB, or OX40 to CD3 or 3rd-generation CARs that links two elements to CD3ζ in tandem. These endodomains are required for complete T cell activation during TCR recognition by antigen-presenting cells (APCs), improving cytokine production and proliferation of CAR-T cells. The effect of CART cells has heretofore been modest for the treatment of solid tumors, due to difficulty in finding unique tumor associated antigens, inefficient homing of T cells to tumor locations, low persistence of T cells in the body and the immunosuppressive microenvironment of solid tumors.
[00042] In particular cases, the lymphocytes include a receptor that is chimeric, non- natural and engineered at least in part by the hand of man. In particular cases, the engineered chimeric antigen receptor (CAR) has one, two, three, four, or more components, and in some embodiments the one or more components facilitate targeting or binding of the lymphocyte to one or more tumor antigen-comprising cancer cells.
[00043] The CAR according to the invention generally comprises at least one transmembrane polypeptide comprising at least one extracellular ligand-biding domain and; one transmembrane polypeptide comprising at least one intracellular signaling domain; such that the polypeptides assemble together to form a Chimeric Antigen Receptor.
[00044] The term "extracellular ligand-binding domain" as used herein is defined as an oligo- or polypeptide that is capable of binding a ligand. Preferably, the domain will be capable of interacting with a cell surface molecule. For example, the extracellular ligand- binding domain may be chosen to recognize a ligand that acts as a cell surface marker on target cells associated with a particular disease state.
[00045] In particular, the extracellular ligand-binding domain can comprise an antigen binding domain derived from an antibody against an antigen of the target.
[00046] As non limiting examples, the antigen of the target can be a tumor-associated surface antigen, such as ErbB2 (HER2/neu), carcinoembryonic antigen (CEA), epithelial cell adhesion molecule (EpCAM), epidermal growth factor receptor (EGFR), EGFR variant III (EGFRvIII), CD 19, CD20, CD30, CD40, disialoganglioside GD2, ductal-epithelial mucine, gp36, TAG-72, glycosphingolipids, glioma-associated antigen, .beta. -human chorionic gonadotropin, alphafetoprotein (AFP), lectin-reactive AFP, thyroglobulin, RAGE- 1, MN-CA IX, human telomerase reverse transcriptase, RU1, RU2 (AS), intestinal carboxyl esterase, mut hsp70-2, M-CSF, prostase, prostase specific antigen (PSA), PAP, NY-ESO-1, LAGA-la, p53, prostein, PSMA, surviving and telomerase, prostate-carcinoma tumor antigen-1 (PCTA-1), MAGE, ELF2M, neutrophil elastase, ephrin B2, CD22, insulin growth factor (IGFl)-I, IGF-II, IGFI receptor, mesothelia, a major histocompatibility complex (MHC) molecule presenting a tumor-specific peptide epitope, 5T4, RORl, Nkp30, NKG2D, tumor stromal antigens, the extra domain A (EDA) and extra domain B (EDB) of fibronectin and the Al domain of tenascin-C (TnC Al) and fibroblast associated protein (fap); a lineage-specific or tissue specific antigen such as CD3, CD4, CD8, CD24, CD25, CD33, CD34, CD133, CD138, CTLA-4, B7-1 (CD80), B7-2 (CD86), endoglin, a major histocompatibility complex (MHC) molecule, BCMA (CD269, TNFRSF 17), or a virus- specific surface antigen such as an HIV-specific antigen (such as HIV gpl20); an EBV- specific antigen, a CMV-specific antigen, a HPV-specific antigen, a Lasse Virus-specific antigen, an Influenza Virus-specific antigen as well as any derivate or variant of these surface markers.
[00047] Preferably, the CAR is specific for BMC A, CAIX, CCR4, PD-L1, PD-L2, PD1, Glucocorticoid-Induced Tumor Necrosis Factor Receptors (GITR), Severe acute respiratory syndrome (SARS), influenza, flavivirus or Middle East Respiratory Syndrome (MERS).
[00048] In a preferred embodiment, said extracellular ligand-binding domain is a single chain antibody fragment (scFv) comprising the light (VL) and the heavy (VH) variable fragment of a target antigen specific monoclonal antibody joined by a flexible linker.
[00049] In a more preferred embodiment, said scFv antibody is specific for BMCA, CAIX, CCR4, PD-L1, PD-L2, PD1, GITR, SARS, influenza, flavivirus or MERS.
[00050] Exemplary antibodies useful in constructing the CAR according to the invention includes antibodies disclosed in for example: WO/2005/060520 , WO/2006/089141, WO/2007/065027, WO/2009/086514, WO/2009/079259, WO/2011/153380,
WO/2014/055897, WO 2015/143194, WO 2015/164865, WO 2013/166500, and WO 2014/144061; PCT/US2015/054202, PCT/US2015/054010 and 62/144,729 the contents of which are hereby incorporated by reference in their entireties.
[00051] PDL1 (68)
[00052] Exemplary anti-PDLl antibodies include antibodies having containing a VH nucleotide sequence having SEQ ID NO: 1485 and a VL nucleotide sequence having SEQ ID NO: 1487; a VH nucleotide sequence having SEQ ID NO: 1485 and a VL nucleotide sequence having SEQ ID NO: 1487; a VH nucleotide sequence having SEQ ID NO: 1489 and a VL nucleotide sequence having SEQ ID NO: 1491 ; a VH nucleotide sequence having SEQ ID NO: 1493 and a VL nucleotide sequence having SEQ ID NO: 1495; a VH nucleotide sequence having SEQ ID NO: 1497 and a VL nucleotide sequence having SEQ ID NO: 1499; a VH nucleotide sequence having SEQ ID NO: 1501 and a VL nucleotide sequence having SEQ ID NO: 1503; a VH nucleotide sequence having SEQ ID NO: 1505 and a VL nucleotide sequence having SEQ ID NO: 1507; a VH nucleotide sequence having SEQ ID NO: 1509 and a VL nucleotide sequence having SEQ ID NO: 1511 ; a VH nucleotide sequence having SEQ ID NO: 1513 and a VL nucleotide sequence having SEQ ID NO: 1515; a VH nucleotide sequence having SEQ ID NO: 1517 and a VL nucleotide sequence having SEQ ID NO: 1519; a VH nucleotide sequence having SEQ ID NO: 1521 and a VL nucleotide sequence having SEQ ID NO: 1523; a VH nucleotide sequence having SEQ ID NO: 1525 and a VL nucleotide sequence having SEQ ID NO: 1527; a VH nucleotide sequence having SEQ ID NO: 1529 and a VL nucleotide sequence having SEQ ID NO: 1531 ; a VH nucleotide sequence having SEQ ID NO: 1533 and a VL nucleotide sequence having SEQ ID NO: 1535; a VH nucleotide sequence having SEQ ID NO: 1537 and a VL nucleotide sequence having SEQ ID NO: 1539.
[00053] Exemplary anti-PDLl antibodies include antibodies having containing a VH amino acid sequence having SEQ ID NO: 970 and a VL amino acid sequence having SEQ ID NO: 971; a VH amino acid having SEQ ID NO: 1486 and a VL polypeptide sequence having SEQ ID NO: 1488 a VH amino acid having SEQ ID NO: 1490 and a VL polypeptide sequence having SEQ ID NO: 1492 a VH amino acid having SEQ ID NO: 1494 and a VL polypeptide sequence having SEQ ID NO: 1496 a VH amino acid having SEQ ID NO: 1498 and a VL polypeptide sequence having SEQ ID NO: 1500 a VH amino acid having SEQ ID NO: 1502 and a VL polypeptide sequence having SEQ ID NO: 1504 a VH amino acid having SEQ ID NO: 1506 and a VL polypeptide sequence having SEQ ID NO: 1508 a VH amino acid having SEQ ID NO: 1510 and a VL polypeptide sequence having SEQ ID NO: 1512 a VH amino acid having SEQ ID NO: 1514 and a VL polypeptide sequence having SEQ ID NO: 1516 a VH amino acid having SEQ ID NO: 1518 and a VL polypeptide sequence having SEQ ID NO: 1520 a VH amino acid having SEQ ID NO: 1522 and a VL polypeptide sequence having SEQ ID NO: 1524 a VH amino acid having SEQ ID NO: 1526 and a VL polypeptide sequence having SEQ ID NO: 1528 a VH amino acid having SEQ ID NO: 1530 and a VL polypeptide sequence having SEQ ID NO: 1532 a VH amino acid having SEQ ID NO: 1534 and a VL polypeptide sequence having SEQ ID NO: 1536 a VH amino acid having SEQ ID NO: 1538 and a VL polypeptide sequence having SEQ ID NO: 1540.
[00054] In other embodiments the anti-PDLl antibodies have a heavy chain with three CDRs including the amino acid sequences SEQ ID NO: 1541, 1554, 1569 respectively and a light chain with three CDRs including the amino acid sequences 1584, 1599, 1610 respectively; or a heavy chain with three CDRs comprising the amino acid sequences 1543,
1556, 1571 and a light chain with three CDRs comprising the amino acid sequences 1586,
1600, 1612; or a heavy chain with three CDRs comprising the amino acid sequences 1544,
1557, 1572 and a light chain with three CDRs comprising the amino acid sequences 1587,
1601, 1613; or a heavy chain with three CDRs comprising the amino acid sequences 1545, 1558, 1573 and a light chain with three CDRs comprising the amino acid sequences 1588,
1602, 1614; or a heavy chain with three CDRs comprising the amino acid sequences 1546,
1559, 1574 and a light chain with three CDRs comprising the amino acid sequences 1589,
1603, 1615; or a heavy chain with three CDRs comprising the amino acid sequences 1547,
1560, 1575 and a light chain with three CDRs comprising the amino acid sequences 1590,
1604, 1616; or a heavy chain with three CDRs comprising the amino acid sequences 1548,
1561, 1576 and a light chain with three CDRs comprising the amino acid sequences 1591,
1605, 1617; or a heavy chain with three CDRs comprising the amino acid sequences 1541,
1562, 1577 and a light chain with three CDRs comprising the amino acid sequences 1592, 1599, 1618; or a heavy chain with three CDRs comprising the amino acid sequences 1549,
1563, 1578 and a light chain with three CDRs comprising the amino acid sequences 1593,
1606, 1619; or a heavy chain with three CDRs comprising the amino acid sequences 1550,
1564, 1579 and a light chain with three CDRs comprising the amino acid sequences 1594,
1607, 1620; or a heavy chain with three CDRs comprising the amino acid sequences 1551,
1565, 1580 and a light chain with three CDRs comprising the amino acid sequences 1595, 1599, 1621; or a heavy chain with three CDRs comprising the amino acid sequences 1542,
1566, 1581 and a light chain with three CDRs comprising the amino acid sequences 1596, 1599, 1622; or a heavy chain with three CDRs comprising the amino acid sequences 1552,
1567, 1582 and a light chain with three CDRs comprising the amino acid sequences 1597,
1608, 1623; or a heavy chain with three CDRs comprising the amino acid sequences 1553,
1568, 1583 and a light chain with three CDRs comprising the amino acid sequences 1598, 1609 1624.
[00055] SARS (26)
[00056] Exemplary SARS neutralizing antibodies include antibodies having containing a VH nucleotide sequence having SEQ ID NO: 1626 and a VL nucleotide sequence having SEQ ID NO: 1628; a VH nucleotide sequence having SEQ ID NO: 1630 and a VL nucleotide sequence having SEQ ID NO: 1639; a VH nucleotide sequence having SEQ ID NO: 1634 and a VL nucleotide sequence having SEQ ID NO: 1640; a VH nucleotide sequence having SEQ ID NO: 1632 and a VL nucleotide sequence having SEQ ID NO: 1641 ; a VH nucleotide sequence having SEQ ID NO: 1633 and a VL nucleotide sequence having SEQ ID NO: 1642; a VH nucleotide sequence having SEQ ID NO: 1634 and a VL nucleotide sequence having SEQ ID NO: 1643; a VH nucleotide sequence having SEQ ID NO: 1635 and a VL nucleotide sequence having SEQ ID NO: 1644; a VH nucleotide sequence having SEQ ID NO: 1636 and a VL nucleotide sequence having SEQ ID NO: 1645; a VH nucleotide sequence having SEQ ID NO: 1637 and a VL nucleotide sequence having SEQ ID NO: 1646
[00057] CXCR4 (33)
[00058] Exemplary anti-CXCR4 antibody include antibodies having a VH amino acid sequence having SEQ ID NO: 771 and a VL amino acid sequence having SEQ ID NO: 779; a VH amino acid sequence having SEQ ID NO: 772 and a VL amino acid sequence having SEQ ID NO: 780; a VH amino acid sequence having SEQ ID NO: 773 and a VL amino acid sequence having SEQ ID NO: 781; a VH amino acid sequence having SEQ ID NO: 774 and a VL amino acid sequence having SEQ ID NO: 782; a VH amino acid sequence having SEQ ID NO: 775 and a VL amino acid sequence having SEQ ID NO: 783; a VH amino acid sequence having SEQ ID NO: 776 and a VL amino acid sequence having SEQ ID NO: 784; a VH amino acid sequence having SEQ ID NO: 777 and a VL amino acid sequence having SEQ ID NO: 785; or a VH amino acid sequence having SEQ ID NO: 778 and a VL amino acid sequence having SEQ ID NO: 786.
[00059] In other embodiments the anti-CXCR4 antibodies have a heavy chain with three CDRs including the amino acid sequences SEQ ID NO: 803, 804, 805 respectively and a light chain with three CDRs including the amino acid sequences 806, 807, 808 respectively; or a heavy chain with three CDRs comprising the amino acid sequences 809, 810, 811, respectively and a light chain with three CDRs comprising the amino acid sequences 812, 813, 814, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 815, 816, 817 respectively and a light chain with three CDRs comprising the amino acid sequences 818, 819, 820 respectively; or a heavy chain with three CDRs comprising the amino acid sequences 827, 828, 829 respectively and a light chain with three CDRs comprising the amino acid sequences 830, 831, 832 respectively; or a heavy chain with three CDRs comprising the amino acid sequences 833, 834, 835, respectively and a light chain with three CDRs comprising the amino acid sequences 836, 837, 838, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 839, 840, 841 respectively and a light chain with three CDRs comprising the amino acid sequences 842, 843, 844 respectively.
[00060] CARBONIC ANHYDRASE IX (40) [00061] Exemplary anti-CA IX antibodies include antibodies having containing a VH amino acid sequence having SEQ ID NO: 845 and a VL amino acid sequence having SEQ ID NO: 846; a VH amino acid sequence having SEQ ID NO: 847 and a VL amino acid sequence having SEQ ID NO: 868; a VH amino acid sequence having SEQ ID NO: 848 and a VL amino acid sequence having SEQ ID NO: 869; a VH amino acid sequence having SEQ ID NO: 849 and a VL amino acid sequence having SEQ ID NO: 870; a VH amino acid sequence having SEQ ID NO: 850 and a VL amino acid sequence having SEQ ID NO: 871; a VH amino acid sequence having SEQ ID NO: 851 and a VL amino acid sequence having SEQ ID NO: 872; a VH amino acid sequence having SEQ ID NO: 852 and a VL amino acid sequence having SEQ ID NO: 873; a VH amino acid sequence having SEQ ID NO: 853 and a VL amino acid sequence having SEQ ID NO: 874; a VH amino acid sequence having SEQ ID NO: 854 and a VL amino acid sequence having SEQ ID NO: 875; a VH amino acid sequence having SEQ ID NO: 855 and a VL amino acid sequence having SEQ ID NO: 876; a VH amino acid sequence having SEQ ID NO: 856 and a VL amino acid sequence having SEQ ID NO: 877; a VH amino acid sequence having SEQ ID NO: 857 and a VL amino acid sequence having SEQ ID NO: 878; a VH amino acid sequence having SEQ ID NO: 858 and a VL amino acid sequence having SEQ ID NO: 879; a VH amino acid sequence having SEQ ID NO: 859 and a VL amino acid sequence having SEQ ID NO: 880; a VH amino acid sequence having SEQ ID NO: 860 and a VL amino acid sequence having SEQ ID NO: 881 ; a VH amino acid sequence having SEQ ID NO: 861 and a VL amino acid sequence having SEQ ID NO: 882 a VH amino acid sequence having SEQ ID NO: 862 and a VL amino acid sequence having SEQ ID NO: 883; a VH amino acid sequence having SEQ ID NO: 863 and a VL amino acid sequence having SEQ ID NO: 884; a VH amino acid sequence having SEQ ID NO: 864 and a VL amino acid sequence having SEQ ID NO: 885; a VH amino acid sequence having SEQ ID NO: 865 and a VL amino acid sequence having SEQ ID NO: 886; a VH amino acid sequence having SEQ ID NO: 866 and a VL amino acid sequence having SEQ ID NO: 887; a VH amino acid sequence having SEQ ID NO: 867 and a VL amino acid sequence having SEQ ID NO: 888.
[00062] In other embodiments the anti-CA IX antibodies have a heavy chain with three CDRs including the amino acid sequences SEQ ID NO: 803, 804, 805 respectively and a light chain with three CDRs including the amino acid sequences 806, 807, 808 respectively; or a heavy chain with three CDRs comprising the amino acid sequences 899, 915, 909 and a light chain with three CDRs comprising the amino acid sequences 905, 906, 952 or a heavy chain with three CDRs comprising the amino acid sequences 899, 915, 909 and a light chain with three CDRs comprising the amino acid sequences 935, 943, 953 or a heavy chain with three CDRs comprising the amino acid sequences 899, 915, 909 and a light chain with three CDRs comprising the amino acid sequences 935, 906, 954 or a heavy chain with three CDRs comprising the amino acid sequences 910, 916, 923 and a light chain with three CDRs comprising the amino acid sequences 936, 944, 955 or a heavy chain with three CDRs comprising the amino acid sequences 899, 915, 909 and a light chain with three CDRs comprising the amino acid sequences 936, 944, 956 or a heavy chain with three CDRs comprising the amino acid sequences 911, 917, 924 and a light chain with three CDRs comprising the amino acid sequences 937, 945, 957 or a heavy chain with three CDRs comprising the amino acid sequences 899, 915, 909 and a light chain with three CDRs comprising the amino acid sequences 935, 946, 958 or a heavy chain with three CDRs comprising the amino acid sequences 899, 915, 909 and a light chain with three CDRs comprising the amino acid sequences 938, 946, 959 or a heavy chain with three CDRs comprising the amino acid sequences 899, 915, 909 and a light chain with three CDRs comprising the amino acid sequences 905, 946, 960 or a heavy chain with three CDRs comprising the amino acid sequences 899, 918, 925 and a light chain with three CDRs comprising the amino acid sequences 937, 947, 955 or a heavy chain with three CDRs comprising the amino acid sequences 899, 918, 926 and a light chain with three CDRs comprising the amino acid sequences 937, 945, 957 or a heavy chain with three CDRs comprising the amino acid sequences 912, 919, 927 and a light chain with three CDRs comprising the amino acid sequences 937, 943, 961 or a heavy chain with three CDRs comprising the amino acid sequences 899, 918, 928 and a light chain with three CDRs comprising the amino acid sequences 937, 906, 960 or a heavy chain with three CDRs comprising the amino acid sequences 899, 918, 928 and a light chain with three CDRs comprising the amino acid sequences 937, 906, 960 or a heavy chain with three CDRs comprising the amino acid sequences 913, 920, 929 and a light chain with three CDRs comprising the amino acid sequences 939, 948, 962 or a heavy chain with three CDRs comprising the amino acid sequences 899, 918, 930 and a light chain with three CDRs comprising the amino acid sequences 935, 944, 955 or a heavy chain with three CDRs comprising the amino acid sequences 899, 921, 931 and a light chain with three CDRs comprising the amino acid sequences 935, 944, 955 or a heavy chain with three CDRs comprising the amino acid sequences 912, 919 ,932 and a light chain with three CDRs comprising the amino acid sequences 940, 949, 963 or a heavy chain with three CDRs comprising the amino acid sequences 899, 915, 909 and a light chain with three CDRs comprising the amino acid sequences 935, 943, 960 or a heavy chain with three CDRs comprising the amino acid sequences 914, 922, 933 and a light chain with three CDRs comprising the amino acid sequences 941, 950, 964 or a heavy chain with three CDRs comprising the amino acid sequences 912, 918, 934 and a light chain with three CDRs comprising the amino acid sequences 942, 951, 965.
[00063] CC-CHEMOKINE RECEPTOR 4 (CCR4) (048)
[00064] Exemplary CC-chemokine receptor 4 (CCR4) antibodies include antibodies having containing a VH nucleotide sequence having SEQ ID NO: 969 and a VL nucleotide sequence having SEQ ID NO: 971 ; a VH nucleotide sequence having SEQ ID NO: 969 and a VL nucleotide sequence having SEQ ID NO: 972.
[00065] Exemplary CCR4 antibodies include antibodies having containing a VH amino acid sequence having SEQ ID NO: 970 and a VL amino acid sequence having SEQ ID NO: 971.
[00066] In other embodiments the CCR4 antibodies have a heavy chain with three CDRs including the amino acid sequences SEQ ID NO: 973, 974, 975 respectively and a light chain with three CDRs including the amino acid sequences 976, 977, 978 respectively.
[00067] MIDDLE EAST RESPIRATORY SYNDROME CORONAVIRUS (MERS-COV). (85)
[00068] Exemplary anti-Middle East Respiratory Syndrome coronavirus (MERS-CoV) antibody include antibodies having a VH nucleotide sequence having SEQ ID NO: 677and a VL nucleotide sequence having SEQ ID NO:679; a VH nucleotide sequence having SEQ ID NO: 681and a VL nucleotide sequence having SEQ ID NO:683; a VH nucleotide sequence having SEQ ID NO: 685and a VL nucleotide sequence having SEQ ID NO:687; a VH nucleotide sequence having SEQ ID NO: 689and a VL nucleotide sequence having SEQ ID NO:692; a VH nucleotide sequence having SEQ ID NO: 693and a VL nucleotide sequence having SEQ ID NO: 695; a VH nucleotide sequence having SEQ ID NO: 697and a VL nucleotide sequence having SEQ ID NO:699; and a VH nucleotide sequence having SEQ ID NO: 701and a VL nucleotide sequence having SEQ ID NO:703. [00069] Exemplary anti-Middle East Respiratory Syndrome coronavirus (MERS-CoV) antibody include antibodies having a VH amino acid sequence SEQ ID NO: 678 and a VL amino acid sequence having SEQ ID NO: 680; a VH amino acid sequence SEQ ID NO: 682 and a VL amino acid sequence having SEQ ID NO: 684; a VH amino acid sequence SEQ ID NO: 686 and a VL amino acid sequence having SEQ ID NO: 688; a VH amino acid sequence SEQ ID NO: 690 and a VL amino acid sequence having SEQ ID NO: 692; a VH amino acid sequence SEQ ID NO: 694 and a VL amino acid sequence having SEQ ID NO: 696; a VH amino acid sequence SEQ ID NO: 698 and a VL amino acid sequence having SEQ ID NO: 700; and a VH amino acid sequence SEQ ID NO: 702 and a VL amino acid sequence having SEQ ID NO: 704.
[00070] In other embodiments the anti-Middle East Respiratory Syndrome coronavirus (MERS-CoV) antibody has a heavy chain with three CDRs including the amino acid sequences of 705, 706, and 707 and a light chain with three CDRs including the amino acid sequences 722, 723, and 724; a heavy chain with three CDRs including the amino acid sequences of 708, 709, and 710 and a light chain with three CDRs including the amino acid sequences 725, 726, and 727; a heavy chain with three CDRs including the amino acid sequences of 711, 712, and 713 and a light chain with three CDRs including the amino acid sequences 728, 729, and 730; a heavy chain with three CDRs including the amino acid sequences of 711, 735, and 715 and a light chain with three CDRs including the amino acid sequences 731, 732, and 733; a heavy chain with three CDRs including the amino acid sequences of 711, 735, and 716 and a light chain with three CDRs including the amino acid sequences 737, 738, and 739; a heavy chain with three CDRs including the amino acid sequences of 717, 718, and 719 and a light chain with three CDRs including the amino acid sequences 736, 742, and 743; and a heavy chain with three CDRs including the amino acid sequences of 714, 720, and 721 and a light chain with three CDRs including the amino acid sequences 740, 729, and 741.
[00071] GITR (93)
[00072] Exemplary anti-human GITR antibody include antibodies having a VH nucleotide sequence having SEQ ID NO: 1361 and a VL nucleotide sequence having SEQ ID NO: 1363; a VH nucleotide sequence having SEQ ID NO: 1365 and a VL nucleotide sequence having SEQ ID NO: 1367; a VH nucleotide sequence having SEQ ID NO: 1369 and a VL nucleotide sequence having SEQ ID NO: 1371 ; a VH nucleotide sequence having SEQ ID NO: 1381 and a VL nucleotide sequence having SEQ ID NO: 1375; a VH nucleotide sequence having SEQ ID NO: 1377 and a VL nucleotide sequence having SEQ ID NO: 1379; a VH nucleotide sequence having SEQ ID NO: 1381 and a VL nucleotide sequence having SEQ ID NO: 1383; a VH nucleotide sequence having SEQ ID NO: 1385 and a VL nucleotide sequence having SEQ ID NO: 1387; a VH nucleotide sequence having SEQ ID NO: 1389 and a VL nucleotide sequence having SEQ ID NO: 1391; a VH nucleotide sequence having SEQ ID NO: 1393 and a VL nucleotide sequence having SEQ ID NO: 1395; a VH nucleotide sequence having SEQ ID NO: 1397 and a VL nucleotide sequence having SEQ ID NO: 1398; or a VH nucleotide sequence having SEQ ID NO: 1401and a VL nucleotide sequence having SEQ ID NO: 1403.
[00073] Exemplary anti-human GITR antibody include antibodies having a VH amino acid sequence having SEQ ID NO: 1362 and a VL amino acid sequence having SEQ ID NO: 1364; a VH amino acid having SEQ ID NO: 1366 and a VL polypeptide sequence having SEQ ID NO: 1368; a VH amino acid sequence having SEQ ID NO: 1371 and a VL amino acid sequence having SEQ ID NO: 1372; a VH amino acid sequence having SEQ ID NO: 1382 and a VL amino acid sequence having SEQ ID NO: 1376; a VH nucleotide sequence having SEQ ID NO: 1378 and a VL nucleotide sequence having SEQ ID NO: 1380; a VH amino acid having SEQ ID NO: 1382 and a VL polypeptide sequence having SEQ ID NO: 1384; a VH amino acid sequence having SEQ ID NO: 1386 and a VL amino acid sequence having SEQ ID NO: 1388; a VH amino acid sequence having SEQ ID NO: 1390 and a VL amino acid sequence having SEQ ID NO: 1392; a VH amino acid having SEQ ID NO: 1394 and a VL polypeptide sequence having SEQ ID NO: 1396; a VH amino acid sequence having SEQ ID NO: 1399 and a VL amino acid sequence having SEQ ID NO: 1400; or a VH amino acid sequence having SEQ ID NO: 1402 and a VL amino acid sequence having SEQ ID NO: 1404.
[00074] In other embodiments the anti-human GITR antibody has a heavy chain with three CDRs including the amino acid sequences 1405, 1406, and 1407 and a light chain with three CDRs including the amino acid sequencesl408, 1409, and 1410 respectively; a heavy chain with three CDRs including the amino acid sequences 1411, 1412, and 1413 and a light chain with three CDRs including the amino acid sequences 1414, 1415, and 1416 respectively; a heavy chain with three CDRs including the amino acid sequences 1417, 1418, and 1419 and a light chain with three CDRs including the amino acid sequences 1420, 1421, and 1422 respectively; a heavy chain with three CDRs including the amino acid sequences 1423, 1424, and 1425 and a light chain with three CDRs including the amino acid sequences 1426, 1427, and 1428 respectively; a heavy chain with three CDRs including the amino acid sequences 1429, 1430, and 1431 and a light chain with three CDRs including the amino acid sequences 1432, 1433, and 1434 respectively; a heavy chain with three CDRs including the amino acid sequences 1435, 1436, and 1437 and a light chain with three CDRs including the amino acid sequencesl438, 1439, and 1440 respectively; a heavy chain with three CDRs including the amino acid sequences 1441, 1442, and 1443 and a light chain with three CDRs including the amino acid sequences 1444, 1445, and 1446 respectively; a heavy chain with three CDRs including the amino acid sequences 1447, 1448, and 1449 and a light chain with three CDRs including the amino acid sequences 1450, 1451, and 1452 respectively; a heavy chain with three CDRs including the amino acid sequences 1453, 1454, and 1455 and a light chain with three CDRs including the amino acid sequencesl456, 1457, and 1458 respectively; a heavy chain with three CDRs including the amino acid sequences 1459, 1460, and 1461 and a light chain with three CDRs including the amino acid sequences 1462, 1463, and 1464 respectively; or a heavy chain with three CDRs including the amino acid sequences 1465, 1466, and 1467 and a light chain with three CDRs including the amino acid sequences 1468, 1469, and 1470 respectively.
[00075] FLAVIVIRUS (73)
[00076] Exemplary anti-West Nile virus envelope protein E (WNE) antibody include antibodies having a VH nucleotide sequence having a VH amino acid sequence having SEQ ID NO: 1224 and a VL amino acid sequence having SEQ ID NO: 1226.
[00077] Exemplary anti-West Nile virus envelope protein E (WNE) antibody include antibodies having a VH nucleotide sequence having SEQ ID NO: 1225 and a VL nucleotide sequence having SEQ ID NO: 1227.
[00078] In other embodiments the anti-West Nile virus envelope protein E (WNE) antibody has a heavy chain with three CDRs including the amino acid sequences 1244, 1245, and 1246 and a light chain with three CDRs including the amino acid sequences 1247, 1248, and 1249 respectively.
[00079] CCR4 (65)
[00080] Exemplary anti-CC-chemokine receptor 4 (CCR4) antibody include antibodies having a VH nucleotide sequence having SEQ ID NO: 1329 and a VL nucleotide sequence having SEQ ID NO: 1331; a VH nucleotide sequence having SEQ ID NO: 1333 and a VL nucleotide sequence having SEQ ID NO: 1335; a VH nucleotide sequence having SEQ ID NO: 1337 and a VL nucleotide sequence having SEQ ID NO: 1192; a VH nucleotide sequence having SEQ ID NO: 1341 and a VL nucleotide sequence having SEQ ID NO: 1343; or a VH nucleotide sequence having SEQ ID NO: 1357 and a VL nucleotide sequence having SEQ ID NO: 1359.
[00081] Exemplary anti-CC-chemokine receptor 4 (CCR4) antibody include antibodies having a VH amino acid sequence having SEQ ID NO: 1330 and a VL amino acid sequence having SEQ ID NO: 1332; a VH amino acid sequence having SEQ ID NO: 1334 and a VL amino acid sequence having SEQ ID NO: 1336; a VH amino acid sequence having SEQ ID NO: 1338 and a VL amino acid sequence having SEQ ID NO: 1340; a VH amino acid sequence having SEQ ID NO: 1342 and a VL amino acid sequence having SEQ ID NO: 1344; or a VH amino acid sequence having SEQ ID NO: 1358 and a VL amino acid sequence having SEQ ID NO: 1360.
[00082] In other embodiments the anti-CC-chemokine receptor 4 (CCR4) antibody has a heavy chain with three CDRs including the amino acid sequences 1203, 1208, and 1211 and a light chain with three CDRs including the amino acid sequences 1207, 1209, and 1216 respectively; or a heavy chain with three CDRs including the amino acid sequences 1204, 1208, and 1212 and a light chain with three CDRs including the amino acid sequences
1207, 1209, and 1217 respectively; or a heavy chain with three CDRs including the amino acid sequences 1204, 1208, and 1213 and a light chain with three CDRs including the amino acid sequences 1207, 1209, and 1217 respectively; or a heavy chain with three CDRs including the amino acid sequences 1205, 1208, and 1214 and a light chain with three CDRs including the amino acid sequences 1207, 1209, and 1218 respectively; or a heavy chain with three CDRs including the amino acid sequences 1206, 1208, and 1210 and a light chain with three CDRs including the amino acid sequences 1207, 1209, and 1220 respectively; or a heavy chain with three CDRs including the amino acid sequences 1202,
1208, and 1210 and a light chain with three CDRs including the amino acid sequences 1207, 1209, and 1219 respectively. [00083] HUMAN IMMUNOGLOBULIN HEAVY CHAIN VARIABLE REGION GERMLINE GENE
VHl-69 (57)
[00084] Exemplary anti-human immunoglobulin heavy chain variable region germline gene VHl-69 antibody include antibodies having a VH nucleotide sequence having SEQ ID NO: 1153 and a VL nucleotide sequence having SEQ ID NO: 1155; or a VH nucleotide sequence having SEQ ID NO: 1163 and a VL nucleotide sequence having SEQ ID
NO: 1155.
[00085] Exemplary anti-human immunoglobulin heavy chain variable region germline gene VHl-69 antibody include antibodies having a VH amino acid sequence having SEQ ID NO: 1154 and a VL amino acid sequence having SEQ ID NO: 1156; or a VH amino acid sequence having SEQ ID NO: 1164 and a VL amino acid sequence having SEQ ID NO: 1156.
[00086] In other embodiments the anti-human immunoglobulin heavy chain variable region germline gene VHl-69 antibody has a heavy chain with three CDRs including the amino acid sequences 1157, 1158, and 1159 and a light chain with three CDRs including the amino acid sequences 1160, 1161, and 1162 respectively.
[00087] INFLUENZA (49)
[00088] Exemplary anti-influenza antibody include antibodies having a VH nucleotide sequence having SEQ ID NO: 981 and a VL nucleotide sequence having SEQ ID NO: 983; a VH nucleotide sequence having SEQ ID NO: 985 and a VL nucleotide sequence having SEQ ID NO: 989; a VH nucleotide sequence having SEQ ID NO: 987 and a VL nucleotide sequence having SEQ ID NO: 991; a VH nucleotide sequence having SEQ ID NO: 993 and a VL nucleotide sequence having SEQ ID NO: 997; a VH nucleotide sequence having SEQ ID NO: 995 and a VK nucleotide sequence having SEQ ID NO: 999; a VH nucleotide sequence having SEQ ID NO: 1001 and a VL nucleotide sequence having SEQ ID NO: 1005; a VH nucleotide sequence having SEQ ID NO: 1003 and a VL nucleotide sequence having SEQ ID NO: 1007; a VH nucleotide sequence having SEQ ID NO: 1009 and a VL nucleotide sequence having SEQ ID NO: 1011 ; a VH nucleotide sequence having SEQ ID NO: 1013 and a VL nucleotide sequence having SEQ ID NO: 1015; and a VH nucleotide sequence having SEQ ID NO: 1017 and a VK nucleotide sequence having SEQ ID NO: 1019; a VH nucleotide sequence having SEQ ID NO: 1020 and a VL nucleotide sequence having SEQ ID NO: 1022. [00089] Exemplary anti-influenza antibody include antibodies having a VH amino acid sequence having SEQ ID NO: 982 and a VL amino acid sequence having SEQ ID NO: 984; a VH amino acid sequence having SEQ ID NO: 986 and a VL amino acid sequence having SEQ ID NO: 988; a VH amino acid sequence having SEQ ID NO: 986 and a VL amino acid sequence having SEQ ID NO: 990; a VH amino acid sequence having SEQ ID NO: 992 and a VL amino acid sequence having SEQ ID NO: 994; a VH amino acid sequence having SEQ ID NO: 992 and a VK amino acid sequence having SEQ ID NO: 996; a VH amino acid sequence having SEQ ID NO: 998 and a VL amino acid sequence having SEQ ID NO: 1000; a VH amino acid sequence having SEQ ID NO: 998 and a VL amino acid sequence having SEQ ID NO: 1002; a VH amino acid sequence having SEQ ID NO: 1004 and a VL amino acid sequence having SEQ ID NO: 1006; a VH amino acid sequence having SEQ ID NO: 1008 and a VL amino acid sequence having SEQ ID NO: 1010; a VH amino acid sequence having SEQ ID NO: 1012 and a VK amino acid sequence having SEQ ID NO: 1014; and a VH amino acid sequence having SEQ ID NO: 1016 and a VL amino acid sequence having SEQ ID NO: 1018.
[00090] In other embodiments the anti-influenza antibody has a heavy chain with three CDRs including the amino acid sequences of 1023, 1031, and 1039 and a light chain with three CDRs including the amino acid sequences 1047, 1059, and 1071 ; a heavy chain with three CDRs including the amino acid sequences of 1023, 1032, and 1040 and a light chain with three CDRs including the amino acid sequences 1048, 1060, and 1072; a heavy chain with three CDRs including the amino acid sequences of 1025, 1032, and 1040 and a light chain with three CDRs including the amino acid sequences 1057, 1069, and 1081 ; a heavy chain with three CDRs including the amino acid sequences of 1026, 1033, and 1041 and a light chain with three CDRs including the amino acid sequences 1049, 1061, and 1073; a heavy chain with three CDRs including the amino acid sequences of 1026, 1033, and 1041 and a light chain with three CDRs including the amino acid sequences 1054, 1066, and 1078; a heavy chain with three CDRs including the amino acid sequences of 1027, 1034, and 1042 and a light chain with three CDRs including the amino acid sequences 1050, 1062, and 1074; a heavy chain with three CDRs including the amino acid sequences of 1027, 1034, and 1042 and a light chain with three CDRs including the amino acid sequences 1056, 1068, and 1080; a heavy chain with three CDRs including the amino acid sequences of 1028, 1035, and 1043 and a light chain with three CDRs including the amino acid sequences 1051, 1063, and 1065; a heavy chain with three CDRs including the amino acid sequences of 1028, 1036, and 1044 and a light chain with three CDRs including the amino acid sequences 1052, 1064, and 1076; a heavy chain with three CDRs including the amino acid sequences of 1029, 1037, and 1045 and a light chain with three CDRs including the amino acid sequences 1053, 1065, and 1077; or a heavy chain with three CDRs including the amino acid sequences of 1030, 1038, and 1046 and a light chain with three CDRs including the amino acid sequences 1058, 1070, and 1082.
[00091]
[00092] Influenza (78)
[00093] Exemplary anti-influenza antibodies include antibodies having containing a VH nucleotide sequence having SEQ ID NO: 397 and a VL nucleotide sequence having SEQ ID NO: 398; a VH nucleotide sequence having SEQ ID NO: 399 and a VL nucleotide sequence having SEQ ID NO:400; a VH nucleotide sequence having SEQ ID NO: 401 and a VL nucleotide sequence having SEQ ID NO: 402; a VH nucleotide sequence having SEQ ID NO: 403 and a VL nucleotide sequence having SEQ ID NO: 404; or a VH nucleotide sequence having SEQ ID NO: 405 and a VL nucleotide sequence having SEQ ID NO:406; or a VH nucleotide sequence having SEQ ID NO: 407 and a VL nucleotide sequence having SEQ ID NO:408; or a VH nucleotide sequence having SEQ ID NO: 409 and a VL nucleotide sequence having SEQ ID NO:410; or a VH nucleotide sequence having SEQ ID NO: 411 and a VL nucleotide sequence having SEQ ID NO:412; or a VH nucleotide sequence having SEQ ID NO: 413 and a VL nucleotide sequence having SEQ ID NO:414; or a VH nucleotide sequence having SEQ ID NO: 415 and a VL nucleotide sequence having SEQ ID NO:416; or a VH nucleotide sequence having SEQ ID NO: 417 and a VL nucleotide sequence having SEQ ID NO:418; or a VH nucleotide sequence having SEQ ID NO: 419 and a VL nucleotide sequence having SEQ ID NO:420;or a VH nucleotide sequence having SEQ ID NO: 421 and a VL nucleotide sequence having SEQ ID NO:422; or a VH nucleotide sequence having SEQ ID NO: 423 and a VL nucleotide sequence having SEQ ID NO: 424; or a VH nucleotide sequence having SEQ ID NO: 425 and a VL nucleotide sequence having SEQ ID NO:426; or a VH nucleotide sequence having SEQ ID NO: 427 and a VL nucleotide sequence having SEQ ID NO:428; or a VH nucleotide sequence having SEQ ID NO: 429 and a VL nucleotide sequence having SEQ ID NO:430; or a VH nucleotide sequence having SEQ ID NO: 431 and a VL nucleotide sequence having SEQ ID NO:432; or a VH nucleotide sequence having SEQ ID NO: 433 and a VL nucleotide sequence having SEQ ID NO:434; or a VH nucleotide sequence having SEQ ID NO: 435 and a VL nucleotide sequence having SEQ ID NO:436; or a VH nucleotide sequence having SEQ ID NO: 437 and a VL nucleotide sequence having SEQ ID NO:438; or a VH nucleotide sequence having SEQ ID NO: 439 and a VL nucleotide sequence having SEQ ID NO:440; or a VH nucleotide sequence having SEQ ID NO: 441 and a VL nucleotide sequence having SEQ ID NO:442; ; or a VH nucleotide sequence having SEQ ID NO: 541 and a VL nucleotide sequence having SEQ ID NO: 542 ; or a VH nucleotide sequence having SEQ ID NO: 543 and a VL nucleotide sequence having SEQ ID NO: 544 ; or a VH nucleotide sequence having SEQ ID NO: 545 and a VL nucleotide sequence having SEQ ID NO: 546 ; or a VH nucleotide sequence having SEQ ID NO: 547 and a VL nucleotide sequence having SEQ ID NO: 548 ; or a VH nucleotide sequence having SEQ ID NO: 549 and a VL nucleotide sequence having SEQ ID NO: 550 ; or a VH nucleotide sequence having SEQ ID NO: 551 and a VL nucleotide sequence having SEQ ID NO: 552 ; or a VH nucleotide sequence having SEQ ID NO: 553 and a VL nucleotide sequence having SEQ ID NO: 554 ; or a VH nucleotide sequence having SEQ ID NO: 555 and a VL nucleotide sequence having SEQ ID NO: 556 ; or a VH nucleotide sequence having SEQ ID NO: 557 and a VL nucleotide sequence having SEQ ID NO: 558 ; or a VH nucleotide sequence having SEQ ID NO: 559 and a VL nucleotide sequence having SEQ ID NO: 560 ; or a VH nucleotide sequence having SEQ ID NO: 561 and a VL nucleotide sequence having SEQ ID NO: 562 ; or a VH nucleotide sequence having SEQ ID NO: 563 and a VL nucleotide sequence having SEQ ID NO: 564 ; or a VH nucleotide sequence having SEQ ID NO: 565 and a VL nucleotide sequence having SEQ ID NO: 566 ; or a VH nucleotide sequence having SEQ ID NO: 567 and a VL nucleotide sequence having SEQ ID NO: 568 ; or a VH nucleotide sequence having SEQ ID NO: 569 and a VL nucleotide sequence having SEQ ID NO: 570 ; or a VH nucleotide sequence having SEQ ID NO: 571 and a VL nucleotide sequence having SEQ ID NO: 572 ; or a VH nucleotide sequence having SEQ ID NO: 573 and a VL nucleotide sequence having SEQ ID NO: 574 ; or a VH nucleotide sequence having SEQ ID NO: 575 and a VL nucleotide sequence having SEQ ID NO: 576 ; or a VH nucleotide sequence having SEQ ID NO: 577 and a VL nucleotide sequence having SEQ ID NO: 578 ; or a VH nucleotide sequence having SEQ ID NO: 579 and a VL nucleotide sequence having SEQ ID NO: 580 ; or a VH nucleotide sequence having SEQ ID NO: 581 and a VL nucleotide sequence having SEQ ID NO: 582 ; or a VH nucleotide sequence having SEQ ID NO: 583 and a VL nucleotide sequence having SEQ ID NO: 584 ; or a VH nucleotide sequence having SEQ ID NO: 585 and a VL nucleotide sequence having SEQ ID NO: 586 ; or a VH nucleotide sequence having SEQ ID NO: 587 and a VL nucleotide sequence having SEQ ID NO: 588 ; or a VH nucleotide sequence having SEQ ID NO: 589 and a VL nucleotide sequence having SEQ ID NO: 590 ; or a VH nucleotide sequence having SEQ ID NO: 591 and a VL nucleotide sequence having SEQ ID NO: 592 ; or a VH nucleotide sequence having SEQ ID NO: 593 and a VL nucleotide sequence having SEQ ID NO: 594 ; or a VH nucleotide sequence having SEQ ID NO: 595 and a VL nucleotide sequence having SEQ ID NO: 596 ; or a VH nucleotide sequence having SEQ ID NO: 597 and a VL nucleotide sequence having SEQ ID NO: 598 ; or a VH nucleotide sequence having SEQ ID NO: 599 and a VL nucleotide sequence having SEQ ID NO: 600.
[00094] Exemplary anti-influenza antibodies antibody include antibodies having containing a VH amino acid sequence having SEQ ID NO: 469 and a VL amino acid sequence having SEQ ID NO: 470; a VH amino acid having SEQ ID NO: 471 and a VL polypeptide sequence having SEQ ID NO:472; a VH amino acid sequence having SEQ ID NO: 473 and a VL amino acid sequence having SEQ ID NO: 474; a VH amino acid sequence having SEQ ID NO: 475 and a VL amino acid sequence having SEQ ID NO: 476; or a VH nucleotide sequence having SEQ ID NO: 477 and a VL nucleotide sequence having SEQ ID NO:478; a VH amino acid sequence having SEQ ID NO: 479 and a VL amino acid sequence having SEQ ID NO: 480; a VH amino acid sequence having SEQ ID NO: 481 and a VL amino acid sequence having SEQ ID NO: 482; a VH amino acid sequence having SEQ ID NO: 483 and a VL amino acid sequence having SEQ ID NO: 484; a VH amino acid sequence having SEQ ID NO: 485 and a VL amino acid sequence having SEQ ID NO: 486; a VH amino acid sequence having SEQ ID NO: 487 and a VL amino acid sequence having SEQ ID NO: 488; a VH amino acid sequence having SEQ ID NO: 489 and a VL amino acid sequence having SEQ ID NO: 490; a VH amino acid sequence having SEQ ID NO: 491 and a VL amino acid sequence having SEQ ID NO: 492; a VH amino acid sequence having SEQ ID NO: 493 and a VL amino acid sequence having SEQ ID NO: 494; a VH amino acid sequence having SEQ ID NO: 495 and a VL amino acid sequence having SEQ ID NO: 496; a VH amino acid sequence having SEQ ID NO: 497 and a VL amino acid sequence having SEQ ID NO: 498; a VH amino acid sequence having SEQ ID NO: 499 and a VL amino acid sequence having SEQ ID NO: 500; a VH amino acid sequence having SEQ ID NO: 501 and a VL amino acid sequence having SEQ ID NO: 502; a VH amino acid sequence having SEQ ID NO: 503 and a VL amino acid sequence having SEQ ID NO: 504; a VH amino acid sequence having SEQ ID NO: 505 and a VL amino acid sequence having SEQ ID NO: 506; a VH amino acid sequence having SEQ ID NO: 507 and a VL amino acid sequence having SEQ ID NO: 508; a VH amino acid sequence having SEQ ID NO: 509 and a VL amino acid sequence having SEQ ID NO: 510; a VH amino acid sequence having SEQ ID NO: 511 and a VL amino acid sequence having SEQ ID NO: 512; a VH amino acid sequence having SEQ ID NO: 513 and a VL amino acid sequence having SEQ ID NO: 514; a VH amino acid sequence having SEQ ID NO: 515 and a VL amino acid sequence having SEQ ID NO: 516; a VH amino acid sequence having SEQ ID NO: 517 and a VL amino acid sequence having SEQ ID NO: 518; a VH amino acid sequence having SEQ ID NO: 519 and a VL amino acid sequence having SEQ ID NO: 520; a VH amino acid sequence having SEQ ID NO: 521 and a VL amino acid sequence having SEQ ID NO: 522; a VH amino acid sequence having SEQ ID NO: 523 and a VL amino acid sequence having SEQ ID NO: 524; a VH amino acid sequence having SEQ ID NO: 525 and a VL amino acid sequence having SEQ ID NO: 526; a VH amino acid sequence having SEQ ID NO: 527 and a VL amino acid sequence having SEQ ID NO: 528; a VH amino acid sequence having SEQ ID NO: 529 and a VL amino acid sequence having SEQ ID NO: 530; a VH amino acid sequence having SEQ ID NO: 531 and a VL amino acid sequence having SEQ ID NO: 532; a VH amino acid sequence having SEQ ID NO: 533 and a VL amino acid sequence having SEQ ID NO: 534; a VH amino acid sequence having SEQ ID NO: 535 and a VL amino acid sequence having SEQ ID NO: 536; a VH amino acid sequence having SEQ ID NO: 537 and a VL amino acid sequence having SEQ ID NO: 538; a VH amino acid sequence having SEQ ID NO: 539 and a VL amino acid sequence having SEQ ID NO: 540 a VH amino acid sequence having SEQ ID NO: 601 and a VL amino acid sequence having SEQ ID NO: 602 a VH amino acid sequence having SEQ ID NO: 603 and a VL amino acid sequence having SEQ ID NO: 604 a VH amino acid sequence having SEQ ID NO: 605 and a VL amino acid sequence having SEQ ID NO: 606 a VH amino acid sequence having SEQ ID NO: 607 and a VL amino acid sequence having SEQ ID NO: 608 a VH amino acid sequence having SEQ ID NO: 609 and a VL amino acid sequence having SEQ ID NO: 610 a VH amino acid sequence having SEQ ID NO: 611 and a VL amino acid sequence having SEQ ID NO: 612 a VH amino acid sequence having SEQ ID NO: 613 and a VL amino acid sequence having SEQ ID NO: 614 a VH amino acid sequence having SEQ ID NO: 615 and a VL amino acid sequence having SEQ ID NO: 616 a VH amino acid sequence having SEQ ID NO: 617 and a VL amino acid sequence having SEQ ID NO: 618 a VH amino acid sequence having SEQ ID NO: 619 and a VL amino acid sequence having SEQ ID NO: 620 a VH amino acid sequence having SEQ ID NO: 621 and a VL amino acid sequence having SEQ ID NO: 622 a VH amino acid sequence having SEQ ID NO: 623 and a VL amino acid sequence having SEQ ID NO: 624 a VH amino acid sequence having SEQ ID NO: 625 and a VL amino acid sequence having SEQ ID NO: 626 a VH amino acid sequence having SEQ ID NO: 627 and a VL amino acid sequence having SEQ ID NO: 628 a VH amino acid sequence having SEQ ID NO: 629 and a VL amino acid sequence having SEQ ID NO: 630 a VH amino acid sequence having SEQ ID NO: 631 and a VL amino acid sequence having SEQ ID NO: 632 a VH amino acid sequence having SEQ ID NO: 633 and a VL amino acid sequence having SEQ ID NO: 634 a VH amino acid sequence having SEQ ID NO: 635 and a VL amino acid sequence having SEQ ID NO: 636 a VH amino acid sequence having SEQ ID NO: 637 and a VL amino acid sequence having SEQ ID NO: 638 a VH amino acid sequence having SEQ ID NO: 639 and a VL amino acid sequence having SEQ ID NO: 640 a VH amino acid sequence having SEQ ID NO: 641 and a VL amino acid sequence having SEQ ID NO: 642 a VH amino acid sequence having SEQ ID NO: 643 and a VL amino acid sequence having SEQ ID NO: 644 a VH amino acid sequence having SEQ ID NO: 645 and a VL amino acid sequence having SEQ ID NO: 646 a VH amino acid sequence having SEQ ID NO: 647 and a VL amino acid sequence having SEQ ID NO: 648 a VH amino acid sequence having SEQ ID NO: 649 and a VL amino acid sequence having SEQ ID NO: 650 a VH amino acid sequence having SEQ ID NO: 651 and a VL amino acid sequence having SEQ ID NO: 652 a VH amino acid sequence having SEQ ID NO: 653 and a VL amino acid sequence having SEQ ID NO: 654 a VH amino acid sequence having SEQ ID NO: 655 and a VL amino acid sequence having SEQ ID NO: 656 a VH amino acid sequence having SEQ ID NO: 657 and a VL amino acid sequence having SEQ ID NO: 658 a VH amino acid sequence having SEQ ID NO: 659 and a VL amino acid sequence having SEQ ID NO: 660.
[00095] In other embodiments the anti-influenza antibodies antibody has a heavy chain with three CDRs including the amino acid sequences SEQ ID NO: 1, 37, 73 respectively and a light chain with three CDRs including the amino acid sequences 109, 145, 181 respectively; or a heavy chain with three CDRs comprising the amino acid sequences 2, 38, 74 respectively and a light chain with three CDRs comprising the amino acid sequences 110, 146, 182, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 3, 39, 75 respectively and a light chain with three CDRs comprising the amino acid sequences 111, 147, 183, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 4, 40, 76 respectively and a light chain with three CDRs comprising the amino acid sequences 112, 148, 184, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 5, 41, 77 respectively and a light chain with three CDRs comprising the amino acid sequences 113, 149, 185, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 6, 42, 78 respectively and a light chain with three CDRs comprising the amino acid sequences 114, 150, 186, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 7, 43, 79 respectively and a light chain with three CDRs comprising the amino acid sequences 115, 151, 187, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 8, 44, 80 respectively and a light chain with three CDRs comprising the amino acid sequences 116, 152, 188, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 9, 45, 81 respectively and a light chain with three CDRs comprising the amino acid sequences 117, 153, 189, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 10, 46, 82 respectively and a light chain with three CDRs comprising the amino acid sequences 118, 154, 190, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 11, 47, 83 respectively and a light chain with three CDRs comprising the amino acid sequences 119, 155, 191, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 12, 48, 84 respectively and a light chain with three CDRs comprising the amino acid sequences 120, 156, 192, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 13, 49, 85 respectively and a light chain with three CDRs comprising the amino acid sequences 121, 157, 193, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 14, 50, 86 respectively and a light chain with three CDRs comprising the amino acid sequences 122, 158, 194, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 15, 51, 87 respectively and a light chain with three CDRs comprising the amino acid sequences 123, 159, 195, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 16, 52, 88 respectively and a light chain with three CDRs comprising the amino acid sequences 124, 160, 196, respectively; ; or a heavy chain with three CDRs comprising the amino acid sequences 17, 53, 89 respectively and a light chain with three CDRs comprising the amino acid sequences 125, 161, 197, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 18, 54, 90 respectively and a light chain with three CDRs comprising the amino acid sequences 126, 162, 198, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 19, 55, 91 respectively and a light chain with three CDRs comprising the amino acid sequences 127, 163, 199, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 20, 56, 92 respectively and a light chain with three CDRs comprising the amino acid sequences 128, 164, 200, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 21, 57, 93 respectively and a light chain with three CDRs comprising the amino acid sequences 129, 165, 201, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 22, 58, 94 respectively and a light chain with three CDRs comprising the amino acid sequences 130, 166, 202, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 23, 59, 95 respectively and a light chain with three CDRs comprising the amino acid sequences 131, 167, 203, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 24, 60, 96 respectively and a light chain with three CDRs comprising the amino acid sequences 132, 168, 204, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 25, 61, 95 respectively and a light chain with three CDRs comprising the amino acid sequences 133, 169, 205, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 26, 62, 96 respectively and a light chain with three CDRs comprising the amino acid sequences 134, 170, 206, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 27, 63, 97 respectively and a light chain with three CDRs comprising the amino acid sequences 135, 171, 207, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 28, 64, 98 respectively and a light chain with three CDRs comprising the amino acid sequences 136, 172, 208, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 29, 65, 99 respectively and a light chain with three CDRs comprising the amino acid sequences 137, 173, 209, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 30, 66, 100 respectively and a light chain with three CDRs comprising the amino acid sequences 138, 174, 210, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 31, 67, 101 respectively and a light chain with three CDRs comprising the amino acid sequences 139, 175, 211, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 32, 68, 102 respectively and a light chain with three CDRs comprising the amino acid sequences 140, 176, 212, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 33, 69, 103 respectively and a light chain with three CDRs comprising the amino acid sequences 141, 177, 213, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 34, 70, 104 respectively and a light chain with three CDRs comprising the amino acid sequences 142, 178, 214, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 35, 71, 105 respectively and a light chain with three CDRs comprising the amino acid sequences 143, 179, 215, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 36, 72, 106 respectively and a light chain with three CDRs comprising the amino acid sequences 144, 180, 216, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 217, 247, 277 respectively and a light chain with three CDRs comprising the amino acid sequences 307, 337, 367, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 218, 248, 278 respectively and a light chain with three CDRs comprising the amino acid sequences 308, 338, 368, respectively; ; or a heavy chain with three CDRs comprising the amino acid sequences 219, 249, 279 respectively and a light chain with three CDRs comprising the amino acid sequences 309, 339, 369, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 220, 250, 280 respectively and a light chain with three CDRs comprising the amino acid sequences 310, 340, 370, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 221, 251, 281 respectively and a light chain with three CDRs comprising the amino acid sequences 311, 341, 371, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 222, 252, 282 respectively and a light chain with three CDRs comprising the amino acid sequences 312, 342, 372, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 223, 253, 283 respectively and a light chain with three CDRs comprising the amino acid sequences 313, 343, 373, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 224, 254, 284 respectively and a light chain with three CDRs comprising the amino acid sequences 314, 344, 374, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 225, 255, 285 respectively and a light chain with three CDRs comprising the amino acid sequences 315, 345, 375, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 226, 256, 286 respectively and a light chain with three CDRs comprising the amino acid sequences 316, 346, 376, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 227, 257, 287 respectively and a light chain with three CDRs comprising the amino acid sequences 317, 347, 377, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 228, 258, 288 respectively and a light chain with three CDRs comprising the amino acid sequences 318, 348, 378, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 229, 259, 289 respectively and a light chain with three CDRs comprising the amino acid sequences 319, 349, 379, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 230, 260, 290 respectively and a light chain with three CDRs comprising the amino acid sequences 320, 350, 380, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 231, 261, 291 respectively and a light chain with three CDRs comprising the amino acid sequences 321, 351, 381, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 232, 262, 292 respectively and a light chain with three CDRs comprising the amino acid sequences 322, 352, 382, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 233, 263, 293 respectively and a light chain with three CDRs comprising the amino acid sequences 323, 353, 383, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 234, 273, 294 respectively and a light chain with three CDRs comprising the amino acid sequences 324, 354, 384, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 235, 274, 295 respectively and a light chain with three CDRs comprising the amino acid sequences 325, 355, 385, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 236, 275, 296 respectively and a light chain with three CDRs comprising the amino acid sequences 326, 356, 386, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 237, 276, 297 respectively and a light chain with three CDRs comprising the amino acid sequences 327, 357, 387, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 237, 277, 298 respectively and a light chain with three CDRs comprising the amino acid sequences 328, 358, 388, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 238, 278, 299 respectively and a light chain with three CDRs comprising the amino acid sequences 329, 359, 389, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 239, 279, 300 respectively and a light chain with three CDRs comprising the amino acid sequences 330, 360, 390, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 240, 280, 301 respectively and a light chain with three CDRs comprising the amino acid sequences 331, 361, 391, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 241, 281, 302 respectively and a light chain with three CDRs comprising the amino acid sequences 332, 362, 392, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 242, 282, 303 respectively and a light chain with three CDRs comprising the amino acid sequences 333, 363, 393, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 243, 283, 304 respectively and a light chain with three CDRs comprising the amino acid sequences 334, 364, 394, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 244, 284, 305 respectively and a light chain with three CDRs comprising the amino acid sequences 335, 365, 395, respectively; or a heavy chain with three CDRs comprising the amino acid sequences 245, 285, 306 respectively and a light chain with three CDRs comprising the amino acid sequences 336, 366, 396, respectively.
[00096] Other anti-influenza antibodies include those having the amino acid or nucleic acid sequences shown in the below Table 1.
Table 1A. Antibody 3I14Variable Region nucleic acid sequences
VH chain of 3114 (SEQ ID NO: 1665)
CAGGTGCAGCTGTTGGAGTCTGGGGGAGGCGTGGTCCAGCCTGGGAGGTCCCTGAGACTCTCCTGT GCAGCCTCTGGATTCACCTTCAGTAACTATGGCATGCACTGGGTCCGCCAGGCTCCAGGCAAGGGG CTGGAGTGGGTGGCAATTATATCATTTGATGGAAGTAAAAAATATTATGCAAACTCCGTGAAGGGC CGATCCACCATCTCCAGAGACAATTCCAAGAACACGCTGTCTCTGCAAATGAACAGCCTGGGACCT GAGGACACGGCTCTATATTACTGTGCGAAACTGCCCTCCCCGTATTACTTTGATAGTCGGTTCGTG TGGGTCGCCGCCAGCGCATTTCACTTCTGGGGCCAGGGAATCCTGGTCACCGTCTCTTCA
VL chain of 3114 (SEQ ID NO: 1667) AATTTTATGCTGACTCAGCCACCCTCAGCGTCTGGGACCCCCGGGCAGAGGGTCACCATCTCTTGC TCTGGAAGCAGCTCCAACATCGGAGGTAATACTGTACACTGGTTCCAGCAGCTCCCAGGAACGGCC CCCAAACTCCTCATCTATACTAATAGTCTGCGGCCCTCAGGGGTCCCTGACCGATTCTCTGGCTCC AAGTCTGGCACCTCAGCCTCCCTGGCCATCAGTGGGCTCCAGTCTGAGGATGAGGCTGATTATTAC TGTGCAGCATGGGATGACAGCCTAAATGGTCAGGTGTTCGGCGGAGGGACCAAGCTGACCGTCCTA
Table IB. Antibody3I14Variable Region amino acid sequences
VH chain of 3114 (SEQ ID NO: 1666)
QVQLLESGGGWQPGRSLRLSCAASGFTFSNYGMHWVRQAPGKGLEWVAI ISFDGSKKYY ANSVKGRSTISRDNSKNTLSLQMNSLGPEDTALYYCAKLPSPYYFDSRFV VAASAFHFW
GQGILVTVSS
VL chain of 3114 (SEQ ID NO: 1668)
NFMLTQPPSASGTPGQRVTISCSGSSSNIGGNTVHWFQQLPGTAPKLLIYTNSLRPSGVPD RFSGSKSGTSASLAISGLQSEDEADYYCAAWDDSLNGQVFGGGTKLTVL
Table 1C. Antibody 3I14VLD94N Variable Region nucleic acid sequence
VL chain of 3I14VLD94N (SEQ ID NO: 1669)
AATTTTATGCTGACTCAGCCACCCTCAGCGTCTGGGACCCCCGGGCAGAGGGTCACCATCTCTTGC TCTGGAAGCAGCTCCAACATCGGAGGTAATACTGTACACTGGTTCCAGCAGCTCCCAGGAACGGCC CCCAAACTCCTCATCTATACTAATAGTCTGCGGCCCTCAGGGGTCCCTGACCGATTCTCTGGCTCC AAGTCTGGCACCTCAGCCTCCCTGGCCATCAGTGGGCTCCAGTCTGAGGATGAGGCTGATTATTAC TGTGCAGCATGGGATAACAGCCTAAATGGTCAGGTGTTCGGCGGAGGGACCAAGCTGACCGTCCTA
Table 1C. Antibody 3I14VLD94N Variable Region amino acid sequence
VL chain of 3I14VLD94N (SEQ ID NO: 1670)
NFMLTQPPSASGTPGQRVTISCSGSSSNIGGNTVHWFQQLPGTAPKLLIYTNSLRPSGVPD RFSGSKSGTSASLAISGLQSEDEADYYCAAWDISLNGQVFGGGTKLTVL
[00097] The amino acid sequences of the heavy and light chain complementary determining regions of the 3114 and3I14VLD94N neutralizing influenza antibodies are shown in the below Table 2
[00098] Table 2
Figure imgf000040_0001
[00099] Other binding domain than scFv can also be used for predefined targeting of lymphocytes, such as camelid single-domain antibody fragments or receptor ligands, antibody binding domains, antibody hypervariable loops or CDRs as non limiting examples.
[000100] In a preferred embodiment said transmembrane domain further comprises a stalk region between said extracellular ligand-binding domain and said transmembrane domain. The term "stalk region" used herein generally means any oligo- or polypeptide that functions to link the transmembrane domain to the extracellular ligand-binding domain. In particular, stalk region are used to provide more flexibility and accessibility for the extracellular ligand-binding domain. A stalk region may comprise up to 300 amino acids, preferably 10 to 100 amino acids and most preferably 25 to 50 amino acids. Stalk region may be derived from all or part of naturally occurring molecules, such as from all or part of the extracellular region of CD8, CD4 or CD28, or from all or part of an antibody constant region. Alternatively the stalk region may be a synthetic sequence that corresponds to a naturally occurring stalk sequence, or may be an entirely synthetic stalk sequence. In a preferred embodiment said stalk region is a part of human CD8 alpha chain
[000101] The signal transducing domain or intracellular signaling domain of the CAR of the invention is responsible for intracellular signaling following the binding of extracellular ligand binding domain to the target resulting in the activation of the immune cell and immune response. In other words, the signal transducing domain is responsible for the activation of at least one of the normal effector functions of the immune cell in which the CAR is expressed. For example, the effector function of a T cell can be a cytolytic activity or helper activity including the secretion of cytokines. Thus, the term "signal transducing domain" refers to the portion of a protein which transduces the effector signal function signal and directs the cell to perform a specialized function.
[000102] Signal transduction domain comprises two distinct classes of cytoplasmic signaling sequence, those that initiate antigen-dependent primary activation, and those that act in an antigen-independent manner to provide a secondary or co-stimulatory signal. Primary cytoplasmic signaling sequence can comprise signaling motifs which are known as immunoreceptor tyrosine-based activation motifs of ITAMs. ITAMs are well defined signaling motifs found in the intracytoplasmic tail of a variety of receptors that serve as binding sites for syk/zap70 class tyrosine kinases. Examples of IT AM used in the invention can include as non limiting examples those derived from TCR zeta, FcR gamma, FcR beta, FcR epsilon, CD3 gamma, CD3 delta, CD3 epsilon, CD5, CD22, CD79a, CD79b and CD66d. In a preferred embodiment, the signaling transducing domain of the CAR can comprise the CD3 zeta signaling domain, or the intracytoplasmic domain of the Fc epsilon RI beta or gamma chains. In another preferred embodiment, the signaling is provided by CD3 zeta together with co-stimulation provided by CD28 and a tumor necrosis factor receptor (TNFr), such as 4- IBB or OX40), for example.
[000103] In particular embodiment the intracellular signaling domain of the CAR of the present invention comprises a co-stimulatory signal molecule. In some embodiments the intracellular signaling domain contains 2, 3, 4 or more co-stimulatory molecules in tandem. A co-stimulatory molecule is a cell surface molecule other than an antigen receptor or their ligands that is required for an efficient immune response.
[000104] "Co-stimulatory ligand" refers to a molecule on an antigen presenting cell that specifically binds a cognate co-stimulatory molecule on a T-cell, thereby providing a signal which, in addition to the primary signal provided by, for instance, binding of a TCR/CD3 complex with an MHC molecule loaded with peptide, mediates a T cell response, including, but not limited to, proliferation activation, differentiation and the like. A co-stimulatory ligand can include but is not limited to CD7, B7-1 (CD80), B7-2 (CD86), PD-Ll, PD-L2, 4- 1BBL, OX40L, inducible costimulatory ligand (ICOS-L), intercellular adhesion molecule (ICAM, CD30L, CD40, CD70, CD83, HLA-G, MICA, M1CB, HVEM, lymphotoxin beta receptor, 3/TR6, ILT3, ILT4, an agonist or antibody that binds Toll ligand receptor and a ligand that specifically binds with B7-H3. A co-stimulatory ligand also encompasses, inter alia, an antibody that specifically binds with a co-stimulatory molecule present on a T cell, such as but not limited to, CD27, CD28, 4-IBB, OX40, CD30, CD40, PD-1, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LTGHT, NKG2C, B7-H3, a ligand that specifically binds with CD83.
[000105] A "co-stimulatory molecule" refers to the cognate binding partner on a T-cell that specifically binds with a co-stimulatory ligand, thereby mediating a co-stimulatory response by the cell, such as, but not limited to proliferation. Co-stimulatory molecules include, but are not limited to an MHC class 1 molecule, BTLA and Toll ligand receptor. Examples of costimulatory molecules include CD27, CD28, CD8, 4-IBB (CD137), OX40, CD30, CD40, PD-1, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, B7-H3 and a ligand that specifically binds with CD83 and the like. The In another particular embodiment, said signal transducing domain is a TNFR-associated Factor 2 (TRAF2) binding motifs, intracytoplasmic tail of costimulatory TNFR member family. Cytoplasmic tail of costimulatory TNFR family member contains TRAF2 binding motifs consisting of the major conserved motif (P/S/A)X(Q/E)E) or the minor motif (PXQXXD), wherein X is any amino acid. TRAF proteins are recruited to the intracellular tails of many TNFRs in response to receptor trimerization.
[000106] The distinguishing features of appropriate transmembrane polypeptides comprise the ability to be expressed at the surface of an immune cell, in particular lymphocyte cells or Natural killer (NK) cells, and to interact together for directing cellular response of immune cell against a predefined target cell. The different transmembrane polypeptides of the CAR of the present invention comprising an extracellular ligand-biding domain and/or a signal transducing domain interact together to take part in signal transduction following the binding with a target ligand and induce an immune response. The transmembrane domain can be derived either from a natural or from a synthetic source. The transmembrane domain can be derived from any membrane-bound or transmembrane protein.
[000107] The term "a part of used herein refers to any subset of the molecule, that is a shorter peptide. Alternatively, amino acid sequence functional variants of the polypeptide can be prepared by mutations in the DNA which encodes the polypeptide. Such variants or functional variants include, for example, deletions from, or insertions or substitutions of, residues within the amino acid sequence. Any combination of deletion, insertion, and substitution may also be made to arrive at the final construct, provided that the final construct possesses the desired activity, especially to exhibit a specific anti-target cellular immune activity. The functionality of the CAR of the invention within a host cell is detectable in an assay suitable for demonstrating the signaling potential of said CAR upon binding of a particular target. Such assays are available to the skilled person in the art. For example, this assay allows the detection of a signaling pathway, triggered upon binding of the target, such as an assay involving measurement of the increase of calcium ion release, intracellular tyrosine phosphorylation, inositol phosphate turnover, or interleukin (IL) 2, interferon .gamma., GM-CSF, IL-3, IL-4 production thus effected.
[000108] Cells
[000109] Embodiments of the invention include cells that express a CAR (i.e, CARTS). The cell may be of any kind, including an immune cell capable of expressing the CAR for cancer therapy or a cell, such as a bacterial cell, that harbors an expression vector that encodes the CAR. As used herein, the terms "cell," "cell line," and "cell culture" may be used interchangeably. All of these terms also include their progeny, which is any and all subsequent generations. It is understood that all progeny may not be identical due to deliberate or inadvertent mutations. In the context of expressing a heterologous nucleic acid sequence, "host cell" refers to a eukaryotic cell that is capable of replicating a vector and/or expressing a heterologous gene encoded by a vector. A host cell can, and has been, used as a recipient for vectors. A host cell may be "transfected" or "transformed," which refers to a process by which exogenous nucleic acid is transferred or introduced into the host cell. A transformed cell includes the primary subject cell and its progeny. As used herein, the terms "engineered" and "recombinant" cells or host cells are intended to refer to a cell into which an exogenous nucleic acid sequence, such as, for example, a vector, has been introduced. Therefore, recombinant cells are distinguishable from naturally occurring cells which do not contain a recombinantly introduced nucleic acid. In embodiments of the invention, a host cell is a T cell, including a cytotoxic T cell (also known as TC, Cytotoxic T Lymphocyte, CTL, T-Killer cell, cytolytic T cell, CD8+ T-cells or killer T cell); NK cells and NKT cells are also encompassed in the invention.
[000110] Some vectors may employ control sequences that allow it to be replicated and/or expressed in both prokaryotic and eukaryotic cells. One of skill in the art would further understand the conditions under which to incubate all of the above described host cells to maintain them and to permit replication of a vector. Also understood and known are techniques and conditions that would allow large-scale production of vectors, as well as production of the nucleic acids encoded by vectors and their cognate polypeptides, proteins, or peptides.
[000111] The cells can be autologous cells, syngeneic cells, allogenic cells and even in some cases, xenogeneic cells.
[000112] In many situations one may wish to be able to kill the modified CTLs, where one wishes to terminate the treatment, the cells become neoplastic, in research where the absence of the cells after their presence is of interest, or other event. For this purpose one can provide for the expression of certain gene products in which one can kill the modified cells under controlled conditions, such as inducible suicide genes.
[000113] Armed CARTS [000114] The invention further includes CARTS that are modified to secrete one or more polypeptides. The polypeptide can be for example an antibody or cytokine. Preferably, the antibody is specific for CAIX, GITR, PD-Ll, PD-L2. PD-1, or CCR4
[000115] Armed CARTS have the advantage of simultaneously secreting a polypeptide at the targeted site, e.g. tumor site.
[000116] Armed CART can be constructed by including a nucleic acid encoding the polypeptide of interest after the intracellular signaling domain. Preferably, there is an internal ribosome entry site, (IRES), positioned between the intracellular signaling domain and the polypeptide of interest. One skilled in the art can appreciate that more than one polypeptide can be expressed by employing multiple IRES sequences in tandem.
[000117] In one embodiment, the methods and compositions presented herein provide a target-specific Anti-CAIX CAR T cell of second generation armed with the power to secrete anti-PD-Ll IgGs in the RCC milieu to combat T cell exhaustion. The human Anti- CAIX CAR containing the CD28 co-stimulatory domain was chosen based in its killing activity and low immunogenicity in human cRCC xenografts in mice. The Anti-CAIX CART cells-secreting Anti-PD-Ll IgGl or IgG4 was extensively compared with an unrelated Anti-BCMA CAR or with an Anti-CAIX CAR, both secreting an irrelevant Anti- S ARS IgGl . We have demonstrated stable expression of the C ARs and high proliferation of all CART cells. Anti-CAIX CART cells have capacity to undergo clonal expansion when in contact with CAIX+ RCC cells, and were also activated, releasing high levels of IFND and IL-2, which could improve tumor suppression. These Anti-CAIX CART cells are also able to secrete high levels of Anti-PD-Ll IgGl or IgG4 and these antibodies can interact specifically with PD-Ll, inducing downregulation of the exhaustion markers PD-1, Tim-3 and Lag-3 in vitro and in vivo. These results have shown that the Anti-PD-Ll antibodies secreted in the tumor microenvironment are able to revert T cell exhaustion, facilitating the Anti-CAIX CART cells antitumor activity. These Anti-CAIX CART cells, mainly the ones secreting anti-PD-Ll, are also able to diminish the proliferation of CAIX+ RCC cells, resulting in a slow tumor growth and small tumor size and weight in an orthotopic NSG mice model of RCC. In addition, Anti-CAIX CART cell secreting the IgGl isotype of Anti- PD-Ll was also able to induce ADCC in vitro and increased the number of human NK cells infiltrating the tumor site in vivo. The human NK cells were injected only in 2 mice of each group, two days before their euthanasia to determine the NK cells capacity to recognize the IgGl isotype of the Anti-PD-Ll in vivo, which was attested. The injection of human NK cells was not made in the beginning of the treatment once our previous experience with this mice model showed that these cells last only for a few days in their blood
[000118] In one embodiment, the injection of CART cells into mice was performed without the addition of interleukins to avoid their influence in the therapeutic effect of CART cells alone.
[000119] In another embodiment, CART cells can be maintained with the use of cytokines such as, for example, IL-2, IL-4, IL-7, IL-9, IL-15 and IL-21.
[000120] Cytokines sharing the yc receptor, like IL-2, IL-4, IL-7, IL-9, IL-15 and IL-21 are important for the development and maintenance of memory T cells. Among them, IL-21 promote a less differentiated phenotype, associated with an enrichment of tumor-specific CD8 T cells, with increased anti-tumor effect in a mouse melanoma model when compared to IL-2 or IL-15.
[000121] In certain embodiments, CART cells are maintained with IL-21.
[000122] CAIX is a consistent marker for development of cancer targeted systemic therapies due to it overexpression in many tumors, remarkably in cRCC, but it is also expressed physiologically in a few tissues.
[000123] In one embodiment, the anti-CAIX scFv in the CAR recognizes the catalytic domain of CAIX, located in the central portion of the protein, which could increase its specificity to sites of higher expression of CAIX.
[000124] The choice of CD28 as a co-stimulatory domain for the CARs presented herein was based in the fact that CD28 CARs direct an active proliferative response and enhance effector functions, whereas 4-lBB-based CARs induce a more progressive T cell accumulation that may counterweigh for less immediate effectiveness. In one embodiment, the CD28 is replaced by 41BB in the CAR constructs.
[000125] T cell exhaustion is common in cancer and these T cells present low capacities of proliferation and cytokine production associated with high apoptosis rate and expression of inhibitory receptors like PD-1, Tim-3 and Lag3. New strategies for preventing T cell exhaustion include of PD-1/PD-L1 axis.
[000126] The methods and compositions presented herein provide Anti-CAIX CART cells-secreting Anti-PD-Ll IgGl or IgG4 that can diminish T cell exhaustion, improving CART cell efficiency in the cRCC treatment in vitro and in vivo. [000127] Introduction of Constructs into CTLs
[000128] Expression vectors that encode the CARs can be introduced as one or more DNA molecules or constructs, where there may be at least one marker that will allow for selection of host cells that contain the construct(s).
[000129] The constructs can be prepared in conventional ways, where the genes and regulatory regions may be isolated, as appropriate, ligated, cloned in an appropriate cloning host, analyzed by restriction or sequencing, or other convenient means. Particularly, using PCR, individual fragments including all or portions of a functional unit may be isolated, where one or more mutations may be introduced using "primer repair", ligation, in vitro mutagenesis, etc., as appropriate. The construct(s) once completed and demonstrated to have the appropriate sequences may then be introduced into the CTL by any convenient means. The constructs may be integrated and packaged into non-replicating, defective viral genomes like Adenovirus, Adeno-associated virus (AAV), or Herpes simplex virus (HSV) or others, including retroviral vectors or lentiviral vectors, for infection or transduction into cells. The constructs may include viral sequences for transfection, if desired. Alternatively, the construct may be introduced by fusion, electroporation, biolistics, transfection, lipofection, or the like. The host cells may be grown and expanded in culture before introduction of the construct(s), followed by the appropriate treatment for introduction of the construct(s) and integration of the construct(s). The cells are then expanded and screened by virtue of a marker present in the construct. Various markers that may be used successfully include hprt, neomycin resistance, thymidine kinase, hygromycin resistance, etc.
[000130] In some instances, one may have a target site for homologous recombination, where it is desired that a construct be integrated at a particular locus. For example,) can knock-out an endogenous gene and replace it (at the same locus or elsewhere) with the gene encoded for by the construct using materials and methods as are known in the art for homologous recombination. For homologous recombination, one may use either .OMEGA, or O-vectors. See, for example, Thomas and Capecchi, Cell (1987) 51, 503-512; Mansour, et al, Nature (1988) 336, 348-352; and Joyner, et al, Nature (1989) 338, 153-156.
[000131] The constructs may be introduced as a single DNA molecule encoding at least the CAR and optionally another gene, or different DNA molecules having one or more genes. Other genes include genes that encode therapeutic molecules or suicide genes, for example. The constructs may be introduced simultaneously or consecutively, each with the same or different markers.
[000132] Vectors containing useful elements such as bacterial or yeast origins of replication, selectable and/or amplifiable markers, promoter/enhancer elements for expression in prokaryotes or eukaryotes, etc. that may be used to prepare stocks of construct DNAs and for carrying out transfections are well known in the art, and many are commercially available.
[000133] Methods of Use
[000134] The cells according to the invention can be used for treating cancer, viral infections or autoimmune disorders in a patient in need thereof. In another embodiment, said isolated cell according to the invention can be used in the manufacture of a medicament for treatment of a cancer, viral infections of autoimmune disorders, in a patient in need thereof.
[000135] The present invention relies on methods for treating patients in need thereof, said method comprising at least one of the following steps: (a) providing a chimeric antigen receptor cells according to the invention and (b) administrating the cells to said patient.
[000136] Said treatment can be ameliorating, curative or prophylactic. It may be either part of an autologous immunotherapy or part of an allogenic immunotherapy treatment. By autologous, it is meant that cells, cell line or population of cells used for treating patients are originating from said patient or from a Human Leucocyte Antigen (HLA) compatible donor. By allogeneic is meant that the cells or population of cells used for treating patients are not originating from said patient but from a donor.
[000137] The invention is particularly suited for allogenic immunotherapy, insofar as it enables the transformation of T-cells, typically obtained from donors, into non-alloreactive cells. This may be done under standard protocols and reproduced as many times as needed. The resulted modified T cells may be pooled and administrated to one or several patients, being made available as an "off the shelf therapeutic product.
[000138] Cells that can be used with the disclosed methods are described in the previous section. Said treatment can be used to treat patients diagnosed with cancer, viral infection, autoimmune disorders or Graft versus Host Disease (GvHD). Cancers that may be treated include tumors that are not vascularized, or not yet substantially vascularized, as well as vascularized tumors. The cancers may comprise nonsolid tumors (such as hematological tumors, for example, leukemias and lymphomas) or may comprise solid tumors. Types of cancers to be treated with the CARs of the invention include, but are not limited to, carcinoma, blastoma, and sarcoma, and certain leukemia or lymphoid malignancies, benign and malignant tumors, and malignancies e.g., sarcomas, carcinomas, and melanomas. Adult tumors/cancers and pediatric tumors/cancers are also included.
[000139] It can be a treatment in combination with one or more therapies against cancer selected from the group of antibodies therapy, chemotherapy, cytokines therapy, dendritic cell therapy, gene therapy, hormone therapy, laser light therapy and radiation therapy.
[000140] According to a preferred embodiment of the invention, said treatment can be administrated into patients undergoing an immunosuppressive treatment. Indeed, the present invention preferably relies on cells or population of cells, which have been made resistant to at least one immunosuppressive agent due to the inactivation of a gene encoding a receptor for such immunosuppressive agent. In this aspect, the immunosuppressive treatment should help the selection and expansion of the T-cells according to the invention within the patient.
[000141] In a further embodiment, the cell compositions of the present invention are administered to a patient in conjunction with (e.g., before, simultaneously or following) bone marrow transplantation, T cell ablative therapy using either chemotherapy agents such as, fludarabine, external-beam radiation therapy (XRT), cyclophosphamide, or antibodies such as OKT3 or CAM PATH. In another embodiment, the cell compositions of the present invention are administered following B-cell ablative therapy such as agents that react with CD20, e.g., Rituxan. For example, in one embodiment, subjects may undergo standard treatment with high dose chemotherapy followed by peripheral blood stem cell
transplantation. In certain embodiments, following the transplant, subjects receive an infusion of the expanded immune cells of the present invention. In an additional embodiment, expanded cells are administered before or following surgery. Said modified cells obtained by any one of the methods described here can be used in a particular aspect of the invention for treating patients in need thereof against Host versus Graft (HvG) rejection and Graft versus Host Disease (GvHD); therefore in the scope of the present invention is a method of treating patients in need thereof against Host versus Graft (HvG) rejection and Graft versus Host Disease (GvHD) comprising treating said patient by administering to said patient an effective amount of modified cells comprising inactivated TCR alpha and/or TCR beta genes. [000142] Administration of Cells
[000143] The invention is particularly suited for allogenic immunotherapy, insofar as it enables the transformation of T-cells, typically obtained from donors, into non-alloreactive cells. This may be done under standard protocols and reproduced as many times as needed. The resulted modified T cells may be pooled and administrated to one or several patients, being made available as an "off the shelf therapeutic product.
[000144] Depending upon the nature of the cells, the cells may be introduced into a host organism, e.g. a mammal, in a wide variety of ways. The cells may be introduced at the site of the tumor, in specific embodiments, although in alternative embodiments the cells hone to the cancer or are modified to hone to the cancer. The number of cells that are employed will depend upon a number of circumstances, the purpose for the introduction, the lifetime of the cells, the protocol to be used, for example, the number of administrations, the ability of the cells to multiply, the stability of the recombinant construct, and the like. The cells may be applied as a dispersion, generally being injected at or near the site of interest. The cells may be in a physiologically-acceptable medium.
[000145] In some embodiments, the cells are encapsulated to inhibit immune recognition and placed at the site of the tumor.
[000146] The cells may be administered as desired. Depending upon the response desired, the manner of administration, the life of the cells, the number of cells present, various protocols may be employed. The number of administrations will depend upon the factors described above at least in part.
[000147] The administration of the cells or population of cells according to the present invention may be carried out in any convenient manner, including by aerosol inhalation, injection, ingestion, transfusion, implantation or transplantation. The compositions described herein may be administered to a patient subcutaneously, intradermaly, intratumorally, intranodally, intramedullary, intramuscularly, by intravenous or
intralymphatic injection, or intraperitoneally. In one embodiment, the cell compositions of the present invention are preferably administered by intravenous injection.
[000148] The administration of the cells or population of cells can consist of the administration of 104 -109 cells per kg body weight, preferably 105 to 106 cells/kg body weight including all integer values of cell numbers within those ranges. The cells or population of cells can be administrated in one or more doses. In another embodiment, said effective amount of cells are administrated as a single dose. In another embodiment, said effective amount of cells are administrated as more than one dose over a period time.
Timing of administration is within the judgment of managing physician and depends on the clinical condition of the patient. The cells or population of cells may be obtained from any source, such as a blood bank or a donor. While individual needs vary, determination of optimal ranges of effective amounts of a given cell type for a particular disease or conditions within the skill of the art. An effective amount means an amount which provides a therapeutic or prophylactic benefit. The dosage administrated will be dependent upon the age, health and weight of the recipient, kind of concurrent treatment, if any, frequency of treatment and the nature of the effect desired.
[000149] It should be appreciated that the system is subject to many variables, such as the cellular response to the ligand, the efficiency of expression and, as appropriate, the level of secretion, the activity of the expression product, the particular need of the patient, which may vary with time and circumstances, the rate of loss of the cellular activity as a result of loss of cells or expression activity of individual cells, and the like. Therefore, it is expected that for each individual patient, even if there were universal cells which could be administered to the population at large, each patient would be monitored for the proper dosage for the individual, and such practices of monitoring a patient are routine in the art.
[000150] Nucleic Acid-Based Expression Systems
[000151] The CARs of the present invention may be expressed from an expression vector. Recombinant techniques to generate such expression vectors are well known in the art.
[000152] Vectors
[000153] The term "vector" is used to refer to a carrier nucleic acid molecule into which a nucleic acid sequence can be inserted for introduction into a cell where it can be replicated. A nucleic acid sequence can be "exogenous," which means that it is foreign to the cell into which the vector is being introduced or that the sequence is homologous to a sequence in the cell but in a position within the host cell nucleic acid in which the sequence is ordinarily not found. Vectors include plasmids, cosmids, viruses (bacteriophage, animal viruses, and plant viruses), and artificial chromosomes (e.g., YACs). One of skill in the art would be well equipped to construct a vector through standard recombinant techniques (see, for example, Maniatis et al, 1988 and Ausubel et al., 1994, both incorporated herein by reference). [000154] The term "expression vector" refers to any type of genetic construct comprising a nucleic acid coding for a RNA capable of being transcribed. In some cases, RNA molecules are then translated into a protein, polypeptide, or peptide. In other cases, these sequences are not translated, for example, in the production of antisense molecules or ribozymes. Expression vectors can contain a variety of "control sequences," which refer to nucleic acid sequences necessary for the transcription and possibly translation of an operably linked coding sequence in a particular host cell. In addition to control sequences that govern transcription and translation, vectors and expression vectors may contain nucleic acid sequences that serve other functions as well and are described infra.
[000155] . Promoters and Enhancers
[000156] A "promoter" is a control sequence that is a region of a nucleic acid sequence at which initiation and rate of transcription are controlled. It may contain genetic elements at which regulatory proteins and molecules may bind, such as RNA polymerase and other transcription factors, to initiate the specific transcription a nucleic acid sequence. The phrases "operatively positioned," "operatively linked," "under control," and "under transcriptional control" mean that a promoter is in a correct functional location and/or orientation in relation to a nucleic acid sequence to control transcriptional initiation and/or expression of that sequence.
[000157] A promoter generally comprises a sequence that functions to position the start site for RNA synthesis. The best known example of this is the TATA box, but in some promoters lacking a TATA box, such as, for example, the promoter for the mammalian terminal deoxynucleotidyl transferase gene and the promoter for the SV40 late genes, a discrete element overlying the start site itself helps to fix the place of initiation. Additional promoter elements regulate the frequency of transcriptional initiation. Typically, these are located in the region 30 110 bp upstream of the start site, although a number of promoters have been shown to contain functional elements downstream of the start site as well. To bring a coding sequence "under the control of a promoter, one positions the 5' end of the transcription initiation site of the transcriptional reading frame "downstream" of (i.e., 3' of) the chosen promoter. The "upstream" promoter stimulates transcription of the DNA and promotes expression of the encoded RNA.
[000158] The spacing between promoter elements frequently is flexible, so that promoter function is preserved when elements are inverted or moved relative to one another. In the tk promoter, the spacing between promoter elements can be increased to 50 bp apart before activity begins to decline. Depending on the promoter, it appears that individual elements can function either cooperatively or independently to activate transcription. A promoter may or may not be used in conjunction with an "enhancer," which refers to a cis-acting regulatory sequence involved in the transcriptional activation of a nucleic acid sequence.
[000159] A promoter may be one naturally associated with a nucleic acid sequence, as may be obtained by isolating the 5 prime' non-coding sequences located upstream of the coding segment and/or exon. Such a promoter can be referred to as "endogenous."
Similarly, an enhancer may be one naturally associated with a nucleic acid sequence, located either downstream or upstream of that sequence. Alternatively, certain advantages will be gained by positioning the coding nucleic acid segment under the control of a recombinant or heterologous promoter, which refers to a promoter that is not normally associated with a nucleic acid sequence in its natural environment. A recombinant or heterologous enhancer refers also to an enhancer not normally associated with a nucleic acid sequence in its natural environment. Such promoters or enhancers may include promoters or enhancers of other genes, and promoters or enhancers isolated from any other virus, or prokaryotic or eukaryotic cell, and promoters or enhancers not "naturally occurring," i.e., containing different elements of different transcriptional regulatory regions, and/or mutations that alter expression. For example, promoters that are most commonly used in recombinant DNA construction include the lactamase (penicillinase), lactose and tryptophan (trp) promoter systems. In addition to producing nucleic acid sequences of promoters and enhancers synthetically, sequences may be produced using recombinant cloning and/or nucleic acid amplification technology, including PCR.TM., in connection with the compositions disclosed herein (see U.S. Pat. Nos. 4,683,202 and 5,928,906, each incorporated herein by reference). Furthermore, it is contemplated the control sequences that direct transcription and/or expression of sequences within non-nuclear organelles such as mitochondria, chloroplasts, and the like, can be employed as well.
[000160] Naturally, it will be important to employ a promoter and/or enhancer that effectively directs the expression of the DNA segment in the organelle, cell type, tissue, organ, or organism chosen for expression. Those of skill in the art of molecular biology generally know the use of promoters, enhancers, and cell type combinations for protein expression, (see, for example Sambrook et al. 1989, incorporated herein by reference). The promoters employed may be constitutive, tissue-specific, inducible, and/or useful under the appropriate conditions to direct high level expression of the introduced DNA segment, such as is advantageous in the large-scale production of recombinant proteins and/or peptides. The promoter may be heterologous or endogenous.
[000161] Additionally any promoter/enhancer combination could also be used to drive expression. Use of a T3, T7 or SP6 cytoplasmic expression system is another possible embodiment. Eukaryotic cells can support cytoplasmic transcription from certain bacterial promoters if the appropriate bacterial polymerase is provided, either as part of the delivery complex or as an additional genetic expression construct.
[000162] The identity of tissue-specific promoters or elements, as well as assays to characterize their activity, is well known to those of skill in the art.
[000163] A specific initiation signal also may be required for efficient translation of coding sequences. These signals include the ATG initiation codon or adjacent sequences. Exogenous translational control signals, including the ATG initiation codon, may need to be provided. One of ordinary skill in the art would readily be capable of determining this and providing the necessary signals
[000164] In certain embodiments of the invention, the use of internal ribosome entry sites (IRES) elements are used to create multigene, or polycistronic, messages, and these may be used in the invention.
[000165] Vectors can include a multiple cloning site (MCS), which is a nucleic acid region that contains multiple restriction enzyme sites, any of which can be used in conjunction with standard recombinant technology to digest the vector. "Restriction enzyme digestion" refers to catalytic cleavage of a nucleic acid molecule with an enzyme that functions only at specific locations in a nucleic acid molecule. Many of these restriction enzymes are commercially available. Use of such enzymes is widely understood by those of skill in the art. Frequently, a vector is linearized or fragmented using a restriction enzyme that cuts within the MCS to enable exogenous sequences to be ligated to the vector.
"Ligation" refers to the process of forming phosphodi ester bonds between two nucleic acid fragments, which may or may not be contiguous with each other. Techniques involving restriction enzymes and ligation reactions are well known to those of skill in the art of recombinant technology. [000166] Splicing sites, termination signals, origins of replication, and selectable markers may also be employed.
[000167] Plasmid Vectors
[000168] In certain embodiments, a plasmid vector is contemplated for use to transform a host cell. In general, plasmid vectors containing replicon and control sequences which are derived from species compatible with the host cell are used in connection with these hosts. The vector ordinarily carries a replication site, as well as marking sequences which are capable of providing phenotypic selection in transformed cells. In a non-limiting example, E. coli is often transformed using derivatives of pBR322, a plasmid derived from an E. coli species. pBR322 contains genes for ampicillin and tetracycline resistance and thus provides easy means for identifying transformed cells. The pBR plasmid, or other microbial plasmid or phage must also contain, or be modified to contain, for example, promoters which can be used by the microbial organism for expression of its own proteins.
[000169] In addition, phage vectors containing replicon and control sequences that are compatible with the host microorganism can be used as transforming vectors in connection with these hosts. For example, the phage lambda GEM.TM. 11 may be utilized in making a recombinant phage vector which can be used to transform host cells, such as, for example, E. coli LE392.
[000170] Further useful plasmid vectors include pIN vectors (Inouye et al, 1985); and pGEX vectors, for use in generating glutathione S transferase (GST) soluble fusion proteins for later purification and separation or cleavage. Other suitable fusion proteins are those with galactosidase, ubiquitin, and the like.
[000171] Bacterial host cells, for example, E. coli, comprising the expression vector, are grown in any of a number of suitable media, for example, LB. The expression of the recombinant protein in certain vectors may be induced, as would be understood by those of skill in the art, by contacting a host cell with an agent specific for certain promoters, e.g., by adding IPTG to the media or by switching incubation to a higher temperature. After culturing the bacteria for a further period, generally of between 2 and 24 h, the cells are collected by centrifugation and washed to remove residual media.
[000172] Viral Vectors
[000173] The ability of certain viruses to infect cells or enter cells via receptor mediated endocytosis, and to integrate into host cell genome and express viral genes stably and efficiently have made them attractive candidates for the transfer of foreign nucleic acids into cells (e.g., mammalian cells). Components of the present invention may be a viral vector that encodes one or more CARs of the invention. Non-limiting examples of virus vectors that may be used to deliver a nucleic acid of the present invention are described below.
[000174] Adenoviral Vectors
[000175] A particular method for delivery of the nucleic acid involves the use of an adenovirus expression vector. Although adenovirus vectors are known to have a low capacity for integration into genomic DNA, this feature is counterbalanced by the high efficiency of gene transfer afforded by these vectors. "Adenovirus expression vector" is meant to include those constructs containing adenovirus sequences sufficient to (a) support packaging of the construct and (b) to ultimately express a tissue or cell specific construct that has been cloned therein. Knowledge of the genetic organization or adenovirus, a 36 kb, linear, double stranded DNA virus, allows substitution of large pieces of adenoviral DNA with foreign sequences up to 7 kb (Grunhaus and Horwitz, 1992).
[000176] AAV Vectors
[000177] The nucleic acid may be introduced into the cell using adenovirus assisted transfection. Increased transfection efficiencies have been reported in cell systems using adenovirus coupled systems (Kelleher and Vos, 1994; Cotten et al, 1992; Curiel, 1994). Adeno associated virus (AAV) is an attractive vector system for use in the cells of the present invention as it has a high frequency of integration and it can infect nondividing cells, thus making it useful for delivery of genes into mammalian cells, for example, in tissue culture (Muzyczka, 1992) or in vivo. AAV has a broad host range for infectivity (Tratschin et al, 1984; Laughlin et al, 1986; Lebkowski et al, 1988; McLaughlin et al., 1988). Details concerning the generation and use of rAAV vectors are described in U.S. Pat. Nos. 5,139,941 and 4,797,368, each incorporated herein by reference.
[000178] Retroviral Vectors
[000179] Retroviruses are useful as delivery vectors because of their ability to integrate their genes into the host genome, transferring a large amount of foreign genetic material, infecting a broad spectrum of species and cell types and of being packaged in special cell lines (Miller, 1992).
[000180] In order to construct a retroviral vector, a nucleic acid (e.g., one encoding the desired sequence) is inserted into the viral genome in the place of certain viral sequences to produce a virus that is replication defective. In order to produce virions, a packaging cell line containing the gag, pol, and env genes but without the LTR and packaging components is constructed (Mann et al, 1983). When a recombinant plasmid containing a cDNA, together with the retroviral LTR and packaging sequences is introduced into a special cell line (e.g., by calcium phosphate precipitation for example), the packaging sequence allows the RNA transcript of the recombinant plasmid to be packaged into viral particles, which are then secreted into the culture media (Nicolas and Rubenstein, 1988; Temin, 1986; Mann et al, 1983). The media containing the recombinant retroviruses is then collected, optionally concentrated, and used for gene transfer. Retroviral vectors are able to infect a broad variety of cell types. However, integration and stable expression require the division of host cells (Paskind et al, 1975).
[000181] Lentiviruses are complex retroviruses, which, in addition to the common retroviral genes gag, pol, and env, contain other genes with regulatory or structural function. Lentiviral vectors are well known in the art (see, for example, Naldini et al, 1996; Zufferey et al, 1997; Blomer et al, 1997; U.S. Pat. Nos. 6,013,516 and 5,994,136). Some examples of lentivirus include the Human Immunodeficiency Viruses: HIV-1, HIV-2 and the Simian Immunodeficiency Virus: SIV. Lentiviral vectors have been generated by multiply attenuating the HIV virulence genes, for example, the genes env, vif, vpr, vpu and nef are deleted making the vector biologically safe.
[000182] Recombinant lentiviral vectors are capable of infecting non-dividing cells and can be used for both in vivo and ex vivo gene transfer and expression of nucleic acid sequences. For example, recombinant lentivirus capable of infecting a non-dividing cell wherein a suitable host cell is transfected with two or more vectors carrying the packaging functions, namely gag, pol and env, as well as rev and tat is described in U.S. Pat. No. 5,994,136, incorporated herein by reference. One may target the recombinant virus by linkage of the envelope protein with an antibody or a particular ligand for targeting to a receptor of a particular cell-type. By inserting a sequence (including a regulatory region) of interest into the viral vector, along with another gene which encodes the ligand for a receptor on a specific target cell, for example, the vector is now target-specific.
[000183] Other Viral Vectors
[000184] Other viral vectors may be employed as vaccine constructs in the present invention. Vectors derived from viruses such as vaccinia virus (Ridgeway, 1988; Baichwal and Sugden, 1986; Coupar et al, 1988), sindbis virus, cytomegalovirus and herpes simplex virus may be employed. They offer several attractive features for various mammalian cells (Friedmann, 1989; Ridgeway, 1988; Baichwal and Sugden, 1986; Coupar et al., 1988; Horwich et al, 1990).
[000185] Delivery Using Modified Viruses
[000186] A nucleic acid to be delivered may be housed within an infective virus that has been engineered to express a specific binding ligand. The virus particle will thus bind specifically to the cognate receptors of the target cell and deliver the contents to the cell. A novel approach designed to allow specific targeting of retrovirus vectors was developed based on the chemical modification of a retrovirus by the chemical addition of lactose residues to the viral envelope. This modification can permit the specific infection of hepatocytes via sialoglycoprotein receptors.
[000187] Another approach to targeting of recombinant retroviruses was designed in which biotinylated antibodies against a retroviral envelope protein and against a specific cell receptor were used. The antibodies were coupled via the biotin components by using streptavidin (Roux et al, 1989). Using antibodies against major histocompatibility complex class I and class II antigens, they demonstrated the infection of a variety of human cells that bore those surface antigens with an ecotropic virus in vitro (Roux et al, 1989).
[000188] Vector Delivery and Cell Transformation
[000189] Suitable methods for nucleic acid delivery for transfection or transformation of cells are known to one of ordinary skill in the art. Such methods include, but are not limited to, direct delivery of DNA such as by ex vivo transfection, by injection, and so forth.
Through the application of techniques known in the art, cells may be stably or transiently transformed.
[000190] Ex Vivo Transformation
[000191] Methods for transfecting eukaryotic cells and tissues removed from an organism in an ex vivo setting are known to those of skill in the art. Thus, it is contemplated that cells or tissues may be removed and transfected ex vivo using nucleic acids of the present invention. In particular aspects, the transplanted cells or tissues may be placed into an organism. In preferred facets, a nucleic acid is expressed in the transplanted cells.
Kits of the Invention [000192] Any of the compositions described herein may be comprised in a kit. In a non- limiting example, one or more cells for use in cell therapy and/or the reagents to generate one or more cells for use in cell therapy that harbors recombinant expression vectors may be comprised in a kit. The kit components are provided in suitable container means.
[000193] Some components of the kits may be packaged either in aqueous media or in lyophilized form. The container means of the kits will generally include at least one vial, test tube, flask, bottle, syringe or other container means, into which a component may be placed, and preferably, suitably aliquoted. Where there are more than one component in the kit, the kit also will generally contain a second, third or other additional container into which the additional components may be separately placed. However, various combinations of components may be comprised in a vial. The kits of the present invention also will typically include a means for containing the components in close confinement for commercial sale. Such containers may include injection or blow molded plastic containers into which the desired vials are retained.
[000194] When the components of the kit are provided in one and/or more liquid solutions, the liquid solution is an aqueous solution, with a sterile aqueous solution being particularly ueful. In some cases, the container means may itself be a syringe, pipette, and/or other such like apparatus, from which the formulation may be applied to an infected area of the body, injected into an animal, and/or even applied to and/or mixed with the other components of the kit.
[000195] However, the components of the kit may be provided as dried powder(s). When reagents and/or components are provided as a dry powder, the powder can be reconstituted by the addition of a suitable solvent. It is envisioned that the solvent may also be provided in another container means. The kits may also comprise a second container means for containing a sterile, pharmaceutically acceptable buffer and/or other diluent.
[000196] In particular embodiments of the invention, cells that are to be used for cell therapy are provided in a kit, and in some cases the cells are essentially the sole component of the kit. The kit may comprise reagents and materials to make the desired cell. In specific embodiments, the reagents and materials include primers for amplifying desired sequences, nucleotides, suitable buffers or buffer reagents, salt, and so forth, and in some cases the reagents include vectors and/or DNA that encodes a CAR as described herein and/or regulatory elements therefor. [000197] In particular embodiments, there are one or more apparatuses in the kit suitable for extracting one or more samples from an individual. The apparatus may be a syringe, scalpel, and so forth.
[000198] In some cases of the invention, the kit, in addition to cell therapy embodiments, also includes a second cancer therapy, such as chemotherapy, hormone therapy, and/or immunotherapy, for example. The kit(s) may be tailored to a particular cancer for an individual and comprise respective second cancer therapies for the individual.
[000199] Combination Therapy
[000200] In certain embodiments of the invention, methods of the present invention for clinical aspects are combined with other agents effective in the treatment of
hyperproliferative disease, such as anti-cancer agents. An "anti-cancer" agent is capable of negatively affecting cancer in a subject, for example, by killing cancer cells, inducing apoptosis in cancer cells, reducing the growth rate of cancer cells, reducing the incidence or number of metastases, reducing tumor size, inhibiting tumor growth, reducing the blood supply to a tumor or cancer cells, promoting an immune response against cancer cells or a tumor, preventing or inhibiting the progression of cancer, or increasing the lifespan of a subject with cancer. More generally, these other compositions would be provided in a combined amount effective to kill or inhibit proliferation of the cell. This process may involve contacting the cancer cells with the expression construct and the agent(s) or multiple factor(s) at the same time. This may be achieved by contacting the cell with a single composition or pharmacological formulation that includes both agents, or by contacting the cell with two distinct compositions or formulations, at the same time, wherein one composition includes the expression construct and the other includes the second agent(s).
[000201] Tumor cell resistance to chemotherapy and radiotherapy agents represents a major problem in clinical oncology. One goal of current cancer research is to find ways to improve the efficacy of chemo- and radiotherapy by combining it with other therapies. In the context of the present invention, it is contemplated that cell therapy could be used similarly in conjunction with chemotherapeutic, radiotherapeutic, or immunotherapeutic intervention, as well as pro-apoptotic or cell cycle regulating agents.
[000202] Alternatively, the present inventive therapy may precede or follow the other agent treatment by intervals ranging from minutes to weeks. In embodiments where the other agent and present invention are applied separately to the individual, one would generally ensure that a significant period of time did not expire between the time of each delivery, such that the agent and inventive therapy would still be able to exert an advantageously combined effect on the cell. In such instances, it is contemplated that one may contact the cell with both modalities within about 12-24 h of each other and, more preferably, within about 6-12 h of each other. In some situations, it may be desirable to extend the time period for treatment significantly, however, where several d (2, 3, 4, 5, 6 or 7) to several wk (1, 2, 3, 4, 5, 6, 7 or 8) lapse between the respective administrations.
[000203] It is expected that the treatment cycles would be repeated as necessary. It also is contemplated that various standard therapies, as well as surgical intervention, may be applied in combination with the inventive cell therapy.
[000204] Chemotherapy
[000205] Cancer therapies also include a variety of combination therapies with both chemical and radiation based treatments. Combination chemotherapies include, for example, abraxane, altretamine, docetaxel, herceptin, methotrexate, novantrone, zoladex, cisplatin (CDDP), carboplatin, procarbazine, mechlorethamine, cyclophosphamide, camptothecin, ifosfamide, melphalan, chlorambucil, busulfan, nitrosurea, dactinomycin, daunorubicin, doxorubicin, bleomycin, plicomycin, mitomycin, etoposide (VP 16), tamoxifen, raloxifene, estrogen receptor binding agents, taxol, gemcitabien, navelbine, farnesyl-protein tansferase inhibitors, transplatinum, 5-fluorouracil, vincristin, vinblastin and methotrexate, or any analog or derivative variant of the foregoing and also
combinations thereof.
[000206] In specific embodiments, chemotherapy for the individual is employed in conjunction with the invention, for example before, during and/or after administration of the invention
[000207] Radiotherapy
[000208] Other factors that cause DNA damage and have been used extensively include what are commonly known as .gamma. -rays, X-rays, and/or the directed delivery of radioisotopes to tumor cells. Other forms of DNA damaging factors are also contemplated such as microwaves and UV -irradiation. It is most likely that all of these factors effect a broad range of damage on DNA, on the precursors of DNA, on the replication and repair of DNA, and on the assembly and maintenance of chromosomes. Dosage ranges for X-rays range from daily doses of 50 to 200 roentgens for prolonged periods of time (3 to 4 wk), to single doses of 2000 to 6000 roentgens. Dosage ranges for radioisotopes vary widely, and depend on the half-life of the isotope, the strength and type of radiation emitted, and the uptake by the neoplastic cells.
[000209] The terms "contacted" and "exposed," when applied to a cell, are used herein to describe the process by which a therapeutic construct and a chemotherapeutic or radiotherapeutic agent are delivered to a target cell or are placed in direct juxtaposition with the target cell. To achieve cell killing or stasis, both agents are delivered to a cell in a combined amount effective to kill the cell or prevent it from dividing.
[000210] Immunotherapy
[000211] Immunotherapeutics generally rely on the use of immune effector cells and molecules to target and destroy cancer cells. The immune effector may be, for example, an antibody specific for some marker on the surface of a tumor cell. The antibody alone may serve as an effector of therapy or it may recruit other cells to actually effect cell killing. The antibody also may be conjugated to a drug or toxin (chemotherapeutic, radionuclide, ricin A chain, cholera toxin, pertussis toxin, etc.) and serve merely as a targeting agent.
Alternatively, the effector may be a lymphocyte carrying a surface molecule that interacts, either directly or indirectly, with a tumor cell target. Various effector cells include cytotoxic T cells and NK cells.
[000212] Immunotherapy other than the inventive therapy described herein could thus be used as part of a combined therapy, in conjunction with the present cell therapy. The general approach for combined therapy is discussed below. Generally, the tumor cell must bear some marker that is amenable to targeting, i.e., is not present on the majority of other cells. Many tumor markers exist and any of these may be suitable for targeting in the context of the present invention. Common tumor markers include PD-1, PD-L1, CTLA4, carcinoembryonic antigen, prostate specific antigen, urinary tumor associated antigen, fetal antigen, tyrosinase (p97), gp68, TAG-72, HMFG, Sialyl Lewis Antigen, MucA, MucB, PLAP, estrogen receptor, laminin receptor, erb B and pl55.
[000213] Genes
[000214] In yet another embodiment, the secondary treatment is a gene therapy in which a therapeutic polynucleotide is administered before, after, or at the same time as the present invention clinical embodiments. A variety of expression products are encompassed within the invention, including inducers of cellular proliferation, inhibitors of cellular proliferation, or regulators of programmed cell death.
[000215] Surgery
[000216] Approximately 60% of persons with cancer will undergo surgery of some type, which includes preventative, diagnostic or staging, curative and palliative surgery. Curative surgery is a cancer treatment that may be used in conjunction with other therapies, such as the treatment of the present invention, chemotherapy, radiotherapy, hormonal therapy, gene therapy, immunotherapy and/or alternative therapies.
[000217] Curative surgery includes resection in which all or part of cancerous tissue is physically removed, excised, and/or destroyed. Tumor resection refers to physical removal of at least part of a tumor. In addition to tumor resection, treatment by surgery includes laser surgery, cryosurgery, electrosurgery, and miscopically controlled surgery (Mohs' surgery). It is further contemplated that the present invention may be used in conjunction with removal of superficial cancers, precancers, or incidental amounts of normal tissue.
[000218] Upon excision of part of all of cancerous cells, tissue, or tumor, a cavity may be formed in the body. Treatment may be accomplished by perfusion, direct injection or local application of the area with an additional anti-cancer therapy. Such treatment may be repeated, for example, every 1, 2, 3, 4, 5, 6, or 7 days, or every 1, 2, 3, 4, and 5 weeks or every 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 months. These treatments may be of varying dosages as well.
[000219] Other Agents
[000220] It is contemplated that other agents may be used in combination with the present invention to improve the therapeutic efficacy of treatment. These additional agents include immunomodulatory agents, agents that affect the upregulation of cell surface receptors and GAP junctions, cytostatic and differentiation agents, inhibitors of cell adhesion, or agents that increase the sensitivity of the hyperproliferative cells to apoptotic inducers.
Immunomodulatory agents include tumor necrosis factor; interferon alpha, beta, and gamma; IL-2 and other cytokines; F42K and other cytokine analogs; or MIP-1, MlP-lbeta, MCP-1, RANTES, and other chemokines. It is further contemplated that the upregulation of cell surface receptors or their ligands such as Fas/Fas ligand, DR4 or DR5/TRAIL would potentiate the apoptotic inducing abililties of the present invention by establishment of an autocrine or paracrine effect on hyperproliferative cells. Increases intercellular signaling by elevating the number of GAP junctions would increase the anti-hyperproliferative effects on the neighboring hyperproliferative cell population. In other embodiments, cytostatic or differentiation agents can be used in combination with the present invention to improve the anti-hyerproliferative efficacy of the treatments. Inhibitors of cell adhesion are
contemplated to improve the efficacy of the present invention. Examples of cell adhesion inhibitors are focal adhesion kinase (FAKs) inhibitors and Lovastatin. It is further contemplated that other agents that increase the sensitivity of a hyperproliferative cell to apoptosis, such as the antibody c225, could be used in combination with the present invention to improve the treatment efficacy.
EXAMPLES
[000221] EXAMPLE 1: MATERIALS AND METHODS
[000222] Cells, culture media and reagents. Human C AIX+ renal cell carcinoma cell lines sk-rc-52, sk-rc-09 and CAIX- sk-rc-59 were obtained from Dr. Gerd Ritter, Memorial Sloan-Kettering Cancer Center, New York. They were cultured at 37°C with 5% CO2 in R- 10 complete medium containing RPMI 1640 medium (Life Technologies) supplemented with 10% FCS, 2 mmol/L L-glutamine, 100 U/ml penicillin, and 100 μg/ml streptomycin (Sigma). Primary human T cells were maintained in R-10 with 10% human serum and 100 IU/ml recombinant human interleukin 2 (IL-2) (Chiron). Human embryonic kidney cell line 293T (ATCC) and mouse fibroblast NIH3T3 cells (ATCC) were grown in D-10 complete medium (Life Technologies) containing DMEM medium with 10% FCS, 100 U/ml penicillin, and 100 μg/ml streptomycin (Sigma). Leukopacks obtained from the blood bank of the Children's Hospital Boston were collected from healthy volunteers with written informed consent.
[000223] In one embodiment, Human ccRCC cell lines, Skrc52, originally CAIX+/ PD- L1-, and Skrc59, originally CAIX-/PD-L1+, were obtained from Dr. Gerd Ritter (Memorial Sloan-Kettering Cancer Center, New York). These cells were cultivated in RPMI 1640 Medium (Life Technologies) supplemented with 10 % (v/v) heat-inactivated fetal bovine serum (FBS, Gibco), 100 IU/ml penicillin and 100 ug/ml streptomycin. 293T (CRL-11268, ATCC) and Lenti-X 293T (Clontech) cells were grown in DMEM Medium (Life
Technologies) supplemented with 10% FBS, 100 IU/ml penicillin and 100 μg/ml streptomycin. All cell lines used in this project were transduced with luciferase through lentiviral transduction and maintained at 37°C with 5% C02. The Skrc52 cells were selected for CAIX-/PD-L1- and CAIX+/PD-L1- cell populations by Fluorescence activated cell sorting (FACS) sorting. Skrc59 cells were engineered to express high levels of human CAIX and CAIX+/PD-L1+ were selected by FACS sorting.
[000224] Cloning of anti-PD-Ll scFv-Fc IgGl and IgG4 into a bicistronic lentiviral vector encoding an anti- CAIX 2nd generation CAR
[000225] The anti-PD-Ll antibody (Ab) used to construct the CART cells was previously selected using a 27-billion-member human scFv phage display library against a full length PD-L1 in the form of paramagnetic proteoliposomes (manuscript in preparation). The DNA sequences that encoded the anti-PD-Ll scFv (Clone 42)-Fc IgGl or IgG4 were codon optimized and synthesized (Genewiz) containing the restriction sites for 5' Ndel and 3' Clal to allow further scFv-Fc cloning to replace ZsGreen in the lentiviral vector pHAGE-elFa signal-scFvG36 (anti-CAIX)-C9TAG-linker-CD28-CD3C-IRES-ZsGreen (e.g. CD28z). This anti-CAIX original vector was previously constructed and published (21). For the cloning of the negative controls, firstly we replaced anti-PD-Ll scFv with an anti-Severe Acute Respiratory Syndrome (SARS) scFv (Clone 11 A) in the IgGl-Fc lentiviral vector containing the anti-CAIX G36 scFv CAR. The DNA sequence that coded for the anti-SARS scFv was amplified by PCR from the plasmid pHAGE CMV-Anti-SARS (11 A) scFv-Fc- CD28-gp41-IRES-ZsGreen to insert the restriction sites for 5' Mlul and 3' Xbal for further cloning using the MM forward primer 5' TCG ACG CGT GAG GTG CAG CTG GTG CAG T 3' and Xbal reverse primer 5' TCC TCTAGA CAG GAC GGT GAC CTT GGT CC 3'. The final pHAGE-elFa-scFv G36 (anti-CAIX)-C9TAG-linker-CD28-CD3C-IRES-anti- SARS (11 A) IgGl was used as one of the negative controls. We also replaced the anti- CAIX scFv in the CAR structure containing the anti-SARS IgGl for the anti-B cell maturation antigen (BCMA) scFv by double digestion of the pHAGE-eIFa-A716scFv (anti- BCMA)-C9TAG-linker-CD28-CD3C-IRES-ZsGreen and the pHAGE-eIFa-G36scFv(anti- CAIX)-C9TAG-linker-CD28-CD3C-IRES-anti-SARS(l lA) IgGl with Ncol and Notl. After the cloning processes we obtained four main plasmids to start the Lentiviruses production: Anti-CAIX CAR able to express anti-PD-Ll IgGl (anti-CAIX/anti-PD-Ll IgGl), anti- CAIX CAR able to express anti-PD-Ll IgG4 (anti-CAIX/ anti-PD-Ll IgG4), anti-CAIX CAR able to express an irrelevant anti-SARS Ab (anti-CAIX/anti-SARS IgGl) and anti- BCMA CAR able to express an irrelevant anti-SARS Ab (anti-BCMA/anti-SARS IgGl).
[000226] scFv isolation and conversion of scFv to scFv-Fc. CAIX-specific scFv antibodies were isolated from a non-immune human scFv phage library as previously reported and submitted to GenBank with accession numbers of GQ903548-GQ90356123. scFv-coding DNA fragments from the pFarber phagemid were digested with SflllNotl sites and subcloned into the mammalian expression vector pcDNA3.1-F105L-hinge-stuffer which has a human IgGl F105 leader sequence and the human IgGl hinge-CH2-CH3 Fc portion to express scFv-Fc antibodies. Plasmids of scFv-Fc were transiently transfected into 293T cells by lipofectamine 2000 (Invitrogen), and expressed antibodies were purified using Sepharose protein A beads (Amersham Bioscience). Specific binding to CAIX was tested by staining with phage scFv antibodies or scFv converted into scFv-Fc format antibodies by incubation with CAIX-expressing 293T and sk-rc-52 cell lines, and with CAIX negative 293T and sk-rc-59 cell lines. In these experiments, irrelevant anti-HIV CCR5 antibody (clone A8)25 or anti-SARS antibody (11 A)24 and fluorescently conjugated secondary antibodies alone were used as negative controls.
[000227] Construction of scFv-CD8-TCRζ and scFv-CD28-TCRζ constructs. Pzl, scFv- CD8-TCRC, and P28z, scFv-CD28-TCRC, DNA constructs in phagemid vector pSLl 180 were obtained from Dr. Michel Sadelain, Memorial Sloan-Kettering Cancer Center, New York. In Pzl, the scFv and TCRζ intracellular domain are appended to N- and C-terminus of human CD8a chain, respectively. Similarly, in P28z, the scFv and ΤΧ¾ζ sequences are appended to the N- and C-terminus of human CD28, respectively. The amino acid sequence of human CD8a is 71 residues in length, consisting of 47 (aa 137 - 183), 23 (aa 184 - 206), and 2 (aa 207 - 208) residues of the CD8a extracellular and hinge, transmembrane, and cytoplasmic domains, respectively. The CD28 sequence in P28z is 107 residues in length, consisting of 40 (aa 114 - 153), 23 (aa 154 - 176), and 44 (aa 177 - 220) residues of the CD28 extracellular, transmembrane, and cytoplasmic domains respectively. The human CD3ζ intracellular domain common to both CARs consists of 112 amino acids (aa 52-163).
[000228] The nucleic acid sequence encoding an internal C9-tag (a nine-amino acid peptide of human rhodopsin, TETSQVAPA) with a GGGGS linker was amplified by PCR and was fused upstream with CD8-TCRζ and CD28-TCRζ sequences with 5' Notl site and 3' Pad sites. The primers used for cloning chimeric TCRζ constructs are 5' TAG GGC GCG GCC GCa acc gag acc age cag gtg gcg ccc gec GGG GGA GGA GGC AGC CCC ACC ACG ACG CCA GCG CCG CGA 3' (forward primer for CD8 construct where italic is the Notl site, upper case is the C9 tag sequence, and underlining indicates the GGGGS linker), 5' TAG GGC GCG GCC GCa acc gag acc age cag gtg gcg ccc gec GGC GGA GGA GGC AGC ATT GAA GTT ATG TAT CCT CCT CCT 3' (forward primer for CD28 construct) and reverse primer for both constructs CTA GCC ΊΤΑΑΤ TAA ,ΤΤΑ GCG AGG AGG GGG CAG GGC CTG CAT, italic is Pac I site. These DNA fragments encoded functional features which are arranged in accordance with the following sequence: Notl - C9tag (TETSQVQPQ) - GGGGS - CD8 or CD28 - TCR-ζ - Pad. The chimeric TCR constructs tagged with internal C9 peptide were cloned into the pcDNA3.1-F105L-hinge stuffer vector containing anti-CXCR4 scFv-Fc, clone 48, using Notl and Pad restriction sites. This design allowed us to insert chimeric TCR receptor constructs to replace Fc portion fragment. Later, anti-CAIX scFv (clone G36) and anti-CCR5 scFv (clone A8, as irrelevant scFv control) antibody fragments were cloned to replace anti-CXCR4 scFv at SfillNotl sites to create CAIX-specific chimeric TCR constructs.
[000229] The lentivirus vector pHAGE-CMV-DsRed-IRES-ZsGreen, and four HIV helper plasmids pHDM-Hgpm2 (HIV gag-pol), pMD-tat, pRC/CMV-rev, and an Env VSV-G pseudotype were obtained from Dr. Richard Mulligan, of the Virus Production Core at The Harvard Gene Therapy Initiative in Boston. The CMV promoter in pHAGE-CMV-IRES- ZsGreen was replaced by an EFla promoter derived from the pSIN lentivirus vector at SpellNotl sites. One of the 5 scFv-Fc antibodies, G36, which possess high affinity to CAIX+ cells and high ADCC only against CAIX+ tumor cells, was cloned into pHAGE- EFla lentivirus vector at Asd/BamHl to replace the first cassette of the DsRed protein.
[000230] Production of lentivirus and transduction of human primary T cells. Lentivirus was produced by five plasmid transient transfection into 293T cells using lipofectamine 2000 as per the manufacturer's instructions (Invitrogen). Cells were prepared for 80% confluence in 15 cm Petri dishes (Nalge Nunc) and transfected with 30 μg of total plasmid DNA. The ratio of vector plasmids (pHDM-Hgpm2 (HIV gag-pol): pMD-tat: pRC/CMV- rev: Env VSV-G pseudotype) was 20: 1 : 1 : 1 :2. After changing to D-10 medium, virus supernatant was harvested on day 3, filtrated through a 0.45 μιτι filter, and concentrated by ultracentrifugation (Beckman Coulter, Fullerton, CA) for 90 minutes at 16,500 rpm (48,960 x g, Beckman SW28 rotor) and 4°C. The virus pellets were resuspended in R-10 medium and kept frozen at -80°C.
[000231] In one embodiment, Lentiviruses were produced by transient transfection of five plasmids into 293T cells using Polyethyleneimine (PEI). Briefly, each 80% confluent 293T cells in 15 cm plate (Nalge Nunc) was transfected with 30 μg of total five plasmids, being 5 μg of each structural plasmid pHDH-Hgpm2 (HIV gag-pol), pMD-tat; pRC/CMV-rev and Env VSV-G, and 10 μg of the main plasmid codifying the CAR (anti-CAIX/anti-PD-Ll IgGl, anti-CAIX/anti-PD-Ll IgG4, anti-CAIX/anti SARS IgGl or anti-BCMA/anti SARS IgGl). The virus supernatant was concentrated using Lenti-X Concentrator (Clontech), following the manufacturer instructions, and kept frozen at -80°C.
[000232] Human PBMCs were isolated by ficoll density gradient separation and were activated with 2 μg/ml PHA (Sigma) plus 100 IU/ml human IL-2 for 4 days. The cells were infected with two or three rounds of lentivirus transduction at multiplicity of infection (MOI) of 10-20 in the presence of 10 μg/ml DEAE. Three days after transduction, transduced T cells were collected for phenotypic and functional analyses in vitro, or were expanded for in vivo experiments.
[000233] Selection, activation and lentivector trasduction of CD8+ T cells. Blood collars collected from healthy volunteers with written informed consent were obtained from the blood bank of the Brigham and Woman's Hospital (Boston, MA). The isolation of human peripheral blood mononuclear cells (PBMCs) was performed using Ficoll-Paque PLUS (GE Healthcare, NJ). The Dynabeads for CD8 Positive Isolation (Life Technologies) were used to isolate CD8 positive cells from PBMCs, which were cultured in RPMI 1640 medium (Life Technologies) with 10% heat inactivated fetal bovine serum, 20mM HEPES, 100 IU/ml penicillin and 100 μg/ml streptomycin and 50 IU/mL of IL-21 (Peprotech) was added in the medium every 2 days. The assays performed to determine if IL-2 or IL-21 were the best cytokine to induce anti-CAIX CART cells proliferation were performed with 50 IU/mL of each cytokine. The CD8+ T cells were activated with Dynabeads Human T- Activator CD3/CD28 (Life Technologies) using a ratio of 1 : 1. The cells were transduced with the Lentiviruses at a multiplicity of infection of 20 and 10μg/mL of Diethylaminoethyl. All the assays were performed in triplicate and using T cells from three different healthy donors.
[000234] Flow cytometric analysis. Transduction efficiency of human primary T cells was assessed by expression of a reporter gene (ZsGreen). The CAIX-Fc protein was expressed from a pcDNA3.1 plasmid that encoded amino acids 38-397 of CAIX followed by human IgGl hinge, CH2 and CH3 domains, the CAIX signal peptide (aa 1-37) was replaced with Ig leader sequence. Expression of scFv(G250) on transduced T cells was tested by staining the cells with 1 μg CAIX-Fc protein, and then APC-conjugated mouse anti-human IgG antibody (Jackson ImmunoResearch). Additionally, expression of the internal rhodopsin nonapeptide (TETSQVAPA) C9 tag of the scFv domain of TCR constructs on transduced T cells was detected by staining with 5 μg mouse 1D4 antibody followed by APC-conjugated goat anti-mouse IgG antibody (Jackson ImmunoResearch). For analysis, the subsets of human cells in culture during clonal expansion experiment were stained with fluorescence conjugated mouse anti-human antibodies (Invitrogen) against CD3 (clone S4.1), CD4 (clone S3.5) or CD8 (clone 3B5). In all cell staining, five hundred thousand cells were stained with antibodies at recommended concentration according to company's instruction. The matched isotype control antibodies for each sample were used and the cells were analyzed using a FACSCalibur cytometer (Becton-Dickinson).
[000235] In one embodiment, transduction of 293T cells or CD8+T cells was confirmed by FACS analysis of the anti-CAIX or anti-BCMA expression. The cells were stained with 10 μg/mL of human CAIX-Fc produced in our lab or human BCMA-mouse-Fc (AB Bioscience) and then developed with 1 :250 APC-conjugated mouse anti-human IgG Ab (Southern Biotech) or goat-anti mouse IgG Ab (Biolegend), respectively. CountBrightTM Absolute Counting Beads (Molecular Probes) was used for the proliferation and clonal expansion assays. All samples were analyzed with an LSR Fortessa or with a FACSCalibur (BD Bioscience) and data were analyzed using FlowJo software. To analyze the status of T cell exhaustion of the CART cells they were cultured in the presence of IL-21 50U/mL (Peprotech) and Dynabeads Human T Activator CD3/CD28 for five days. After this period the CART cells were co-cultured with Skrc-59 CAIX+ PD-L1+ cells for 2 days in order to stimulate exhaustion. 1x106 CART cells from this assay and Tumor-infiltrating
Lymphocytes (TIL) collected from the in vivo assay were stained with FITC-conjugated anti-human PD-1, PE-conjugated anti-human Tim3, PerCP/Cy5.5-conjugated anti-human Lag3 antibodies (Biolegend) and Pacific Blue-conjugated anti-human CD45 and and analyzed by FACS. To verify the expression levels of CAIX and PD-L1 in the different RCC cell lineages used in this project, we used 10 μg/mL of the anti -human CAIX mAb (Clone G36), produced in our laboratory, and 10 μg/mL of the biotinylated mouse anti- human PD-L1 (Biolegend). The primary antibodies were detected using 1 :250 APC- conjugated anti-human Ab and PE-conjugated avidin, respectively, and analyzed by FACS.
[000236] ADCC and cytotoxicity assay of lentivirus transduced T cells. Cytotoxicity assays were performed using the DELFIA EuTDA Cytotoxicity kit (Perkin Elmer, Boston, MA) in accordance with the manufacturer's instructions. Briefly, target tumor cells were labeled with a fluorescent ligand (BATDA) for 30 minutes at 37 °C and 1 x 104 labeled cells were loaded per well in 96-well U-bottom plate. For antibody-dependent cellular cytotoxicity (ADCC) assay, a panel of anti-CAIX scFv-Fc antibodies or irrevelant scFv-Fc antibody at a concentration of 1 μg/ml or 5 μg/ml was added separately. The assay was set up with ratios of effector cells (human PBMC) to target cells (E:T) at 50: 1, 25: 1 and 12.5: 1. For the T cell cytoxicity assay, different ratios of effector cells (nontransduced or transduced T cells) to target cells (E:T) were prepared (100: 1, 50: 1 and 25: 1). The culture was incubated for 4 hours in humidified 5% C02 at 37°C. After the plate was spun for 5 minutes at 500x g, 20 μΐ of supernatant was transferred to a flat-bottom plate. 200 μΐ of Europium solution was added and the fluorescence released from the cells was read by fiuorometer (Victor™, PerkinElmer). The control for spontaneous release was prepared by culturing the labeling cells only and the control for maximum release was made by adding lysis buffer (kit provided) to the labeling cells.
[000237] ELISA, ELISPOT assays and Western blot. For cytokine secretion, RCC cell lines sk-rc-52 (CAIX+) or sk-rc-59 (CAIX-) were seeded overnight at 1 x 106 per well in a 24-well plate, followed by 1 x 106 untransduced or transduced T cells. Before co-culture with tumor cells, T cells were washed with PBS twice to remove human IL-2. After overnight incubation, the supernatant was harvested and analyzed for IL-2 and IFN-γ by ELISA (e-Bioscience). In detecting T cells for the IFN-γ ELISPOT assay (e-Bioscience), a membrane was developed using AEC substrate solution and the number of spots was counted by ELISPOT plate reader (C.T.L. Cellular Technology).
[000238] For Western blot, preparation of untransduced and transduced T cells was described50. One million cells were prepared in non-reducing and reducing buffer (0.1 M dithiothreitol) and run on a 10-20% polyacrylamide gradient gel (Invitrogen). Proteins were transferred to polyvinylidence fluoride transfer membrane (NEN Life Science Products, Boston, MA) at 100 V, 4°C overnight. The membrane was incubated with 1 :2000 primary antibody, anti-human ζ-chain monoclonal antibody 8D3 (BD Pharmingen, San Diego, CA) and then with 1 :3000 secondary antibody horseradish peroxidase (Caltag).
Immunodetection was performed using the ECL Plus Western blotting detection system (GE Healthcare, Piscataway, NJ) and x-ray film exposure.
[000239] Detection oflgG secreted by CART cells using ELISA. The total level of IgG secreted to the medium of transduced cells was detected using Human IgG ELISA
Quantitation Set (Bethyl Laboratories). The Anti-PD-Ll Abs secreted by transduced CD8+ CART Cells were purified with Protein A sepharose beads (GE Healthcare) and biotinylated using the EZ-Link Sulfo-NHS-LC-Biotin (Thermo Scientific). These antibodies were incubated with 5 μg/mL of human PD-L1 produced in the lab, which was pre-immobilized in MaxiSorp plates (Nunc) by 2 hours, RT. The biotinylated antibodies were detected by incubation with streptavidin-HRP for lh and developed with SureBlueTM TMB Peroxidase Substrate and TMB Stop Solution (KPL). The absorbance was read at λ=450 nm.
[000240] Proliferation, clonal expansion and cytokine secretion after tumor cell contact. Tumor cells were irradiated (3,000 rads) and seeded at 2.5 x 105 per well. T cells were added at 1 x 106 in culture medium containing R-10 plus 100 IU/ml human IL-2 for a week culture. T cells were split to maintain suitable density and re-stimulated with tumor cells weekly. The number of T cells was counted every 3 or 4 days for 2 weeks. The percentage expression of ZsGreen by transduced T cells and T cell subsets were determined weekly by fluorescence-activated cell sorting (FACS). For cytokine secretion studies after tumor cell contact, T cells that were in contact with irradiated tumor cells for one or two weeks were washed, incubated with fresh tumor cells overnight and culture supernatants were collected after 24 hrs for analysis.
[000241] Clonal expansion qfCAIX+ CART cells.
[000242] In one embodiment, Skrc52 CAIX+/PD-L1- and Skrc52 CAIX-/PD-L1- cells were irradiated with 3,000 rads and seeded at 2.5xl05 per well. lxlO6 T cells were added at the culture medium containing 50 IU/ml human IL-21 every two days. T cells were split to maintain suitable density and re-stimulated with tumor cells weekly. T cell number was counted once a week for 3 weeks by FACS.
[000243] Effect ofanti-CAIX CART Cells Secreting anti-PD-Ll antibodies on RCC cells viability and antibody-dependent cellular cytotoxicity (ADCC). 2.5x103 Skrc59 CAIX+/PD-L1+ and Skrc52 CAIX-/PD-L1- were plated in 96 wells plate ON. Four days after the CART cells transduction they were added to the RCC cells in the 25: 1, 50: 1 and 100: 1 ratio Effector cells: Tumor cells (E:T) and incubated ON. CART cells were removed and the viability of the tumor cells was assayed for MTT (Life Technologies). For the ADCC assay RCC cells were incubated for 1 hour, 37oC with 50 of the CART cells supernatant adjusted for 500 ng/mL of the respective Ab Anti-PD-Ll IgGl, Anti-PD-Ll IgG4 or Anti-SARS IgGl. The cells were then incubated with 12.5: 1, 25: 1 or 50: 1 NK cells for 4h, 37 oC, Lactate dehydrogenase (LDH) was measured in the supernatant by CytoTox 96® Non-Radioactive Cytotoxicity Assay (Promega).
[000244] ELISA assays to detect IL-2 and IFN released by functional CART cells. For analysis of cytokine secretion, 2.5x103 RCC cells Skrc59 CAIX+/PD-L1+ or Skrc52 CAIX-/PD-Ll-were seeded in 96 wells plates ON, followed by 5: 1, 25: 1 and 50: 1 CAR transduced T cells addition and incubation ON. The supernatant was removed and analyzed for IL-2 and IFNy secretion using the Human IFNy or Human IL-2 ELISA Ready-SET-Go Kit (eBioscience).
[000245] Orthotopic Renal Cell Carcinoma Model Establishment and CART-Cells Therapy. 5xl04 passaged Skrc59 CAIX+/PD-L1+ cells were suspended in 10 of culture medium and diluted 1 : 1 in Matrigel™ (Life Technologies) and injected into the left subrenal capsule of 6-8 week-old male NSG mice (N=35). After a week, tumor implantation was confirmed by bioluminescence (BLI) image using a Xenogen IVIS imaging system (Life Technologies) and 1.0x107 of each CAR T cell (anti-BCMA CAR/ anti-SARS IgGl, anti-CAIX CAR/anti SARS IgGl, anti-CAIX CAR/ anti-PD-Ll IgGl and anti-CAIX CAR/ anti-PD-Ll IgG4) or untransduced T cells were injected intravenously in the tail vein (Day 0); N=6 mice per group. The tumor BLI was quantified after 7, 14, 23 and 30 days of CART cells injection. A second injection of 2.5xl06 CAR or untransduced T cells was made on day 17. Mice were sacrificed at 30 days post tumor engraftment by standard C02 inhalation, and tumors were harvested and weighted. The kidney tumors from all mice were divided in two equal parts and one of them was fragmented in small pieces and digested with collagenase 0.5U/mL and DNAse 1.0 mg/mLto TIL extraction, which were analyzed for the expression of the exhaustion markers and the percentage of CART cells by FACS. The other part was fixed in 10% buffered formaldehyde, and submitted to
immunohistochemistry for different markers. Two mice of each group were injected with 4.5x106 NK cells 2 days before the euthanasia. NK cells present in the tumor were stained with APC-Anti-CD56 Ab and analyzed by FACS. Animal experiments were performed in accordance with the guidelines of the DFCI Animal Care Committee.
[000246] Tumor establishment and T cell therapy. In one embodiment, due to immune- rejection of sk-rc-52 in 6-8 week-old female BALB/c nude mice and to accelerate in vivo growth properties, five million cells were subcutaneously inoculated into the mice, harvested, and expanded in vitro. The cell line was then passaged two more times in nude mice and the passaged cells were expanded for further experiments (subclone 4-1). For the therapeutic experiments, 5 million sk-rc-59 and 7.5 million passaged sk-rc-52 cells were subcutaneously inoculated on opposing flanks into nude mice to yield comparable tumor growth rates. After 7 days, tumors grew to the size of ~6 mm, and 50 million nontransduced or transduced T cells were injected intravenously. The mice were also treated with 20,000 IU human IL-2 by peritoneal injection every two days. Tumor size was measured by caliper in two dimensions and the mean of two tumor diameter was reported here. Animal experiments were performed in accordance with the guidelines of the Dana Farber Cancer Institute Animal Care Committee. Mice were sacrificed when tumors reached 15-mm diameter or 2,000 mm3 and tumors were harvested.
[000247] Immunohistochemistry and immunofluorescence staining. For in vitro examination of transduced T cells, the cultured T cells were washed twice using PBS and resupended in 2μΜ Far Red DDAO-SE CellTrace dye (Molecular Probe) in PBS for 15 minutes at 37°C. Then the cells were washed with culture medium twice and cytospun on the glass slide. Far red pre-stained CART cells with ZsGreen coexpression were visualized using confocal microscopy (Zeiss) at the Optical Imaging Core facility, Harvard
NeuroDiscovery Center.
[000248] To examine the killing effect of transduced T cells in tumor bed in situ, tumors were prepared for frozen sections for ApopTag Peroxidase In Situ Apoptosis Detection kit (Millipore). Cryosections were incubated with TdT enzyme (Millipore) for 1 hour. Rabbit anti-DIG (Dako) was added and incubated for 30 minutes and then Cy 3 -conjugated anti- rabbit antibody (Invitrogen) was added and incubated for 30 minutes. Sections were mounted with DAPI antifade mounting medium and fluorescent images were examined using confocal microscopy.
[000249] Xenograft tumors and mouse spleens were harvested, fixed in 10%
formalin/PBS solution, and submitted to the Harvard Medical School, Rodent Histopathology Core Facility. Paraffin-embedded sections were dewaxed with xylene and rehydrated through graded alcohols before staining. Immunohistochemistry staining was performed by incubating with anti-human granzyme B antibody (Dako, clone GrB-7 (1 :200)) as a primary antibody for 1 hour followed by secondary anti-rabbit antibody (Pierce) or anti-mouse antibody (Dako) for 30 minutes. Sections were developed using DAB substrate and counterstained with hematoxylin.
[000250] In one embodiment, the fixed tumors were paraffin-embedded, sectioned at four- micrometer, placed on slides and prepared for IHQ. The tissues were stained with the anti human: Ki67 (Vector, VP-K451), PD-L1 (Clone 405.9A11, produced in Dr. Gordon Freeman's lab), granzyme B (Abeam, ab4059) or NCAM (CD56) (Abeam, abl33345) antibodies, followed by secondary HRP conjugated anti -rabbit Ab or HRP-Avidin. The slides were developed using DAB and counterstained with hematoxylin. The images were obtained in an Olympus BX51 microscopy using a DP71 digital camera (Olympus) and analyzed in the DP Controller Software (Olympus). The image quantification was performed using the IHC Profiler Plugin of ImageJ Software as described in Varghese F, Bukhari AB, Malhotra R, De A. IHC Profiler: an open source plugin for the quantitative evaluation and automated scoring of immunohistochemistry images of human tissue samples. PloS one. 2014;9:e96801.
[000251] Statistical analyses.
[000252] Statistical significance was determined using the two-tailed Student's /-test.
[000253] The statistical analysis associated with Figures 16-23 are reprentative of at least three experiments unless otherwise noted. The statistical significance of the data was evaluated using AN OVA and Tukey posttest. P<0.05 was considered significant. The statistical analysis was performed using the IBM SPSS Statistics software version 20.
[000254] EXAMPLE 2 : ADCC MEDIATED KILLING OF ANTI-CAIX ANTIBODIES AND
CHOICE OF CAR TARGETING MOIETY.
[000255] We have previously reported on a panel of high affinity human anti-CAIX antibodies that differed in their epitope mapping, expression levels and ability to internalize CALX23. Our first aim was to investigate the anti-tumor activity of five of these anti-CAIX single-chain antibodies as candidates for CAR construction. To test for anti-CAIX mAb mediated ADCC, the scFvs were converted to scFv-Fc (hlgGl) minibodies23. We found that all scFv-Fcs exhibited antigen-specific tumor lysis. For tumor cell line sk-rc-09 with high CAIX+ expression, specific lysis ranged from 40-57% and for sk-rc-52 with moderate CAIX+ expression, specific lysis ranged from 46-60%, with background of lysis of < 5% for the CAIX- tumor cell line sk-rc-59. For negative control scFv-Fcs such as anti-CXCR4 48-Fc23 and anti-SARS 11 A-Fc24, only background levels of cell lysis were seen (Fig. 1). Based on ADCC killing and other published analyses, scFvG36 was chosen for further evaluation as the CAR targeting moiety.
[000256] Construction and expression of CAIX-specific chimeric receptors. Two generations of anti-CAIX CARs were constructed: 1st generation G36 CD8 CAR, with scFvG36 linked to CD8, truncated extracellular, hinge, and transmembrane domains plus signaling domain of TCRζ (G36-CD8z). To deliver costimulatory signals, 2nd generation CD28 CAR was generated, consisting of scFvG36 fused to truncated extracellular, transmembrane and intracellular domains of CD28 plus signaling domain of ΚΤΙζ (G36- CD28z) (Fig. 2A). Irrelevant 2nd generation CD28 CAR was made by using anti-HIV CCR5 (clone A8) scFv instead 15. In order to detect the expression of these constructs, human rhodopsin C9 tag were inserted between the scFv and CD8 or CD28 domains, respectively and ZsGreen was expressed after the IRES sequence. High concentrations of viral stocks were obtained at comparable levels among the different constructs that were tested by cotransfection of vector plasmids into 293T cells (data not shown).
[000257] For transduction, PHA mitogen was used to stimulate peripheral blood lymphocytes for 3 days. Concentrated lentivirus supernatants were used to infect human primary T cells in the presence of cationic reagent DEAE as it increased the transduction rate of 1.5-2x fold as compared with polybrene (data not shown). The transduction rate of primary T cells ranged from 17% to 45% by ZsGreen expression in FACS analysis. A representative experiment showing ZsGreen expression in circa 25% by primary CART cells following lentivirus transduction is shown in Fig. 2B, left column. CAIX-Fc fusion protein can bind to the G36-CD8z and -CD28z CART cells but not to control A8-CD28z CART cells (Fig 2B, middle column). C9-tag expression was only detected at circa one- third the level of the CAIX-Fc protein (Fig 2B, right column) which is likely related to the finding that mAb 1D4 preferentially recognizes the rhodopsin nonapeptide C9 when presented as a carboxy -terminal verses internal polypeptide sequence (data not shown). Transduced cells that were cultured in vitro for 6 weeks maintained their expression of ZsGreen. [000258] On Western blot under reducing conditions, G36 and A8 CD28z CARs migrated with a mol wt of circa 53kD whereas endogenous TCRζ was 16 kDa. G36-CD8z CAR migrated with a mol wt of circa 48 kD. Under nonreducing conditions, these two CD28z CARs formed homodimers (Fig. 2C, data of CD8z CAR not shown).
[000259] EXAMPLE 3: ENHANCED CYTOKINE SECRETION BY TRANSDUCED T CELLS ON
CONTACT WITH CAIX+ TUMOR.
[000260] A study was performed to compare the reported superior effects of using 2nd generation G36-CD28z CART cells that incorporate signaling components of the costimulatory molecule CD28 to bypass MHC presentation and enhance T cell effector functions verses 1st generation G36-CD8z CART cells. As seen in Fig 3A, after incubation with CAIX+ sk-rc-52 cells overnight, only low levels of type I cytokines IL-2, IFNy and IL- 17 secretion were seen with control A8 CD28z CART cells or LAK cells alone. In contrast, both 1st and 2nd generation G36 expressing CART cells showed elevated levels of cytokine secretion with 2nd generation G36-CD28z CART cells secreting higher amounts of type I cytokines which reflects their higher activation status compared to 1st generation G36-CD8z CART cells. Specifically, G36-CD28z CART cells secreted 6.5X, 2.3X and 4X more IL-2, IFNy and IL-17, respectively than G36-CD8z CART cells. Specificity of cytokine secretion induction by the two G36 CART cells is seen by their minimal stimulation with CAIX- sk- rc-59 cells.
[000261] In an Elispot study, after interaction with CAIX+ sk-rc-52 tumors, G36-CD28z CART cells became high capacity IFN- y producing cells (Fig 3B). G36-CD28z CART cells produced 6 times more spots than seen for G36-CD8z CART cells upon interaction with CAIX+ sk-rc 52 tumor cells and 12 times more spots than seen after interaction with CAIX- sk-rc-59 tumor cells. Similarly, G36-CD28z CART cells had a higher amount of granzyme B-secreting spots after contact with CAIX+ tumors as compared with G36-CD8z CART cells and control T cells. PMA and ionomycin stimulated T cells yielded the highest amount of IFN- y and granzyme B secreting T cells. These studies demonstrate both specificity and high capacity of G36-CD28z CART cells to be activated by contact with CAIX+ tumor cells.
[000262] EXAMPLE 4 : SPECIFIC CYTOTOXICITY VIA CAR SIGNALING IN TRANSDUCED T CELLS. An in vitro cytotoxicity assay was established to further evaluate the killing activity of the different G36 CART cells. Using different ratios of effector-to-target, G36-CD28z CART cells and its' twice in vivo passaged subclone 4-1 exhibited the highest amount of cytolysis of CAIX+ tumor sk-rc-52 (Fig 3C). With high ratio of more than 25: 1, G36- CD28z CART cells showed 2-3 fold higher cytotoxicity than G36-CD8z CART cells and with low ratio of 5: 1, G36-CD28z CART cells showed 8-9 fold higher lysis than G36-CD8z CART cells. However, G36-CD8z CART cells still exhibited good cytotoxicity with up to more than 60% tumor lysis using 100: 1 of E:T ratio. Irrelevant A8-CD28z CART cells and control T cell LAK showed the background non-specific tumor lysis with around 20% lysis when using the highest 100: 1 of E:T ratio. In all cases of using CAIX- tumor sk-rc-59, transduced and untransduced T cells showed background lysis.
[000263] EXAMPLE 5 : IMPROVED IN VITRO PROLIFERATION IN CART CELLS WITH
PROLONGED CAIX+ TUMOR.
[000264] Besides enhanced cytokine secretion and cytotoxicity on short term CAIX+ tumor cell contact, incorporation of the CD28 costimulatory molecule into the CAR construct demonstrated improved proliferation upon prolonged contact with antigen-specific tumor cells. Untransduced and transduced (around 20%) T cells were mixed with freshly irradiated tumor cells weekly in the presence of 100 units/ml human IL-2. To test the different levels of antigen stimulation to a fixed amount of T cells, we used tumor cell to T cell ratios of 1 :8, 1 :4 and 1 :2. T cell numbers were counted by trypan exclusion and CART cell fractions were examined by flow cytometry. Under culture with CAIX- sk-rc-59 tumor cells, the number of transduced and untransduced T cells was maintained (Fig 4A bottom). The lack of basal level of proliferation of control T cells might be due to the high amount of suppressive cytokines secreted by the tumor cell line. In contrast, after two weeks of culture with CAIX+ sk-rc-52 tumor cells, at ratio 1 :8, the population of G36-CD28z CART cells increased to 30-fold and G36-CD8z CART cells proliferated up to 17-fold whereas at a ratio of 1 :4, the number of G36-CD28z CART cells increased 19-fold and G36-CD8z CART cells proliferated 4-fold. With higher amounts of tumor cells, neither G36-CD28z or G36- CD8z CART cells could proliferate. Irrelevant A8-CD28z CART cells and control T cell LAK showed no proliferation with tumor cells (Fig. 4A top).
[000265] Proliferating T cells were also harvested to examine their enrichment on CAIX+ tumor cell contact. On CAIX- tumor contact, there was no change in the percentage of any CART cells within the population. However on contact with CAIX+ sk-rc-52 tumor cells, there was enrichment in both populations of G36 CART cells. For G36-CD28z CART cells, the positive population was enriched from 18% on day 0 to 52% on day 8 to 88% on day 16. Expression of G36-CD8z CART cells was enriched from 19% on day 0 (same levels at T cells only) to 32% on day 8, and to 72% on day 16. No expansion of A8-CD28z CART cells was seen over the two week study (Fig. 4B). The percentage of CD8 cells remained constant throughout the 16 day study under all conditions (Fig 4C).
[000266] EXAMPLE 6 : PERSISTENT EFFECTOR FUNCTION OF CART CELLS AFTER RE- CONTACT WITH TUMOR.
[000267] Transduced T cells that were in contact with irradiated tumor cells for one or two weeks were also tested for cytokine secretion after 24 hours of contact with fresh non- irradiated tumor cells. Upon contact with CAIX+ tumor (sk-rc-52) for one or two weeks, G36-CD28z and G36-CD8z CART cells showed similar IFN- γ secretion levels although costimulatory signaling through G36-CD28z CAR yielding 2x to 2.5x more IFN- γ secretion than seen for G36-CD8z CAR (Table 1). For IL-2 secretion, two weeks of tumor contact for G36-CD28z and G36-CD8z CART cells exhibited more IL-2 secretion than one week of contact. G36-CD28z CART cells yielding 5x more IL2 than G36-CD8z CART cell on one week of contact and 2.5x more on contact for two weeks. In addition, G36-CD28z CART cells in contact with tumor cells for two weeks secreted 3.3x more IL-2 than one time tumor contact whereas G36-CD8z CART gave 6.8x more IL-2 secretion after two weeks compared to after one week of tumor contact. These results indicate that the transduced CART cells did not become exhausted and maintained functional activity after a second tumor stimulation. Only background levels of INF-γ and IL-2 secretion were seen with A8-CD28z, LAK and G36 CART cell treatments on contact with CAIX- sk-rc59 cells.
[000268] EXAMPLE 7: SUPPRESSION OF ESTABLISHED TUMOR BY CART CELLS.
[000269] We next tested CART cells to inhibit established tumor cell growth in nude mice that were inoculated with sk-rc-52 tumor cells on left flank and sk-rc-59 tumor cells on right flank that had been established to yield similar tumor curves. On day 7 after tumor implantation, with typical tumor size of -6x6 mm, 50 million G36-CD28z CART cells, A8- CD28z CART cell or untransduced T cells (LAK) were injected intravenously. Adoptive T- cell therapy was performed in two separate experiments with group sizes of n=7 in the first trial and n=8 in the second trial, in the presence of high dose IL-2 (2 x 105 IU) via intraperitoneal injection. No T-cell treatment was included in order to compare the growth of tumor and the effect of cell-therapy. [000270] In trial one, treated and untreated CAIX- sk-rc-59 tumors had average size of 6.09 ± 0.02 mm on day 4 and 9.29 ± 0.12 mm on day 25 (within four tested groups). They exhibited the same tumor growth rate in control groups and T-cell treated groups. Untreated CAIX+ tumors that received no T cells showed similar tumor size as CAIX- tumors, with an average size of 6.09 ± 0.13 mm on day 4 and 9.15 ± 0.11 mm on day 25. However, the tumor size of G36-CD28z CART cell treated mice showed statistically significant reduction in size compared to no T-cell treated mice at every time point that was examined over the 25 day study (Fig. 5). G36-CD28z CART treatment also led to a greater reduction in tumor size than seen with A8-CD28z CART cell and LAK treated mice on day 7 (p<0.05) and on day 25 (p<0.00\), as calculated by two-tailed t test. In trial two, tumor size of G36-CD28z CART cell treated mice was significant smaller than that of no T-cell treated mice through the 29 day experiment. G36-CD28z CART cell treated mice also had smaller tumors than were seen with A8 CD28z CART cell and LAK treated mice on day 8 to day 26 with p<0.0\ and on day 29 with /K0.001 (Fig. 5).
[000271] Partial regression of CAIX+ tumor was considered when the tumor size was smaller than 30% volume of control CAIX- tumor in a same mouse receiving the same T- cell. Partial tumor regression was observed in a high percentage of cases using G36-CD28z CART cells (10 out of 15, (67%)), but only infrequently in irrelevant target A8-CD28z CART cells (1 out of 15, (7%)) and in activated T cell LAKs (2 out of 15, (13%)) (Table 2). Frequency of partial regression response was found to be statistically significant for mice treated with G36-CD28z CART cells versus control A8-CD28z CART cells and LAKs at /?<0.001 and /?<0.005, respectively by Fisher test.
[000272] EXAMPLE 8 : IN SITU CYTOTOXICITY BY CART CELLS.
[000273] A sample of the whole population of transduced T cells used for the in vivo study were pre-stained with Far red dye and the CART cells expressing ZsGreen protein within the population were analyzed by confocal microscopy. These results demonstrated circa 30% transduction efficiency which is in agreement with our FACS analysis (Fig 6A).
[000274] To provide evidence that G36-CD28z CART cell treatment of CAIX+ sk-rc-52 tumor cells in vivo resulted in killing by apoptosis, tumor sections were stained by Tunnel assay. On day 3 after adoptive T cell treatment, Tunnel staining identified apoptotic tumor cells (red) at the edge of tumor (Fig. 6B upper row) and inside the tumor bed (Fig. 6B middle row). The apoptoic tumor cells lost the DAPI nuclear staining. Shown in the enlarged graph (Fig. 6B bottom row) is a ZsGreen expressing CART cell interacting with two tumor cells that were going apoptosis.
[000275] Due to the limitation of fluorescent signal, ZsGreen expressing CART cells could not be observed from the whole tissue section. Therefore on day 3 after G36-CD28z CART cell or LAK treatment, the tumors were harvested and sections were also stained with granzyme B antibody to locate the activated T cells. In Fig 6C, the dark brown areas of staining show granzyme B+ T cells that are seen infiltrating into the CAIX+ sk-rc-52 tumor sections (Fig. 6C upper left). These granzyme B+ T cells were seen surrounding the tumor (Fig. 6C upper left (a) and middle) and inside the tumor (Fig. 6C upper left (b) and lower). Tumors with necrotic areas were shown in H&E stained slides (labeled as n inside Fig. 6C right middle and lower) and lie at locations near to the granzyme B+ T cells. In contrast, the CAIX+ sk-rc-52 tumors treated with control activated T cells (LAK) (Fig. 7) did not show any granzyme B+ T cells. Similarly, CALX- sk-rc-59 treated with G36-CD28z CART cells (Fig. 8) or treated with LAK (Fig. 9) showed a low background staining while tumor was proliferating. For positive control of granzyme B staining, CART cells was locally injected into the established sk-rc-52 tumor in mice. After one day, the mice was sacrificed and tumor tissue was sectioned for this staining (Fig. 10).
Figure imgf000080_0001
levels <50 pg/ml IFN-^ and <10 g ml IL-2.
Figure imgf000081_0001
[000276] EXAMPLE 9 : ANTI-CARBONIC ANHYDRASE IX CHIMERIC ANTIGEN RECEPTOR T
CELLS RELEASING ANTI-PD-Ll ANTIBODIES REVERT T CELL EXHAUSTION AND REGRESS RENAL CELL CARCINOMA IN A HUMANIZED MOUSE MODEL
[000277] Characterization of anti-CAIX CAR T cells secreting anti-PDLl IgGl or IgG4
[000278] In order to develop a new CAR therapy for CAIX+ RCC, we engineered a bicistronic lentiviral vector to express the anti-CAIX (G36) scFv linked to CD28 and Οϋ3-ζ signaling domains (G36-CD28z CAR in the first cassette and anti-PD-Ll IgGl or IgG4 in a second expression cassette after an IRES site (Figure 16A). The anti-PD-Ll IgG sequence was inserted into the lentiviral vector with the aim to block T-cell exhaustion, which we propose may imporve the efficacy of G36-CD28z CART cells (Figure 16B). As controls, we used an anti-CAIX CAR or anti-BCMA CAR containing an irrelevant anti-SARS IgGl mAb in the second cassette. The lentiviruses generated from these constructs were transduced into CD8 T cells and cultivated in the presence of IL-21, which yielded CART cells with modestly improved proliferation than was seen with IL-2 (Figures 21 A and 2 IB), while maintaining the same specific killing activity for CAIX+ RCC (Figures 21 C and 21D). The percentage of CAIX and PD-L1 expression in all RCC lineages used in our experiments is shown in the Figure 22. [000279] The CART cell functionality is demonstrated in Figure 23, where CD8 T cells transduced with all CARS were able to proliferate in the presence of IL-21 and anti- CD8/CD28 beads (Figures 23A and 23B), achieving transduction levels of 65-90% after four days (Figure 23C). Fourteen days after transduction, we evaluated the stable long-term expression of CAR by the integrated lentiviruses (Figure 16C), which was maintained around 25-50% for all CARs. Total IgG levels secreted by CD8 T cells was also determined, ranging around 300-650 ng/mL after 4 days (Figure 16D). The binding specificity of the anti-PD-Ll IgGl and IgG4 antibodies for human PD-L1 was also confirmed (Figure 16E). The levels of biotinylated anti-PDLl IgGl and 4 were significantly lower than total IgG, which could be explained by the fact that a portion of the IgG was wasted during the purification process. The ability of anti-CAIX CART cells to undergo clonal expansion in the presence of CAIX+ RCC cells was established (Figures 16F and 16G). Anti-CAIX CART cells cannot expand significantly in the presence of CAIX- RCC cells.
[000280] Effector Activity of Anti-CAIX CART Cells. All anti-CAIX CART cells were able to induce around 50-70% decrease in the viability of Skrc59 CAIX+/PD-L1+, indicating that the Anti-PD-Ll IgGl and IgG4, secreted by some CART cells, did not augment cell death under these assay conditions (Figure 17 A). Anti-CAIX CART cells induced IL-2 and IFNy release in the presence of CAIX+/PD-L1+ cells, indicating the specific activation of anti-CAIX CART cells (Figures 17C and 17E, respectively).
Regarding the anti-CAIX CART cells secreting anti-PD-Ll IgGs, the unique differential effect was seen for the IgGl isoform, which was able to induce around 60% of ADCC in CAIX+/PD-L1+ RCC cells when incubated with natural killer cells (NK) (Figure 17G). No effect in cell viability, cytokines secretion or ADCC was detected for any of the CART cells in the presence of CAIX-/PD-L1- cells (Figures 17B, 17D, 17F and 17H).
[000281] Anti-CAIX CART cells-secreting anti-PD-Ll antibodies can diminish T cell exhaustion in vitro. A circa 50% decrease in the exhaustion markers Lag-3, Tim3 and PD-1 was found in the anti-PD-Ll IgGl and IgG4 anti-CAIX CART groups (Figures 18 A, 18B and 18C, respectively) after induction of exhaustion compared to the parental anti-CAIX or irrelevant anti-BCMA CART cells. At this point, the killing activity of anti-CAIX CART cells without anti-PD-Ll was retested over Skrc59 CAIX+/PD-L1+ cells. As can be seen in Figure 18D, the anti-CAIX CART cells had lost their killing activity against CAIX+/PD- L1+ RCC in vitro to a level that was similar to the irrelavent CAR group, establishing that the anti-CAIX CART cells became anergic. In contract, the RCC viability diminished 25- 50% for the anti-CAIX CAR anti-PD-Ll IgGl and IgG4 CART groups, thereby providing evidence that the checkpoint blockade elicited by the presence of sectreted anti-PD-Ll IgGs can lead to diminished T cell exhaustion.
[000282] Anti-CAIX CART cells secreting anti-PD-Ll antibodies can further decrease tumor growth in an orthotopic mouse model of human RCC NSG mice were used to establish an orthotopic RCC model by injecting Skrc-59 CAIX+PD-Ll+luciferase+ positive RCC cells under the kidney capsule followed by i.v. injection of 1.0x107 CART or untransduced T cells (Day 0) and repeat treatment on Day 17 with a lower dose (2.5xl06) of the same cells. We did not treat the mice with systemic IL-2 to maintain the proliferation of CART cells to avoid the bias that this molecule could exert over the tumor growth. The data in Figures 19A-19C demonstrate that all three anti-CAIX CART cell groups showed decreased RCC growth compared to irrelevant anti-BCMA CART cells or untransduced cells over the course of the experiment with the marked anti-tumor effects of the anti-CAEX CART cells secreting anti-PD-Ll IgGl or IgG4 becoming evidenct at day 23 and 30 (Figure 19A and 19B). However, even one week after i.v. treatment with CART cells, we observed that the tumors were 2-3 times smaller in the anti-PD-Ll -secreting CART cells when compared with parental anti-CAIX CART cells and the two control groups (Figure 24A). We also analyzed CD45+ T cell survival in the mouse blood to gauge their survival in this passive transfer model. At Day 8 we observed that the amount of human T cells within the PBMCs was only 10-15% (Figure 24B) and for this reason we decided to expand the CART cells in vitro to perform a second injection into the mail blood at Day 17. One week after the second injection (Day 23) the anti-PD-Ll IgGl and IgG4 groups had tumors 15 times smaller than the control groups and 5 times smaller than the anti-CAIX CAR T cells without anti-PD-Ll secretion (Figure 19C and Figure 24A). At day 30, the group of mice treated with CART cells-secreting anti-PD-Ll antibody had tumors 5 times smaller than the control groups (Figure 19C and Figure 24A). The excised tumors weights were also lower from the mice treated CART cells-secreting anti-PD-Ll antibody and that was particularly evident for the anti-PDLl IgG4 antibody group (Figuresl9B and 19D). [000283] Analysis of CART cell tumor infiltrates and evidence that anti-CAIX CART cells secreting anti-PD-Ll antibodies can lead to reversal of T cell exhaustion. Analysis in the excised tumors showed around 10% of TIL in all groups (Figure 24C)
[000284] One of the most important effects observed with the anti-CAIX CART cells secreting anti-PD-Ll IgGl or IgG4 antibodies in vivo was their ability to decrease the expression of the exhaustion markers PD-1, Tim-3 and Lag-3. As shown in Figure 20 A, we observed a circa 40-50% decrease in the expression of these markers in the TIL's when compared with the treatment using untransduced control cells at the Day 30 There was also a circa 30-70% decrease compared to anti-CAIX CAR cells That were not secreting anti- PDL-1 antibodies thereby providing evidence that the locally secreted antibodies had an effect on decreasing T cell exhaustion.
[000285] The effector activity of CART cells and their influence over RCC proliferation in vivo was evaluated by the immunohistochemical detection of granzyme B in the TIL, the tumor proliferation marker Ki67 and the tumor immunosuppressive proteinPD-Ll (Figures 20B and 20C). The granzyme B staining showed the effector activity of CD8+ cells, especially in the RCC tumorstreatedwith the anti-CAIX CART cells secreting anti-PD-Ll IgG4, which presented an augmented percentage of high positive stained cells (Figure 20B and 20C). PD-L1 expression decreased dramatically in the tumors treated with Antianti- CAIX CART cells, being more expressive in the Anti-CAIX/ Anti-PD-Ll IgG-secreting groups (Figures 20B and 20C). Ki67 expression decreased significantly in the Anti- CAIX/ Anti-PD-Ll IgG-secreting groups, as we can visualize in the total DAB pixel count graph, however when the intensity among the positive nuclei staining (Ki67 IHC quantification graph) was evaluated, we can note that the Anti-CAIX/ Anti-PD-Ll IgG4 presented the lowest intensity of Ki67 expression (Figures 20B and 20C). For the quantification of nuclear proteins, like Ki67, DAB staining pattern is confined to the nuclei, and the threshold feature of ImageJ should be used to select the positive stained areas for quantification. For this reason, there are no negative cells in the Ki67 IHC quantification graph (Figure 20C) and DAB pixel count were also shown for evaluation of total Ki67 staining, including negative cells (Figure 20C).
[000286] Anti-CAIX CART cells secreting anti-PD-Ll IgGl antibodies can recruit NK cells to the tumor. The tumors of the mice treated with Anti-CAIX/ Anti-PD-Ll IgGl that received an injection of NK cells 2 days before the euthanasia showed the presence of 40% more NK cells inside the tumor, when compared with Anti-BCMA/Anti-SARS IgGl, as detected by Anti-CD56 staining by FACS (Figure 25A). The increase in NK cells in the Anti-CAIX/Anti-PD-Ll IgGl group was also detected and quantified by IHC (Figure 25B). Very few NK cells were also detected in the groups treated with CART cells secreting an unspecific IgGl Ab.
[000287] OTHER EMBODIMENTS
[000288] While the invention has been described in conjunction with the detailed description thereof, the foregoing description is intended to illustrate and not limit the scope of the invention, which is defined by the scope of the appended claims. Other aspects, advantages, and modifications are within the scope of the following claims.
REFERENCES
1. Ivanov S, Liao SY, Ivanova A, Danilkovitch-Miagkova A, Tarasova N, Weirich G et al. Expression of hypoxia-inducible cell-surface transmembrane carbonic anhydrases in human cancer. Am J Pathol 2001; 158(3): 905-19.
2. Loncaster JA, Harris AL, Davidson SE, Logue JP, Hunter RD, Wycoff CC et al. Carbonic anhydrase (CA IX) expression, a potential new intrinsic marker of hypoxia: correlations with tumor oxygen measurements and prognosis in locally advanced carcinoma of the cervix. Cancer research 2001 ; 61(17): 6394-9.
3. Hilvo M, Baranauskiene L, Salzano AM, Scaloni A, Matulis D, Innocenti A et al. Biochemical characterization of CA IX, one of the most active carbonic anhydrase isozymes. J Biol Chem 2008; 283(41): 27799-809.
4. Oosterwijk E, Ruiter DJ, Hoedemaeker PJ, Pauwels EK, Jonas U, Zwartendijk J et al. Monoclonal antibody G 250 recognizes a determinant present in renal-cell carcinoma and absent from normal kidney. International journal of cancer. Journal international du cancer 1986; 38(4): 489-94. 5. Liao SY, Brewer C, Zavada J, Pastorek J, Pastorekova S, Manetta A et al. Identification of the MN antigen as a diagnostic biomarker of cervical intraepithelial squamous and glandular neoplasia and cervical carcinomas. Am J Pathol 1994; 145(3): 598- 609.
6. Liao SY, Aurelio ON, Jan K, Zavada J, Stanbridge EJ. Identification of the MN/CA9 protein as a reliable diagnostic biomarker of clear cell carcinoma of the kidney. Cancer research 1997; 57(14): 2827-31.
7. Atkins M, Regan M, McDermott D, Mier J, Stanbridge E, Youmans A et al. Carbonic anhydrase IX expression predicts outcome of interleukin 2 therapy for renal cancer. Clin Cancer Res 2005; 11(10): 3714-21.
8. Lokich J. Spontaneous regression of metastatic renal cancer. Case report and literature review. Am J Clin Oncol 1997; 20(4): 416-8.
9. Chang AE, Li Q, Jiang G, Sayre DM, Braun TM, Redman BG. Phase II trial of autologous tumor vaccination, anti-CD3-activated vaccine-primed lymphocytes, and interleukin-2 in stage IV renal cell cancer. J Clin Oncol 2003; 21(5): 884-90.
10. Dudley ME, Wunderlich JR, Robbins PF, Yang JC, Hwu P, Schwartzentruber DJ et al. Cancer regression and autoimmunity in patients after clonal repopulation with antitumor lymphocytes. Science 2002; 298(5594): 850-4.
11. Schaft N, Willemsen RA, de Vries J, Lankiewicz B, Essers BW, Gratama JW et al. Peptide fine specificity of anti-glycoprotein 100 CTL is preserved following transfer of engineered TCR alpha beta genes into primary human T lymphocytes. J Immunol 2003; 170(4): 2186-94.
12. Bubenik J. MHC class I down-regulation: tumour escape from immune surveillance? (review). International journal of oncology 2004; 25(2): 487-91. 13. Gajewski TF, Meng Y, Blank C, Brown I, Kacha A, Kline J et al. Immune resistance orchestrated by the tumor microenvironment. Immunological reviews 2006; 213: 131-45.
14. Frigola X, Inman BA, Lohse CM, Krco CJ, Cheville JC, Thompson RH et al. Identification of a soluble form of B7-H1 that retains immunosuppressive activity and is associated with aggressive renal cell carcinoma. Clin Cancer Res 2011 ; 17(7): 1915-23.
15. Grepin R, Guyot M, Giuliano S, Boncompagni M, Ambrosetti D, Chamorey E et al. The CXCL7/CXCR1/2 axis is a key driver in the growth of clear cell renal cell carcinoma. Cancer research 2014; 74(3): 873-83.
16. Sadelain M, Brentjens R, Riviere I. The promise and potential pitfalls of chimeric antigen receptors. Curr Opin Immunol 2009; 21(2): 215-23.
17. Lamers CH, Sleijfer S, van Steenbergen S, van Elzakker P, van Krimpen B, Groot C et al. Treatment of metastatic renal cell carcinoma with CAIX CAR-engineered T cells: clinical evaluation and management of on-target toxicity. Molecular therapy : the journal of the American Society of Gene Therapy 2013; 21(4): 904-12.
18. Milone MC, Fish JD, Carpenito C, Carroll RG, Binder GK, Teachey D et al. Chimeric receptors containing CD137 signal transduction domains mediate enhanced survival of T cells and increased antileukemic efficacy in vivo. Molecular therapy : the journal of the American Society of Gene Therapy 2009; 17(8): 1453-64.
19. Wilkie S, Picco G, Foster J, Davies DM, ien S, Cooper L et al. Retargeting of human T cells to tumor-associated MUCl : the evolution of a chimeric antigen receptor. J Immunol 2008; 180(7): 4901-9.
20. Lo AS, Ma Q, Liu DL, Junghans RP. Anti-GD3 chimeric sFv-CD28/T-cell receptor zeta designer T cells for treatment of metastatic melanoma and other neuroectodermal tumors. Clin Cancer Res 2010; 16(10): 2769-80. 21. Kalos M, Levine BL, Porter DL, Katz S, Grupp SA, Bagg A et al. T cells with chimeric antigen receptors have potent antitumor effects and can establish memory in patients with advanced leukemia. Science translational medicine 2011 ; 3(95): 95ra73.
22. Pegram HJ, Park JH, Brentjens RJ. CD28z CARs and armored CARs. Cancer J 2014; 20(2): 127-33.
23. Xu C, Lo A, Yammanuru A, Tallarico AS, Brady K, Murakami A et al. Unique biological properties of catalytic domain directed human anti-CAIX antibodies discovered through phage-display technology. PloS one 2010; 5(3): e9625.
24. Sui J, Aird DR, Tamin A, Murakami A, Yan M, Yammanuru A et al. Broadening of neutralization activity to directly block a dominant antibody-driven SARS-coronavirus evolution pathway. PLoS pathogens 2008; 4(11): el000197.
25. Mirzabekov T, Kontos H, Farzan M, Marasco W, Sodroski J. Paramagnetic proteoliposomes containing a pure, native, and oriented seven-transmembrane segment protein, CCR5. Nat Biotechnol 2000; 18(6): 649-54.
26. Wald O, Weiss ID, Wald H, Shoham H, Bar-Shavit Y, Beider K et al. IFN-gamma acts on T cells to induce NK cell mobilization and accumulation in target organs. J Immunol 2006; 176(8): 4716-29.
27. Zeytin H, Reali E, Zaharoff DA, Rogers CJ, Schlom J, Greiner JW. Targeted delivery of murine IFN-gamma using a recombinant fowlpox virus: NK cell recruitment to regional lymph nodes and priming of tumor-specific host immunity. Journal of interferon & cytokine research : the official journal of the International Society for Interferon and Cytokine Research 2008; 28(2): 73-87.
28. Murugaiyan G, Saha B. Protumor vs antitumor functions of IL-17. J Immunol 2009; 183(7): 4169-75. 29. Bar E, Whitney PG, Moor K, Reis e Sousa C, LeibundGut-Landmann S. IL-17 regulates systemic fungal immunity by controlling the functional competence of NK cells. Immunity 2014; 40(1): 117-27.
30. Hinrichs CS, Kaiser A, Paulos CM, Cassard L, Sanchez-Perez L, Heemskerk B et al. Type 17 CD8+ T cells display enhanced antitumor immunity. Blood 2009; 114(3): 596-9.
31. Hombach AA, Rappl G, Abken H. Arming cytokine-induced killer cells with chimeric antigen receptors: CD28 outperforms combined CD28-OX40 "super-stimulation".
Molecular therapy : the journal of the American Society of Gene Therapy 2013; 21(12): 2268-77.
32. Mor F, Cohen IR. IL-2 rescues antigen-specific T cells from radiation or dexamethasone-induced apoptosis. Correlation with induction of Bel -2. J Immunol 1996; 156(2): 515-22.
33. Isakov N, Altman A. PKC-theta-mediated signal delivery from the TCR/CD28 surface receptors. Frontiers in immunology 2012; 3: 273.
34. Loskog A, Giandomenico V, Rossig C, Pule M, Dotti G, Brenner MK. Addition of the CD28 signaling domain to chimeric T-cell receptors enhances chimeric T-cell resistance to T regulatory cells. Leukemia 2006; 20(10): 1819-28.
35. Schwarzer A, Wolf B, Fisher JL, Schwaab T, Olek S, Baron U et al. Regulatory T- cells and associated pathways in metastatic renal cell carcinoma (mRCC) patients undergoing DC-vaccination and cytokine-therapy. PloS one 2012; 7(10): e46600.
36. Lamers CH, Willemsen R, van Elzakker P, van Steenbergen-Langeveld S, Broertjes M, Oosterwijk-Wakka J et al. Immune responses to transgene and retroviral vector in patients treated with ex vivo-engineered T cells. Blood 2011; 117(1): 72-82. 37. Miotti S, Negri DR, Valota O, Calabrese M, Bolhuis RL, Gratama JW et al. Level of anti-mouse-antibody response induced by bi-specific monoclonal antibody OC/TR in ovarian-carcinoma patients is associated with longer survival. International journal of cancer. Journal international du cancer 1999; 84(1): 62-8.
38. Kershaw MH, Westwood JA, Parker LL, Wang G, Eshhar Z, Mavroukakis SA et al. A phase I study on adoptive immunotherapy using gene-modified T cells for ovarian cancer. Clin Cancer Res 2006; 12(20 Pt 1): 6106-15.
39. Pastorekova S. Carbonic anhydrase IX (CA IX) as a potential target for cancer therapy. Cancer Therapy 2004; 2: 245-262.
40. Pastorekova S, Parkkila S, Parkkila AK, Opavsky R, Zelnik V, Saarnio J et al. Carbonic anhydrase IX, MN/CA IX: analysis of stomach complementary DNA sequence and expression in human and rat alimentary tracts. Gastroenterology 1997; 112(2): 398- 408.
41. Saarnio J, Parkkila S, Parkkila AK, Waheed A, Casey MC, Zhou XY et al. Immunohistochemistry of carbonic anhydrase isozyme IX (MN/CA IX) in human gut reveals polarized expression in the epithelial cells with the highest proliferative capacity.
The journal of histochemistry and cytochemistry : official journal of the Histochemistry Society 1998; 46(4): 497-504.
42. Zavada J, Zavadova Z, Zat'ovicova M, Hyrsl L, Kawaciuk I. Soluble form of carbonic anhydrase IX (CA IX) in the serum and urine of renal carcinoma patients. Br J Cancer 2003; 89(6): 1067-71.
43. Hombach A, Koch D, Sircar R, Heuser C, Diehl V, Kruis W et al. A chimeric receptor that selectively targets membrane-bound carcinoembryonic antigen (mCEA) in the presence of soluble CEA. Gene Ther 1999; 6(2): 300-4. 44. Carpenito C, Milone MC, Hassan R, Simonet JC, Lakhal M, Suhoski MM et al. Control of large, established tumor xenografts with genetically retargeted human T cells containing CD28 and CD137 domains. Proceedings of the National Academy of Sciences of the United States of America 2009; 106(9): 3360-5.
45. Gill S, Tasian SK, Ruella M, Shestova O, Li Y, Porter DL et al. Efficacy against human acute myeloid leukemia and myeloablation of normal hematopoiesis in a mouse model using chimeric antigen receptor-modified T cells. Blood 2014.
46. Hombach AA, Heiders J, Foppe M, Chmielewski M, Abken H. OX40 costimulation by a chimeric antigen receptor abrogates CD28 and IL-2 induced IL-10 secretion by redirected CD4(+) T cells. Oncoimmunology 2012; 1(4): 458-466.
47. Song DG, Ye Q, Carpenito C, Poussin M, Wang LP, Ji C et al. In vivo persistence, tumor localization, and antitumor activity of CAR-engineered T cells is enhanced by costimulatory signaling through CD137 (4-1BB). Cancer research 2011; 71(13): 4617-27.
48. Bedke J, Stenzl A. Immunotherapeutic strategies for the treatment of renal cell carcinoma: where are we now? Expert review of anticancer therapy 2013; 13(12): 1399- 408.
49. Bailey A, McDermott DF. Immune checkpoint inhibitors as novel targets for renal cell carcinoma therapeutics. Cancer J 2013; 19(4): 348-52.
50. Maher J, Brentjens RJ, Gunset G, Riviere I, Sadelain M. Human T-lymphocyte cytotoxicity and proliferation directed by a single chimeric TCRzeta /CD28 receptor. Nat Biotechnol 2002; 20(1): 70-5.
51. Ferlay J, Soeqomataram I, Dikshit R, Eser S, Mathers C, Rebelo M, et al. Cancer incidence and mortality worldwide: sources, methods and major patterns in GLOBOCAN 2012. International journal of cancer. 2015;136:E359-86. 52. Dutcher JP. Recent developments in the treatment of renal cell carcinoma. Therapeutic advances in urology. 2013;5:338-53.
53. Cohen HT, McGovern FJ. Renal-cell carcinoma. The New England journal of medicine. 2005;353:2477-90.
54. Sedlakova O, Svastova E, Takacova M, Kopacek J, Pastorek J, Pastorekova S. Carbonic anhydrase IX, a hypoxia-induced catalytic component of the pH regulating machinery in tumors. Frontiers in physiology. 2014;4:400.
55. Benej M, Pastorekova S, Pastorek J. Carbonic anhydrase IX: regulation and role in cancer. Sub-cellular biochemistry. 2014;75: 199-219.
56. Tostain J, Li G, Gentil-Perret A, Gigante M. Carbonic anhydrase 9 in clear cell renal cell carcinoma: a marker for diagnosis, prognosis and treatment. European journal of cancer. 2010;46:3141-8.
57. Genega EM, Ghebremichael M, Najarian R, Fu Y, Wang Y, Argani P, et al. Carbonic anhydrase IX expression in renal neoplasms: correlation with tumor type and grade. American journal of clinical pathology. 2010;134:873-9.
58. Alegre ML, Frauwirth KA, Thompson CB. T-cell regulation by CD28 and CTLA-4. Nature reviews Immunology. 2001 ;1 :220-8.
59. Pardoll DM. The blockade of immune checkpoints in cancer immunotherapy. Nature reviews Cancer. 2012; 12:252-64.
60. Harshman LC, Drake CG, Choueiri TK. PD-1 blockade in renal cell carcinoma: to equilibrium and beyond. Cancer immunology research. 2014;2: 1132-41.
61. Srivastava S, Riddell SR. Engineering CAR-T cells: Design concepts. Trends in immunology. 2015;36:494-502. 62. Maude SL, Frey N, Shaw PA, Aplenc R, Barrett DM, Bunin NJ, et al. Chimeric antigen receptor T cells for sustained remissions in leukemia. The New England journal of medicine. 2014;371 : 1507-17.
63. Zhu Y, Tan Y, Ou R, Zhong Q, Zheng L, Du Y, et al. Anti-CD 19 chimeric antigen receptor- modified T cells for B-cell malignancies: a systematic review of efficacy and safety in clinical trials. European journal of haematology. 2015.
64. Kakarla S, Gottschalk S. CAR T cells for solid tumors: armed and ready to go? Cancer journal. 2014;20: 151-5.
65. Lo AS, Xu C, Murakami A, Marasco WA. Regression of established renal cell carcinoma in nude mice using lentivirus-transduced human T-cells expressing a human anti- CAIX chimeric antigen receptor. Molecular Therapy - Oncolytics. 2014;1 : 1-12.
66. Hsu CY, Uludag H. A simple and rapid nonviral approach to efficiently transfect primary tissue-derived cells using polyethylenimine. Nature protocols. 2012;7:935-45.
67. Singh H, Figliola MJ, Dawson MJ, Huls H, Olivares S, Switzer K, et al. Reprogramming CD19-specific T cells with IL-21 signaling can improve adoptive immunotherapy of B-lineage malignancies. Cancer research. 2011;71 :3516-27.
68. June C, Rosenberg SA, Sadelain M, Weber JS. T-cell therapy at the threshold. Nature biotechnology. 2012;30:611-4.
69. Chang DK, Moniz RJ, Xu Z, Sun J, Signoretti S, Zhu Q, et al. Human anti-CAIX antibodies mediate immune cell inhibition of renal cell carcinoma in vitro and in a humanized mouse model in vivo. Molecular cancer. 2015;14: 119.
70. Kaka AS, Shaffer DR, Hartmaier R, Leen AM, Lu A, Bear A, et al. Genetic modification of T cells with IL-21 enhances antigen presentation and generation of central memory tumor-specific cytotoxic T-lymphocytes. Journal of immunotherapy. 2009;32:726- 36.
71. Li Y, Bleakley M, Yee C. IL-21 influences the frequency, phenotype, and affinity of the antigen-specific CD8 T cell response. Journal of immunology. 2005;175:2261-9.
72. van der Stegen SJ, Hamieh M, Sadelain M. The pharmacology of second-generation chimeric antigen receptors. Nature reviews Drug discovery. 2015;14:499-509.
73. Long AH, Haso WM, Shem JF, Wanhainen KM, Murgai M, Ingaramo M, et al. 4-1BB costimulation ameliorates T cell exhaustion induced by tonic signaling of chimeric antigen receptors. Nature medicine. 2015;21 :581-90.
74. Lee DW, Kochenderfer JN, Stetler-Stevenson M, Cui YK, Delbrook C, Feldman SA, et al. T cells expressing CD 19 chimeric antigen receptors for acute lymphoblastic leukaemia in children and young adults: a phase 1 dose-escalation trial. Lancet. 2015;385:517-28.
75. Virgin HW, Wherry EJ, Ahmed R. Redefining chronic viral infection. Cell. 2009;138:30-50.
76. Wherry EJ. T cell exhaustion. Nature immunology. 2011;12:492-9.
77. Topalian SL, Hodi FS, Brahmer JR, Gettinger SN, Smith DC, McDermott DF, et al. Safety, activity, and immune correlates of anti-PD-1 antibody in cancer. The New England journal of medicine. 2012;366:2443-54.
78. Brahmer JR, Tykodi SS, Chow LQ, Hwu WJ, Topalian SL, Hwu P, et al. Safety and activity of anti-PD-Ll antibody in patients with advanced cancer. The New England journal of medicine. 2012;366:2455-65.
79. John LB, Devaud C, Duong CP, Yong CS, Beavis PA, Haynes NM, et al. Anti-PD-1 antibody therapy potently enhances the eradication of established tumors by gene-modified T cells. Clinical cancer research : an official journal of the American Association for Cancer Research. 2013; 19:5636-46.

Claims

We Claim:
1. A chimeric antigen receptor (CAR) comprising an intracellular signaling domain, a transmembrane domain and an extracellular domain
2. The CAR of claim 1, wherein the transmembrane domain further comprises a stalk region positioned between the extracellular domain and the transmembrane domain.
3. The CAR or claim 1, wherein the transmembrane domain comprises CD28.
4. The CAR of claim 1, further comprising one or more additional costimulatory
molecules positioned between the transmembrane domain and the intracellular signaling domain
5. The CAR of claim 4, wherein the costimulatory molecules is CD28, 4-1BB, ICOS, or OX40.
6. The CAR of claim 1, wherein the intracellular signaling domain comprises a CD3 zeta chain.
7. The CAR of claim 1, wherein the extracellular domain is an antibody.
8. The CAR of claim 7, wherein the antibody is a Fab or a scFV.
9. The CAR of claim7, wherein the antibody is specific for BCMA, CD 138, CCR4, PD-1, PDL-1, PD-L2, CXCR4, GITR, SARS virus, flavivirus, MERS virus, influenza virus, or CAIX.
10. A nucleic acid encoding the CAR of any one of the preceding claims further
comprising a nucleic acid encoding a polypeptide positioned after the intracellular signaling domain.
11. The nucleic acid of claim 10, wherein the polypeptide is an antibody
12. The nucleic acid of claim 11, wherein the antibody is a scFV.
13. The nucleic acid of claim 12, wherein the antibody is specific for BCMA, CD138, CCR4, PD-1, PDL-1, PD-L2, CXCR4, GITR, SARS virus, flavivirus, MERS virus, influenza virus, or CAIX
14. A vector comprising the nucleic acid of any one of claims 11-13.
15. A cell comprising the vector of claim 14.
16. A genetically engineered cell which express and bear on the cell surface membrane the chimeric antigen receptor of any one of claims 1-9.
17. The genetically engineered cell of claim 16, wherein the cell is a T-cell or an NK cell.
18. The genetically engineered cell of claim 17, wherein the T cell is CD4+ or CD8+.
19. The genetically engineered cell of claim 18, which comprises a mixed population of CD4+ and CD8 cells+.
20. The cell of claim 16, wherein the cell is further engineered to express and secrete a polypeptide
21. The cell of claim 20, wherein the expressed and secreted polypeptide is anti-PDL-1.
PCT/US2015/067225 2014-12-19 2015-12-21 Chimeric antigen receptors and methods of use thereof Ceased WO2016100985A2 (en)

Priority Applications (20)

Application Number Priority Date Filing Date Title
KR1020177020045A KR102923234B1 (en) 2014-12-19 2015-12-21 Chimeric antigen receptors and methods of using the same
IL302660A IL302660B2 (en) 2014-12-19 2015-12-21 Chimeric antigen receptors and methods of use thereof
AU2015364245A AU2015364245B2 (en) 2014-12-19 2015-12-21 Chimeric antigen receptors and methods of use thereof
IL252295A IL252295B2 (en) 2014-12-19 2015-12-21 Chimeric antigen receptors and methods of use thereof
EP15828615.3A EP3233900A2 (en) 2014-12-19 2015-12-21 Chimeric antigen receptors and methods of use thereof
CN201580069023.0A CN108064252A (en) 2014-12-19 2015-12-21 Chimeric antigen receptor and its application method
IL320860A IL320860A (en) 2014-12-19 2015-12-21 Chimeric antigen receptors and methods of use thereof
RU2017125531A RU2017125531A (en) 2014-12-19 2015-12-21 CHIMERIC ANTIGENIC RECEPTORS AND WAYS OF THEIR APPLICATION
US15/537,779 US20170362297A1 (en) 2014-12-19 2015-12-21 Chimeric antigen receptors and methods of use thereof
CA2968412A CA2968412A1 (en) 2014-12-19 2015-12-21 Chimeric antigen receptors and methods of use thereof
KR1020267003069A KR20260038272A (en) 2014-12-19 2015-12-21 Chimeric antigen receptors and methods of use thereof
JP2017532639A JP2018504894A (en) 2014-12-19 2015-12-21 Chimeric antigen receptor and method of use thereof
BR112017013176-5A BR112017013176A2 (en) 2014-12-19 2015-12-21 chimeric antigen receptors and methods for using them
AU2020204373A AU2020204373B2 (en) 2014-12-19 2020-06-30 Chimeric antigen receptors and methods of use thereof
US16/986,913 US12195514B2 (en) 2014-12-19 2020-08-06 Chimeric antigen receptors and methods of use thereof
AU2022200257A AU2022200257B2 (en) 2014-12-19 2022-01-17 Chimeric antigen receptors and methods of use thereof
JP2022011441A JP7548950B2 (en) 2014-12-19 2022-01-28 Chimeric antigen receptors and methods of use thereof
AU2024200592A AU2024200592B2 (en) 2014-12-19 2024-01-31 Chimeric antigen receptors and methods of use thereof
JP2024147204A JP7833003B2 (en) 2014-12-19 2024-08-29 Chimeric antigen receptor and method of use thereof
US18/970,194 US20250243259A1 (en) 2014-12-19 2024-12-05 Chimeric antigen receptors and methods of use thereof

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201462094625P 2014-12-19 2014-12-19
US62/094,625 2014-12-19
US201562252083P 2015-11-06 2015-11-06
US62/252,083 2015-11-06

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US15/537,779 A-371-Of-International US20170362297A1 (en) 2014-12-19 2015-12-21 Chimeric antigen receptors and methods of use thereof
US16/986,913 Continuation US12195514B2 (en) 2014-12-19 2020-08-06 Chimeric antigen receptors and methods of use thereof

Publications (2)

Publication Number Publication Date
WO2016100985A2 true WO2016100985A2 (en) 2016-06-23
WO2016100985A3 WO2016100985A3 (en) 2016-08-18

Family

ID=55229842

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2015/067225 Ceased WO2016100985A2 (en) 2014-12-19 2015-12-21 Chimeric antigen receptors and methods of use thereof

Country Status (11)

Country Link
US (3) US20170362297A1 (en)
EP (1) EP3233900A2 (en)
JP (3) JP2018504894A (en)
KR (2) KR102923234B1 (en)
CN (1) CN108064252A (en)
AU (4) AU2015364245B2 (en)
BR (1) BR112017013176A2 (en)
CA (1) CA2968412A1 (en)
IL (3) IL252295B2 (en)
RU (1) RU2017125531A (en)
WO (1) WO2016100985A2 (en)

Cited By (35)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2017147383A1 (en) 2016-02-25 2017-08-31 Cell Medica Switzerland Ag Modified cells for immunotherapy
WO2018005682A3 (en) * 2016-06-29 2018-02-08 Checkpoint Therapeutics, Inc. Pd-l1-specific antibodies and methods of using the same
WO2018057585A1 (en) * 2016-09-21 2018-03-29 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Chimeric antigen receptor (car) that targets chemokine receptor ccr4 and its use
WO2018089829A1 (en) 2016-11-10 2018-05-17 Fortis Therapeutics, Inc. Cd46-specific effector cells and uses thereof
WO2018223600A1 (en) * 2017-06-06 2018-12-13 上海优卡迪生物医药科技有限公司 Octs-car dual targeting chimeric antigen receptor, encoding gene, recombinant expression vector and construction and use thereof
US10155818B2 (en) 2014-05-28 2018-12-18 Agenus Inc. Anti-GITR antibodies and methods of use thereof
EP3432924A1 (en) * 2016-03-23 2019-01-30 Novartis AG Cell secreted minibodies and uses thereof
JP2019525771A (en) * 2016-07-07 2019-09-12 アイオバンス バイオセラピューティクス,インコーポレイテッド Programmed death 1 ligand 1 (PD-L1) binding protein and method of use thereof
US10428305B2 (en) 2014-05-15 2019-10-01 National University Of Singapore Modified natural killer cells that express IL15 and uses thereof
JP2019528769A (en) * 2016-10-04 2019-10-17 プレシジョン バイオサイエンシズ,インク. Co-stimulatory domains for use in genetically modified cells
JP2019535303A (en) * 2016-12-05 2019-12-12 上海優▲か▼迪生物医薬科技有限公司Shanghai Unicar−Therapy Bio−Medicine Technology Co.,Ltd CAR-T gene recombination vector and its construction method and use for suppressing immune escape with PDL1 blocked
WO2020011247A1 (en) 2018-07-13 2020-01-16 Nanjing Legend Biotech Co., Ltd. Co-receptor systems for treating infectious diseases
US10538739B2 (en) 2013-01-28 2020-01-21 St. Jude Children's Research Hospital, Inc. Chimeric receptor with NKG2D specificity for use in cell therapy against cancer and infectious disease
US10729725B2 (en) 2017-05-12 2020-08-04 Crispr Therapeutics Ag Materials and methods for engineering cells and uses thereof in immuno-oncology
US10836830B2 (en) 2015-12-02 2020-11-17 Agenus Inc. Antibodies and methods of use thereof
CN113226340A (en) * 2018-11-26 2021-08-06 恩卡尔塔公司 Methods of simultaneously expanding multiple immune cell types, related compositions, and uses thereof in cancer immunotherapy
US20210292427A1 (en) * 2018-07-24 2021-09-23 Cafa Therapeutics Limited Method for treating tumor using immune effector cell
US11141436B2 (en) 2019-03-05 2021-10-12 Nkarta, Inc. Immune cells engineered to express CD19-directed chimeric antigen receptors and uses thereof in immunotherapy
US11166985B2 (en) 2017-05-12 2021-11-09 Crispr Therapeutics Ag Materials and methods for engineering cells and uses thereof in immuno-oncology
US11254912B2 (en) 2018-05-11 2022-02-22 Crispr Therapeutics Ag Methods and compositions for treating cancer
US11359028B2 (en) 2016-11-09 2022-06-14 Agenus Inc. Anti-OX40 antibodies and anti-GITR antibodies
US11365236B2 (en) 2017-03-27 2022-06-21 Nkarta, Inc. Truncated NKG2D chimeric receptors and uses thereof in natural killer cell immunotherapy
US11389481B2 (en) 2019-04-30 2022-07-19 Crispr Therapeutics Ag Allogeneic cell therapy of B cell malignancies using genetically engineered T cells targeting CD19
US11484604B2 (en) 2020-08-07 2022-11-01 Fortis Therapeutics, Inc. Immunoconjugates targeting CD46 and methods of use thereof
WO2022235940A1 (en) 2021-05-06 2022-11-10 Dana-Farber Cancer Institute, Inc. Antibodies against alk and methods of use thereof
EP4112070A1 (en) * 2014-04-25 2023-01-04 Dana Farber Cancer Institute, Inc. Middle east respiratory syndrome coronavirus neutralizing antibodies and methods of use thereof
US11896616B2 (en) 2017-03-27 2024-02-13 National University Of Singapore Stimulatory cell lines for ex vivo expansion and activation of natural killer cells
US12005081B2 (en) 2019-04-30 2024-06-11 Senti Biosciences, Inc. Chimeric receptors and methods of use thereof
US12049510B2 (en) 2018-09-27 2024-07-30 Autolus Limited Chimeric antigen receptor
US12258381B2 (en) 2018-02-09 2025-03-25 National University Of Singapore Activating chimeric receptors and uses thereof in natural killer cell immunotherapy
US12258378B2 (en) 2018-03-14 2025-03-25 Dana-Farber Cancer Institute, Inc. Engineered cells, T cell immune modulating antibodies and methods for using the same
US12441787B2 (en) 2018-04-02 2025-10-14 National University Of Singapore Neutralization of human cytokines with membrane-bound anti-cytokine non-signaling binders expressed in immune cells
US12448462B2 (en) 2019-06-14 2025-10-21 Dana-Farber Cancer Institute, Inc. Antibodies against MUC1
US12486514B2 (en) 2018-08-29 2025-12-02 National University Of Singapore Method to specifically stimulate survival and expansion of genetically-modified immune cells
US12577311B2 (en) 2018-11-30 2026-03-17 Dana-Farber Cancer Institute, Inc. Chimeric antigen receptor factories and methods of use thereof

Families Citing this family (17)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
BR112015007672A2 (en) * 2012-10-04 2017-08-08 Dana Farber Cancer Inst Inc human monoclonal anti-pd-l1 antibodies and methods of use
CA3097152A1 (en) * 2018-04-16 2019-10-24 Memorial Sloan Kettering Cancer Center T-cell exhaustion, & methods & compositions relating thereto
US11104732B2 (en) * 2019-04-24 2021-08-31 Innovative Cellular Therapeutics Holdings, Ltd. Reducing immune inhibition induced by SIGLEC-15
US12479890B2 (en) * 2019-04-26 2025-11-25 The University Of North Carolina At Chapel Hill Chimeric antigen receptor constructs and their use in CAR-T cells
AU2020315213A1 (en) * 2019-07-17 2022-02-03 National University Of Singapore Functional binders synthesized and secreted by immune cells
WO2021016606A1 (en) * 2019-07-24 2021-01-28 Eureka Therapeutics, Inc. Chimeric antigen receptor t cells and uses thereof
AU2020396896A1 (en) * 2019-12-02 2022-06-09 Dana-Farber Cancer Institute, Inc. Antibodies against PD-L1 and methods of use thereof
WO2021142835A1 (en) * 2020-01-19 2021-07-22 北京卡替医疗技术有限公司 Strengthened receptor for improving immune cell function
WO2021225399A1 (en) * 2020-05-08 2021-11-11 (주)에스엠티바이오 Chimeric antigen receptor for treatment of cancer
WO2022173950A1 (en) * 2021-02-11 2022-08-18 The Trustees Of The University Of Pennsylvania Ccr4-targeting chimeric antigen receptor cell therapy
KR20220136876A (en) 2021-04-01 2022-10-11 주식회사 이뮤노로지컬디자이닝랩 Transformed professional antigen presenting cells specifically binding to antigen containing chimeric antigen receptor(CAR) and uses thereof
TWI867291B (en) * 2021-04-12 2024-12-21 中央研究院 Improved coronavirus vaccine
KR20220144000A (en) 2021-04-16 2022-10-26 주식회사 이뮤노로지컬디자이닝랩 Chimeric antigen receptor specifically binding to programmed death-ligand 1(PD-L1) and use thereof
KR20230089464A (en) 2021-12-13 2023-06-20 주식회사 이뮤노로지컬디자이닝랩 Transformed professional antigen presenting cells specifically binding to antigen containing chimeric antigen receptor(CAR) and uses thereof
KR20230089462A (en) 2021-12-13 2023-06-20 주식회사 이뮤노로지컬디자이닝랩 Transformed professional antigen presenting cells specifically binding to antigen containing chimeric antigen receptor(CAR) and uses thereof
CA3245511A1 (en) * 2022-03-08 2025-06-13 Vaxcell-Bio Co., Ltd. PD-L1 SPECIFIC CHIMERIC ANTIGENIC RECEPTOR AND IMMUNE CELL CONTAINING IT
WO2025059162A1 (en) 2023-09-11 2025-03-20 Dana-Farber Cancer Institute, Inc. Car-engager containing il-2 variants to enhance the functionality of car t cells

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5994136A (en) 1997-12-12 1999-11-30 Cell Genesys, Inc. Method and means for producing high titer, safe, recombinant lentivirus vectors
US6013516A (en) 1995-10-06 2000-01-11 The Salk Institute For Biological Studies Vector and method of use for nucleic acid delivery to non-dividing cells

Family Cites Families (25)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4797368A (en) 1985-03-15 1989-01-10 The United States Of America As Represented By The Department Of Health And Human Services Adeno-associated virus as eukaryotic expression vector
US4683202A (en) 1985-03-28 1987-07-28 Cetus Corporation Process for amplifying nucleic acid sequences
US5139941A (en) 1985-10-31 1992-08-18 University Of Florida Research Foundation, Inc. AAV transduction vectors
US5928906A (en) 1996-05-09 1999-07-27 Sequenom, Inc. Process for direct sequencing during template amplification
US20050113564A1 (en) * 2003-11-05 2005-05-26 St. Jude Children's Research Hospital Chimeric receptors with 4-1BB stimulatory signaling domain
CN1914226B (en) 2003-11-25 2012-02-01 达纳-法伯癌症研究院有限公司 Antibodies against SARS-COV and methods of use thereof
CA2597717C (en) 2005-02-18 2014-10-21 Dana-Farber Cancer Institute Antibodies against cxcr4 and methods of use thereof
US8466263B2 (en) 2005-12-02 2013-06-18 Dana-Farber Cancer Institute, Inc. Carbonic anhydrase IX (G250) anitbodies
BRPI0819971A2 (en) 2007-12-06 2017-06-27 Burnham Institute For Medical Res antibodies to influenza viruses and methods of their use
US8962806B2 (en) 2007-12-28 2015-02-24 Dana-Farber Cancer Institute, Inc. Humanized monoclonal antibodies and methods of use
EP2575882B1 (en) 2010-06-02 2017-11-01 Dana-Farber Cancer Institute, Inc. Humanized monoclonal antibodies and methods of use
US9402865B2 (en) 2011-01-18 2016-08-02 The Trustees Of The University Of Pennsylvania Compositions and methods for treating cancer
EP3594245A1 (en) * 2012-02-13 2020-01-15 Seattle Children's Hospital d/b/a Seattle Children's Research Institute Bispecific chimeric antigen receptors and therapeutic uses thereof
ES3065694T3 (en) * 2012-04-11 2026-05-07 Us Health Chimeric antigen receptors targeting b-cell maturation antigen
WO2013166500A1 (en) 2012-05-04 2013-11-07 Dana-Farber Cancer Institute, Inc. Affinity matured anti-ccr4 humanized monoclonal antibodies and methods of use
AU2013289971A1 (en) * 2012-07-13 2015-01-22 The Trustees Of The University Of Pennsylvania Enhancing activity of CAR T cells by co-introducing a bispecific antibody
BR112015007672A2 (en) * 2012-10-04 2017-08-08 Dana Farber Cancer Inst Inc human monoclonal anti-pd-l1 antibodies and methods of use
BR112015020516A2 (en) * 2013-02-26 2017-10-10 Memorial Sloan Kettering Cancer Center immunotherapy compositions and methods
SG11201507359SA (en) 2013-03-15 2015-10-29 Dana Farber Cancer Inst Inc Flavivirus neutralizing antibodies and methods of use thereof
US20170174751A1 (en) 2014-03-19 2017-06-22 Dana-Farber Cancer Institute, Inc. Immunogenetic restriction on elicitation of antibodies
EP3134111B1 (en) 2014-04-25 2022-06-08 Dana-Farber Cancer Institute, Inc. Middle east respiratory syndrome coronavirus neutralizing antibodies and methods of use thereof
RU2017115315A (en) 2014-10-03 2018-11-08 Дана-Фарбер Кэнсер Инститьют, Инк. ANTIBODIES TO A GLUCCORTICOID-INDUCED TUMOR NECROSIS FACTOR (GITR) RECEPTOR AND METHODS OF APPLICATION
AU2015328273B2 (en) 2014-10-06 2020-09-17 Dana-Farber Cancer Institute, Inc. Humanized CC chemokine receptor 4 (CCR4) antibodies and methods of use thereof
RU2017125735A (en) * 2014-12-19 2019-01-22 Дана-Фарбер Кэнсер Инститьют, Инк. CHIMERIC ANTIGENIC RECEPTORS AGAINST CARBOANHYDRAIS IX AND METHODS OF APPLICATION
WO2017075537A1 (en) * 2015-10-30 2017-05-04 Aleta Biotherapeutics Inc. Compositions and methods for treatment of cancer

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6013516A (en) 1995-10-06 2000-01-11 The Salk Institute For Biological Studies Vector and method of use for nucleic acid delivery to non-dividing cells
US5994136A (en) 1997-12-12 1999-11-30 Cell Genesys, Inc. Method and means for producing high titer, safe, recombinant lentivirus vectors

Non-Patent Citations (82)

* Cited by examiner, † Cited by third party
Title
ALEGRE ML; FRAUWIRTH KA; THOMPSON CB.: "T-cell regulation by CD28 and CTLA-4", NATURE REVIEWS IMMUNOLOGY, vol. 1, 2001, pages 220 - 8, XP055345954, DOI: doi:10.1038/35105024
ATKINS M; REGAN M; MCDERMOTT D; MIER J; STANBRIDGE E; YOUMANS A ET AL.: "Carbonic anhydrase IX expression predicts outcome of interleukin 2 therapy for renal cancer", CLIN CANCER RES, vol. 11, no. 10, 2005, pages 3714 - 3721
BAILEY A; MCDERMOTT DF.: "Immune checkpoint inhibitors as novel targets for renal cell carcinoma therapeutics", CANCER J, vol. 19, no. 4, 2013, pages 348 - 52
BAR E; WHITNEY PG; MOOR K; REIS E SOUSA C: "LeibundGut-Landmann S. IL-17 regulates systemic fungal immunity by controlling the functional competence of NK cells", IMMUNITY, vol. 40, no. 1, 2014, pages 117 - 127
BEDKE J; STENZL A.: "Immunotherapeutic strategies for the treatment of renal cell carcinoma: where are we now?", EXPERT REVIEW OF ANTICANCER THERAPY, vol. 13, no. 12, 2013, pages 1399 - 408
BENEJ M; PASTOREKOVA S; PASTOREK J.: "Carbonic anhydrase IX: regulation and role in cancer", SUB-CELLULAR BIOCHEMISTRY, vol. 75, 2014, pages 199 - 219
BRAHMER JR; TYKODI SS; CHOW LQ; HWU WJ; TOPALIAN SL; HWU P ET AL.: "Safety and activity of anti-PD-L1 antibody in patients with advanced cancer", THE NEW ENGLAND JOURNAL OF MEDICINE, vol. 366, 2012, pages 2455 - 65, XP002685330, DOI: doi:10.1056/NEJMoa1200694
BUBENIK J.: "MHC class I down-regulation: tumour escape from immune surveillance? (review", INTERNATIONAL JOURNAL OF ONCOLOGY, vol. 25, no. 2, 2004, pages 487 - 491
CARPENITO C; MILONE MC; HASSAN R; SIMONET JC; LAKHAL M; SUHOSKI MM ET AL.: "Control of large, established tumor xenografts with genetically retargeted human T cells containing CD28 and CD137 domains", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF THE UNITED STATES OFAMERICA, vol. 106, no. 9, 2009, pages 3360 - 5, XP002732434, DOI: doi:10.1073/pnas.0813101106
CHANG AE; LI Q; JIANG G; SAYRE DM; BRAUN TM; REDMAN BG.: "Phase II trial of autologous tumor vaccination, anti-CD3-activated vaccine-primed lymphocytes, and interleukin-2 in stage IV renal cell cancer", J CLIN ONCOL, vol. 21, no. 5, 2003, pages 884 - 890
CHANG DK; MONIZ RJ; XU Z; SUN J; SIGNORETTI S; ZHU Q ET AL.: "Human anti-CAIX antibodies mediate immune cell inhibition of renal cell carcinoma in vitro and in a humanized mouse model in vivo", MOLECULAR CANCER., vol. 14, 2015, pages 119
COHEN HT; MCGOVERN FJ.: "Renal-cell carcinoma", THE NEW ENGLAND JOURNAL OF MEDICINE, vol. 353, 2005, pages 2477 - 90
DUDLEY ME; WUNDERLICH JR; ROBBINS PF; YANG JC; HWU P; SCHWARTZENTRUBER DJ ET AL.: "Cancer regression and autoimmunity in patients after clonal repopulation with antitumor lymphocytes.", SCIENCE, vol. 298, no. 5594, 2002, pages 850 - 854, XP009113075, DOI: doi:10.1126/science.1076514
DUTCHER JP.: "Recent developments in the treatment of renal cell carcinoma", THERAPEUTIC ADVANCES IN UROLOGY, vol. 5, 2013, pages 338 - 53
FERLAY J; SOERJOMATARAM I; DIKSHIT R; ESER S; MATHERS C; REBELO M ET AL.: "Cancer incidence and mortality worldwide: sources, methods and major patterns in GLOBOCAN 2012", INTERNATIONAL JOURNAL OF CANCER, vol. 136, 2015, pages E359 - 86
FRIGOLA X; INMAN BA; LOHSE CM; KRCO CJ; CHEVILLE JC; THOMPSON RH ET AL.: "Identification of a soluble form of B7-H1 that retains immunosuppressive activity and is associated with aggressive renal cell carcinoma", CLIN CANCER RES, vol. 17, no. 7, 2011, pages 1915 - 1923
GAJEWSKI TF; MENG Y; BLANK C; BROWN I; KACHA A; KLINE J ET AL.: "Immune resistance orchestrated by the tumor microenvironment.", IMMUNOLOGICAL REVIEWS, vol. 213, 2006, pages 131 - 145
GENEGA EM; GHEBREMICHAEL M; NAJARIAN R; FU Y; WANG Y; ARGANI P ET AL.: "Carbonic anhydrase IX expression in renal neoplasms: correlation with tumor type and grade", AMERICAN JOURNAL OF CLINICAL PATHOLOGY, vol. 134, 2010, pages 873 - 9, XP055110184, DOI: doi:10.1309/AJCPPPR57HNJMSLZ
GILL S; TASIAN SK; RUELLA M; SHESTOVA O; LI Y; PORTER DL ET AL.: "Efficacy against human acute myeloid leukemia and myeloablation of normal hematopoiesis in a mouse model using chimeric antigen receptor-modified T cells", BLOOD, 2014
GREPIN R; GUYOT M; GIULIANO S; BONCOMPAGNI M; AMBROSETTI D; CHAMOREY E ET AL.: "The CXCL7/CXCR1/2 axis is a key driver in the growth of clear cell renal cell carcinoma.", CANCER RESEARCH, vol. 74, no. 3, 2014, pages 873 - 883, XP055371270, DOI: doi:10.1158/0008-5472.CAN-13-1267
HARSHMAN LC; DRAKE CG; CHOUEIRI TK.: "PD-1 blockade in renal cell carcinoma: to equilibrium and beyond", CANCER IMMUNOLOGY RESEARCH, vol. 2, 2014, pages 1132 - 41, XP055275769, DOI: doi:10.1158/2326-6066.CIR-14-0193
HILVO M; BARANAUSKIENE L; SALZANO AM; SCALONI A; MATULIS D; INNOCENTI A ET AL.: "Biochemical characterization of CA IX, one of the most active carbonic anhydrase isozymes", JBIOL CHEM, vol. 283, no. 41, 2008, pages 27799 - 809
HINRICHS CS; KAISER A; PAULOS CM; CASSARD L; SANCHEZ-PEREZ L; HEEMSKERK B ET AL.: "Type 17 CD8+ T cells display enhanced antitumor immunity", BLOOD, vol. 114, no. 3, 2009, pages 596 - 599
HOMBACH A; KOCH D; SIRCAR R; HEUSER C; DIEHL V; KRUIS W ET AL.: "A chimeric receptor that selectively targets membrane-bound carcinoembryonic antigen (mCEA) in the presence of soluble CEA", GENE THER, vol. 6, no. 2, 1999, pages 300 - 4
HOMBACH AA; HEIDERS J; FOPPE M; CHMIELEWSKI M; ABKEN H.: "OX40 costimulation by a chimeric antigen receptor abrogates CD28 and IL-2 induced IL-10 secretion by redirected CD4(+) T cells", ONCOIMMUNOLOGY, vol. 1, no. 4, 2012, pages 458 - 466, XP055403337, DOI: doi:10.4161/onci.19855
HOMBACH AA; RAPPL G; ABKEN H.: "Arming cytokine-induced killer cells with chimeric antigen receptors: CD28 outperforms combined CD28-OX40 ''super-stimulation", MOLECULAR THERAPY : THE JOURNAL OF THE AMERICAN SOCIETY OF GENE THERAPY, vol. 21, no. 12, 2013, pages 2268 - 2277
HSU CY; ULUDAG H.: "A simple and rapid nonviral approach to efficiently transfect primary tissue-derived cells using polyethylenimine", NATURE PROTOCOLS, vol. 7, 2012, pages 935 - 45
ISAKOV N; ALTMAN A.: "PKC-theta-mediated signal delivery from the TCR/CD28 surface receptors", FRONTIERS IN IMMUNOLOGY, vol. 3, 2012, pages 273
IVANOV S; LIAO SY; IVANOVA A ET AL.: "Danilkovitch-Miagkova A, Tarasova N, Weirich G et al. Expression of hypoxia-inducible cell-surface transmembrane carbonic anhydrases in human cancer", AM JPATHOL, vol. 158, no. 3, 2001, pages 905 - 19
JOHN LB; DEVAUD C; DUONG CP; YONG CS; BEAVIS PA; HAYNES NM ET AL.: "Anti-PD-1 antibody therapy potently enhances the eradication of established tumors by gene-modified T cells", CLINICAL CANCER RESEARCH : AN OFFICIAL JOURNAL OF THE AMERICAN ASSOCIATION FOR CANCER RESEARCH, vol. 19, 2013, pages 5636 - 46, XP002737460, DOI: doi:10.1158/1078-0432.CCR-13-0458
JOYNER ET AL., NATURE, vol. 338, 1989, pages 153 - 156
JUNE C; ROSENBERG SA; SADELAIN M; WEBER JS.: "T-cell therapy at the threshold", NATURE BIOTECHNOLOGY, vol. 30, 2012, pages 611 - 4
KAKA AS; SHAFFER DR; HARTMAIER R; LEEN AM; LU A; BEAR A ET AL.: "Genetic modification of T cells with IL-21 enhances antigen presentation and generation of central memory tumor-specific cytotoxic T-lymphocytes", JOURNAL OF IMMUNOTHERAPY, vol. 32, 2009, pages 726 - 36
KAKARLA S; GOTTSCHALK S.: "CAR T cells for solid tumors: armed and ready to go?", CANCER JOURNAL, vol. 20, 2014, pages 151 - 5
KALOS M; LEVINE BL; PORTER DL; KATZ S; GRUPP SA; BAGG A ET AL.: "T cells with chimeric antigen receptors have potent antitumor effects and can establish memory in patients with advanced leukemia", SCIENCE TRANSLATIONAL MEDICINE, vol. 3, no. 95, 2011, pages 95RA73, XP002667262, DOI: doi:10.1126/scitranslmed.3002842
KERSHAW MH; WESTWOOD JA; PARKER LL; WANG G; ESHHAR Z; MAVROUKAKIS SA ET AL.: "A phase I study on adoptive immunotherapy using gene-modified T cells for ovarian cancer", CLIN CANCER RES, vol. 12, 2006, pages 6106 - 15
LAMERS CH; SLEIJFER S; VAN STEENBERGEN S; VAN ELZAKKER P; VAN KRIMPEN B; GROOT C ET AL.: "Treatment of metastatic renal cell carcinoma with CAIX CAR-engineered T cells: clinical evaluation and management of on-target toxicity", MOLECULAR THERAPY : THE JOURNAL OF THE AMERICAN SOCIETY OF GENE THERAPY, vol. 21, no. 4, 2013, pages 904 - 912, XP002755666
LAMERS CH; WILLEMSEN R; VAN ELZAKKER P; VAN STEENBERGEN-LANGEVELD S; BROERTJES M; OOSTERWIJK-WAKKA J ET AL.: "Immune responses to transgene and retroviral vector in patients treated with ex vivo-engineered T cells", BLOOD, vol. 117, no. 1, 2011, pages 72 - 82, XP055234814, DOI: doi:10.1182/blood-2010-07-294520
LEE DW; KOCHENDERFER JN; STETLER-STEVENSON M; CUI YK; DELBROOK C; FELDMAN SA ET AL.: "T cells expressing CD19 chimeric antigen receptors for acute lymphoblastic leukaemia in children and young adults: a phase 1 dose-escalation trial", LANCET, vol. 385, 2015, pages 517 - 28, XP055388598, DOI: doi:10.1016/S0140-6736(14)61403-3
LI Y; BLEAKLEY M; YEE C.: "IL-21 influences the frequency, phenotype, and affinity of the antigen-specific CD8 T cell response", JOURNAL OF IMMUNOLOGY, vol. 175, 2005, pages 2261 - 9, XP002389121
LIAO SY; AURELIO ON; JAN K; ZAVADA J; STANBRIDGE EJ.: "Identification of the MN/CA9 protein as a reliable diagnostic biomarker of clear cell carcinoma of the kidney", CANCER RESEARCH, vol. 57, no. 14, 1997, pages 2827 - 2831
LIAO SY; BREWER C; ZAVADA J; PASTOREK J; PASTOREKOVA S; MANETTA A ET AL.: "Identification of the MN antigen as a diagnostic biomarker of cervical intraepithelial squamous and glandular neoplasia and cervical carcinomas", AM JPATHOL, vol. 145, no. 3, 1994, pages 598 - 609, XP002933894
LO AS; MA Q; LIU DL; JUNGHANS RP.: "Anti-GD3 chimeric sFv-CD28/T-cell receptor zeta designer T cells for treatment of metastatic melanoma and other neuroectodermal tumors", CLIN CANCER RES, vol. 16, no. 10, 2010, pages 2769 - 2780, XP002754564, DOI: doi:10.1158/1078-0432.CCR-10-0043
LO AS; XU C; MURAKAMI A; MARASCO WA.: "Regression of established renal cell carcinoma in nude mice using lentivirus-transduced human T-cells expressing a human anti-CAIX chimeric antigen receptor", MOLECULAR THERAPY - ONCOLYTICS, vol. 1, 2014, pages 1 - 12
LOKICH J.: "Spontaneous regression of metastatic renal cancer. Case report and literature review", AM J CLIN ONCOL, vol. 20, no. 4, 1997, pages 416 - 418
LONCASTER JA; HARRIS AL; DAVIDSON SE; LOGUE JP; HUNTER RD; WYCOFF CC ET AL.: "Carbonic anhydrase (CA IX) expression, a potential new intrinsic marker of hypoxia: correlations with tumor oxygen measurements and prognosis in locally advanced carcinoma of the cervix", CANCER RESEARCH, vol. 61, no. 17, 2001, pages 6394 - 9
LONG AH; HASO WM; SHEM JF; WANHAINEN KM; MURGAI M; INGARAMO M ET AL.: "4-1BB costimulation ameliorates T cell exhaustion induced by tonic signaling of chimeric antigen receptors", NATURE MEDICINE, vol. 21, 2015, pages 581 - 90, XP055278553, DOI: doi:10.1038/nm.3838
LOSKOG A; GIANDOMENICO V; ROSSIG C; PULE M; DOTTI G; BRENNER MK.: "Addition of the CD28 signaling domain to chimeric T-cell receptors enhances chimeric T-cell resistance to T regulatory cells", LEUKEMIA, vol. 20, no. 10, 2006, pages 1819 - 1828, XP055109421, DOI: doi:10.1038/sj.leu.2404366
MAHER J; BRENTJENS RJ; GUNSET G; RIVIERE I; SADELAIN M.: "Human T-lymphocyte cytotoxicity and proliferation directed by a single chimeric TCRzeta /CD28 receptor", NAT BIOTECHNOL, vol. 20, no. 1, 2002, pages 70 - 5, XP002588277
MANSOUR ET AL., NATURE, vol. 336, 1988, pages 348 - 352
MAUDE SL; FREY N; SHAW PA; APLENC R; BARRETT DM; BUNIN NJ ET AL.: "Chimeric antigen receptor T cells for sustained remissions in leukemia", THE NEW ENGLAND JOURNAL OF MEDICINE, vol. 371, 2014, pages 1507 - 17, XP055188099, DOI: doi:10.1056/NEJMoa1407222
MILONE MC; FISH JD; CARPENITO C; CARROLL RG; BINDER GK; TEACHEY D ET AL.: "Chimeric receptors containing CD137 signal transduction domains mediate enhanced survival of T cells and increased antileukemic efficacy in vivo", MOLECULAR THERAPY : THE JOURNAL OF THE AMERICAN SOCIETY OF GENE THERAPY, vol. 17, no. 8, 2009, pages 1453 - 1464
MIOTTI S; NEGRI DR; VALOTA O; CALABRESE M; BOLHUIS RL; GRATAMA JW ET AL.: "Level of anti-mouse-antibody response induced by bi-specific monoclonal antibody OC/TR in ovarian-carcinoma patients is associated with longer survival", INTERNATIONAL JOURNAL OF CANCER. JOURNAL INTERNATIONAL DU CANCER, vol. 84, no. 1, 1999, pages 62 - 68
MIRZABEKOV T; KONTOS H; FARZAN M; MARASCO W; SODROSKI J.: "Paramagnetic proteoliposomes containing a pure, native, and oriented seven-transmembrane segment protein, CCR5.", NAT BIOTECHNOL, vol. 18, no. 6, 2000, pages 649 - 654, XP002952021, DOI: doi:10.1038/76501
MOR F; COHEN IR.: "IL-2 rescues antigen-specific T cells from radiation or dexamethasone-induced apoptosis. Correlation with induction of Bcl-2", J IMMUNOL, vol. 156, no. 2, 1996, pages 515 - 522
MURUGAIYAN G; SAHA B.: "Protumor vs antitumor functions of IL-17", JIMMUNOL, vol. 183, no. 7, 2009, pages 4169 - 4175
OOSTERWIJK E; RUITER DJ; HOEDEMAEKER PJ; PAUWELS EK; JONAS U; ZWARTENDIJK J ET AL.: "Monoclonal antibody G 250 recognizes a determinant present in renal-cell carcinoma and absent from normal kidney", INTERNATIONAL JOURNAL OF CANCER. JOURNAL INTERNATIONAL DU CANCER, vol. 38, no. 4, 1986, pages 489 - 94, XP008009792, DOI: doi:10.1002/ijc.2910380406
PARDOLL DM.: "The blockade of immune checkpoints in cancer immunotherapy", NATURE REVIEWS CANCER, vol. 12, 2012, pages 252 - 64, XP055415943, DOI: doi:10.1038/nrc3239
PASTOREKOVA S.: "Carbonic anhydrase IX (CA IX) as a potential target for cancer therapy", CANCER THERAPY, vol. 2, 2004, pages 245 - 262
PASTOREKOVA S; PARKKILA S; PARKKILA AK; OPAVSKY R; ZELNIK V; SAARNIO J ET AL.: "Carbonic anhydrase IX, MN/CA IX: analysis of stomach complementary DNA sequence and expression in human and rat alimentary tracts", GASTROENTEROLOGY, vol. 112, no. 2, 1997, pages 398 - 408, XP000909802, DOI: doi:10.1053/gast.1997.v112.pm9024293
PEGRAM HJ; PARK JH; BRENTJENS RJ.: "CD28z CARs and armored CARs", CANCER J, vol. 20, no. 2, 2014, pages 127 - 133, XP055247596, DOI: doi:10.1097/PPO.0000000000000034
SAAMIO J; PARKKILA S; PARKKILA AK; WAHEED A; CASEY MC; ZHOU XY ET AL.: "Immunohistochemistry of carbonic anhydrase isozyme IX (MN/CA IX) in human gut reveals polarized expression in the epithelial cells with the highest proliferative capacity", THE JOURNAL OF HISTOCHEMISTRY AND CYTOCHEMISTRY : OFFICIAL JOURNAL OF THE HISTOCHEMISTRY SOCIETY, vol. 46, no. 4, 1998, pages 497 - 504
SADELAIN M; BRENTJENS R; RIVIERE I.: "The promise and potential pitfalls of chimeric antigen receptors", CURR OPIN IMMUNOL, vol. 21, no. 2, 2009, pages 215 - 223, XP026058399, DOI: doi:10.1016/j.coi.2009.02.009
SCHAFT N; WILLEMSEN RA; DE VRIES J; LANKIEWICZ B; ESSERS BW; GRATAMA JW ET AL.: "Peptide fine specificity of anti-glycoprotein 100 CTL is preserved following transfer of engineered TCR alpha beta genes into primary human T lymphocytes", J IMMUNOL, vol. 170, no. 4, 2003, pages 2186 - 2194
SCHWARZER A; WOLF B; FISHER JL; SCHWAAB T; OLEK S; BARON U ET AL.: "Regulatory T-cells and associated pathways in metastatic renal cell carcinoma (mRCC) patients undergoing DC-vaccination and cytokine-therapy", PLOS ONE, vol. 7, no. 10, 2012, pages E46600
SEDLAKOVA O; SVASTOVA E; TAKACOVA M; KOPACEK J; PASTOREK J; PASTOREKOVA S.: "Carbonic anhydrase IX, a hypoxia-induced catalytic component of the pH regulating machinery in tumors", FRONTIERS IN PHYSIOLOGY, vol. 4, 2014, pages 400
SINGH H; FIGLIOLA MJ; DAWSON MJ; HULS H; OLIVARES S; SWITZER K ET AL.: "Reprogramming CD19-specific T cells with IL-21 signaling can improve adoptive immunotherapy of B-lineage malignancies", CANCER RESEARCH, vol. 71, 2011, pages 3516 - 27, XP055295461, DOI: doi:10.1158/0008-5472.CAN-10-3843
SONG DG; YE Q; CARPENITO C; POUSSIN M; WANG LP; JI C ET AL.: "In vivo persistence, tumor localization, and antitumor activity of CAR-engineered T cells is enhanced by costimulatory signaling through CD137 (4-1BB", CANCER RESEARCH, vol. 71, no. 13, 2011, pages 4617 - 27, XP055526216, DOI: doi:10.1158/0008-5472.CAN-11-0422
SRIVASTAVA S; RIDDELL SR.: "Engineering CAR-T cells: Design concepts", TRENDS IN IMMUNOLOGY, vol. 36, 2015, pages 494 - 502, XP055251965, DOI: doi:10.1016/j.it.2015.06.004
SUI J; AIRD DR; TAMIN A; MURAKAMI A; YAN M; YAMMANURU A ET AL.: "Broadening of neutralization activity to directly block a dominant antibody-driven SARS-coronavirus evolution pathway", PLOSPATHOGENS, vol. 4, no. 11, 2008, pages E1000197, XP003029224, DOI: doi:10.1371/JOURNAL.PPAT.1000197
THOMAS; CAPECCHI, CELL, vol. 51, 1987, pages 503 - 512
TOPALIAN SL; HODI FS; BRAHMER JR; GETTINGER SN; SMITH DC; MCDERMOTT DF ET AL.: "Safety, activity, and immune correlates of anti-PD-1 antibody in cancer", THE NEW ENGLAND JOURNAL OF MEDICINE, vol. 366, 2012, pages 2443 - 54, XP055098235, DOI: doi:10.1056/NEJMoa1200690
TOSTAIN J; LI G; GENTIL-PERRET A; GIGANTE M.: "Carbonic anhydrase 9 in clear cell renal cell carcinoma: a marker for diagnosis, prognosis and treatment", EUROPEAN JOURNAL OF CANCER., vol. 46, 2010, pages 3141 - 8
VAN DER STEGEN SJ; HAMIEH M; SADELAIN M.: "The pharmacology of second-generation chimeric antigen receptors", NATURE REVIEWS DRUG DISCOVERY, vol. 14, 2015, pages 499 - 509, XP055276028, DOI: doi:10.1038/nrd4597
VIRGIN HW; WHERRY EJ; AHMED R.: "Redefining chronic viral infection", CELL, vol. 138, 2009, pages 30 - 50
WALD O; WEISS ID; WALD H; SHOHAM H; BAR-SHAVIT Y; BEIDER K ET AL.: "IFN-gamma acts on T cells to induce NK cell mobilization and accumulation in target organs", JIMMUNOL, vol. 176, no. 8, 2006, pages 4716 - 4729
WHERRY EJ.: "T cell exhaustion", NATURE IMMUNOLOGY, vol. 12, 2011, pages 492 - 9, XP055445573, DOI: doi:10.1038/ni.2035
WILKIE S; PICCO G; FOSTER J; DAVIES DM; JULIEN S; COOPER L ET AL.: "Retargeting of human T cells to tumor-associated MUC1: the evolution of a chimeric antigen receptor", J IMMUNOL, vol. 180, no. 7, 2008, pages 4901 - 4909
XU C; LO A; YAMMANURU A; TALLARICO AS; BRADY K; MURAKAMI A ET AL.: "Unique biological properties of catalytic domain directed human anti-CAIX antibodies discovered through phage-display technology", PLOS ONE, vol. 5, no. 3, 2010, pages E9625
ZAVADA J; ZAVADOVA Z; ZAT'OVICOVA M; HYRSL L; KAWACIUK I.: "Soluble form of carbonic anhydrase IX (CA IX) in the serum and urine of renal carcinoma patients", BR J CANCER, vol. 89, no. 6, 2003, pages 1067 - 71, XP002693545, DOI: doi:10.1038/SJ.BJC.6601264
ZEYTIN H; REALI E; ZAHAROFF DA; ROGERS CJ; SCHLOM J; GREINER JW.: "Targeted delivery of murine IFN-gamma using a recombinant fowlpox virus: NK cell recruitment to regional lymph nodes and priming of tumor-specific host immunity", JOURNAL OF INTERFERON & CYTOKINE RESEARCH : THE OFFICIAL JOURNAL OF THE INTERNATIONAL SOCIETY FOR INTERFERON AND CYTOKINE RESEARCH, vol. 28, no. 2, 2008, pages 73 - 87
ZHU Y; TAN Y; OU R; ZHONG Q; ZHENG L; DU Y ET AL.: "Anti-CD19 chimeric antigen receptor-modified T cells for B-cell malignancies: a systematic review of efficacy and safety in clinical trials", EUROPEAN JOURNAL OF HAEMATOLOGY, 2015

Cited By (91)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10836999B2 (en) 2013-01-28 2020-11-17 St. Jude Children's Research Hospital, Inc. Chimeric receptor with NKG2D specificity for use in cell therapy against cancer and infectious disease
US11873512B2 (en) 2013-01-28 2024-01-16 St. Jude Children's Research Hospital, Inc. Chimeric receptor with NKG2D specificity for use in cell therapy against cancer and infectious disease
US10774309B2 (en) 2013-01-28 2020-09-15 St. Jude Children's Research Hospital, Inc. Natural killer cell immunotherapy for treating cancer
US10801012B2 (en) 2013-01-28 2020-10-13 St. Jude Children's Research Hospital, Inc. Chimeric receptor with NKG2D specificity for use in cell therapy against cancer and infectious disease
US10829737B2 (en) 2013-01-28 2020-11-10 St. Jude Children's Research Hospital, Inc. Chimeric receptor with NKG2D specificity for use in cell therapy against cancer and infectious disease
US10538739B2 (en) 2013-01-28 2020-01-21 St. Jude Children's Research Hospital, Inc. Chimeric receptor with NKG2D specificity for use in cell therapy against cancer and infectious disease
EP4112070A1 (en) * 2014-04-25 2023-01-04 Dana Farber Cancer Institute, Inc. Middle east respiratory syndrome coronavirus neutralizing antibodies and methods of use thereof
US12264335B2 (en) 2014-05-15 2025-04-01 National University Of Singapore Natural killer cells expressing membrane-bound interleukin 15 (mbIL15) and uses thereof
US10774311B2 (en) 2014-05-15 2020-09-15 National University Of Singapore Natural killer cells modified to express membrane-bound interleukin 15 and uses thereof
US11560548B2 (en) 2014-05-15 2023-01-24 National University Of Singapore Immune cells expressing membrane-bound interleukin 15 (mbIL15) and uses thereof
US10428305B2 (en) 2014-05-15 2019-10-01 National University Of Singapore Modified natural killer cells that express IL15 and uses thereof
US10155818B2 (en) 2014-05-28 2018-12-18 Agenus Inc. Anti-GITR antibodies and methods of use thereof
US11401335B2 (en) 2014-05-28 2022-08-02 Agenus Inc. Anti-GITR antibodies and methods of use thereof
US10280226B2 (en) 2014-05-28 2019-05-07 Agenus Inc. Anti-GITR antibodies and methods of use thereof
US10577426B2 (en) 2014-05-28 2020-03-03 Agenus Inc. Anti-GITR antibodies and methods of use thereof
US10829559B2 (en) 2014-05-28 2020-11-10 Agenus Inc. Anti-GITR antibodies and methods of use thereof
US11897962B2 (en) 2014-05-28 2024-02-13 Agenus Inc. Anti-GITR antibodies and methods of use thereof
US10800849B2 (en) 2014-05-28 2020-10-13 Agenus Inc. Anti-GITR antibodies and methods of use thereof
US11447557B2 (en) 2015-12-02 2022-09-20 Agenus Inc. Antibodies and methods of use thereof
US10836830B2 (en) 2015-12-02 2020-11-17 Agenus Inc. Antibodies and methods of use thereof
WO2017147383A1 (en) 2016-02-25 2017-08-31 Cell Medica Switzerland Ag Modified cells for immunotherapy
EP3432924A1 (en) * 2016-03-23 2019-01-30 Novartis AG Cell secreted minibodies and uses thereof
US11834505B2 (en) 2016-06-29 2023-12-05 Checkpoint Therapeutics, Inc. PD-L1-specific antibodies and methods of using the same
US10590199B2 (en) 2016-06-29 2020-03-17 Checkpoint Therapeutics, Inc. PD-L1-specific antibodies and methods of using the same
WO2018005682A3 (en) * 2016-06-29 2018-02-08 Checkpoint Therapeutics, Inc. Pd-l1-specific antibodies and methods of using the same
US12023355B2 (en) 2016-07-07 2024-07-02 Iovance Biotherapeutics, Inc. Programmed death 1 ligand 1 (PD-L1) binding proteins and methods of use thereof
US11141434B2 (en) 2016-07-07 2021-10-12 Iovance Biotherapeutics, Inc. Programmed death 1 ligand 1 (PD-L1) binding proteins and methods of use thereof
JP7093771B2 (en) 2016-07-07 2022-06-30 アイオバンス バイオセラピューティクス,インコーポレイテッド Programmed Death 1 Ligand 1 (PD-L1) -binding protein and its usage
JP2019525771A (en) * 2016-07-07 2019-09-12 アイオバンス バイオセラピューティクス,インコーポレイテッド Programmed death 1 ligand 1 (PD-L1) binding protein and method of use thereof
US11992519B2 (en) 2016-09-21 2024-05-28 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Chimeric antigen receptor (CAR) that targets chemokine receptor CCR4 and its use
EP3515475B1 (en) 2016-09-21 2024-05-01 The U.S.A. as represented by the Secretary, Department of Health and Human Services Chimeric antigen receptor (car) that targets chemokine receptor ccr4 and its use
US11077178B2 (en) 2016-09-21 2021-08-03 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Chimeric antigen receptor (CAR) that targets chemokine receptor CCR4 and its use
WO2018057585A1 (en) * 2016-09-21 2018-03-29 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Chimeric antigen receptor (car) that targets chemokine receptor ccr4 and its use
JP2019536469A (en) * 2016-09-21 2019-12-19 ザ ユナイテッド ステイツ オブ アメリカ, アズ リプレゼンテッド バイ ザ セクレタリー, デパートメント オブ ヘルス アンド ヒューマン サービシーズ Chimeric antigen receptor (CAR) targeting chemokine receptor CCR4 and uses thereof
AU2017332161B9 (en) * 2016-09-21 2024-08-22 The United States Government As Represented By The Department Of Veterans Affairs Chimeric antigen receptor (car) that targets chemokine receptor CCR4 and its use
JP2022160443A (en) * 2016-10-04 2022-10-19 プレシジョン バイオサイエンシズ,インク. Costimulatory domains for use in genetically engineered cells
JP7106715B2 (en) 2016-10-04 2022-07-26 プレシジョン バイオサイエンシズ,インク. Costimulatory domains for use in genetically engineered cells
JP2021151235A (en) * 2016-10-04 2021-09-30 プレシジョン バイオサイエンシズ,インク. Co-stimulatory domains for use in genetically modified cells
US11286291B2 (en) 2016-10-04 2022-03-29 Precision Biosciences, Inc. Co-stimulatory domains for use in genetically-modified cells
JP2019528769A (en) * 2016-10-04 2019-10-17 プレシジョン バイオサイエンシズ,インク. Co-stimulatory domains for use in genetically modified cells
US11359028B2 (en) 2016-11-09 2022-06-14 Agenus Inc. Anti-OX40 antibodies and anti-GITR antibodies
US12049511B2 (en) 2016-11-10 2024-07-30 Fortis Therapeutics, Inc. Engineered CD46-specific effector cells and uses thereof in the treatment of cancer
WO2018089829A1 (en) 2016-11-10 2018-05-17 Fortis Therapeutics, Inc. Cd46-specific effector cells and uses thereof
EP3538551A4 (en) * 2016-11-10 2020-11-11 Fortis Therapeutics, Inc. Cd46-specific effector cells and uses thereof
JP2019535303A (en) * 2016-12-05 2019-12-12 上海優▲か▼迪生物医薬科技有限公司Shanghai Unicar−Therapy Bio−Medicine Technology Co.,Ltd CAR-T gene recombination vector and its construction method and use for suppressing immune escape with PDL1 blocked
US11896616B2 (en) 2017-03-27 2024-02-13 National University Of Singapore Stimulatory cell lines for ex vivo expansion and activation of natural killer cells
US11365236B2 (en) 2017-03-27 2022-06-21 Nkarta, Inc. Truncated NKG2D chimeric receptors and uses thereof in natural killer cell immunotherapy
US12351617B2 (en) 2017-03-27 2025-07-08 National University Of Singapore Immune cells comprising truncated NKG2D chimeric receptors
US11166985B2 (en) 2017-05-12 2021-11-09 Crispr Therapeutics Ag Materials and methods for engineering cells and uses thereof in immuno-oncology
US11622977B2 (en) 2017-05-12 2023-04-11 Crispr Therapeutics Ag Materials and methods for engineering cells and uses thereof in immuno-oncology
US11298378B2 (en) 2017-05-12 2022-04-12 Crispr Therapeutics Ag Materials and methods for engineering cells and uses thereof in immuno-oncology
US10729725B2 (en) 2017-05-12 2020-08-04 Crispr Therapeutics Ag Materials and methods for engineering cells and uses thereof in immuno-oncology
US10857184B2 (en) 2017-05-12 2020-12-08 Crispr Therapeutics Ag Materials and methods for engineering cells and uses thereof in immuno-oncology
US10881689B2 (en) 2017-05-12 2021-01-05 Crispr Therapeutics Ag Materials and methods for engineering cells and uses thereof in immuno-oncology
US11207351B2 (en) 2017-05-12 2021-12-28 Crispr Therapeutics Ag Materials and methods for engineering cells and uses thereof in immuno-oncology
US11202802B2 (en) 2017-05-12 2021-12-21 Crispr Therapeutics Ag Materials and methods for engineering cells and uses thereof in immuno-oncology
US11013767B2 (en) 2017-05-12 2021-05-25 Crispr Therapeutics Ag Materials and methods for engineering cells and uses thereof in immuno-oncology
US11191783B2 (en) 2017-05-12 2021-12-07 Crispr Therapeutics Ag Materials and methods for engineering cells and uses thereof in immuno-oncology
US11471491B1 (en) 2017-05-12 2022-10-18 Crispr Therapeutics Ag Materials and methods for engineering cells and uses thereof in immuno-oncology
US10736919B2 (en) 2017-05-12 2020-08-11 Crispr Therapeutics Ag Materials and methods for engineering cells and uses thereof in immuno-oncology
US11071755B1 (en) 2017-05-12 2021-07-27 Crispr Therapeutics Ag Materials and methods for engineering cells and uses thereof in immuno-oncology
US11135247B2 (en) 2017-05-12 2021-10-05 Crispr Therapeutics Ag Materials and methods for engineering cells and uses thereof in immuno-oncology
WO2018223600A1 (en) * 2017-06-06 2018-12-13 上海优卡迪生物医药科技有限公司 Octs-car dual targeting chimeric antigen receptor, encoding gene, recombinant expression vector and construction and use thereof
US12258381B2 (en) 2018-02-09 2025-03-25 National University Of Singapore Activating chimeric receptors and uses thereof in natural killer cell immunotherapy
US12258378B2 (en) 2018-03-14 2025-03-25 Dana-Farber Cancer Institute, Inc. Engineered cells, T cell immune modulating antibodies and methods for using the same
US12441787B2 (en) 2018-04-02 2025-10-14 National University Of Singapore Neutralization of human cytokines with membrane-bound anti-cytokine non-signaling binders expressed in immune cells
US11649438B2 (en) 2018-05-11 2023-05-16 Crispr Therapeutics Ag Methods and compositions for treating cancer
US12227763B2 (en) 2018-05-11 2025-02-18 Crispr Therapeutics Ag Methods and compositions for treating cancer
US11254912B2 (en) 2018-05-11 2022-02-22 Crispr Therapeutics Ag Methods and compositions for treating cancer
CN112334479A (en) * 2018-07-13 2021-02-05 南京传奇生物科技有限公司 Co-receptor systems for the treatment of infectious diseases
EP3820888A4 (en) * 2018-07-13 2022-04-27 Nanjing Legend Biotech Co., Ltd. CO-RECEPTOR SYSTEMS FOR THE TREATMENT OF INFECTIOUS DISEASES
WO2020011247A1 (en) 2018-07-13 2020-01-16 Nanjing Legend Biotech Co., Ltd. Co-receptor systems for treating infectious diseases
US20210292427A1 (en) * 2018-07-24 2021-09-23 Cafa Therapeutics Limited Method for treating tumor using immune effector cell
US12486514B2 (en) 2018-08-29 2025-12-02 National University Of Singapore Method to specifically stimulate survival and expansion of genetically-modified immune cells
US12049510B2 (en) 2018-09-27 2024-07-30 Autolus Limited Chimeric antigen receptor
US12454578B2 (en) 2018-09-27 2025-10-28 Autolus Limited Cytolytic immune cell comprising BCMA- and CD19-specific chimeric antigen receptors
EP3886877A4 (en) * 2018-11-26 2022-08-24 Nkarta, Inc. METHODS OF SIMULTANEOUS EXPANSION OF MULTIPLE IMMUNE CELL TYPES, COMPOSITIONS THEREOF AND USES THEREOF IN CANCER IMMUNOTHERAPY
AU2019385873B2 (en) * 2018-11-26 2026-02-05 Nkarta, Inc. Methods for the simultaneous expansion of multiple immune cell types, related compositions and uses of same in cancer immunotherapy
CN113226340A (en) * 2018-11-26 2021-08-06 恩卡尔塔公司 Methods of simultaneously expanding multiple immune cell types, related compositions, and uses thereof in cancer immunotherapy
US12590148B2 (en) 2018-11-26 2026-03-31 Nkarta, Inc. Methods for the simultaneous expansion of multiple immune cell types, related compositions and uses of same in cancer immunotherapy
US12577311B2 (en) 2018-11-30 2026-03-17 Dana-Farber Cancer Institute, Inc. Chimeric antigen receptor factories and methods of use thereof
US11253547B2 (en) 2019-03-05 2022-02-22 Nkarta, Inc. CD19-directed chimeric antigen receptors and uses thereof in immunotherapy
US11141436B2 (en) 2019-03-05 2021-10-12 Nkarta, Inc. Immune cells engineered to express CD19-directed chimeric antigen receptors and uses thereof in immunotherapy
US12398187B2 (en) 2019-03-05 2025-08-26 Nkarta, Inc. CD19-directed chimeric antigen receptors and uses thereof in immunotherapy
US11154575B2 (en) 2019-03-05 2021-10-26 Nkarta, Inc. Cancer immunotherapy using CD19-directed chimeric antigen receptors
US11389481B2 (en) 2019-04-30 2022-07-19 Crispr Therapeutics Ag Allogeneic cell therapy of B cell malignancies using genetically engineered T cells targeting CD19
US12005081B2 (en) 2019-04-30 2024-06-11 Senti Biosciences, Inc. Chimeric receptors and methods of use thereof
US12448462B2 (en) 2019-06-14 2025-10-21 Dana-Farber Cancer Institute, Inc. Antibodies against MUC1
US12144888B2 (en) 2020-08-07 2024-11-19 Fortis Therapeutics, Inc. Immunoconjugates targeting CD46 and methods of use thereof
US11484604B2 (en) 2020-08-07 2022-11-01 Fortis Therapeutics, Inc. Immunoconjugates targeting CD46 and methods of use thereof
WO2022235940A1 (en) 2021-05-06 2022-11-10 Dana-Farber Cancer Institute, Inc. Antibodies against alk and methods of use thereof

Also Published As

Publication number Publication date
IL252295B2 (en) 2023-10-01
AU2022200257B2 (en) 2023-11-16
JP7548950B2 (en) 2024-09-10
CN108064252A (en) 2018-05-22
WO2016100985A3 (en) 2016-08-18
KR20170090506A (en) 2017-08-07
US12195514B2 (en) 2025-01-14
EP3233900A2 (en) 2017-10-25
BR112017013176A2 (en) 2018-05-15
US20170362297A1 (en) 2017-12-21
AU2020204373A1 (en) 2020-07-23
AU2020204373B2 (en) 2021-10-21
AU2015364245B2 (en) 2020-04-02
KR102923234B1 (en) 2026-02-04
JP2024163140A (en) 2024-11-21
AU2024200592A1 (en) 2024-02-22
US20250243259A1 (en) 2025-07-31
IL252295A0 (en) 2017-07-31
AU2015364245A1 (en) 2017-06-08
IL320860A (en) 2025-07-01
IL302660A (en) 2023-07-01
RU2017125531A (en) 2019-01-21
AU2024200592B2 (en) 2026-03-12
JP2022064952A (en) 2022-04-26
JP7833003B2 (en) 2026-03-18
CA2968412A1 (en) 2016-06-23
IL252295B1 (en) 2023-06-01
JP2018504894A (en) 2018-02-22
IL302660B2 (en) 2025-10-01
KR20260038272A (en) 2026-03-18
US20210061877A1 (en) 2021-03-04
IL302660B1 (en) 2025-06-01
AU2022200257A1 (en) 2022-02-10

Similar Documents

Publication Publication Date Title
AU2024200592B2 (en) Chimeric antigen receptors and methods of use thereof
US12024567B2 (en) Method of treating a tumor expressing carbonic anhydrase IX (G250) by administering a G250-specific chimeric antigen receptor
JP6989634B2 (en) Chimeric antigen receptor targeting B cell maturation antigen
CN113784732B (en) Engineered immune cells targeting BCMA and uses thereof
US20200405811A1 (en) Cd5 chimeric antigen receptor for adoptive t cell therapy
JP2023145589A (en) Novel platforms for costimulation, novel CAR designs, and other enhancements for adoptive cell therapy
AU2019235900B2 (en) Engineered cells, T cell immune modulating antibodies and methods for using the same
WO2015193406A1 (en) Cd123 specific multi-chain chimeric antigen receptor

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 15828615

Country of ref document: EP

Kind code of ref document: A2

WWE Wipo information: entry into national phase

Ref document number: 252295

Country of ref document: IL

ENP Entry into the national phase

Ref document number: 2968412

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2015364245

Country of ref document: AU

Date of ref document: 20151221

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2017532639

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 15537779

Country of ref document: US

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112017013176

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 20177020045

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2017125531

Country of ref document: RU

Kind code of ref document: A

REEP Request for entry into the european phase

Ref document number: 2015828615

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 112017013176

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20170619

WWD Wipo information: divisional of initial pct application

Ref document number: 320860

Country of ref document: IL