WO2016064643A1 - Lactobacillus acidophilus surface layer protein a (slpa) as a therapeutic agent for the treatment of inflammatory diseases - Google Patents

Lactobacillus acidophilus surface layer protein a (slpa) as a therapeutic agent for the treatment of inflammatory diseases Download PDF

Info

Publication number
WO2016064643A1
WO2016064643A1 PCT/US2015/055620 US2015055620W WO2016064643A1 WO 2016064643 A1 WO2016064643 A1 WO 2016064643A1 US 2015055620 W US2015055620 W US 2015055620W WO 2016064643 A1 WO2016064643 A1 WO 2016064643A1
Authority
WO
WIPO (PCT)
Prior art keywords
slpa
protein
seq
amino acid
acid sequence
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2015/055620
Other languages
French (fr)
Inventor
Yaima L. LIGHTFOOT
Bikash SAHAY
Mansour Mohamadzadeh
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
University of Florida
University of Florida Research Foundation Inc
Original Assignee
University of Florida
University of Florida Research Foundation Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by University of Florida, University of Florida Research Foundation Inc filed Critical University of Florida
Priority to US15/521,418 priority Critical patent/US10562943B2/en
Publication of WO2016064643A1 publication Critical patent/WO2016064643A1/en
Anticipated expiration legal-status Critical
Priority to US16/790,793 priority patent/US11098088B2/en
Priority to US16/804,020 priority patent/US11028135B2/en
Priority to US17/340,141 priority patent/US20210300973A1/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/195Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • C07K14/335Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Lactobacillus (G)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/66Microorganisms or materials therefrom
    • A61K35/74Bacteria
    • A61K35/741Probiotics
    • A61K35/744Lactic acid bacteria, e.g. enterococci, pediococci, lactococci, streptococci or leuconostocs
    • A61K35/747Lactobacilli, e.g. L. acidophilus or L. brevis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/04Peptides having up to 20 amino acids in a fully defined sequence; Derivatives thereof
    • A61K38/12Cyclic peptides, e.g. bacitracins; Polymyxins; Gramicidins S, C; Tyrocidins A, B or C
    • A61K38/13Cyclosporins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/164Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/0012Galenical forms characterised by the site of application
    • A61K9/0053Mouth and digestive tract, i.e. intraoral and peroral administration
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N1/00Microorganisms; Compositions thereof; Processes of propagating, maintaining or preserving microorganisms or compositions thereof; Processes of preparing or isolating a composition containing a microorganism; Culture media therefor
    • C12N1/20Bacteria; Culture media therefor
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/74Vectors or expression systems specially adapted for prokaryotic hosts other than E. coli, e.g. Lactobacillus, Micromonospora
    • C12N15/746Vectors or expression systems specially adapted for prokaryotic hosts other than E. coli, e.g. Lactobacillus, Micromonospora for lactic acid bacteria (Streptococcus; Lactococcus; Lactobacillus; Pediococcus; Enterococcus; Leuconostoc; Propionibacterium; Bifidobacterium; Sporolactobacillus)

Definitions

  • the gastrointestinal (GI) microbiota plays a critical role in determining the immunologic outcome of various signaling events in host cells via their gene products, exceeding the human genome by a hundredfold (Ley et al, 2006; Qin et al, 2010). As such, the composition of the GI microbiota and host immunity are mutualistic and continuously influence each other (Maslowski and Mackay, 2011; McDermott and Huffnagle, 2014).
  • Intestinal homeostasis is tightly controlled by regulatory immune mechanisms, which are established by the interactions of the trillions of microbes and their gene products with numerous pattern recognition receptors (PRRs), including C-type lectin receptors (CLRs), such as SIGNR3 (Konstantinov et al, 2008; Osorio and Reis e Sousa, 2011). Disruption of this delicate balance by inimical signals has devastating consequences that may result in intestinal disorders, including inflammatory bowel disease (IBD).
  • IBD inflammatory bowel disease
  • innate cells trigger intestine-infiltrating pathogenic T cell subsets ⁇ e.g., Thl, Thl7), and regulatory T cells (Tregs) with pro-inflammatory characteristics (Geremia et al., 2014; Khazaie et al., 2012; Neurath, 2014) that ultimately drive tissue destruction and intestinal disease progression.
  • Innate cells ⁇ e.g., dendritic cells, macrophages
  • Sips Lactobacillus acidophilus surface layer proteins
  • L. acidophilus NCFM possesses three Slp- encoding genes: slpA (LBA0169), slpB (LBA0175), and slpX (LBA0512) (Goh et al, 2009).
  • Sips including cell shape determinants, molecular sieves, protective layers against viral infection, anchoring sites for surface- associated enzymes and facilitators of cellular adhesion through PRRs, including C-type lectins (CLECs) (Konstantinov et al, 2008).
  • CLECs C-type lectins
  • CLECs recognize carbohydrate structures on self and non-self antigens (Engering et al, 2002; Osorio and Reis e Sousa, 2011). Eighteen CLECs, including DC-specific ICAM-3- grabbing nonintegrin (DC-SIGN), have been identified on dendritic cells (DCs) and macrophages (M ⁇ s) (Ehlers, 2010; van Kooyk and Geijtenbeek, 2003). DC-SIGN, which was previously shown to bind L.
  • DC-SIGN DC-specific ICAM-3- grabbing nonintegrin
  • SIGNR3 contains a carbohydrate recognition domain (CRD) and signals through a hemi-immunoreceptor tyrosine-based activation motif (hemi-ITAM) pathway (Tanne et al., 2009).
  • hemi-ITAM hemi-immunoreceptor tyrosine-based activation motif
  • Such signaling potentially downregulates the ubiquitously expressed leukotriene A 4 hydrolase (LTA 4 H) (Tobin et al., 2010) that catalyzes proinflammatory leukotriene B 4 (LTB 4 ) synthesis from LTA 4 (Snelgrove et al, 2010), which consequently activates interleukin (IL)-1 ⁇ production.
  • LTA 4 H ubiquitously expressed leukotriene A 4 hydrolase
  • LTA 4 H proinflammatory leukotriene B 4
  • LTA 4 proinflammatory leukotriene B 4
  • IL interleukin
  • the current invention provides a recombinant bacterium, for example, a recombinant Lactobacillus acidophilus, the recombinant bacterium being genetically modified to decrease or eliminate the display of lipoteichoic acid (LTA), surface layer protein B (SlpB) and surface layer protein X (SlpX) on the surface of said bacterium.
  • LTA lipoteichoic acid
  • SlpB surface layer protein B
  • SlpX surface layer protein X
  • the current invention also provides an efficacious therapy for a subject suffering from an inflammation mediated disease (inflammatory diseases), for example, an autoinflammatory disease, such as IBD or other inflammatory diseases, such as allergies, ankylosing spondylitis, Crohn's disease, diabetes, Type I diabetes, gastroesophageal reflux disease, Hashimoto's thyroiditis, hyperthyroidism, hypothyroidism, interstitial cystitis (IC), Lofgren's syndrome, lupus erythematosis, myasthenia gravis, multiple sclerosis, osteoarthritis, polymyalgia rheumatica, prostatitis, psoriasis, psoriatic arthritis, Raynaud's syndrome/phenomenon, reactive arthritis (Reiter syndrome), restless leg syndrome, reflex sympathetic dystrophy (RSD), rheumatoid arthritis, scleroderma, Sjogren's syndrome, ulcerative colitis and uveitis.
  • an autoinflammatory disease
  • the methods of the current invention comprise administering to a subject in need thereof a therapeutically effective amount of recombinant L. acidophilus cells of the current invention or a therapeutically effective amount of purified surface layer protein A (SlpA), for example, SlpA isolated from L. acidophilus.
  • the L. acidophilus cells belong to L. acidophilus strain NCK2187 which is a bacterium genetically modified to decrease or eliminate the display of LTA, SlpB and SlpX on the surface.
  • Another embodiment provides for the recombinant expression of SlpA in bacterial cells that are devoid of LTA, SlpB and SlpX expression on the cell surface.
  • the recombinant bacterial cells e.g., L. acidophilus cells
  • SlpA isolated from L. acidophilus can be formulated into a pharmaceutical composition comprising a pharmaceutically acceptable carrier and/or excipient (optionally in combination with other therapeutic agents).
  • the pharmaceutical composition is administered orally.
  • FIGS 1A-1E L. acidophilus NCK2187 strain development and characteristics.
  • A Agarose gel image illustrating PCR amplicons of ItaS (LBA0447), slpB, and slpX deletions in NCK2187.
  • B SDS-PAGE gel of 5 M LiCl-purified S-layer fractions from the parental strains, NCK56 and NCK1909; NCK2030 (LTA + , SlpA + , SlpB-, SlpX-); and NCK2187 (LTA , SlpA + , SlpB-, SlpX-).
  • C Protein gel showing predominance of SlpA in NCK2187 and absence of other Sips.
  • D Protein gel showing predominance of SlpA in NCK2187 and absence of other Sips.
  • FIGS. 2A-2C L. acidophilus NCK2187 promotes intestinal regulation in steady- state.
  • A. B6 mice were orally gavaged with 10 9 CFU NCK56 (blue) or NCK2187 (green) on days 0, 3, 6, and 9, or left untreated, and immune responses in the colon analyzed at day 14 by flow cytometry.
  • B-C. FoxP3-GFP mice were treated and evaluated as in (A).
  • mice A group of mice was co-transferred with CD4 CD25 + T cells as a positive control for protection (Tregs; gray). Colitis severity was determined in part by weight loss, diarrhea scores, and FOB (A). (See Tables 2-4 for statistical analyses results.)
  • FIGS. 4A-4D L. acidophilus NCK2187 and its SlpA protect intestinal barrier function and prevent dysbiosis in pathogenic T-cell induced colitis.
  • Ragl -/- mice were injected with 10 6 CD4 + CD45RB hi T cells, and then orally gavaged with NCK56 (red), NCK2187 (green), or SlpA (blue), 1 and 3 days after transfer, and subsequently once a week for 4 consecutive weeks, or left untreated (magenta).
  • a group of mice was co-transferred with CD4 CD25 + T cells as a positive control for protection (Tregs; gray).
  • FIGS. 5A-5D L. acidophilus NCK2187 and its SlpA bind to murine SIGNR3 to induce regulatory signals.
  • A. B6 mice were orally gavaged with 10 9 CFU NCK56 or NCK2187 and the colonic gene expression of C-type lectin receptors were measured by RT- PCR. Each box represents an individual mouse; n 4. Data represent three individual experiments and are shown as mean ⁇ SEM.
  • B. Binding of SlpA to various hFc fusion proteins were analyzed by flow cytometry.
  • C IL- ⁇ production by colonic DCs of naive WT B6 GF or Signr3-/- mice treated with NCK56 (blue) or NCK2187 (green) on days 0, 3, 6, and 9, or left untreated (black), as determined by flow cytometry.
  • D IL- ⁇ production by colonic DCs of naive WT B6 GF or Signr3-/- mice treated with NCK56 (blue) or NCK2187 (green) on days 0, 3, 6, and 9, or left untreated (black), as determined by flow cytometry.
  • FIGS 6A-6H L. acidophilus NCK2187 and its SlpA do not protect against DSS- induced colitis in Signr3 mice.
  • WT or Signr3 ' (KO) mice were orally gavaged with NCK56, NCK2187 or SlpA at days -1 and -3, and 3% DSS was given in the drinking water. Mice were gavaged with bacteria or purified SlpA an additional 2 times and monitored for disease progression. Colitis severity was determined in part by weight loss (A). (See Table 6 for statistical analyses from WT mice.)
  • mice/group 4-6 mice/group.
  • H Species richness and microbial diversity in DSS-treated mice. Top: The Chao richness index was used as a measure of species richness. Bottom: The Shannon diversity index was used to estimate microbial diversity for each group. Data are shown as mean ⁇ SEM. *P ⁇ 0.05, **P ⁇ 0.01, ****P ⁇ 0.0001.
  • FIGS 7A-7C L. acidophilus NCK2187 and its SlpA do not prevent immune infiltration and activation during DSS-induced colitis in Signr3 -/- mice.
  • WT or Signr3 -/- (KO) mice were orally gavaged with NCK56, NCK2187 or SlpA at days -1 and -3, and 3% DSS was given in the drinking water. Mice were gavaged with bacteria or purified SlpA an additional 2 times, and immunity analyzed by flow cytometry at day 10.
  • B-C The results indicate the frequency of neutrophils in the colons of untreated or DSS-treated WT (left) and Signr3 -/- mice (right).
  • Colonic DCs and M ⁇ s were analyzed by flow cytometry for the production of IL- ⁇ (B), and colonic Tregs were evaluated for co-expression of RORyt + (C).
  • n 5 mice/group.
  • FIGS 8A-8B L. acidophilus NCK2187 and its SlpA in pathogenic T-cell induced colitis.
  • Ragl mice were injected with 10 6 CD4+CD45RBhi T cells, and then orally gavaged with NCK56 (red), NCK2187 (green), or SlpA (blue), 1 and 3 days after transfer, and subsequently once a week for 4 consecutive weeks, or left untreated (magenta).
  • a group of mice was co-transferred with CD4 + CD25 + T cells as a positive control for protection (Tregs; gray).
  • FIGS 10A-10B Dextran sodium sulfate (DSS) treatment and oral gavage regimens.
  • DSS Dextran sodium sulfate
  • mice were orally gavaged with NCK56, NCK2187 or SlpA at the specified time points. 3% DSS was given in the drinking water from days 0 to 5.
  • B DSS-induced colitis therapy. 3% DSS was given in the drinking water from days 0 to 5. Mice were then orally gavaged with NCK56, NCK2187, or SlpA at the circled time points.
  • FIGS 11A-11E L. acidophilus-SlpA protects against DSS-induced colitis.
  • C57BL/6 mice were orally gavaged with NCK56, NCK2187 or SlpA, and 3% DSS was given in the drinking water.
  • Colitis development in the mice was monitored by measuring weight loss (A), diarrhea development (B), presence of fecal occult blood (FOB) (C), gross morphology of the colons (D), and histopathology (E).
  • A weight loss
  • B diarrhea development
  • FOB fecal occult blood
  • D gross morphology of the colons
  • E histopathology
  • *P ⁇ 0.05, **P ⁇ 0.01 and ***P ⁇ 0.001 representing the specified group by its color compared with PBS.
  • FIGS 12A-12E L. acidophilus-SlpA reverses DSS-induced colitis.
  • C57BL/6 mice were given 3% DSS in the drinking water, and were then orally gavaged with NCK56, NCK2187 or SlpA.
  • Colitis development in the mice was monitored by measuring weight loss (A), diarrhea development (B), presence of fecal occult blood (FOB) (C), gross morphology of the colons (D), and histopathology (E).
  • A weight loss
  • B diarrhea development
  • FOB fecal occult blood
  • D gross morphology of the colons
  • E histopathology
  • *P ⁇ 0.05 and **P ⁇ 0.01 representing the specified group by its color compared with PBS.
  • FIGS 13A-13E L. acidophilus-SlpA protects against pathogenic T cell-induced colitis.
  • Rag 1-/- mice were injected with 10 6 CD4 CD25 T cells, and were then orally gavaged with NCK56, NCK2187, or SlpA, 1 and 3 days after transfer, and subsequently once a week for 4 consecutive weeks.
  • Colitis development in the mice was monitored by measuring weight loss (A), diarrhea development (B), presence of fecal occult blood (FOB) (C, gross morphology of the colons (D), and histopathology (E).
  • A weight loss
  • B diarrhea development
  • FOB fecal occult blood
  • D gross morphology of the colons
  • E histopathology
  • NCK2187 induces the generation of Tregs in healthy controls.
  • C57BL/6 mice were orally gavaged with 10 9 CFU NCK56 (WT), NCK2187 (SlpA + ), or left untreated; immune responses were analyzed by flow cytometry 3 days-post gavage.
  • WT CFU NCK56
  • SlpA + NCK2187
  • FIG. 14B spleens
  • FIGS 15A-15C L. acidophilus-SlpA isolation by NaCl.
  • L. acidophilus-SlpA was isolated and purified using NaCl.
  • A. SDS-PAGE containing 2.5 ⁇ g of LiCl- and NaCl- isolated SlpA stained with Coomassie blue to visualize the purified protein.
  • B-C. Mass spectrometry data analyzed on the Scaffold (Searle 2010) platform showed 97 unique spectra with 55 unique peptides with the possibility of two proteins (B).
  • 58336516 (SlpA) shows 54% coverage whereas gi
  • the regions of SlpB matching the generated peptides are common between SlpA and SlpB (shown in the red box, C), and no single unique peptide from SlpB was identified.
  • FIGS 16A-16E NaCl-purified SlpA is not toxic to mice.
  • A-E C57BL/6 mice were treated orally every other day with SlpA (0, 150, 300, 600 ⁇ g/100 ⁇ L per mouse), for a total of four times. One-week later, mice were sacrificed and a whole blood chemistry profile was generated for each mouse with a comprehensive metabolic chemistry panel, using a VetScan V2S analyzer. All animal experiments were performed under the guidelines of the Animal Welfare Act and the Public Health Policy on Humane Care, and with approval by the Institutional Animal Care and Use Committee (IACUC protocol 201406559) at the University of Florida.
  • IACUC protocol 201406559 Institutional Animal Care and Use Committee
  • FIGS 17A-17E Generated mAb BM1 recognizes L. acidophilus-SlpA.
  • C57BL/6 mice were immunized once a week for 3 months with 100 ⁇ g of SlpA, and 300 ⁇ g of heat- killed Lactobacillus gasseri as adjuvant.
  • Polyclonal sera were tested for recognition of isolated SlpA by Western Blot (WB), and splenic cells from SlpA-reactive mice were fused with Sp2/0 myeloma cells at a ratio of 7:1. Hybridomas were seeded on semi-solid medium for clone selection and screening. Subsequently, clones were screened by ELISA for SlpA reactivity.
  • Reactive clones were isotyped and all IgM secretors removed.
  • Clone BM1 (IgG) was selected for its ability to recognize SlpA by WB (A), flow cytometry (B), confocal microscopy (C), and ELISA (D, E).
  • Proteins separated by SDS-PAGE were transferred onto a PVDF membrane and detected by BM1.
  • Carboxylated Dynabeads were coated with purified SlpA and reactivity of BM1 mAb confirmed by Canto II flow cytometry. Data were analyzed by Flow Jo. Experiments were performed at least three times with similar trends.
  • RAW 264.7 cells were pulsed for 1 or 3 hrs with NaCl purified SlpA (10 ⁇ g/mL). Subsequently, cells were fixed and stained with BMl mAb for detection by confocal microscopy. Cells were incubated with BMl mAb, overnight.
  • BMl by ELISA BMl by ELISA.
  • ELISA plates were coated with 500 ng of purified SlpA overnight, and binding by BMl was tested thereafter.
  • E. Germ- free (GF) mice were orally treated with 10 9 CFU L. acidophilus, 150 ⁇ g of SlpA, or left untreated. Fecal pellets from these mice were used to coat ELISA plates; BSA was used as a negative control.
  • BMl mAb only bound to plates coated with feces derived from treated mice. All animal experiments were performed under the guidelines of the Animal Welfare Act and the Public Health Policy on Humane Care, and with approval by the Institutional Animal Care and Use Committee (IACUC protocol 201406559) at the University of Florida. *** denotes statistical significance p ⁇ 0.01. ***p ⁇ 0.001.
  • SEQ ID NO: 1 Amino acid sequence of phosphoglycerol transferase protein from L. acidophilus (Genbank Accession No. AAV42337.1).
  • SEQ ID NO: 2 Amino acid sequence of SlpB protein from L. acidophilus (Genbank
  • SEQ ID NO: 3 Amino acid sequence of SlpX protein from L. acidophilus (Genbank Accession No. YP_193425).
  • SEQ ID NO: 4 Amino acid sequence of SlpA protein from L. acidophilus (Genbank Accession No. P35829).
  • SEQ ID NO: 5 to 46 The list of primer sequences for Real-Time PCR analyses (see Table 1).
  • SEQ ID NO: 47 to 55 SlpA protein sequences as discussed below.
  • the current invention provides a bacterium lacking on its surface LTA, SlpB and SlpX.
  • the current invention also provides SlpA as an effector molecule expressed by bacteria, for example, L. acidophilus and its in vivo protective role in inflammation mediated diseases (inflammatory diseases), for example, inflammation mediated diseases of the gastrointestinal tract such as IBD or other inflammatory diseases, such as allergies, ankylosing spondylitis, Crohn's disease, diabetes, Type I diabetes, gastroesophageal reflux disease, Hashimoto's thyroiditis, hyperthyroidism, hypothyroidism, Irritable Bowel Syndrome (IBS), interstitial cystitis (IC), Lofgren's syndrome, lupus erythematosis, myasthenia gravis, multiple sclerosis, osteoarthritis, polymyalgia rheumatica, prostatitis, psoriasis, psoriatic arthritis, Raynaud's syndrome/phenomenon,
  • a bacterium lacking LTA and methods of preparing such bacterium are described in
  • the current invention provides a bacterium further modified to decrease or eliminate the display of SlpB and SlpX on the surface.
  • bacterial cells lacking LTA expression on the cell surface are genetically modified to decrease or eliminate SlpB and SlpX expression on the cell surface. Such cells can be genetically modified to expression SlpA and used in the methods disclosed herein.
  • Yet other embodiments utilize bacterial cells genetically modified to express SlpA but which lack LTA expression on the cell surface and also lack genes encoding SlpB and SlpX or orthologs of SlpB and SlpX (i.e., protein homo logs that are present within different species and have very similar or identical function).
  • Non- limiting examples of such bacterial cells include those that lack genes encoding phosphoglycerol transferase protein (Genbank Accession No. AAV42337.1; SEQ ID NO: 1), SlpB and SlpX or orthologs of phosphoglycerol transferase (Genbank Accession No. AAV42337.1), SlpB and SlpX.
  • the cells do not express SEQ ID NO: 2 or the SlpB polypeptides associated with Uniprot access numbers Q48508, C2HR61, Q5FMK0, Q8GFE5, J9W284, J9W905, B1H0V4, H6VTN5, Q09FL7, V7HZR4, S4NDQ7, S4NKH4, S4NL65 and S4NQU9 and SEQ ID NO: 3 or the SlpX polypeptides associated with SlpX protein are provided by Uniprot access numbers C2HMW6, S6E4Y8, S6DRU6, S6DL03, S6E593, S6DQJ3, F0TJ46, Q5FLN0, D4YUC6, R5ZGF3, E4SM72, F2M2V8, C2KB60, D5H1S0, I7KQ44, U6FUJ7, U6FJC0, U6F914, U6F7V6, U6F834, U4QN79, U4
  • the phosphoglycerol transferase protein comprises SEQ ID NO: 1
  • SlpB protein comprises the amino acid sequence of SEQ ID NO: 2
  • SlpX protein comprises the amino acid sequence of SEQ ID NO: 3. Accordingly, in addition to the modifications required to reduce the surface display of LTA, the bacterium of the current invention has been further genetically modified to decrease or eliminate the expression of a polypeptide comprising amino acid sequence of SEQ ID NO: 1, comprising amino acid sequence of SEQ ID NO: 2 and a polypeptide comprising the amino acid sequence of SEQ ID NO: 3.
  • the bacterium of the current invention has decreased or eliminated expression of a polypeptide comprising the amino acid sequence having at least 70%, 80%, 90%, 95%, 97%, 98%, or 99% sequence identity to the amino acid sequence of SEQ ID NO: 1, at least 70%, 80%, 90%, 95%, 97%, 98%, or 99% sequence identity to the amino acid sequence of SEQ ID NO: 2 and a polypeptide comprising the amino acid sequence having at least 70%, 80%, 90%, 95%, 97%, 98%, or 99% sequence identity to the amino acid sequence of SEQ ID NO: 3.
  • SlpB protein is provided by Uniprot access numbers Q48508, C2HR61, Q5FMK0, Q8GFE5, J9W284, J9W905, B1H0V4, H6VTN5, Q09FL7, V7HZR4, S4NDQ7, S4NKH4, S4NL65 and S4NQU9 (each of which is hereby incorporated by reference in their entireties). Additional examples of SlpB proteins are well known to a person of ordinary skill in the art and such embodiments are within the purview of the current invention.
  • SlpX protein is provided by Uniprot access numbers C2HMW6, S6E4Y8, S6DRU6, S6DL03, S6E593, S6DQJ3, F0TJ46, Q5FLN0, D4YUC6, R5ZGF3, E4SM72, F2M2V8, C2KB60, D5H1S0, I7KQ44, U6FUJ7, U6FJC0, U6F914, U6F7V6, U6F834, U4QN79, U4QA33, F3MP54, F0NWR2, FONVRl, F6CEM8, F6CBQ1, I7JYF2 and C2ELK0 (each of which is hereby incorporated by reference in their entireties). Additional examples of SlpX proteins are well known to a person of ordinary skill in the art and such embodiments are within the purview of the current invention.
  • the genetic modifications resulting in decreased or eliminated expression of the polypeptides include, but are not limited to, deleting the entire coding region of the gene or a portion of the coding nucleotide sequence, introducing a frame shift mutation, a missense mutation, an insertion, by introducing a stop codon or a combinations of any of the aforementioned mutations. Additional mutations which would lead to decreased, or eliminated, expression of a polypeptide of interest and methods of introducing such mutations into a bacterium are well known to a person of ordinary skill in the art and such embodiments are within the purview of the claimed invention.
  • the «/3 ⁇ 49-counterselective knockout strategy (described in Goh et al, 2009) which is hereby incorporated by reference in its entirety) was used to generate in-frame deletions in the slpB and slpX genes of L. acidophilus NCK2030 to produce L. acidophilus NCK2187.
  • the lactic acid bacterium is a surface layer protein expressing Lactobacillus. These bacterial cells may also be referred to as probiotic bacterial cells.
  • Non-limiting examples of such lactic acid bacteria include, but are not limited to, L. acidophilus, L. amylolyticus, L. amylovorus, L. brevis, L. brevis ssp gravesensis, L. buchneri, L. crispatus, L. gallinarum, L. gigeriorum, L. helveticus/suntoryeus, L. hilgardii, L. kefiranofaciens, L. pasteurii, L. lactis andL. ultunensis.
  • An embodiment provides a composition comprising the recombinant bacterium of the current invention and a pharmaceutically acceptable carrier and/or excipient.
  • the bacteria of the current invention provide protective role in inflammation mediated diseases, for example, inflammation mediated diseases of gastrointestinal tract such IBD. Accordingly, certain embodiments of the current invention provide methods of treating and/or preventing an inflammation mediated disease of the gastrointestinal system in a subject, the method comprising, administering to the subject a therapeutically effective amount of the bacterium of the current invention. In one embodiment, the bacterium is orally administered to the subject. In certain embodiments of the invention a subject is a mammal.
  • Non-limiting examples of a mammal treatable according to the methods of the current invention include mouse, rat, dog, guinea pig, cow, horse, cat, rabbit, pig, monkey, ape, chimpanzee, and human. Additional examples of mammals treatable with the methods of the current invention are well known to a person of ordinary skill in the art and such embodiments are within the purview of the current invention.
  • a probiotic food refers to a food which contains microorganisms associated with beneficial effects to humans and animals upon ingestion of the probiotic food.
  • probiotic food include yogurt, fermented vegetable, kefir, sauerkraut, miso soup, pickle, tempeh and kimchi.
  • inflammation mediated disease refers to a disease characterized by a dysregulation of the normal immune response. Inflammation mediated diseases (inflammatory diseases) can cause organ damage, and are associated with increased morbidity and/or mortality.
  • An example of immune dysregulation is the inappropriate activation of inflammatory cytokines, such as IL- 12, IL-6 or TNF alpha, whose actions lead to pathological consequences.
  • treatment, treating, treat or equivalents of these terms refer to healing, alleviating, relieving, altering, remedying, ameliorating, improving, or affecting the condition or the symptoms of a subject suffering with a disease, for example, a gastrointestinal disorder.
  • the subject to be treated can be suffering from or at risk of developing the disorder, for example, a gastrointestinal disorder, including, for example, an IBD or be at risk of developing an IBD.
  • the bacterium is provided at (or shortly after) the onset of a symptom.
  • the therapeutic administration of the substance serves to attenuate any actual symptom.
  • the terms "preventing, preventive, prophylactic” or equivalents of these terms are indicate that the recombinant bacterium is provided in advance of any disease symptoms and are a separate aspect of the invention (i.e., an aspect of the invention that is distinct from aspects related to the terms "treatment, treating, treat” or equivalents of these terms which refer to healing, alleviating, relieving, altering, remedying, ameliorating, improving, or affecting the condition or the symptoms of a subject suffering with an inflammatory disease, for example, a gastrointestinal disorder).
  • the prophylactic administration of the recombinant bacterium serves to prevent or attenuate any subsequent symptoms or disease.
  • terapéuticaally effective dose By “therapeutically effective dose,” “therapeutically effective amount”, or “effective amount” is intended to be an amount of a recombinant bacterium disclosed herein or the amount of SlpA that, when administered to a subject, decreases the inflammatory response, or reduces any increase in an inflammatory response as compared to untreated subjects.
  • “Positive therapeutic response” refers to, for example, improving the condition of at least one of the symptoms of an inflammatory disorder.
  • unit dose refers to a physically discrete unit suitable for use in a subject, each unit containing a predetermined quantity of the therapeutic composition calculated to produce the desired response in association with its administration, i.e., the appropriate route and treatment regimen.
  • the quantity to be administered both according to number of treatments and unit dose, depends on the subject to be treated, the state of the subject and the protection desired. Precise amounts of the therapeutic composition also depend on the judgment of the practitioner and are peculiar to each individual.
  • the dosage of recombinant bacteria will vary depending upon such factors as the patient's age, weight, height, sex, general medical condition and previous medical history. In specific embodiments, it may be desirable to administer the bacterium in the range of about 10 4 to about 10 12 CFU, 10 5 to 10 11 CFU, 10 6 to 10 10 CFU, 10 8 to 10 10 CFU or 10 8 to 10 12 CFU.
  • the method comprises administration of multiple doses of the bacterium.
  • the method may comprise administration of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, or more therapeutically effective doses of a composition comprising the bacterium as described herein.
  • doses are administered over the course of 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 10 days, 14 days, 21 days, 30 days, or more than 30 days.
  • the frequency and duration of administration of multiple doses of the compositions is such as to reduce or prevent an inflammatory response and thereby treat or prevent a gastrointestinal disorder.
  • treatment of a subject with a therapeutically effective amount of the recombinant bacterium of the invention can include a single treatment or can include a series of treatments. It will also be appreciated that the effective dosage of a bacterium used for treatment may increase or decrease over the course of a particular treatment. Changes in dosage may result and become apparent from the results of diagnostic assays for detecting inflammation known in the art and described herein.
  • the present invention also includes combinations of the recombinant bacteria with one another, and/or with one or more other agents useful in the treatment of an inflammation mediated disease of the GI tract.
  • bacteria of the invention may be administered in combination with effective doses of conventional anti-inflammatory agents, such as sulfasalazine, cyclosporine, prednisone, methylprednisone, budesonide, mesalamine, azathioprine, TNF inhibitors, methotrexate, or 6-mercaptopurine, a corticosteroid, infliximab or combinations thereof, for treatment of inflammation mediated diseases of the GI tract.
  • conventional anti-inflammatory agents such as sulfasalazine, cyclosporine, prednisone, methylprednisone, budesonide, mesalamine, azathioprine, TNF inhibitors, methotrexate, or 6-mercaptopurine, a corticosteroid, inflix
  • the inflammation mediated disease treated according to the current invention is IBD.
  • IBD include Crohn's disease or ulcerative colitis. Additional examples of IBD are well known to a person of ordinary skill in the art and such embodiments are within the purview of the current invention.
  • the disclosed methods and compositions are aimed at improving the condition of at least one of the symptoms of an inflammatory disorder, such as IBD.
  • the current invention also provides SlpA as an effector molecule expressed by bacteria and which provide protective role in inflammation mediated diseases, for example, inflammation mediated diseases of gastrointestinal tract such IBD. Accordingly, certain embodiments of the current invention provide an isolated bacterial SlpA protein or a non- naturally occurring protein derivative thereof.
  • bacterial SlpA protein is provided by a protein having the sequence of
  • SEQ ID NO: 4 or a protein having at least 95% sequence identity to the sequence of SEQ ID NO: 4.
  • Certain other examples of SlpA protein are provided by Uniprot access numbers C2HR60 (SEQ ID NO: 47), P35829 (SEQ ID NO: 48), G1UE81 (SEQ ID NO: 49), Q9Z4J9 (SEQ ID NO: 50), H6VTN4 (SEQ ID NO: 51), Q09FM2 (SEQ ID NO: 52), L7YE91 (SEQ ID NO: 53), K8DVK7 (SEQ ID NO: 54) and F0NUB7 (SEQ ID NO: 55) (each of which is hereby incorporated by reference in its entirety). Additional examples of SlpA proteins are well known to a person of ordinary skill in the art and such embodiments are within the purview of the current invention for use in formulation of the compositions disclosed herein as well as the methods of using such compositions for the treatment of inflammatory diseases.
  • a "non-naturally" occurring protein derivative indicates that the protein derivative is different than the its naturally occurring counterpart in some manner.
  • modifications which can distinguish a non-naturally occurring protein derivative from its naturally occurring counterpart include mutations in the amino acid sequences (e.g., point mutations or the introduction of one or more glycosylation site into the protein), non-naturally occurring post-translational modifications (e.g. glycosylation or phosphorylation patterns), attachment to the protein of extraneous molecules (e.g. molecular labels, such as radioisotopes or fluorescent labels, polyethyleneglycol (PEG), etc.). Additional examples of such modifications are well known to a person of ordinary skill in the art and such embodiments are within the purview of the current invention.
  • the non-naturally occurring SlpA protein derivative according to the current invention comprises a molecular label conjugated to a bacterial SlpA protein, for example, SlpA protein having the sequence of SEQ ID NO: 4 or the protein having at least 95% sequence identity to the sequence of SEQ ID NO: 4.
  • the label can be a radiolabel, fluorescent label, affinity label, targeting label.
  • the non-naturally occurring SlpA protein derivative according to the current invention comprises a protein having one or more mutations in the naturally occurring sequence of a bacterial SlpA protein, for example, SlpA protein having a sequence of SEQ ID NO: 4 or having a sequence at least 95% identical to the sequence of SEQ ID NO: 4.
  • the non-naturally occurring SlpA protein derivative comprises about 1 to about 20 mutations, about 3 to about 15 mutations, or about 5 to about 10 mutations.
  • the mutations do not negatively affect the ability of the non-naturally occurring SlpA protein derivative of the current invention of protecting against inflammation mediated diseases, for example, inflammation mediated diseases of gastrointestinal tract such IBD.
  • An embodiment of the current invention also provides a composition comprising the non-naturally occurring SlpA protein derivative and a pharmaceutically acceptable carrier and/or excipient.
  • the pharmaceutically acceptable carrier and/or excipient comprise substances, such as an inert vehicle, or pharmaceutical acceptable adjuvants, preservatives etc.
  • substances such as an inert vehicle, or pharmaceutical acceptable adjuvants, preservatives etc.
  • pharmaceutically acceptable substances are well known to a person of ordinary skill in the art and such embodiments are within the purview of the current invention.
  • the pharmaceutical composition may be a liquid formulation or a solid formulation.
  • the pharmaceutical composition when the pharmaceutical composition is a solid formulation it may be formulated as a tablet, a sucking tablet, a chewing tablet, a chewing gum, a capsule, a sachet, a powder, a granule, a coated particle, a coated tablet, an enterocoated tablet, an enterocoated capsule, a melting strip or a film.
  • the pharmaceutical composition when the pharmaceutical composition is a liquid formulation it may be formulated as an oral solution, a suspension, an emulsion or syrup.
  • Said composition may further comprise a carrier material independently selected from, but not limited to, the group consisting of lactic acid fermented foods, fermented dairy products, resistant starch, dietary fibers, carbohydrates, proteins, and glycosylated proteins.
  • compositions as disclosed herein, can be formulated in accordance with standard pharmaceutical practice (see, e.g., Remington: The Science and Practice of Pharmacy (20th ed.), ed. A. R. Gennaro, Lippincott Williams & Wilkins, 2000 and Encyclopedia of Pharmaceutical Technology, eds. J. Swarbrick and J. C. Boylan, 1988-1999, Marcel Dekker, New York) known by a person skilled in the art.
  • Pharmaceutical composition according to the invention may also be formulated to release active agents substantially immediately upon administration or at any predetermined time or time period after administration.
  • the composition can be formulated into conventional oral dosage forms such as tablets, capsules, powders, granules and liquid preparations such as syrups, elixirs, and concentrated drops.
  • Non-toxic solid carriers or diluents may be used which include, for example, pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharine, talcum, cellulose, glucose, sucrose, magnesium, carbonate, and the like.
  • binders which are agents which impart cohesive qualities to powdered materials are also necessary.
  • starch, gelatin, sugars such as lactose or dextrose, and natural or synthetic gums can be used as binders.
  • Disintegrants are also necessary in the tablets to facilitate break-up of the tablet.
  • Disintegrants include starches, clays, celluloses, algins, gums and cross-linked polymers.
  • lubricants and glidants are also included in the tablets to prevent adhesion to the tablet material to surfaces in the manufacturing process and to improve the flow characteristics of the powder material during manufacture.
  • Colloidal silicon dioxide is most commonly used as a glidant and compounds such as talc or stearic acids are most commonly used as lubricants.
  • composition can also be formulated as a food composition, a dietary supplement, a functional food, a medical food or a nutritional product as long as the required effect is achieved, i.e. treatment and/or prevention of an inflammatory disorder of the gastrointestinal tract.
  • Said food composition may be chosen from the group consisting of beverages, yogurts, juices, ice creams, breads, biscuits, crackers, cereals, health bars, spreads and nutritional products.
  • the food composition may further comprise a carrier material, wherein said carrier material is chosen from the group consisting of lactic acid fermented foods, fermented dairy products, resistant starch, dietary fibers, carbohydrates, proteins and glycosylated proteins.
  • the current invention provides a method of treating or preventing an inflammation mediated disease of the gastrointestinal system in a subject, the method comprising, administering to the subject a therapeutically effective amount of the composition comprising the SlpA protein or a non-naturally occurring SlpA derivative.
  • the composition is orally administered to the subject.
  • SlpA protein or a non-naturally occurring SlpA derivatives can be administered or formulated in combination with effective doses of conventional anti-inflammatory agents, such as sulfasalazine, cyclosporine, prednisone, methylprednisone, budesonide, mesalamine, azathioprine, TNF inhibitors, methotrexate, or 6-mercaptopurine, a corticosteroid, infliximab or combinations thereof, for treatment of inflammation mediated diseases of the GI tract.
  • conventional anti-inflammatory agents such as sulfasalazine, cyclosporine, prednisone, methylprednisone, budesonide, mesalamine, azathioprine, TNF inhibitors, methotrexate, or 6-mercaptopurine, a corticosteroid, infliximab or combinations thereof, for treatment of inflammation mediated diseases of the GI tract.
  • conventional anti-inflammatory agents
  • Yet another aspect of the invention relates to a method of purifying SlpA comprising growing SlpA expressing bacterial cells, pelleting said bacterial cells from culture medium containing said bacterial cells, resuspending said bacterial cells in 5M NaCl for a period of 5 minutes to 24 hours, preferably between 30 minutes and two hours, to form an extraction composition, removing bacterial cells from said extraction composition by centrifugation to form a composition containing SlpA and dialyzing or filtering said composition using a dialysis bag or ultrafiltrating device having a molecular weight cut-off of 30 kDa to reduce the salt content of said composition containing SlpA.
  • the method can further comprise the precipitation of SlpA protein in said dialyzed composition comprising SlpA (for example, with 1M NaCl or another suitable preciptitating agent).
  • the method can also further comprise the washing of said precipitated SlpA with water or a buffer and lyophilization of said washed SlpA.
  • the SlpA expressing bacterial cells do not express LTA, SlpB or orthologs thereof or SlpX or orthologs thereof.
  • the SlpA expressing bacterial cells do not express phosphoglycerol transferase or orthologs thereof, SlpB or orthologs thereof or SlpX or orthologs thereof.
  • the bacterial cells in some embodiments: a) express a protein that has the amino acid sequence of SEQ ID NO: 4 or the protein has the amino acid sequence at least 70%, 80%, 90%, 95%, 97%, 98%, or 99% identical to the sequence of SEQ ID NO: 4; and b) do not express (i) a polypeptide comprising the amino acid sequence of SEQ ID NO: 1 or a polypeptide having at least 70%, 80%, 90%, 95%, 97%, 98%, or 99% sequence identity to the amino acid sequence of SEQ ID NO: 1 ; (ii) a polypeptide comprising the amino acid sequence of SEQ ID NO: 2 or a polypeptide comprising the amino acid sequence having at least 70%, 80%, 90%, 95%, 97%, 98%, or 99% sequence identity to the amino acid sequence of SEQ ID NO: 2; and (iii) a polypeptide comprising the amino acid sequence of SEQ ID NO: 3 or a polypeptide having at least 70%, 80%, 90%, 9
  • these bacterial cells are Lactobacillus strain, such as a LacotbaciUus strain is selected from the group consisting of L. acidophilus, L. amylolyticus, L. amylovorus, L. brevis, L. brevis ssp gravesensis, L. buchneri, L. crispatus, L. gallinarum, L. gigeriorum, L. helveticus/suntoryeus, L. hilgardii, L. kefiranofaciens, L. pasteurii, L. lactis and L. ultunensis.
  • LacotbaciUus strain is selected from the group consisting of L. acidophilus, L. amylolyticus, L. amylovorus, L. brevis, L. brevis ssp gravesensis, L. buchneri, L. crispatus, L. gallinarum, L. gigeriorum, L. helveticu
  • mice C57BL/6 (B6), and B6 recombination-activating gene 1 -deficient (Ragl ⁇ ) mice were purchased from Jackson Laboratories (Bar Harbor, ME). Germ-free (GF) B6 mice were obtained from the National Gnotobiotic Rodent Resource Center at the University of North Carolina and maintained in the GF facilities at the University of Florida (UF). The mouse strain 031934-UCD, C51BL/6-Cd209d tm1.1Cfg /Mmucd (Signr3 -/- ) was provided by the NIH- sponsored Mutant Mouse Regional Resource Center (MMRRC) National System and was backcrossed at the Max Planck Institute of Colloids and Interfaces, Berlin, Germany.
  • MMRRC Mutant Mouse Regional Resource Center
  • the upp -counterselective knockout strategy was used to generate an in-frame deletion of the phosphoglycerol transferase gene within NCK2030 (LTA + SlpB SlpX- SlpA + ), resulting in the generation of NCK2187 (LTA-SlpB-SlpX-SlpA + ) (Goh et al, 2009).
  • Wild- type L. acidophilus NCFM (NCK56), and NCK2187 were propagated anaerobically in MRS broth (Difco, BD, Franklin Lakes, NJ) at 37°C for 15 hrs.
  • MRS 0.2 g/2 mL
  • mice received either 1x10 9 CFU of NCK56 or NCK2187 in 100 ⁇ of PBS. Mice enrolled in steady-state studies were orally gavaged every 3 days for a total of 4 times, and immune changes analyzed at day 14. The gavage schedule was determined based on the clearance kinetics of the bacterial strains.
  • SlpA was purified from NCK2187 with LiCl. Cultures from 18 h grown NCK2187 were pelleted at 5,000 rpm for 10 min. Bacterial pellets were washed with cold PBS and re- pelleted before extraction. Pellets were resuspended in 5 M LiCl or 5M NaCl (Sigma- Aldrich, St. Louis, MO), gently stirred for 30 min, and the bacteria removed by centrifugation (13,000 rpm, 15 min). Supernatants were dialyzed against distilled water overnight using a dialysis bag with a cut-off molecular weight of 30 kDa for salt removal.
  • the protein precipitate was dissolved in 1 M LiCl or 1M NaCl and pelleted at 13,000 rpm for 30 min.
  • the SlpA protein preparation was washed with water a minimum of three times before lyophilization (FreeZone, Labconco, Kansas City, MO). Freeze-dried SlpA was stored at 4°C until used. SDS-PAGE gels and proteomics analyses were used to confirm SlpA purity. For oral gavage, mice were given 150 ⁇ g of SlpA in 300 ⁇ PBS.
  • Lamina Propria Leukocyte (LPL) Preparation Colonic lamina intestinal cells were isolated, as previously described (Lightfoot et al, 2014). Freshly isolated colons were cut into 0.5 cm sections and intraepithelial lymphocytes removed with a digestion buffer consisting of HBSS (GIBCO, Life Technologies, Grand Island, NY) containing 5 mM EDTA (GIBCO, Life Technologies) and 10 mM HEPES (GIBCO, Life Technologies), for (20 min, 37°C).
  • Remaining colon tissues were digested in DMEM (GIBCO, Life Technologies) supplemented with 0.25 ng/mL Collagenase Type VII (Sigma- Aldrich), 0.125 U/mL Liberase TM Research Grade (Roche Applied Science, Indianapolis, IN), 10 mM HEPES, 0.1 M CaC12 (Sigma-Aldrich), and 5% FBS (GIBCO, Life Technologies). Three digestions of 10 min each at 37°C were performed. Single cell suspensions obtained were combined and stained for flow cytometry-based analyses or used for ex vivo studies.
  • Isolated colonic LPLs were co-cultured with NCK56 or NCK2187 for 12 h at 37°C. Supernatants were then collected and stored at -80°C for later cytokine analyses using Bio- Plex Pro Mouse Cytokine Immunoassay kits (Bio-Rad, Hercules, CA). Activation phenotypes of DCs were analyzed by flow cytometry using the appropriate antibodies to quantify expression levels of MHC-II molecules and costimulatory markers. Flow Cytometry and Antibodies
  • Colonic LPLs were stained as described previously (Lightfoot et al, 2014). Colonic LPLs were stained with LIVE/DEAD Aqua Dead Cell Stain Kit (Molecular Probes, Life Technologies). Washed cells were incubated with Mouse Fc Blocking Reagent (Miltenyi Biotec, Auburn, CA) per the manufacturer's instructions before staining with combinations of the following antibodies or their corresponding isotype controls: CD45 (30-F11), CDl lc (N418), CDl lb (Ml/70), CDl lb (Ml/70), F4/80 (BM8), GR1 (RB6-8C5), I-A/I-E MHCII (2G9), CD3 (145-2C11), CD4 (RM4-5), CD8 (53-607), Pro-IL- ⁇ (NJTEN3)/Rat IgGl, ⁇ , IFNy (XMG1.2)/Rat IgGl, ⁇ , IL-17A (TCI 1-18H10.1)/Rat IgGl
  • cytokines For the detection of intracellular cytokines, cells were fixed and permeabilized with BD Cytofix/Cytoperm (BD Biosciences). Colonic T cells were stimulated with phorbol 12-myristate 13 -acetate (PMA) (50 ng/mL) and ionomycin (2.5 ⁇ g/mL) in the presence of Brefeldin A (Biolegend) for 2.5 h.
  • PMA phorbol 12-myristate 13 -acetate
  • ionomycin 2.5 ⁇ g/mL
  • the Transcription Factor Fixation/Permeabilization kit from eBioscience was used for FoxP3 staining. After staining, a BD LSRFortessa (BD Biosciences) cell analyzer was used to acquire fixed cells. Data were analyzed with Flow Jo software (Tree Star, Ashland, OR).
  • Antibodies and their corresponding isotype controls were purchased from eBioscience (San Diego, CA), Biolegend (San Diego, CA), BD Pharmingen, or R&D Systems (Minneapolis, MN).
  • CD45RB hi CD4 + T cells In preparation for the adoptive transfer of CD45RB hi CD4 + T cells into Rag1 -/- mice, spleen and mesenteric lymph node (MLN) single cell suspensions obtained from healthy B6 mice were pooled and incubated in AffiniPure Goat Anti-Mouse IgG (H+L)-coated cell culture plates (Jackson ImmunoResearch Laboratories, Inc., West Grove, PA) at 37°C for 1 h.
  • CD4 + T cells were isolated from non-adherent cells using the CD4 + T cell Isolation Kit II (MACS, Miltenyi Biotec, San Diego, CA), and CD25 + CD4 + T cells were then depleted by positive selection (MACS, Miltenyi Biotec).
  • mice WT and Signr3 -/- mice were treated with 3% DSS in the drinking water for 5 days (made fresh every 2-3 days) to induce colitis. Mice were monitored for disease progression through day 10 after treatment as described above. For prevention studies, mice were orally gavaged with NCK56, NCK2187, or SlpA at days -3 and -1, then every other day after 3% DSS treatment, for a total of 5 gavages (2 before, and 3 after 3% DSS).
  • Colitis scores in T cell- and DSS-induced colitis were determined by histopathology. Tissues were fixed, sectioned, and stained with hematoxylin and eosin (Histology Tech Services, Gainesville, FL). Stained sections were analyzed blindly by a boarded veterinary pathologist. Colitis was graded based on 7 parameters (0-17) as previously described (Cheng et al., 2014).
  • FITC-labeled dextran Passive transepithelial absorption of FITC-labeled dextran (Sigma-Aldrich) in vivo was used to determine intestinal barrier function as previously described (Napolitano et al, 1996). Mice were gavaged with FITC-dextran, MW 4,000 (60 mg/100 g body weight). Blood was collected retro-orbitally after proper anesthetization; mice were sacrificed after blood collection. Fluorescence intensity in the serum was measured with a fluorimeter (485 nm excitation, 519 nm emission). FITC-dextran concentrations in the mouse sera were determined from standard curves generated by serial dilution of FITC-dextran using blank subtraction in the test samples using sera from mice that were not gavaged with the permeability tracer.
  • Macroscopic damage in the colons of Rag1 -/- , WT, and Signr3 -/- mice was visualized with a Multi-Purpose Rigid Telescope attached to a TELE PACK X (Karl Storz- Endoscope, Germany). Mice were fasted for 2-4 h, and subsequently the colons of the living subjects were imaged under appropriate anesthetic conditions.
  • IL2ss IL2 signal sequence
  • NCK2025 significantly mitigated chemical and T cell-mediated colitis (Mohamadzadeh et al., 2011). Additionally, NCK2025 significantly abated inflammation-promoting polyposis in Apc lox458 x TS4-Cre mouse model, where protection correlated with the regulation of innate and T cell-induced inflammation (Khazaie et al., 2012). Thus, the controlled inflammation may result from the crosstalk between NCK2025-SlpA and intestinal cells. To test this hypothesis, the upp- counterselective gene replacement strategy was used to generate in-frame deletions in the slpB and slpX genes of NCK2030.
  • the LTA derivative was created by a deletion of the phosphoglycerol transferase gene (Mohamadzadeh et al., 2011) in NCK2030, resulting in NCK2187, which expresses only SlpA (Fig. 1A-C).
  • colonic cells were obtained from na ' ive B6 mice. While such intestinal cell- bacterial co-cultures did not significantly change the expression of DC costimulatory molecules (e.g., CD40) (not shown) or IL-10, only NCK56 elevated the levels of IL- ⁇ , IL-6, IL-12, and TNF-a (Fig. IE).
  • DC costimulatory molecules e.g., CD40
  • IL-10 IL-10
  • NCK56 elevated the levels of IL- ⁇ , IL-6, IL-12, and TNF-a (Fig. IE).
  • NCK2187 significantly increased the frequency of colonic FoxP3 + Tregs when compared to both untreated (PBS) and NCK56-treated mice (Fig. 2A). Moreover, IL-17A + and IFNy + CD4 + T cells were significantly reduced by NCK2187 treatment (Fig. 2A). NCK2187-treated FoxP3-GFP mice also exhibited higher numbers of colonic IL-10 + TGF- ⁇ i + Tregs than NCK56-treated and untreated mice (Fig. 2B, 2C). Collectively, oral treatment with this novel L. acidophilus strain induced colonic regulatory immune responses.
  • mice adoptively transferred with CD45RB hi CD4 + T cells were orally treated with NCK56, NCK2187, its purified SlpA, or PBS (Fig. 3 A).
  • Untreated (PBS) and NCK56-treated mice with adoptively transferred T cells developed severe colitis as demonstrated by weight loss, bloody diarrhea, shortening of the colon, and increased damage of the colon (Fig. 3A-C, Fig. 8A).
  • the levels of systemically induced proinflammatory IL- ⁇ , IL-6, TNF-a, IFNy, G-CSF, and MIP- ⁇ were significantly enhanced in the sera of these groups of mice (Fig. 3D).
  • NCK2187 and its purified SlpA significantly protected Ragl mice from T cell- induced colitis (Tables 2-4).
  • NCK2187- and SlpA-treated mice gained weight throughout the course of the study and did not develop significant bloody diarrhea in the way that the PBS and NCK56 groups did (Fig. 3A). Furthermore, cecal and colonic atrophy due to pathogenic inflammation was not observed in these mice, as the tissue destruction and immune cell infiltration associated with T cell-induced colitis were significantly abrogated in NCK2187 and SlpA treated groups (Fig. 3B and 3C). Accordingly, systemic inflammation was significantly reduced in these groups of mice (Fig. 3D).
  • T cell-induced colitis resulted in intestinal epithelial erosions and ulcerations in mice that did not receive NCK2187 or purified SlpA (Fig. 3C). Indeed, the colonic expression of tight junction associated genes was significantly downregulated in PBS- and NCK56-treated Rag1 -/- mice (Fig. 4A).
  • FITC-dextran permeability assays confirmed that these mice were suffering from a dysfunctional intestinal barrier (Fig. 4A). Accordingly, NCK2187 and SlpA significantly protected barrier integrity and function (Fig. 4A).
  • An immunologically and anatomically weakened intestinal epithelial barrier during acute intestinal inflammation allows luminal bacteria to interact with the intestinal mucosae and the infiltrating immune cells, initiating inflammatory responses directed against the gut commensals and introducing dysbiosis.
  • SIGNR3 exhibits the most biochemical similarity to human DC-SIGN.
  • NCK2187 delivers immunoregulatory signals via its interaction with SIGNR3.
  • mice lacking Signrl expression are less susceptible to induced colitis (Saunders et al., 2010), while mice deficient in Dectinl and Signr3 exhibit exacerbated disease (Eriksson et al, 2013; Iliev et al, 2012).
  • SlpA:SIGNR3 signaling in disease conditions DSS-treated WT and Signr3 -/- mice were orally gavaged with NCK56, NCK2187, or SlpA, and monitored for disease progression. Consistent with the T cell-induced colitis model, disease progression and severity were significantly reduced in WT mice orally treated with NCK2187 or purified SlpA (Fig.
  • NCK2187 and SlpA did not confer any protection in Signr3 -/- mice (Fig. 6). Measurements included weight loss, histopathology-based colitis scores, evaluation of gross mucosal damage, and immune cell recruitment and activation (Figs. 6 and 7).
  • NCK2187 and SlpA treatments of WT mice prevented increased fecal albumin levels seen with protein-losing enteropathies after DSS treatment (Fig. 6F).
  • NCK2187 or SlpA on barrier integrity were noted in Signr3 -/- mice (data not shown).
  • protected WT mice NCK2187- and SlpA-treated clustered together in UniFrac analyses, while diseased untreated and NCK56-treated WT mice clustered separately (Fig. 6G).
  • DSS-induced colitis model was employed. 6 oral treatments with 150 ⁇ g SlpA/mouse, and only 4 oral gavages of 10 9 CFU NCK2187 were sufficient to prevent weight loss in mice given 3% DSS in the drinking water for 5 days (Fig. 11 A). See Fig. 10A for graphical summary of the treatment regimen.
  • age and sex-matched C57BL/6 mice were gavaged twice with NCK56 (WT), NCK2187, or purified SlpA, prior to being given 3% DSS in the drinking water.
  • mice were gavaged twice more with the different bacterial strains or 4 more times with SlpA to compensate for the ability of NCK56 and NCK2187 to persist in these animals for 3 days post-gavage (Fig. ID).
  • Mice treated with NCK2187 or SlpA developed only a mild form of colitis and recovered significantly faster than DSS-alone or NCK56-treated mice (Fig. 11).
  • mice were orally gavaged with varying bacteria strains or purified SlpA once signs of colitis were noted, i.e., diarrhea and fecal occult blood (see Fig. 10B for treatment regimen).
  • Mice receiving either NCK2187 or SlpA recovered significantly faster than NCK56-treated or DSS-alone treated mice (Fig. 12). These results indicate that NCK2187 and SlpA are efficacious in ameliorating existing colitis.
  • EXAMPLE 7 PREVENTION OF T CELL-INDUCED COLITIS BY L. ACIDOPHILUS SLPA
  • Oral treatment with 10 9 CFU NCK2187 was as effective as the Tregs in the prevention of weight loss in recipient Ragl -/- mice (Fig. 13 A).
  • Purified SlpA was also found to be protective in recipient Ragl -/- mice (Fig. 13); however, given the chronic nature of the model, a higher dose of SlpA may be needed to reach the level of protection observed with NCK2187.
  • the human GI tract harbors trillions of microbes, most of which are bacteria (Qin et al., 2010), and are critical determinants to the health of the host (Nicholson et al., 2012; Subramanian et al., 2014). This is especially true in the case of IBD, given the intimate association of the gut microbiota and their gene products with the adjacent colonic tissue (Hold et al, 2014; Huttenhower et al, 2014).
  • Certain embodiments of the current invention identify specific bacterial molecule-host receptor interactions that may account for the responses induced by effector bacterial strains. For example, oral treatment using a L. acidophilus strain lacking the gene responsible for LTA biosynthesis significantly reduced pathogenic inflammation in the GI tract, thereby promoting the mitigation of induced colitis (Mohamadzadeh et al, 2011) and the ablation of colonic polyposis (Khazaie et al., 2012).
  • the bacteria lacking LTA and their uses are described in US Patent Application Publication 20130224153, the contents of which are incorporated by reference herein in its entirety. However, a need still remains for identifying other bacterial strains and/or agents useful for treatment of inflammatory diseases, such as colitis or inflammatory bowel disease.
  • the current invention provides bacteria with systematically deleted genes for the construction of novel bacterial strains, for example, NCK2187, and the assignment of roles to sip candidate genes that are responsible for SlpA, SlpB, and SlpX protein expression (Goh et al., 2009).
  • This molecular approach to targeting genes in L. acidophilus defined the functional role of SlpA and demonstrated that SlpA affects intestinal innate cells and conventional T cell subset activation, including Tregs, in steady-state and murine colitis models.
  • NCK2187 and purified SlpA not only mitigated T cell- induced colitis by significantly reducing inflammation, but also protected the composition of the microbiota and intestinal barrier function. Additionally, systemic immune responses were also altered, whereupon the levels of proinflammatory cytokines, including IL- ⁇ , whose detrimental role in IBD was recently demonstrated (Coccia et al., 2012), decreased significantly. These data suggests the involvement of the IL- ⁇ signaling axis in intestinal protection. Accordingly, gene-screening results, along with SlpA binding to SIGNR3, highlight the involvement of SIGNR3 in the process of tempering highly activated gut immune responses. Additional data regarding SIGNR3 engagement using Signr3 -/- mice clarified the role of this signaling molecule in induced immune regulation, as was also documented in the Leishmania infantum murine model (Lefevre et al, 2013).
  • the current invention indicates that the interaction of SlpA with SIGNR3 can impact the status of innate and T cell polarization in induced colitis. Also, effective modulation of these cellular and molecular factors may significantly modify pathogenic inflammation that results in colitis, and would therefore restore intestinal homeostasis by rebalancing deteriorated immunity, the composition of the gut microbiota, and mucosal barrier function.
  • S-layers are paracrystalline (glyco) protein arrays that are present in abundance on the cell surface of a subset of eubacteria and archaea.
  • NaCl sodium chloride
  • An automated mass spectrometry microbial identification system that uses Matrix Assisted Laser Desorption Ionization Time-of-Flight technology (MALDI-TOF) indicated 97 unique spectra and 55 unique peptides generated post-trypsinization of the protein isolate, which identified two possible proteins [gi
  • MALDI-TOF Matrix Assisted Laser Desorption Ionization Time-of-Flight technology
  • urea nitrogen BUN
  • creatinine alanine aminotransferase
  • Fig. 16C alanine aminotransferase
  • ADSAINANTNAKYDVDVTPS I SAIAAVAKSDTMPAI PGSLTGS I SASYNGKSYTANLPKD SGNATITDSNNNTVKPAKLEADKAYTVTVPDVSFNFGSENAGKVITIGSANPNVTFTKKT GDQPASTVKVTLDQDGVAKLSSVQIKNVYAIDTTYNSNVNFYDVTTGAIVTTGAVS IDAD NQGQLNITSVVAAINSKYFAAQYDKKQLTNDVTFDTETAVKDALKAQKIEVSSVGYFKAP HTFTVNVKATSNKNGKSATLPVTVTVPNVADPVVPSQSKTIMHNAYFYDKDAKRVGTDKV TRYNTVTVAMNTTKLANGI SYYEVIENGKA
  • Vibriobactin antibodies a vaccine strategy. J Med Chem; 52:3801-13.
  • IL- ⁇ mediates chronic intestinal inflammation by promoting the accumulation of IL-17A secreting innate lymphoid cells and CD4(+) Thl7 cells.
  • DC-SIGN escape mechanism for pathogens.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Organic Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Epidemiology (AREA)
  • Microbiology (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • Biotechnology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Molecular Biology (AREA)
  • Biochemistry (AREA)
  • Biomedical Technology (AREA)
  • General Engineering & Computer Science (AREA)
  • Mycology (AREA)
  • Immunology (AREA)
  • Biophysics (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Virology (AREA)
  • Physics & Mathematics (AREA)
  • Plant Pathology (AREA)
  • Nutrition Science (AREA)
  • Physiology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Peptides Or Proteins (AREA)

Abstract

The current invention provides a recombinant bacterium, the recombinant bacterium being genetically modified to decrease or eliminate the display of lipoteichoic acid (LTA), surface layer protein B (SlpB) and surface layer protein X (SlpX) on the surface of said bacterium. Efficacious therapies for a subject suffering from an inflammation mediated disease are also provided. The methods of the current invention comprise administering to a subject in need thereof a therapeutically effective amount of the recombinant L. acidophilus cells or a therapeutically effective amount of the isolated surface layer protein A (SlpA) or a non-naturally occurring derivative thereof. The recombinant L. acidophilus cells or SlpA isolated from L. acidophilus can be in a pharmaceutical composition comprising a pharmaceutically acceptable carrier and/or excipient. In an embodiment of the invention, the pharmaceutical composition is administered orally.

Description

DESCRIPTION
LACTOBACILLUS ACIDOPHILUS SURFACE LAYER PROTEIN A (SLPA)
AS A THERAPEUTIC AGENT FOR THE TREATMENT OF INFLAMMATORY DISEASES
CROSS-REFERENCE TO RELATED APPLICATION This application claims the benefit of U.S. Provisional Application Serial No. 62/068,338, filed October 24, 2014, the disclosure of which is hereby incorporated by reference in its entirety, including all figures, tables and amino acid or nucleic acid sequences.
This invention was made with government support under R01 AI093370 awarded by National Institutes of Health. The government has certain rights in the invention.
BACKGROUND OF THE INVENTION
The gastrointestinal (GI) microbiota plays a critical role in determining the immunologic outcome of various signaling events in host cells via their gene products, exceeding the human genome by a hundredfold (Ley et al, 2006; Qin et al, 2010). As such, the composition of the GI microbiota and host immunity are mutualistic and continuously influence each other (Maslowski and Mackay, 2011; McDermott and Huffnagle, 2014).
Intestinal homeostasis is tightly controlled by regulatory immune mechanisms, which are established by the interactions of the trillions of microbes and their gene products with numerous pattern recognition receptors (PRRs), including C-type lectin receptors (CLRs), such as SIGNR3 (Konstantinov et al, 2008; Osorio and Reis e Sousa, 2011). Disruption of this delicate balance by inimical signals has devastating consequences that may result in intestinal disorders, including inflammatory bowel disease (IBD). When this occurs, highly activated innate cells trigger intestine-infiltrating pathogenic T cell subsets {e.g., Thl, Thl7), and regulatory T cells (Tregs) with pro-inflammatory characteristics (Geremia et al., 2014; Khazaie et al., 2012; Neurath, 2014) that ultimately drive tissue destruction and intestinal disease progression. Innate cells {e.g., dendritic cells, macrophages) are the initial targets of either culpable microbes or their gene products, which subsequently affect the regulation/stimulation of intestinal immunity (Atarashi et al., 2013; Ivanov and Honda, 2012; Yang et al., 2014). Given these entwined relationships, it is not surprising that microbial products have been linked to the pathology of intestinal auto-inflammation (Nicholson et al., 2012). The underlying associations between gut microbes and inflammatory diseases (e.g., IBD) have been well documented; however, the cellular and molecular mechanisms by which intestinal commensal gene product(s) and their molecular receptor(s) impact immune responses remain unclear.
Information regarding the immunobiologic functions of Lactobacillus acidophilus surface layer proteins (Sips) is relatively limited. Sips are paracrystalline (glyco) protein arrays that are abundantly present on the cell surfaces of most eubacteria and archaea, including L. acidophilus (Johnson et al, 2013). L. acidophilus NCFM possesses three Slp- encoding genes: slpA (LBA0169), slpB (LBA0175), and slpX (LBA0512) (Goh et al, 2009). Diverse functional roles have been proposed for Sips, including cell shape determinants, molecular sieves, protective layers against viral infection, anchoring sites for surface- associated enzymes and facilitators of cellular adhesion through PRRs, including C-type lectins (CLECs) (Konstantinov et al, 2008).
CLECs recognize carbohydrate structures on self and non-self antigens (Engering et al, 2002; Osorio and Reis e Sousa, 2011). Eighteen CLECs, including DC-specific ICAM-3- grabbing nonintegrin (DC-SIGN), have been identified on dendritic cells (DCs) and macrophages (MΦs) (Ehlers, 2010; van Kooyk and Geijtenbeek, 2003). DC-SIGN, which was previously shown to bind L. acidophilus-SlpA in vitro (Konstantinov et al, 2008), is a calcium-dependent carbohydrate-binding protein with specificity for the mannose-containing glycans of microbial surface components and fucose-containing Lewis antigens (Ehlers, 2010). Of the eight murine homologs of DC-SIGN, SIGNR3 (CD209d) exhibits the most biochemical similarity to human DC-SIGN (Powlesland et al, 2006).
SIGNR3 contains a carbohydrate recognition domain (CRD) and signals through a hemi-immunoreceptor tyrosine-based activation motif (hemi-ITAM) pathway (Tanne et al., 2009). Such signaling potentially downregulates the ubiquitously expressed leukotriene A4 hydrolase (LTA4H) (Tobin et al., 2010) that catalyzes proinflammatory leukotriene B4 (LTB4) synthesis from LTA4 (Snelgrove et al, 2010), which consequently activates interleukin (IL)-1β production. Here, we identify SlpA as a key effector molecule expressed by L. acidophilus, and demonstrate its in vivo protective role in murine colitis models. Moreover, we provide evidence that protection by L. acidophilus-SlpA is conferred via signaling through a single CLR, namely SIGNR3. As discussed above, normal gut immune responses dictate that resident innate and adaptive immune cells must coexist with the large number of microbes inhabiting the GI tract while still being able to mount an immune response against invading pathogens. Maintenance of immune homeostasis toward commensal bacteria and their microbial gene products is essential in the prevention of chronic inflammation in the gut. Overt intestinal inflammation is a hallmark of IBD. Current therapies for the management of IBD include antibiotic regimens to prevent the outgrowth and systemic dissemination of pathogenic microorganisms, as well as corticosteroids and immunomodulators to decrease the inflammatory response in the intestines. However, these therapies are not without undesirable and harmful side effects, as antibiotics also deplete the beneficial intestinal microflora, and corticosteroids and immunomodulators act as global immune suppressors, thereby increasing the risk of infection and cancer. Thus, there is a need for identifying new therapeutic agents for the treatment of such diseases.
BRIEF SUMMARY OF THE INVENTION
The current invention provides a recombinant bacterium, for example, a recombinant Lactobacillus acidophilus, the recombinant bacterium being genetically modified to decrease or eliminate the display of lipoteichoic acid (LTA), surface layer protein B (SlpB) and surface layer protein X (SlpX) on the surface of said bacterium.
The current invention also provides an efficacious therapy for a subject suffering from an inflammation mediated disease (inflammatory diseases), for example, an autoinflammatory disease, such as IBD or other inflammatory diseases, such as allergies, ankylosing spondylitis, Crohn's disease, diabetes, Type I diabetes, gastroesophageal reflux disease, Hashimoto's thyroiditis, hyperthyroidism, hypothyroidism, interstitial cystitis (IC), Lofgren's syndrome, lupus erythematosis, myasthenia gravis, multiple sclerosis, osteoarthritis, polymyalgia rheumatica, prostatitis, psoriasis, psoriatic arthritis, Raynaud's syndrome/phenomenon, reactive arthritis (Reiter syndrome), restless leg syndrome, reflex sympathetic dystrophy (RSD), rheumatoid arthritis, scleroderma, Sjogren's syndrome, ulcerative colitis and uveitis. The methods of the current invention comprise administering to a subject in need thereof a therapeutically effective amount of recombinant L. acidophilus cells of the current invention or a therapeutically effective amount of purified surface layer protein A (SlpA), for example, SlpA isolated from L. acidophilus. In one embodiment, the L. acidophilus cells belong to L. acidophilus strain NCK2187 which is a bacterium genetically modified to decrease or eliminate the display of LTA, SlpB and SlpX on the surface. Another embodiment provides for the recombinant expression of SlpA in bacterial cells that are devoid of LTA, SlpB and SlpX expression on the cell surface.
The recombinant bacterial cells (e.g., L. acidophilus cells) or SlpA isolated from L. acidophilus can be formulated into a pharmaceutical composition comprising a pharmaceutically acceptable carrier and/or excipient (optionally in combination with other therapeutic agents). In an embodiment of the invention, the pharmaceutical composition is administered orally. BRIEF DESCRIPTION OF THE DRAWINGS
The patent or application file contains at least one drawing executed in color. Copies of this patent or patent application publication, with color drawing(s), will be provided by the Office upon request and payment of the necessary fee.
Figures 1A-1E. L. acidophilus NCK2187 strain development and characteristics. A. Agarose gel image illustrating PCR amplicons of ItaS (LBA0447), slpB, and slpX deletions in NCK2187. B. SDS-PAGE gel of 5 M LiCl-purified S-layer fractions from the parental strains, NCK56 and NCK1909; NCK2030 (LTA+, SlpA+, SlpB-, SlpX-); and NCK2187 (LTA , SlpA+, SlpB-, SlpX-). C. Protein gel showing predominance of SlpA in NCK2187 and absence of other Sips. D. B6 mice were orally gavaged with 109 CFU erythromycin- resistant NCK56 or NCK2187. Fecal pellets were collected daily and tested for the presence of erythromycin-resistant strains, n = 3 mice/group. Data are representative of five independent experiments and are shown as mean ± SEM. E. Colonic LP cells were co- cultured with NCK56 or NCK2187 (1 : 1) and secreted cytokines were measured in the supernatants. Data are shown as mean ± SEM. *P<0.05, **P<0.01, ***P<0.001.
Figures 2A-2C. L. acidophilus NCK2187 promotes intestinal regulation in steady- state. A. B6 mice were orally gavaged with 109 CFU NCK56 (blue) or NCK2187 (green) on days 0, 3, 6, and 9, or left untreated, and immune responses in the colon analyzed at day 14 by flow cytometry. B-C. FoxP3-GFP mice were treated and evaluated as in (A). C. Regulatory cytokine production in FoxP3-GFP+ (green dotted bars) versus FoxP3-GFP (white bars) cells was measured by intracellular staining and FACS analyses, n = 5 mice/group. Data represent four individual experiments and are shown as mean ± SEM. *P<0.05, **P<0.01, ***P<0.001, ****P<0.0001. Black asterisks compare NCK2187 to untreated (PBS) mice, and red asterisks to NCK56-treated mice. Figures 3A-3D. L. acidophilus NCK2187 and its SlpA protect against pathogenic T- cell induced colitis. Ragl mice were injected with 106 CD4+CD45RBhi T cells, and then orally gavaged with NCK56 (red), NCK2187 (green), or SlpA (blue), 1 and 3 days after transfer, and subsequently once a week for 4 consecutive weeks, or left untreated (magenta). A group of mice was co-transferred with CD4 CD25+ T cells as a positive control for protection (Tregs; gray). Colitis severity was determined in part by weight loss, diarrhea scores, and FOB (A). (See Tables 2-4 for statistical analyses results.) B-C. Colitis scores based on histopathology and gross morphology of the colons were also used as measures of disease. Scale bar = 200 μιη. D. Circulating levels of proinflammatory cytokines were measured in the sera of the mice transferred and treated as mentioned above, or sham adoptive transferred (white bars), n = 5 mice/group. Data represent three individual experiments and are shown as mean ± SEM. *P<0.05, **P<0.01, ***P<0.001, ****p<0 0001. Black asterisks compare NCK2187 to PBS-treated adoptively transferred mice, and red asterisks to NCK56-treated mice.
Figures 4A-4D. L. acidophilus NCK2187 and its SlpA protect intestinal barrier function and prevent dysbiosis in pathogenic T-cell induced colitis. Ragl-/- mice were injected with 106 CD4+CD45RBhi T cells, and then orally gavaged with NCK56 (red), NCK2187 (green), or SlpA (blue), 1 and 3 days after transfer, and subsequently once a week for 4 consecutive weeks, or left untreated (magenta). A group of mice was co-transferred with CD4 CD25+ T cells as a positive control for protection (Tregs; gray). A. Colonic expression of tight junction-associated genes Cldn3 and Ocln, determined by RT-PCR, as well as passive transepithelial absorption of FITC-dextran, were used as measures of epithelial barrier integrity. Sham adoptive transferred Ragl 1 mice (white bars) were used as baseline controls in some cases, n = 5 mice/group. Data represent three individual experiments and are shown as mean ± SEM. *P<0.05, **P<0.01. Black asterisks compare NCK2187 to PBS-treated adoptively transferred mice, and red asterisks to NCK56-treated mice. B. UniFrac analyses were used to calculate distances between the microbial communities of the different samples (week 7) and three-dimensional scatterplots were generated by using principal coordinate analyses (PCoA). Gray dots = CD4 CD45RBhi T cells + PBS; yellow dots = CD4+CD45RBhi T cells + NCK56; green dots = CD4+CD45RBhi T cells + NCK2187; blue dots = CD4+CD45RBhi T cells + SlpA; red dots = CD4+CD45RBhi T cells + Tregs. Each dot represents the fecal microbiota data of an individual mouse. C. Changes in the relative abundance of different phyla were also analyzed. (See Table 5 for statistical analyses among the different groups.) Dark blue = Actinobacteria; green = Bacteroidetes; red = Proteobacteria; yellow = Verrucomicrobia; aqua = Firmicutes; purple = Tenericutes; black = Others. D. Comparison of microbial communities at family or order levels. The heat map depicts the relative value in individual mice, n = 5-6 mice/group.
Figures 5A-5D. L. acidophilus NCK2187 and its SlpA bind to murine SIGNR3 to induce regulatory signals. A. B6 mice were orally gavaged with 109 CFU NCK56 or NCK2187 and the colonic gene expression of C-type lectin receptors were measured by RT- PCR. Each box represents an individual mouse; n = 4. Data represent three individual experiments and are shown as mean ± SEM. B. Binding of SlpA to various hFc fusion proteins were analyzed by flow cytometry. Gray tinted line = SlpA-coated beads only; orange = SlpA-coated beads + secondary antibody; green = SlpA-coated beads + control fusion protein; blue = SlpA-coated beads + SIGNRl-hFc; red = SlpA-coated beads + SIGNR3-hFc. Binding assays results were confirmed five independent times. C. IL-Ιβ production by colonic DCs of naive WT B6 GF or Signr3-/- mice treated with NCK56 (blue) or NCK2187 (green) on days 0, 3, 6, and 9, or left untreated (black), as determined by flow cytometry. D. Frequency of colonic FoxP3+ Tregs in KO mice treated with NCK56 or NCK2187 was measured by flow cytometry, n = 5 mice/group. Data represent four individual experiments and are shown as mean ± SEM. *P<0.05. Black asterisks compare NCK2187 to untreated (PBS) mice, and red asterisks to NCK56-treated mice.
Figures 6A-6H. L. acidophilus NCK2187 and its SlpA do not protect against DSS- induced colitis in Signr3 mice. WT or Signr3 ' (KO) mice were orally gavaged with NCK56, NCK2187 or SlpA at days -1 and -3, and 3% DSS was given in the drinking water. Mice were gavaged with bacteria or purified SlpA an additional 2 times and monitored for disease progression. Colitis severity was determined in part by weight loss (A). (See Table 6 for statistical analyses from WT mice.) B-C. Colitis scores based on histopathology, and gross morphology of the colons were also used as measures of disease. Scale bar = 200 μιη. n = 5 mice/group. Empty bars = WT; lined bars = KO; white bars = untreated; purple bars = DSS; red bars = DSS + NCK56; green bars = DSS + NCK2187; blue bars = DSS + SlpA. D. Colonoscopies were performed in the different groups with a Multi-Purpose Rigid™ Telescope attached to a TELE PACK X. E. Mean relative colonic expression of tight junction-associated genes in WT mice. F. Fecal albumin levels in WT mice as a measure of intestinal permeability. G. UniFrac analyses were used to calculate distances between the microbial communities of the different samples (Day 10) and three-dimensional scatterplots were generated by using PCoA. Light gray: WT + DSS; green: WT + DSS + NCK56; brown: WT + DSS + NCK2187; blue: WT + DSS + SlpA; aqua: KO + DSS; red: KO + DSS + NCK56; yellow: KO + DSS + NCK2187; purple: KO + DSS + SlpA. n = 4-6 mice/group. H. Species richness and microbial diversity in DSS-treated mice. Top: The Chao richness index was used as a measure of species richness. Bottom: The Shannon diversity index was used to estimate microbial diversity for each group. Data are shown as mean ± SEM. *P<0.05, **P<0.01, ****P<0.0001.
Figures 7A-7C. L. acidophilus NCK2187 and its SlpA do not prevent immune infiltration and activation during DSS-induced colitis in Signr3-/- mice. WT or Signr3-/- (KO) mice were orally gavaged with NCK56, NCK2187 or SlpA at days -1 and -3, and 3% DSS was given in the drinking water. Mice were gavaged with bacteria or purified SlpA an additional 2 times, and immunity analyzed by flow cytometry at day 10. A. Representative plots indicate the frequency of neutrophils in the colons of untreated or DSS-treated WT (left) and Signr3-/- mice (right). B-C. Colonic DCs and MΦs were analyzed by flow cytometry for the production of IL-Ιβ (B), and colonic Tregs were evaluated for co-expression of RORyt+ (C). n = 5 mice/group. Gray tinted line = isotype control; black = untreated; purple = DSS; red = DSS + NCK56; green = DSS + NCK2187; blue = DSS + SlpA. Data are shown as mean ± SEM, and are representative of three different experiments. *P<0.05, **P<0.01, ***P<0.001, ****P<0.0001.
Figures 8A-8B. L. acidophilus NCK2187 and its SlpA in pathogenic T-cell induced colitis. Ragl mice were injected with 106 CD4+CD45RBhi T cells, and then orally gavaged with NCK56 (red), NCK2187 (green), or SlpA (blue), 1 and 3 days after transfer, and subsequently once a week for 4 consecutive weeks, or left untreated (magenta). A group of mice was co-transferred with CD4+CD25+ T cells as a positive control for protection (Tregs; gray). A. Colonic expression of Ltb4rl, Ltb4r2, and II lb were determined by RT- PCR. n = 5 mice/group. Data represent three individual experiments and are shown as mean ± SEM. *P<0.05, **P<0.01. Black asterisks compare NCK2187 to PBS-treated adoptively transferred mice, and red asterisks to NCK56-treated mice. B. Colonoscopies were performed in the specified groups with a Multi-Purpose Rigid™ Telescope attached to a TELEPACK X.
Figure 9. L. acidophilus NCK2187 and its SlpA cannot normalize sera cytokine levels upon DSS-induced colitis in Signr3-/- mice. WT or Signr3-/- mice were orally gavaged with NCK56, NCK2187 or SlpA at days -1 and -3, and 3% DSS was given in the drinking water. Mice were gavaged with bacteria or purified SlpA an additional 2 times. Cytokine levels were measured in the sera at the endpoint of the experiment, n = 4 mice/group. Empty bars = WT; lined bars = KO; white bars = untreated; purple bars = DSS; red bars = DSS + NCK56; green bars = DSS + NCK2187; blue bars = DSS + SlpA. Data are shown as mean ± SEM. *P<0.05, **P<0.01, ***P<0.001.
Figures 10A-10B. Dextran sodium sulfate (DSS) treatment and oral gavage regimens. (A) DSS-induced colitis prevention study; mice were orally gavaged with NCK56, NCK2187 or SlpA at the specified time points. 3% DSS was given in the drinking water from days 0 to 5. (B) DSS-induced colitis therapy. 3% DSS was given in the drinking water from days 0 to 5. Mice were then orally gavaged with NCK56, NCK2187, or SlpA at the circled time points.
Figures 11A-11E. L. acidophilus-SlpA protects against DSS-induced colitis. C57BL/6 mice were orally gavaged with NCK56, NCK2187 or SlpA, and 3% DSS was given in the drinking water. Colitis development in the mice was monitored by measuring weight loss (A), diarrhea development (B), presence of fecal occult blood (FOB) (C), gross morphology of the colons (D), and histopathology (E). *P<0.05, **P<0.01 and ***P<0.001 representing the specified group by its color compared with PBS.
Figures 12A-12E. L. acidophilus-SlpA reverses DSS-induced colitis. C57BL/6 mice were given 3% DSS in the drinking water, and were then orally gavaged with NCK56, NCK2187 or SlpA. Colitis development in the mice was monitored by measuring weight loss (A), diarrhea development (B), presence of fecal occult blood (FOB) (C), gross morphology of the colons (D), and histopathology (E). *P<0.05 and **P<0.01 representing the specified group by its color compared with PBS.
Figures 13A-13E. L. acidophilus-SlpA protects against pathogenic T cell-induced colitis. Rag 1-/- mice were injected with 106 CD4 CD25 T cells, and were then orally gavaged with NCK56, NCK2187, or SlpA, 1 and 3 days after transfer, and subsequently once a week for 4 consecutive weeks. Colitis development in the mice was monitored by measuring weight loss (A), diarrhea development (B), presence of fecal occult blood (FOB) (C, gross morphology of the colons (D), and histopathology (E). *P<0.05, **P<0.01 and ***P<0.001 representing the specified group by its color compared with PBS.
Figures 14A-14B. NCK2187 induces the generation of Tregs in healthy controls. C57BL/6 mice were orally gavaged with 109 CFU NCK56 (WT), NCK2187 (SlpA+), or left untreated; immune responses were analyzed by flow cytometry 3 days-post gavage. When compared to untreated or NCK56-treated mice, NCK2187 led to an expansion of total Tregs in the mesenteric lymph nodes (MLN; Figure 14 A) and spleens (Figure 14B) of the mice tested. **P<0.01 and ***P<0.001 compared with PBS.
Figures 15A-15C. L. acidophilus-SlpA isolation by NaCl. L. acidophilus-SlpA was isolated and purified using NaCl. A. SDS-PAGE containing 2.5 μg of LiCl- and NaCl- isolated SlpA stained with Coomassie blue to visualize the purified protein. B-C. Mass spectrometry data analyzed on the Scaffold (Searle 2010) platform showed 97 unique spectra with 55 unique peptides with the possibility of two proteins (B). The predicted protein gi|58336516 (SlpA) shows 54% coverage whereas gi|362076610 (SlpB) reveals only 18% of coverage (highlighted portion. C). The regions of SlpB matching the generated peptides are common between SlpA and SlpB (shown in the red box, C), and no single unique peptide from SlpB was identified.
Figures 16A-16E. NaCl-purified SlpA is not toxic to mice. A-E. C57BL/6 mice were treated orally every other day with SlpA (0, 150, 300, 600 μg/100μL per mouse), for a total of four times. One-week later, mice were sacrificed and a whole blood chemistry profile was generated for each mouse with a comprehensive metabolic chemistry panel, using a VetScan V2S analyzer. All animal experiments were performed under the guidelines of the Animal Welfare Act and the Public Health Policy on Humane Care, and with approval by the Institutional Animal Care and Use Committee (IACUC protocol 201406559) at the University of Florida.
Figures 17A-17E. Generated mAb BM1 recognizes L. acidophilus-SlpA. C57BL/6 mice were immunized once a week for 3 months with 100 μg of SlpA, and 300 μg of heat- killed Lactobacillus gasseri as adjuvant. Polyclonal sera were tested for recognition of isolated SlpA by Western Blot (WB), and splenic cells from SlpA-reactive mice were fused with Sp2/0 myeloma cells at a ratio of 7:1. Hybridomas were seeded on semi-solid medium for clone selection and screening. Subsequently, clones were screened by ELISA for SlpA reactivity. Reactive clones were isotyped and all IgM secretors removed. Clone BM1 (IgG) was selected for its ability to recognize SlpA by WB (A), flow cytometry (B), confocal microscopy (C), and ELISA (D, E). A. L. acidophilus-SlpA detection by WB with BM1. 100 ng of purified SlpA, 108 CFU L. acidophilus (L. a.), 108 CFU L. reuteri (L. r.), or 100 ng of BSA. Proteins separated by SDS-PAGE were transferred onto a PVDF membrane and detected by BM1. B. L. acidophilus SlpA detection with BM1 by flow cytometry. Carboxylated Dynabeads were coated with purified SlpA and reactivity of BM1 mAb confirmed by Canto II flow cytometry. Data were analyzed by Flow Jo. Experiments were performed at least three times with similar trends. C. L. acidophilus-SlpA detection with BMl by confocal microscopy. RAW 264.7 cells were pulsed for 1 or 3 hrs with NaCl purified SlpA (10 μg/mL). Subsequently, cells were fixed and stained with BMl mAb for detection by confocal microscopy. Cells were incubated with BMl mAb, overnight. Cells were washed and subsequently incubated with a secondary antibody (Alexa Fluor 488 anti- mouse IgGl, 1 : 100) for 4 hrs. Nuclei were stained with DAPI (15 min) and visualized by a Zeiss confocal microscope. D. L. acidophilus-SlpA detection with BMl by ELISA. ELISA plates were coated with 500 ng of purified SlpA overnight, and binding by BMl was tested thereafter. E. Germ-free (GF) mice were orally treated with 109 CFU L. acidophilus, 150 μg of SlpA, or left untreated. Fecal pellets from these mice were used to coat ELISA plates; BSA was used as a negative control. BMl by ELISA. ELISA plates were coated with 500 ng of purified SlpA overnight, and binding by BMl was tested thereafter. E. Germ- free (GF) mice were orally treated with 109 CFU L. acidophilus, 150 μg of SlpA, or left untreated. Fecal pellets from these mice were used to coat ELISA plates; BSA was used as a negative control. BMl mAb only bound to plates coated with feces derived from treated mice. All animal experiments were performed under the guidelines of the Animal Welfare Act and the Public Health Policy on Humane Care, and with approval by the Institutional Animal Care and Use Committee (IACUC protocol 201406559) at the University of Florida. *** denotes statistical significance p<0.01. ***p <0.001.
BRIEF DESCRIPTION OF THE SEQUENCES SEQ ID NO: 1: Amino acid sequence of phosphoglycerol transferase protein from L. acidophilus (Genbank Accession No. AAV42337.1).
SEQ ID NO: 2: Amino acid sequence of SlpB protein from L. acidophilus (Genbank
Accession No. YP 193105).
SEQ ID NO: 3: Amino acid sequence of SlpX protein from L. acidophilus (Genbank Accession No. YP_193425).
SEQ ID NO: 4: Amino acid sequence of SlpA protein from L. acidophilus (Genbank Accession No. P35829).
SEQ ID NO: 5 to 46: The list of primer sequences for Real-Time PCR analyses (see Table 1).
SEQ ID NO: 47 to 55: SlpA protein sequences as discussed below. DETAILED DISCLOSURE OF THE INVENTION
The current invention provides a bacterium lacking on its surface LTA, SlpB and SlpX. The current invention also provides SlpA as an effector molecule expressed by bacteria, for example, L. acidophilus and its in vivo protective role in inflammation mediated diseases (inflammatory diseases), for example, inflammation mediated diseases of the gastrointestinal tract such as IBD or other inflammatory diseases, such as allergies, ankylosing spondylitis, Crohn's disease, diabetes, Type I diabetes, gastroesophageal reflux disease, Hashimoto's thyroiditis, hyperthyroidism, hypothyroidism, Irritable Bowel Syndrome (IBS), interstitial cystitis (IC), Lofgren's syndrome, lupus erythematosis, myasthenia gravis, multiple sclerosis, osteoarthritis, polymyalgia rheumatica, prostatitis, psoriasis, psoriatic arthritis, Raynaud's syndrome/phenomenon, reactive arthritis (Reiter syndrome), restless leg syndrome, reflex sympathetic dystrophy (RSD), rheumatoid arthritis, scleroderma, Sjogren's syndrome, ulcerative colitis and uveitis.
A bacterium lacking LTA and methods of preparing such bacterium are described in
US Patent Application Publication 20130224153, the contents of which are incorporated by reference herein in its entirety, particularly, paragraphs [0031] to [0034]. In addition to modifications required to decrease or eliminate display of LTA on the surface, the current invention provides a bacterium further modified to decrease or eliminate the display of SlpB and SlpX on the surface. In some embodiments, bacterial cells lacking LTA expression on the cell surface are genetically modified to decrease or eliminate SlpB and SlpX expression on the cell surface. Such cells can be genetically modified to expression SlpA and used in the methods disclosed herein. Yet other embodiments utilize bacterial cells genetically modified to express SlpA but which lack LTA expression on the cell surface and also lack genes encoding SlpB and SlpX or orthologs of SlpB and SlpX (i.e., protein homo logs that are present within different species and have very similar or identical function). Non- limiting examples of such bacterial cells include those that lack genes encoding phosphoglycerol transferase protein (Genbank Accession No. AAV42337.1; SEQ ID NO: 1), SlpB and SlpX or orthologs of phosphoglycerol transferase (Genbank Accession No. AAV42337.1), SlpB and SlpX. For example, the cells do not express SEQ ID NO: 2 or the SlpB polypeptides associated with Uniprot access numbers Q48508, C2HR61, Q5FMK0, Q8GFE5, J9W284, J9W905, B1H0V4, H6VTN5, Q09FL7, V7HZR4, S4NDQ7, S4NKH4, S4NL65 and S4NQU9 and SEQ ID NO: 3 or the SlpX polypeptides associated with SlpX protein are provided by Uniprot access numbers C2HMW6, S6E4Y8, S6DRU6, S6DL03, S6E593, S6DQJ3, F0TJ46, Q5FLN0, D4YUC6, R5ZGF3, E4SM72, F2M2V8, C2KB60, D5H1S0, I7KQ44, U6FUJ7, U6FJC0, U6F914, U6F7V6, U6F834, U4QN79, U4QA33, F3MP54, F0NWR2, F0NVR1, F6CEM8, F6CBQ1, 17JYF2 and C2ELK0.
In certain embodiments, the phosphoglycerol transferase protein comprises SEQ ID
NO: 1, SlpB protein comprises the amino acid sequence of SEQ ID NO: 2 and SlpX protein comprises the amino acid sequence of SEQ ID NO: 3. Accordingly, in addition to the modifications required to reduce the surface display of LTA, the bacterium of the current invention has been further genetically modified to decrease or eliminate the expression of a polypeptide comprising amino acid sequence of SEQ ID NO: 1, comprising amino acid sequence of SEQ ID NO: 2 and a polypeptide comprising the amino acid sequence of SEQ ID NO: 3. In an embodiment, in addition to the modifications required to reduce or eliminate the surface display of LTA, the bacterium of the current invention has decreased or eliminated expression of a polypeptide comprising the amino acid sequence having at least 70%, 80%, 90%, 95%, 97%, 98%, or 99% sequence identity to the amino acid sequence of SEQ ID NO: 1, at least 70%, 80%, 90%, 95%, 97%, 98%, or 99% sequence identity to the amino acid sequence of SEQ ID NO: 2 and a polypeptide comprising the amino acid sequence having at least 70%, 80%, 90%, 95%, 97%, 98%, or 99% sequence identity to the amino acid sequence of SEQ ID NO: 3.
Certain examples of phosphoglycerol transferase protein from L. acidophilus
(Genbank Accession No. AAV42337.1) protein are provided by Uniprot access numbers Q5FLT7, A0A0D5MGR2, F3MQQ2, U6F845, U6FPM2,U6FK51, A8YTT6,U6F7B9, C7XM54, E3R4H1, C2KGR7, D0DKS2 and K1NT37 (each of which is hereby incorporated by reference in their entireties). Additional examples of phosphoglycerol transferase proteins are well known to a person of ordinary skill in the art and such embodiments are within the purview of the current invention.
Certain examples of SlpB protein are provided by Uniprot access numbers Q48508, C2HR61, Q5FMK0, Q8GFE5, J9W284, J9W905, B1H0V4, H6VTN5, Q09FL7, V7HZR4, S4NDQ7, S4NKH4, S4NL65 and S4NQU9 (each of which is hereby incorporated by reference in their entireties). Additional examples of SlpB proteins are well known to a person of ordinary skill in the art and such embodiments are within the purview of the current invention. Certain examples of SlpX protein are provided by Uniprot access numbers C2HMW6, S6E4Y8, S6DRU6, S6DL03, S6E593, S6DQJ3, F0TJ46, Q5FLN0, D4YUC6, R5ZGF3, E4SM72, F2M2V8, C2KB60, D5H1S0, I7KQ44, U6FUJ7, U6FJC0, U6F914, U6F7V6, U6F834, U4QN79, U4QA33, F3MP54, F0NWR2, FONVRl, F6CEM8, F6CBQ1, I7JYF2 and C2ELK0 (each of which is hereby incorporated by reference in their entireties). Additional examples of SlpX proteins are well known to a person of ordinary skill in the art and such embodiments are within the purview of the current invention.
The genetic modifications resulting in decreased or eliminated expression of the polypeptides include, but are not limited to, deleting the entire coding region of the gene or a portion of the coding nucleotide sequence, introducing a frame shift mutation, a missense mutation, an insertion, by introducing a stop codon or a combinations of any of the aforementioned mutations. Additional mutations which would lead to decreased, or eliminated, expression of a polypeptide of interest and methods of introducing such mutations into a bacterium are well known to a person of ordinary skill in the art and such embodiments are within the purview of the claimed invention. In one embodiment of the invention, the «/¾9-counterselective knockout strategy (described in Goh et al, 2009) which is hereby incorporated by reference in its entirety) was used to generate in-frame deletions in the slpB and slpX genes of L. acidophilus NCK2030 to produce L. acidophilus NCK2187.
In a certain embodiment, the lactic acid bacterium is a surface layer protein expressing Lactobacillus. These bacterial cells may also be referred to as probiotic bacterial cells. Non-limiting examples of such lactic acid bacteria include, but are not limited to, L. acidophilus, L. amylolyticus, L. amylovorus, L. brevis, L. brevis ssp gravesensis, L. buchneri, L. crispatus, L. gallinarum, L. gigeriorum, L. helveticus/suntoryeus, L. hilgardii, L. kefiranofaciens, L. pasteurii, L. lactis andL. ultunensis.
An embodiment provides a composition comprising the recombinant bacterium of the current invention and a pharmaceutically acceptable carrier and/or excipient.
The bacteria of the current invention provide protective role in inflammation mediated diseases, for example, inflammation mediated diseases of gastrointestinal tract such IBD. Accordingly, certain embodiments of the current invention provide methods of treating and/or preventing an inflammation mediated disease of the gastrointestinal system in a subject, the method comprising, administering to the subject a therapeutically effective amount of the bacterium of the current invention. In one embodiment, the bacterium is orally administered to the subject. In certain embodiments of the invention a subject is a mammal. Non-limiting examples of a mammal treatable according to the methods of the current invention include mouse, rat, dog, guinea pig, cow, horse, cat, rabbit, pig, monkey, ape, chimpanzee, and human. Additional examples of mammals treatable with the methods of the current invention are well known to a person of ordinary skill in the art and such embodiments are within the purview of the current invention.
For the purposes of the current invention, a probiotic food refers to a food which contains microorganisms associated with beneficial effects to humans and animals upon ingestion of the probiotic food. Non-limiting examples of probiotic food include yogurt, fermented vegetable, kefir, sauerkraut, miso soup, pickle, tempeh and kimchi.
For the purposes of this invention the term "inflammation mediated disease" or "inflammatory disease" refers to a disease characterized by a dysregulation of the normal immune response. Inflammation mediated diseases (inflammatory diseases) can cause organ damage, and are associated with increased morbidity and/or mortality. An example of immune dysregulation is the inappropriate activation of inflammatory cytokines, such as IL- 12, IL-6 or TNF alpha, whose actions lead to pathological consequences.
For the purposes of this invention the terms "treatment, treating, treat" or equivalents of these terms refer to healing, alleviating, relieving, altering, remedying, ameliorating, improving, or affecting the condition or the symptoms of a subject suffering with a disease, for example, a gastrointestinal disorder. The subject to be treated can be suffering from or at risk of developing the disorder, for example, a gastrointestinal disorder, including, for example, an IBD or be at risk of developing an IBD. When provided therapeutically, the bacterium is provided at (or shortly after) the onset of a symptom. The therapeutic administration of the substance serves to attenuate any actual symptom.
For the purposes of this invention, the terms "preventing, preventive, prophylactic" or equivalents of these terms are indicate that the recombinant bacterium is provided in advance of any disease symptoms and are a separate aspect of the invention (i.e., an aspect of the invention that is distinct from aspects related to the terms "treatment, treating, treat" or equivalents of these terms which refer to healing, alleviating, relieving, altering, remedying, ameliorating, improving, or affecting the condition or the symptoms of a subject suffering with an inflammatory disease, for example, a gastrointestinal disorder). The prophylactic administration of the recombinant bacterium serves to prevent or attenuate any subsequent symptoms or disease. By "therapeutically effective dose," "therapeutically effective amount", or "effective amount" is intended to be an amount of a recombinant bacterium disclosed herein or the amount of SlpA that, when administered to a subject, decreases the inflammatory response, or reduces any increase in an inflammatory response as compared to untreated subjects. "Positive therapeutic response" refers to, for example, improving the condition of at least one of the symptoms of an inflammatory disorder.
An effective amount of the therapeutic agent is determined based on the intended goal. The term "unit dose" refers to a physically discrete unit suitable for use in a subject, each unit containing a predetermined quantity of the therapeutic composition calculated to produce the desired response in association with its administration, i.e., the appropriate route and treatment regimen. The quantity to be administered, both according to number of treatments and unit dose, depends on the subject to be treated, the state of the subject and the protection desired. Precise amounts of the therapeutic composition also depend on the judgment of the practitioner and are peculiar to each individual. Generally, the dosage of recombinant bacteria will vary depending upon such factors as the patient's age, weight, height, sex, general medical condition and previous medical history. In specific embodiments, it may be desirable to administer the bacterium in the range of about 104 to about 1012 CFU, 105 to 1011 CFU, 106 to 1010 CFU, 108 to 1010 CFU or 108 to 1012 CFU.
In some embodiments of the invention, the method comprises administration of multiple doses of the bacterium. The method may comprise administration of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, or more therapeutically effective doses of a composition comprising the bacterium as described herein. In some embodiments, doses are administered over the course of 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 10 days, 14 days, 21 days, 30 days, or more than 30 days. The frequency and duration of administration of multiple doses of the compositions is such as to reduce or prevent an inflammatory response and thereby treat or prevent a gastrointestinal disorder. Moreover, treatment of a subject with a therapeutically effective amount of the recombinant bacterium of the invention can include a single treatment or can include a series of treatments. It will also be appreciated that the effective dosage of a bacterium used for treatment may increase or decrease over the course of a particular treatment. Changes in dosage may result and become apparent from the results of diagnostic assays for detecting inflammation known in the art and described herein.
The present invention also includes combinations of the recombinant bacteria with one another, and/or with one or more other agents useful in the treatment of an inflammation mediated disease of the GI tract. For example, bacteria of the invention may be administered in combination with effective doses of conventional anti-inflammatory agents, such as sulfasalazine, cyclosporine, prednisone, methylprednisone, budesonide, mesalamine, azathioprine, TNF inhibitors, methotrexate, or 6-mercaptopurine, a corticosteroid, infliximab or combinations thereof, for treatment of inflammation mediated diseases of the GI tract. The term "administration in combination" refers to both concurrent and sequential administration of the active agents. The combination therapies are of course not limited to the agents provided herein, but include any composition for the treatment of inflammatory disorders.
In certain embodiments, the inflammation mediated disease treated according to the current invention is IBD. Non-limiting examples of IBD include Crohn's disease or ulcerative colitis. Additional examples of IBD are well known to a person of ordinary skill in the art and such embodiments are within the purview of the current invention. As discussed above, the disclosed methods and compositions are aimed at improving the condition of at least one of the symptoms of an inflammatory disorder, such as IBD.
The current invention also provides SlpA as an effector molecule expressed by bacteria and which provide protective role in inflammation mediated diseases, for example, inflammation mediated diseases of gastrointestinal tract such IBD. Accordingly, certain embodiments of the current invention provide an isolated bacterial SlpA protein or a non- naturally occurring protein derivative thereof.
An example of bacterial SlpA protein is provided by a protein having the sequence of
SEQ ID NO: 4 or a protein having at least 95% sequence identity to the sequence of SEQ ID NO: 4. Certain other examples of SlpA protein are provided by Uniprot access numbers C2HR60 (SEQ ID NO: 47), P35829 (SEQ ID NO: 48), G1UE81 (SEQ ID NO: 49), Q9Z4J9 (SEQ ID NO: 50), H6VTN4 (SEQ ID NO: 51), Q09FM2 (SEQ ID NO: 52), L7YE91 (SEQ ID NO: 53), K8DVK7 (SEQ ID NO: 54) and F0NUB7 (SEQ ID NO: 55) (each of which is hereby incorporated by reference in its entirety). Additional examples of SlpA proteins are well known to a person of ordinary skill in the art and such embodiments are within the purview of the current invention for use in formulation of the compositions disclosed herein as well as the methods of using such compositions for the treatment of inflammatory diseases.
For the purposes of this invention a "non-naturally" occurring protein derivative indicates that the protein derivative is different than the its naturally occurring counterpart in some manner. Certain examples of modifications which can distinguish a non-naturally occurring protein derivative from its naturally occurring counterpart include mutations in the amino acid sequences (e.g., point mutations or the introduction of one or more glycosylation site into the protein), non-naturally occurring post-translational modifications (e.g. glycosylation or phosphorylation patterns), attachment to the protein of extraneous molecules (e.g. molecular labels, such as radioisotopes or fluorescent labels, polyethyleneglycol (PEG), etc.). Additional examples of such modifications are well known to a person of ordinary skill in the art and such embodiments are within the purview of the current invention.
In one embodiment, the non-naturally occurring SlpA protein derivative according to the current invention comprises a molecular label conjugated to a bacterial SlpA protein, for example, SlpA protein having the sequence of SEQ ID NO: 4 or the protein having at least 95% sequence identity to the sequence of SEQ ID NO: 4. The label can be a radiolabel, fluorescent label, affinity label, targeting label.
In another embodiment, the non-naturally occurring SlpA protein derivative according to the current invention comprises a protein having one or more mutations in the naturally occurring sequence of a bacterial SlpA protein, for example, SlpA protein having a sequence of SEQ ID NO: 4 or having a sequence at least 95% identical to the sequence of SEQ ID NO: 4. In certain embodiments, the non-naturally occurring SlpA protein derivative comprises about 1 to about 20 mutations, about 3 to about 15 mutations, or about 5 to about 10 mutations. In another embodiment, the mutations do not negatively affect the ability of the non-naturally occurring SlpA protein derivative of the current invention of protecting against inflammation mediated diseases, for example, inflammation mediated diseases of gastrointestinal tract such IBD.
An embodiment of the current invention also provides a composition comprising the non-naturally occurring SlpA protein derivative and a pharmaceutically acceptable carrier and/or excipient.
The pharmaceutically acceptable carrier and/or excipient comprise substances, such as an inert vehicle, or pharmaceutical acceptable adjuvants, preservatives etc. Examples pharmaceutically acceptable substances are well known to a person of ordinary skill in the art and such embodiments are within the purview of the current invention.
The pharmaceutical composition may be a liquid formulation or a solid formulation.
When the pharmaceutical composition is a solid formulation it may be formulated as a tablet, a sucking tablet, a chewing tablet, a chewing gum, a capsule, a sachet, a powder, a granule, a coated particle, a coated tablet, an enterocoated tablet, an enterocoated capsule, a melting strip or a film. When the pharmaceutical composition is a liquid formulation it may be formulated as an oral solution, a suspension, an emulsion or syrup. Said composition may further comprise a carrier material independently selected from, but not limited to, the group consisting of lactic acid fermented foods, fermented dairy products, resistant starch, dietary fibers, carbohydrates, proteins, and glycosylated proteins.
Pharmaceutical compositions, as disclosed herein, can be formulated in accordance with standard pharmaceutical practice (see, e.g., Remington: The Science and Practice of Pharmacy (20th ed.), ed. A. R. Gennaro, Lippincott Williams & Wilkins, 2000 and Encyclopedia of Pharmaceutical Technology, eds. J. Swarbrick and J. C. Boylan, 1988-1999, Marcel Dekker, New York) known by a person skilled in the art. Pharmaceutical composition according to the invention may also be formulated to release active agents substantially immediately upon administration or at any predetermined time or time period after administration.
For oral administration, the composition can be formulated into conventional oral dosage forms such as tablets, capsules, powders, granules and liquid preparations such as syrups, elixirs, and concentrated drops. Non-toxic solid carriers or diluents may be used which include, for example, pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharine, talcum, cellulose, glucose, sucrose, magnesium, carbonate, and the like. For compressed tablets, binders, which are agents which impart cohesive qualities to powdered materials are also necessary. For example, starch, gelatin, sugars such as lactose or dextrose, and natural or synthetic gums can be used as binders. Disintegrants are also necessary in the tablets to facilitate break-up of the tablet. Disintegrants include starches, clays, celluloses, algins, gums and cross-linked polymers. Moreover, lubricants and glidants are also included in the tablets to prevent adhesion to the tablet material to surfaces in the manufacturing process and to improve the flow characteristics of the powder material during manufacture. Colloidal silicon dioxide is most commonly used as a glidant and compounds such as talc or stearic acids are most commonly used as lubricants.
Pharmaceutical composition can also be formulated as a food composition, a dietary supplement, a functional food, a medical food or a nutritional product as long as the required effect is achieved, i.e. treatment and/or prevention of an inflammatory disorder of the gastrointestinal tract. Said food composition may be chosen from the group consisting of beverages, yogurts, juices, ice creams, breads, biscuits, crackers, cereals, health bars, spreads and nutritional products. The food composition may further comprise a carrier material, wherein said carrier material is chosen from the group consisting of lactic acid fermented foods, fermented dairy products, resistant starch, dietary fibers, carbohydrates, proteins and glycosylated proteins.
Accordingly, the current invention provides a method of treating or preventing an inflammation mediated disease of the gastrointestinal system in a subject, the method comprising, administering to the subject a therapeutically effective amount of the composition comprising the SlpA protein or a non-naturally occurring SlpA derivative. In certain embodiments, the composition is orally administered to the subject. SlpA protein or a non-naturally occurring SlpA derivatives can be administered or formulated in combination with effective doses of conventional anti-inflammatory agents, such as sulfasalazine, cyclosporine, prednisone, methylprednisone, budesonide, mesalamine, azathioprine, TNF inhibitors, methotrexate, or 6-mercaptopurine, a corticosteroid, infliximab or combinations thereof, for treatment of inflammation mediated diseases of the GI tract. Non-limiting examples of such diseases include IBD, for example, Crohn's disease or ulcerative colitis.
Yet another aspect of the invention relates to a method of purifying SlpA comprising growing SlpA expressing bacterial cells, pelleting said bacterial cells from culture medium containing said bacterial cells, resuspending said bacterial cells in 5M NaCl for a period of 5 minutes to 24 hours, preferably between 30 minutes and two hours, to form an extraction composition, removing bacterial cells from said extraction composition by centrifugation to form a composition containing SlpA and dialyzing or filtering said composition using a dialysis bag or ultrafiltrating device having a molecular weight cut-off of 30 kDa to reduce the salt content of said composition containing SlpA. The method can further comprise the precipitation of SlpA protein in said dialyzed composition comprising SlpA (for example, with 1M NaCl or another suitable preciptitating agent). The method can also further comprise the washing of said precipitated SlpA with water or a buffer and lyophilization of said washed SlpA.
In some embodiments of the purification methodology, the SlpA expressing bacterial cells do not express LTA, SlpB or orthologs thereof or SlpX or orthologs thereof. Alternatively, the SlpA expressing bacterial cells do not express phosphoglycerol transferase or orthologs thereof, SlpB or orthologs thereof or SlpX or orthologs thereof.
Thus, the bacterial cells, in some embodiments: a) express a protein that has the amino acid sequence of SEQ ID NO: 4 or the protein has the amino acid sequence at least 70%, 80%, 90%, 95%, 97%, 98%, or 99% identical to the sequence of SEQ ID NO: 4; and b) do not express (i) a polypeptide comprising the amino acid sequence of SEQ ID NO: 1 or a polypeptide having at least 70%, 80%, 90%, 95%, 97%, 98%, or 99% sequence identity to the amino acid sequence of SEQ ID NO: 1 ; (ii) a polypeptide comprising the amino acid sequence of SEQ ID NO: 2 or a polypeptide comprising the amino acid sequence having at least 70%, 80%, 90%, 95%, 97%, 98%, or 99% sequence identity to the amino acid sequence of SEQ ID NO: 2; and (iii) a polypeptide comprising the amino acid sequence of SEQ ID NO: 3 or a polypeptide having at least 70%, 80%, 90%, 95%, 97%, 98%, or 99% sequence identity to the amino acid sequence of SEQ ID NO: 3. In certain aspects of the invention, these bacterial cells are Lactobacillus strain, such as a LacotbaciUus strain is selected from the group consisting of L. acidophilus, L. amylolyticus, L. amylovorus, L. brevis, L. brevis ssp gravesensis, L. buchneri, L. crispatus, L. gallinarum, L. gigeriorum, L. helveticus/suntoryeus, L. hilgardii, L. kefiranofaciens, L. pasteurii, L. lactis and L. ultunensis.
MATERIALS AND METHODS
Mice
C57BL/6 (B6), and B6 recombination-activating gene 1 -deficient (Ragl ^) mice were purchased from Jackson Laboratories (Bar Harbor, ME). Germ-free (GF) B6 mice were obtained from the National Gnotobiotic Rodent Resource Center at the University of North Carolina and maintained in the GF facilities at the University of Florida (UF). The mouse strain 031934-UCD, C51BL/6-Cd209dtm1.1Cfg/Mmucd (Signr3-/-) was provided by the NIH- sponsored Mutant Mouse Regional Resource Center (MMRRC) National System and was backcrossed at the Max Planck Institute of Colloids and Interfaces, Berlin, Germany. Genotyping of the Signr3 gene in WT and Signr3-/- mice was performed according to a protocol provided by the Consortium for Functional Glycomics. Dr. L. Morel (UF) contributed the FoxP3-GFP mice. Mice were bred in-house in the animal facility at the College of Veterinary Medicine, UF. Mice were maintained under specific pathogen-free, Helicobacter-frQQ conditions and used at 6-8 weeks of age in accordance with the Animal Welfare Act and the Public Health Policy on Humane Care. Procedures were approved by UF's Institutional Animal Case and Use Committee (IACUC).
Bacterial Strains The upp -counterselective knockout strategy was used to generate an in-frame deletion of the phosphoglycerol transferase gene within NCK2030 (LTA+ SlpB SlpX- SlpA+), resulting in the generation of NCK2187 (LTA-SlpB-SlpX-SlpA+) (Goh et al, 2009). Wild- type L. acidophilus NCFM (NCK56), and NCK2187 were propagated anaerobically in MRS broth (Difco, BD, Franklin Lakes, NJ) at 37°C for 15 hrs. In preparation for oral treatment, bacteria were washed twice with sterile PBS, and the number of colony-forming units (CFU) were estimated by measuring the optical density at 600 nm. The concentration of each L. acidophilus strain was accordingly adjusted. To determine the clearance kinetics of the different L. acidophilus strains, groups of mice (n=3) were orally gavaged with erythromycin- resistant (Em1) NCK56 or NCK2187 (1x109 CFU/100 μL/mouse). Fecal pellets were collected before gavage and every day thereafter for up to 7 days. Each fecal pellet was then resuspended in 10% MRS (0.2 g/2 mL). The homogenized material was serially diluted and plated onto MRS agar containing Em (2 μg/mL). The daily average excreted L. acidophilus was quantified. For the oral gavage of mice, each mouse received either 1x109 CFU of NCK56 or NCK2187 in 100 μΕ of PBS. Mice enrolled in steady-state studies were orally gavaged every 3 days for a total of 4 times, and immune changes analyzed at day 14. The gavage schedule was determined based on the clearance kinetics of the bacterial strains.
Surface Layer Protein A Isolation
SlpA was purified from NCK2187 with LiCl. Cultures from 18 h grown NCK2187 were pelleted at 5,000 rpm for 10 min. Bacterial pellets were washed with cold PBS and re- pelleted before extraction. Pellets were resuspended in 5 M LiCl or 5M NaCl (Sigma- Aldrich, St. Louis, MO), gently stirred for 30 min, and the bacteria removed by centrifugation (13,000 rpm, 15 min). Supernatants were dialyzed against distilled water overnight using a dialysis bag with a cut-off molecular weight of 30 kDa for salt removal. The protein precipitate was dissolved in 1 M LiCl or 1M NaCl and pelleted at 13,000 rpm for 30 min. The SlpA protein preparation was washed with water a minimum of three times before lyophilization (FreeZone, Labconco, Kansas City, MO). Freeze-dried SlpA was stored at 4°C until used. SDS-PAGE gels and proteomics analyses were used to confirm SlpA purity. For oral gavage, mice were given 150 μg of SlpA in 300 μί PBS.
Lamina Propria Leukocyte (LPL) Preparation Colonic lamina propria cells were isolated, as previously described (Lightfoot et al, 2014). Freshly isolated colons were cut into 0.5 cm sections and intraepithelial lymphocytes removed with a digestion buffer consisting of HBSS (GIBCO, Life Technologies, Grand Island, NY) containing 5 mM EDTA (GIBCO, Life Technologies) and 10 mM HEPES (GIBCO, Life Technologies), for (20 min, 37°C). Remaining colon tissues were digested in DMEM (GIBCO, Life Technologies) supplemented with 0.25 ng/mL Collagenase Type VII (Sigma- Aldrich), 0.125 U/mL Liberase TM Research Grade (Roche Applied Science, Indianapolis, IN), 10 mM HEPES, 0.1 M CaC12 (Sigma-Aldrich), and 5% FBS (GIBCO, Life Technologies). Three digestions of 10 min each at 37°C were performed. Single cell suspensions obtained were combined and stained for flow cytometry-based analyses or used for ex vivo studies.
Ex vivo Stimulation of Colonic LPLs
Isolated colonic LPLs were co-cultured with NCK56 or NCK2187 for 12 h at 37°C. Supernatants were then collected and stored at -80°C for later cytokine analyses using Bio- Plex Pro Mouse Cytokine Immunoassay kits (Bio-Rad, Hercules, CA). Activation phenotypes of DCs were analyzed by flow cytometry using the appropriate antibodies to quantify expression levels of MHC-II molecules and costimulatory markers. Flow Cytometry and Antibodies
Colonic LPLs were stained as described previously (Lightfoot et al, 2014). Colonic LPLs were stained with LIVE/DEAD Aqua Dead Cell Stain Kit (Molecular Probes, Life Technologies). Washed cells were incubated with Mouse Fc Blocking Reagent (Miltenyi Biotec, Auburn, CA) per the manufacturer's instructions before staining with combinations of the following antibodies or their corresponding isotype controls: CD45 (30-F11), CDl lc (N418), CDl lb (Ml/70), CDl lb (Ml/70), F4/80 (BM8), GR1 (RB6-8C5), I-A/I-E MHCII (2G9), CD3 (145-2C11), CD4 (RM4-5), CD8 (53-607), Pro-IL-Ιβ (NJTEN3)/Rat IgGl, κ, IFNy (XMG1.2)/Rat IgGl, κ, IL-17A (TCI 1-18H10.1)/Rat IgGl, κ, IL-10 (JES5-16E3)/Rat IgG2b, K, LAP (TGF-βΙ, TW7-16B4)/Mouse IgGl, κ, FoxP3 (FJK-16A)/Rat IgG2a, κ, RORyt (AFKJS-9)/Rat IgG2a, κ. For the detection of intracellular cytokines, cells were fixed and permeabilized with BD Cytofix/Cytoperm (BD Biosciences). Colonic T cells were stimulated with phorbol 12-myristate 13 -acetate (PMA) (50 ng/mL) and ionomycin (2.5 μg/mL) in the presence of Brefeldin A (Biolegend) for 2.5 h. The Transcription Factor Fixation/Permeabilization kit from eBioscience was used for FoxP3 staining. After staining, a BD LSRFortessa (BD Biosciences) cell analyzer was used to acquire fixed cells. Data were analyzed with Flow Jo software (Tree Star, Ashland, OR).
Antibodies and their corresponding isotype controls were purchased from eBioscience (San Diego, CA), Biolegend (San Diego, CA), BD Pharmingen, or R&D Systems (Minneapolis, MN).
T cell-Induced Colitis
In preparation for the adoptive transfer of CD45RBhi CD4+ T cells into Rag1-/- mice, spleen and mesenteric lymph node (MLN) single cell suspensions obtained from healthy B6 mice were pooled and incubated in AffiniPure Goat Anti-Mouse IgG (H+L)-coated cell culture plates (Jackson ImmunoResearch Laboratories, Inc., West Grove, PA) at 37°C for 1 h. CD4+ T cells were isolated from non-adherent cells using the CD4+ T cell Isolation Kit II (MACS, Miltenyi Biotec, San Diego, CA), and CD25+ CD4+ T cells were then depleted by positive selection (MACS, Miltenyi Biotec). Bound CD25+ CD4+ T cells were collected and injected into the regulatory T cells (Tregs) group. The resulting cell suspensions after negative and positive selection was consistently comprised of >98% CD25- CD45RBhi CD4+ T cells. Rag1-/- mice were orally gavaged once with NCK56, NCK2187, or SlpA prior to the adoptive transfer of T cells by intraperitoneal injection (i.p.). One day later, the mice were orally gavaged once more, and once a week for 4 consecutive weeks thereafter (Fig. 3A). Colitis progression was monitored by determining mouse weight loss, diarrhea development, and fecal occult blood (FOB) presence throughout the study. Stool consistency was scored as follows: 0 = normal, 2 = pasty, 4 = watery with perianal staining. DSS-Induced Colitis
WT and Signr3-/- mice were treated with 3% DSS in the drinking water for 5 days (made fresh every 2-3 days) to induce colitis. Mice were monitored for disease progression through day 10 after treatment as described above. For prevention studies, mice were orally gavaged with NCK56, NCK2187, or SlpA at days -3 and -1, then every other day after 3% DSS treatment, for a total of 5 gavages (2 before, and 3 after 3% DSS).
Histopathology Colitis scores in T cell- and DSS-induced colitis were determined by histopathology. Tissues were fixed, sectioned, and stained with hematoxylin and eosin (Histology Tech Services, Gainesville, FL). Stained sections were analyzed blindly by a boarded veterinary pathologist. Colitis was graded based on 7 parameters (0-17) as previously described (Cheng et al., 2014).
FITC-Dextran Intestinal Permeability Assay
Passive transepithelial absorption of FITC-labeled dextran (Sigma-Aldrich) in vivo was used to determine intestinal barrier function as previously described (Napolitano et al, 1996). Mice were gavaged with FITC-dextran, MW 4,000 (60 mg/100 g body weight). Blood was collected retro-orbitally after proper anesthetization; mice were sacrificed after blood collection. Fluorescence intensity in the serum was measured with a fluorimeter (485 nm excitation, 519 nm emission). FITC-dextran concentrations in the mouse sera were determined from standard curves generated by serial dilution of FITC-dextran using blank subtraction in the test samples using sera from mice that were not gavaged with the permeability tracer.
Colonoscopy of DSS- and T cell-Induced Colitis Mice
Macroscopic damage in the colons of Rag1-/- , WT, and Signr3-/- mice was visualized with a Multi-Purpose Rigid Telescope attached to a TELE PACK X (Karl Storz- Endoscope, Germany). Mice were fasted for 2-4 h, and subsequently the colons of the living subjects were imaged under appropriate anesthetic conditions.
Real-time PCR and 16S Ribosomal DNA Sequencing
Colonic tissues from Rag1-/- , WT, and Signr3-/- mice were isolated and processed for changes in gene expression as previously described (Lightfoot et al, 2014). Microbiome analyses were performed on the Illumina Miseq (Illumina, Inc., San Diego) as outlined previously (Lightfoot et al, 2014). Primers used, as well as their sequences, are listed in the Table 1 below showing the list of primer sequences for Real-Time PCR analyses.
Figure imgf000025_0001
Figure imgf000026_0001
SIGNR1 and SIGNR3 Binding Assays C-type lectin receptors, SIGNRl and SIGNR3, were fused to the Fc part of human IgGl (SIGNRl-hFc and SIGNR3-hFc) as previously described (Eriksson et al, 2013). Briefly, the extracellular regions of murine SIGNRl and SIGNR3 were amplified and ligated into the expression vector pFUSE-hIgGl-Fc2 (Invivogen, Toulouse, France) for expression in CHO-S cells. Expression in CHO cells was driven by an hEFl-HTLV promoter and secretion into the culture supernatant was mediated by an external IL2 signal sequence (IL2ss). Binding of SlpA-coated beads (Dynabeads MyOne Carboxylic Acid, Life Technologies) to fusion proteins was analyzed by flow cytometry.
Statistical Analyses
Representative data indicate mean ± SEM. Significance was determined by two-tailed unpaired t-tests for two group comparisons (GraphPad Prism v6.0d for Mac OS X, La Jolla, CA). Statistical significance for differences in weight loss, diarrhea score, and FOB score was calculated using multiple unpaired t-tests correcting for multiple comparisons with the Holm- Sidak method in Prism v6.0d.
All patents, patent applications, provisional applications, and publications referred to or cited herein are incorporated by reference in their entirety, including all figures and tables, to the extent they are not inconsistent with the explicit teachings of this specification.
Following are examples which illustrate procedures for practicing the invention. These examples should not be construed as limiting. All percentages are by weight and all solvent mixture proportions are by volume unless otherwise noted.
EXAMPLE 1 - NCK2187 PROMOTES INTESTINAL IMMUNE REGULATION IN
STEADY-STATE
Transient colonization of the colon with NCK2025 (LTA ) significantly mitigated chemical and T cell-mediated colitis (Mohamadzadeh et al., 2011). Additionally, NCK2025 significantly abated inflammation-promoting polyposis in Apclox458x TS4-Cre mouse model, where protection correlated with the regulation of innate and T cell-induced inflammation (Khazaie et al., 2012). Thus, the controlled inflammation may result from the crosstalk between NCK2025-SlpA and intestinal cells. To test this hypothesis, the upp- counterselective gene replacement strategy was used to generate in-frame deletions in the slpB and slpX genes of NCK2030. The LTA derivative was created by a deletion of the phosphoglycerol transferase gene (Mohamadzadeh et al., 2011) in NCK2030, resulting in NCK2187, which expresses only SlpA (Fig. 1A-C).
To demonstrate that the newly generated NCK2187 transiently colonizes the gut, the clearance kinetics of both the erythromycin-resistant NCK56 and NCK2187 strains were determined in C57BL/6 (B6) mice that were orally treated once with 109 CFU/mouse. Data show that mice cleared both NCK56 and NCK2187 after 3 days, indicating that the deletion of LTA, SlpB, and SlpX in NCK2187 did not alter its transient passage through the GI tract when compared to its WT parent (Fig. ID).
To investigate the activation of colonic DCs when co-cultured with NCK56 or NCK2187, colonic cells were obtained from na'ive B6 mice. While such intestinal cell- bacterial co-cultures did not significantly change the expression of DC costimulatory molecules (e.g., CD40) (not shown) or IL-10, only NCK56 elevated the levels of IL-Ιβ, IL-6, IL-12, and TNF-a (Fig. IE).
Next, naive mice were orally gavaged with NCK56 or NCK2187 and colonic immune responses analyzed. Treatment with NCK2187 significantly increased the frequency of colonic FoxP3+ Tregs when compared to both untreated (PBS) and NCK56-treated mice (Fig. 2A). Moreover, IL-17A+ and IFNy+ CD4+ T cells were significantly reduced by NCK2187 treatment (Fig. 2A). NCK2187-treated FoxP3-GFP mice also exhibited higher numbers of colonic IL-10+ TGF-βi+ Tregs than NCK56-treated and untreated mice (Fig. 2B, 2C). Collectively, oral treatment with this novel L. acidophilus strain induced colonic regulatory immune responses.
EXAMPLE 2 - PROTECTIVE PROPERTY OF NCK2187 AND ITS SLPA AGAINST
INFLAMMATION AND DYSBIOSIS
To elucidate the consequences of the immunoregulatory responses observed above during inflammation, Rag1-/- mice adoptively transferred with CD45RBhi CD4+ T cells were orally treated with NCK56, NCK2187, its purified SlpA, or PBS (Fig. 3 A). Untreated (PBS) and NCK56-treated mice with adoptively transferred T cells developed severe colitis as demonstrated by weight loss, bloody diarrhea, shortening of the colon, and increased damage of the colon (Fig. 3A-C, Fig. 8A). Furthermore, the levels of systemically induced proinflammatory IL-Ιβ, IL-6, TNF-a, IFNy, G-CSF, and MIP-Ια were significantly enhanced in the sera of these groups of mice (Fig. 3D). In contrast, similar to the Treg co-transferred mice, NCK2187 and its purified SlpA significantly protected Ragl mice from T cell- induced colitis (Tables 2-4).
Table 2. Statistical analysis of weight loss curves in T cell-induced colitis.
Figure imgf000029_0001
Table 3. Statistical analysis of diarrhea score curves in T cell-induced colitis.
Figure imgf000029_0002
Table 4. Statistical analysis of fecal occult blood (FOB) score curves in T cell induced colitis.
Figure imgf000030_0001
NCK2187- and SlpA-treated mice gained weight throughout the course of the study and did not develop significant bloody diarrhea in the way that the PBS and NCK56 groups did (Fig. 3A). Furthermore, cecal and colonic atrophy due to pathogenic inflammation was not observed in these mice, as the tissue destruction and immune cell infiltration associated with T cell-induced colitis were significantly abrogated in NCK2187 and SlpA treated groups (Fig. 3B and 3C). Accordingly, systemic inflammation was significantly reduced in these groups of mice (Fig. 3D).
The genes encoding the receptors for LTB4, Ltb4rl and Ltb4r2 were significantly down-regulated in the colons of NCK2187- and SlpA-treated mice (Fig. 8B), which may have contributed to the reduced expression of colonic Illb (Fig. 8B).
T cell-induced colitis resulted in intestinal epithelial erosions and ulcerations in mice that did not receive NCK2187 or purified SlpA (Fig. 3C). Indeed, the colonic expression of tight junction associated genes was significantly downregulated in PBS- and NCK56-treated Rag1-/- mice (Fig. 4A).
Furthermore, FITC-dextran permeability assays confirmed that these mice were suffering from a dysfunctional intestinal barrier (Fig. 4A). Accordingly, NCK2187 and SlpA significantly protected barrier integrity and function (Fig. 4A). An immunologically and anatomically weakened intestinal epithelial barrier during acute intestinal inflammation allows luminal bacteria to interact with the intestinal mucosae and the infiltrating immune cells, initiating inflammatory responses directed against the gut commensals and introducing dysbiosis. To elucidate the status and composition of the microbiota in the T cell-induced colitis model (week 7), we analyzed the microbial communities in the colons of the different experimental groups and found that the severity of colitis was associated with significant changes in the microbiota (Fig. 4B-D, Table 5). UniFrac analyses revealed that fecal bacterial diversity in PBS- and NCK56 treated Rag1 -/- mice was modified in such a way that these groups were found to cluster separately from each other and from the protected mice (Fig. 4B). Conversely, SlpA-, NCK2187-, and Treg-treated groups clustered together and showed similar phyla distributions (Fig. 4B and 4C). Induced colitis in PBS- and NCK56-treated groups resulted in a significant contraction of members of the Bacteroidetes phyla (Fig. 4C). Additionally, the normally underrepresented Verrucomicrobia phyla was increased in these colitogenic mice (Fig. 4C), suggesting a shift in the intestinal milieu and the substrates available in the inflamed colon, which may promote previously underrepresented microbial communities so that they dominate the population. Alterations in the microbial composition were also manifested at lower taxonomic levels: NCK2187-, SlpA-, and Treg-treated groups once again showed similar relative abundance and distribution of several unclassified genera (Fig. 4D). Table 5. Analysis of phyla distribution in the fecal microbiota after T cell-induced colitis.
Figure imgf000031_0001
EXAMPLE 3 - L. ACIDOPHILUS-SLPA BINDING TO SIGNR3 PROMOTES COLONIC REGULATORY IMMUNE RESPONSES
Symbiotic bacteria and their gene products dictate the nature of innate responses via their sensing receptors (Ivanov and Honda, 2012; Yang et al, 2014); however such stimulatory signals must be regulated by other receptors to avoid intestinal inflammation. As previously stated, SIGNR3 exhibits the most biochemical similarity to human DC-SIGN. We screened all known murine SIGNR1-8 and found that Signrl and Signr3 genes are differentially activated in the colonic tissue of mice orally treated with NCK2187 (Fig. 5 A), prompting us to evaluate the binding of SlpA to SIGNR1 and SIGNR3.
Subsequently, the corresponding extracellular domain of SIGNR1 and SIGNR3 were fused to the Fc portion of human IgGi (SIGNRl-hFc, SIGNR3-hFc) and then transiently expressed in Chinese hamster ovary (CHO)-S cells (data not shown). Data demonstrate that while expressed SIGNR3-hFc bound to purified SlpA coated onto charged beads, SIGNRl- hFc, DCAR-hFc (control protein), hFc, and the secondary rat anti-human Fc antibody alone did not, suggesting SlpA-binding specificity to SIGNR3 (Fig. 5B).
To clarify the role of SlpA:SIGNR3 binding and signaling in vivo, we first orally treated WT and Signr3-/- mice with our bacterial strains and analyzed the immunologic responses induced in steady-state. While NCK2187 treatment led to reduced IL-Ιβ in both conventional (data not shown) and germ-free (GF) B6 mice (Fig. 5C, left), no antiinflammatory effects were observed in NCK2187-treated Signr3-/- mice (Fig. 5C, right). Furthermore, the Treg-inducing properties of NCK2187 (Fig. 2A and 2B) were abrogated in Signr3-/-mice (Fig. 5D). These data strongly suggest that NCK2187 delivers immunoregulatory signals via its interaction with SIGNR3.
EXAMPLE 4 - NCK2187 AND ITS SLPA CANNOT PREVENT DEXTRAN SULFATE SODIUM (DSS) INDUCED COLITIS IN THE ABSENCE OF SIGNR3 SIGNALING
Previous reports have highlighted the role of specific CLRs in experimental colitis. For instance, mice lacking Signrl expression are less susceptible to induced colitis (Saunders et al., 2010), while mice deficient in Dectinl and Signr3 exhibit exacerbated disease (Eriksson et al, 2013; Iliev et al, 2012). To further investigate SlpA:SIGNR3 signaling in disease conditions, DSS-treated WT and Signr3-/- mice were orally gavaged with NCK56, NCK2187, or SlpA, and monitored for disease progression. Consistent with the T cell-induced colitis model, disease progression and severity were significantly reduced in WT mice orally treated with NCK2187 or purified SlpA (Fig. 6 and Table 6); however, NCK2187 and SlpA did not confer any protection in Signr3-/- mice (Fig. 6). Measurements included weight loss, histopathology-based colitis scores, evaluation of gross mucosal damage, and immune cell recruitment and activation (Figs. 6 and 7).
Disease progression and inflammation were associated with alterations in intestinal barrier integrity and the composition of the gut microbiota (Figs. 6E-6H). Several gut permeability markers were evaluated by RT-PCR. The restoration of claudins (Cldnl, Cldn3, and Cldn5) in WT mice treated with NCK2187 or SlpA, indicate that NCK2187 and SlpA were capable of promoting intercellular tight junctions (Fig. 6E).
Accordingly, only NCK2187 and SlpA treatments of WT mice prevented increased fecal albumin levels seen with protein-losing enteropathies after DSS treatment (Fig. 6F). On the other hand, no positive effects by NCK2187 or SlpA on barrier integrity were noted in Signr3-/- mice (data not shown). In terms of microbiota composition, protected WT mice (NCK2187- and SlpA-treated) clustered together in UniFrac analyses, while diseased untreated and NCK56-treated WT mice clustered separately (Fig. 6G).
Conversely, the microbial communities of all DSS-treated Signr3-/- mice formed a single cluster, indicating that dysbiosis was uniformly distributed independent of treatment group (Fig. 6G). Furthermore, richness and diversity, analyzed by the Chao Richness index and Shannon Diversity index, respectively, were maintained in NCK2187- and SlpA-treated WT mice, while no such effects could be observed in Signr3-/- mice (Fig. 6H).
Table 6. Statistical analysis of weight loss curves in DSS-induced colitis in WT mice.
Figure imgf000034_0001
Induced immune responses in the colons of DSS-treated mice were analyzed to determine differences, if any, among the treatment groups. Neutrophilic infiltration in the colons of NCK2187- and SlpA-treated SIGNR3 -sufficient mice that were given DSS decreased to nearly PBS-treated control mice levels; while, in contrast, an even higher frequency of infiltrating neutrophils was detected in Signr3-/- mice after the induction of colitis, irrespective of the treatment group analyzed (Fig. 7A). Similarly, the number of IL- Ιβ-producing DCs and macrophages was significantly decreased with NCK2187 and SlpA treatment in WT mice; however, no changes were observed among the different treatment groups in the absence of SlpA:SIGNR3 signaling (Fig. 7B).
Pathogenic inflammation can result in proinflammatory FoxP3 RORyt+ Tregs (Hovhannisyan et al., 2011; Khazaie et al., 2012). While no major change in the total number of FoxP3+ Tregs was measured among the WT and Signr3-/- KO groups, the quality of these Tregs was significantly altered. A large number of FoxP3+ cells co-expressed RORyt after DSS treatment in both WT and Signr3-/- mice (Fig. 7C). However, in accordance with the protection observed, NCK2187 and SlpA treatment prevented the generation of FoxP3+ RORyt+ Tregs only in WT mice but not Signr3-/- mice (Fig. 7C). Correspondingly, the levels of circulating cytokines in the sera (IL-Ιβ, IL-10, IL-17A, IFNy and TNF-a) were rebalanced only in NCK2187- and SlpA-treated WT mice but not in Signr3-/- mice (Fig. 9).
Collectively, these clinical and immunologic data provide robust evidence in support of an immunoregulatory role for L. acidophilus SlpA that is highly dependent on intact SIGNR3 signaling.
EXAMPLE 5 - EFFECTIVE DOSE FOR PREVENTION OF DSS-INDUCED COLITIS BY L. ACIDOPHILUS SLPA
To test the required dose of purified SlpA for efficacy in the prevention of colitis, DSS-induced colitis model was employed. 6 oral treatments with 150μg SlpA/mouse, and only 4 oral gavages of 109 CFU NCK2187 were sufficient to prevent weight loss in mice given 3% DSS in the drinking water for 5 days (Fig. 11 A). See Fig. 10A for graphical summary of the treatment regimen. For the DSS-induced colitis prevention studies, age and sex-matched C57BL/6 mice were gavaged twice with NCK56 (WT), NCK2187, or purified SlpA, prior to being given 3% DSS in the drinking water. At the start of the treatment, the mice were gavaged twice more with the different bacterial strains or 4 more times with SlpA to compensate for the ability of NCK56 and NCK2187 to persist in these animals for 3 days post-gavage (Fig. ID). Mice treated with NCK2187 or SlpA developed only a mild form of colitis and recovered significantly faster than DSS-alone or NCK56-treated mice (Fig. 11). Collectively, these data suggest that NCK2187 and SlpA are suitable treatments for the prevention of colitis.
EXAMPLE 6 - REVERSAL OF DSS-INDUCED COLITIS BY ACIDOPHILUS
SLPA
Having tested the protective capacity of L. acidophilus SlpA, its ability to ameliorate established colitis was tested. For these studies, mice were orally gavaged with varying bacteria strains or purified SlpA once signs of colitis were noted, i.e., diarrhea and fecal occult blood (see Fig. 10B for treatment regimen). Mice receiving either NCK2187 or SlpA recovered significantly faster than NCK56-treated or DSS-alone treated mice (Fig. 12). These results indicate that NCK2187 and SlpA are efficacious in ameliorating existing colitis. EXAMPLE 7 - PREVENTION OF T CELL-INDUCED COLITIS BY L. ACIDOPHILUS SLPA
The regulatory effects of L. acidophilus SlpA in a chronic inflammatory model of colitis, namely, the pathogenic T cell transfer model was tested. Immunodeficient Ragl-/- mice were injected with regulatory T cell (Treg)-depleted CD4+ splenic cells (CD4+CD25~), then left untreated or gavaged with NCK56, NCK2187, or purified SlpA (15(^g/mouse), and monitored for the onset of colitis. Recipient mice were gavaged twice with their corresponding treatments at days 1 and 3 after the transfer, then once a week for the next 4 weeks, for a total of 6 gavages. An additional group receiving Tregs was used as a positive control for the prevention of colitis. Oral treatment with 109 CFU NCK2187 was as effective as the Tregs in the prevention of weight loss in recipient Ragl -/- mice (Fig. 13 A). Purified SlpA was also found to be protective in recipient Ragl -/- mice (Fig. 13); however, given the chronic nature of the model, a higher dose of SlpA may be needed to reach the level of protection observed with NCK2187.
EXAMPLE 8 - NCK2187 PROMOTES THE GENERATION OF FoxP3+ REGULATORY T CELLS (TREGS)
To gain a better understanding of the protective mechanisms induced by L. acidophilus SlpA that may explain the aforementioned protection, we orally gavaged healthy control mice with either NCK56 or NCK2187, and analyzed the frequency of Tregs locally and systemically. Compared to untreated or NCK56 treated mice, NCK2187 induced the generation of Tregs (Fig. 14). Taken together, these data suggest that L. acidophilus SlpA triggers important regulatory signaling cascades that may enable the restoration of intestinal homeostasis in experimental models of colitis.
EXAMPLE 9 -
The human GI tract harbors trillions of microbes, most of which are bacteria (Qin et al., 2010), and are critical determinants to the health of the host (Nicholson et al., 2012; Subramanian et al., 2014). This is especially true in the case of IBD, given the intimate association of the gut microbiota and their gene products with the adjacent colonic tissue (Hold et al, 2014; Huttenhower et al, 2014). Early experiments suggest that susceptibility to pathogenic intestinal inflammation in experimental colitis depends upon the presence of enteric antigens (Kuhn et al, 1993), and were later supported by human studies, which demonstrated that an imbalance in the commensal bacterial composition, termed dysbiosis, is a defining characteristic of patients suffering from IBD (Frank et al., 2007; Sokol et al., 2006). Accordingly, a major focus in the field has been the identification of effector bacterial strains that influence the immune system (Ahern et al, 2014), and thus, may be employed to reprogram undesired immune responses, both locally and systemically.
Search for microbes with immunoregulatory properties at the strain level and not merely at the species level is warranted. Certain embodiments of the current invention identify specific bacterial molecule-host receptor interactions that may account for the responses induced by effector bacterial strains. For example, oral treatment using a L. acidophilus strain lacking the gene responsible for LTA biosynthesis significantly reduced pathogenic inflammation in the GI tract, thereby promoting the mitigation of induced colitis (Mohamadzadeh et al, 2011) and the ablation of colonic polyposis (Khazaie et al., 2012). The bacteria lacking LTA and their uses are described in US Patent Application Publication 20130224153, the contents of which are incorporated by reference herein in its entirety. However, a need still remains for identifying other bacterial strains and/or agents useful for treatment of inflammatory diseases, such as colitis or inflammatory bowel disease.
To address this need, the current invention provides bacteria with systematically deleted genes for the construction of novel bacterial strains, for example, NCK2187, and the assignment of roles to sip candidate genes that are responsible for SlpA, SlpB, and SlpX protein expression (Goh et al., 2009). This molecular approach to targeting genes in L. acidophilus defined the functional role of SlpA and demonstrated that SlpA affects intestinal innate cells and conventional T cell subset activation, including Tregs, in steady-state and murine colitis models.
As seen in Figures 3 and 4, NCK2187 and purified SlpA not only mitigated T cell- induced colitis by significantly reducing inflammation, but also protected the composition of the microbiota and intestinal barrier function. Additionally, systemic immune responses were also altered, whereupon the levels of proinflammatory cytokines, including IL-Ιβ, whose detrimental role in IBD was recently demonstrated (Coccia et al., 2012), decreased significantly. These data suggests the involvement of the IL-Ιβ signaling axis in intestinal protection. Accordingly, gene-screening results, along with SlpA binding to SIGNR3, highlight the involvement of SIGNR3 in the process of tempering highly activated gut immune responses. Additional data regarding SIGNR3 engagement using Signr3-/- mice clarified the role of this signaling molecule in induced immune regulation, as was also documented in the Leishmania infantum murine model (Lefevre et al, 2013).
These data reflect that the SlpA:SIGNR3 interaction significantly reduces the high affinity receptors for LTB4 in T cell transferred RagF-/- mice. Downregulation of LTB4 and/or its receptors is critical in preventing inf ammasome activation, which otherwise results in increased IL-Ιβ (Lefevre et al., 2013). Interestingly, interrupting the interaction between SlpA and SIGNR3 resulted in hyperactive immunity and the production of IL-Ιβ in SignrS-/- mice under inflammatory conditions. Such dysregulated immune responses in Signr3-/- mice promoted neutrophil infiltration and significantly affected the function of colonic Tregs, which reverted toward proinflammatory FoxP3+ RORyt+ Tregs, all of which significantly contributed to pathologic inflammation, a condition seen in IBD progression.
In contrast, balanced immunity was restored in WT mice that were treated with NCK2187 or SlpA. Induced colonic inflammation in WT mice that were treated with NCK56, but not in NCK2187- or SlpA-treated mice, and in KO mice, regardless of treatment, resulted in microbial dysbiosis and barrier dysfunction, another hallmark of IBD.
As such, the current invention indicates that the interaction of SlpA with SIGNR3 can impact the status of innate and T cell polarization in induced colitis. Also, effective modulation of these cellular and molecular factors may significantly modify pathogenic inflammation that results in colitis, and would therefore restore intestinal homeostasis by rebalancing deteriorated immunity, the composition of the gut microbiota, and mucosal barrier function.
EXAMPLE 10 - A PROCESS FOR ISOLATOIN AND PURIFICATOIN OF SLPA FROM
LACTOBACILLUS ACIDOPHILUS
It is estimated that over 1 million individuals in the U.S. suffer from IBD (Kappelman et al, 2007; Kappelman et al, 2013). Additionally, ample evidence indicates that dysfunctional immune responses are potentially elicited by gut dysbiosis (Major et al, 2014). To specifically determine the effects of SlpA and its binding to SIGNR3 on intestinal cells and the consequences thereafter, the upp counter-selective knockout strategy (Mohamadzadeh et al, 2011a) was used to generate a new strain of L. acidophilus, called NCK2187, which expresses only SlpA Our data show that SlpA plays a critical role in controlling immune responses upon its interaction with SIGNR3, resulting in the diminution of induced colitis, protection of intestinal barrier integrity, and sustenance of the gut bacterial composition. To build upon these observations, we have optimized the purification of SlpA to investigate its physiological effects when orally administrated to mice, and evaluated whether this protein could resist the harsh condition of the gastrointestinal milieu, both important factors that may facilitate the feasibility of potential clinical trials.
Isolation and Detection of L. acidophilus Surface Layer Protein A
S-layers are paracrystalline (glyco) protein arrays that are present in abundance on the cell surface of a subset of eubacteria and archaea. We first sought to improve the process of SlpA isolation and purification. For this purpose, we used sodium chloride (NaCl) (5 M) as discussed in the Materials and Methods section. To avoid non-SlpA protein contamination in our isolation, we employed the LTA-, SlpB-, and SlpX-deficient L. acidophilus NCK2187 strain. Visualization of the isolated protein by SDS-PAGE showed a single protein band of the expected size (46 kDa, Fig. 15 A). An automated mass spectrometry microbial identification system that uses Matrix Assisted Laser Desorption Ionization Time-of-Flight technology (MALDI-TOF) indicated 97 unique spectra and 55 unique peptides generated post-trypsinization of the protein isolate, which identified two possible proteins [gi|58336516 (SlpA) and gi|362076610 (SlpB)] (Fig. 15B). Further analyses revealed that the peptides generated cover 54% of SlpA and 18% of SlpB (highlighted, Fig. 15C). However, the coverage region of SlpB is shared between SlpA and SlpB (red box, Fig. 15C), and no single unique peptide from SlpB was identified. MALDI-TOF data were analyzed on Scaffoldl (Searle, 2010).26 Therefore, mass spectrometry and SDS-PAGE analyses clearly demonstrated that the identity of the purified SlpA protein was retained whether purified by NaCl or by LiCl (Fig. 15).
To assess potential toxicity of the isolated SlpA, groups of C57BL/6 mice were then orally gavaged with SlpA (0, 150, 300, 600 μg/100μL per mouse) every other day for a total of four times. Subsequently, the blood chemistry profiles of these animals were analyzed. Obtained data demonstrated that oral treatment of the mice with varying doses of SlpA did not significantly alter whole blood biochemical values in these animals (Fig. 16). Changes in enzyme activity or concentration of other anaiytes in the blood were used as metrics of tissue damage or physiologic stress. Various parameters were measured, including total protein and albumin; the concentration of globulins is a calculation based on the aforementioned measurements (Fig. 16A). Function of the urinary system was evaluated by measuring blood levels of urea nitrogen (BUN) and creatinine, which are normally excreted by the kidneys (Fig. 16B). Any evidence of hepatocyte injury was assessed by measuring the activity of the hepatocellular leakage enzyme, alanine aminotransferase (ALT) (Fig. 16C). The production and activity of alkaline phosphatase (ALP), which is associated with biliary epithelial cells and canalicular membranes of cells in the liver (Center, 2007),27 can be seen with solubilization of hepatocyte membranes due to increased bile salts and release of membrane blebs with cellular injury (Fig. 16D) (Thrall et al, 2012).28 The electrolytes, sodium, potassium, calcium, and phosphorus, were also measured to gauge any changes in hydration status, excretional activity, or global cellular damage within the treated mice (Fig. 16E). No statistical differences were found in any of the parameters when comparing the controls and those mice receiving varying doses of SlpA administration, indicating no evidence of toxicity with oral treatment with SlpA in these animals.
We then elected to generate a specific monoclonal antibody against purified SlpA (Bergeron et al, 2009; Simrell et al, 1979).29, 30 Thus, groups of C57BL/6 mice were immunized with purified SlpA with L. gasseri as an adjuvant for 3 months (every week/100 μg of SlpA). Subsequently, spleen cells were derived to generate hybridoma cells producing monoclonal antibody (mAb) recognizing SlpA. As seen in Fig. 17, the antibody derived from one of our hybridoma cell clones, BM1, recognized SlpA by Western blot (Fig. 17A). Furthermore, this mAb also recognized SlpA on the surface of SlpA-coated beads, and on SlpA-pulsed RAW 264.7 macrophages (Figs. 17B-C, respectively). As we previously noted significant immunomodulatory effects by purified SlpA in the colon, these data suggested that SlpA dissolved in PBS may resist the hostile acidic milieu of the upper gastrointestinal tract and/or enzymatic degradation within the intestinal lumen. To verify this, we established an ELISA using the mAb, BM1, that can detect SlpA (Fig. 17D). Data clearly show that using this developed ELISA, SlpA can be detected in the fecal samples from mono-associated germ- free B6 mice (Fig. 17E), indicating that SlpA can potentially resist the harsh conditions of the gastrointestinal system. These data may be useful for initiating Phase I clinical trials using NaCl-purified SlpA to demonstrate its ability to potentially downregulate induced colonic inflammation in man. Concluding Remarks
To gain further insights into the physiological effects of SlpA, studies have been performed to elucidate the feasibility of Phase I clinical trials using this protein. It appears that SlpA using the newly employed purification method does not elicit potential toxicity when administered orally to animals, and that the structural epitope(s) of this bacterial protein can still be recognized by the mAb generated in our laboratory even after it is excreted through the feces. Nonetheless, further mechanistic studies, such as local and peripheral, targeted and untargeted metabolomics in treated animals, are required to demonstrate the role of SlpA on the host physiology, as well as its effects on other intestinal immune cells, including epithelial cells, colonic B cells, which mount critical humoral immune responses (e.g., IgA), and innate lymphoid cells (ILCs) in steady state and colonic disease.
It should be understood that the examples and embodiments described herein are for illustrative purposes only and that various modifications or changes in light thereof will be suggested to persons skilled in the art and are to be included within the spirit and purview of this application and the scope of the appended claims. In addition, any elements or limitations of any invention or embodiment thereof disclosed herein can be combined with any and/or all other elements or limitations (individually or in any combination) or any other invention or embodiment thereof disclosed herein, and all such combinations are contemplated with the scope of the invention without limitation thereto.
SEQ ID NO: 1 (Genbank Accession No. AAV42337.1)
1 MERTKSFFKW LTQTKLGFFT IVLVLFWLKT YYIYLTKFNL GAVGPMQQFL LLINPIPSGM
61 LLLGIGLFFK GRKSYWIILI IDFLLTLWLF SNILYYREFS NFLSFSIIKT SGSTSDNLGK
121 SIAGITLASD FLAFLDIAVI IALLATKVIK MDVRPLKLKV SLLIEFLALS LMGLNLLMAQ
181 KDRSGLLTRT FDNNYIVKYL GINEYAIYDG YKTAQTSAQM AKANVSDLKS VRNYLNANKV
241 KPNPEYTGVA KGKNVLVIHL ESFQQFLIGY KWKGKEVTPN LNKIYHQKDT ISFDNFFNQV
301 GQGKTSDAEM MLENSLYGLQ SGSAMSTYGT SNTFESAPAI LHQQAGYTTA VMHGGAGSFW
361 NRNNAYKSFG YQYFMPLSFY ENKPSYYIGY GLKDKIFFDQ SIKYIERLPQ PFYLKMITVT
421 NHYPYDIDKK NQSIAKTNTG DETVDGYVQT AHYLDQAIGE LMSWMKKTGL DKKTLIVFYG
481 DHYGISGNHH KASAQLLKKK SFNDFDNLQF QRVPLMFHMK GLKGGINHTY GGEIDVLPTL
541 LNLLGIKDSD TIQFGYDLLS KNAPQIVAQR NGDFITPEYS KVGSDYYYTK TGKRIKPNKK
601 LKAELTAISN TVTTQLSLSD RVINGNLLRF YRPKWFTKVK PKDYDYNKEP SLKRLFNDPS
661 KTSLWYQNHK KTTQKDFKTD APELKK
SEQ ID NO: 2 (Genbank Accession No. YP 193105)
1 MKKNLRIVSA AAAALLAVAP VAASAVSTVN AAAVNAIAVG GSATPLPNNS DVQISSSVAG
61 VTTKNGSSYT NGRISGSINA SYNGTSYSAN FSSSNAGVW STPGHTELSG EQINGLEPGS
121 AVTVTLRDGV SFNFGSTNAN KTITLAFPKN VSAAGLADAN KVSATSETSV DAGKTIQVKT
181 DKNGWSFGS AQVLNVKWE TSDVRAVSFY DIQTGKTVEN GTLSIVAGSN ARANVQEIVN
241 AFNAKYQASQ LNNANSNANV RLTDNNAQAV ATMLRAQNID VDAQGYFTAP ASLSLTFHAE
301 STQNNETAQL PVTVSVTNGK EVTPSTVDSV SKRIMHNAYY YDKDAKRVGT DSVKRYNSVS
361 VLPNTTTING KAYYQWENG KAVDKYINAA NIDGTKRTLK HNAYVYASSK KRANKWLKK
421 GEWTTYGAS YTFKNGQKYY KIGDNTDKTY VKVANFR
SEQ ID NO: 3 (Genbank Accession No. YP 193425)
1 MKKNRKMLGL AAATLLAVAP VATSWPVQA DTAVNVGSAA GTGANTTNTT TQAPQNKPYF
61 TYNNEI IGEA TQSNPLGNW RTTISFKSDD KVSDLISTIS KAVQFHKNNS ASGENVTINE
121 NDFINQLKAN GVTVKTVQPS NKNEKAYEAI DKVPSTSFNI TLSATGDNNQ TATIQIPMVP
181 QGASTPTDTT QNPQINWTKG GQAQSSSLNG QVFQVAVGSN FNPLNFTNSN GENI IVSAQQ
241 SKNNTTFASI EATSNPVNTS EAGRYYNVTL TATGNTGKKT TATYTVLITS SQKQTLYGNG
301 ESTISTYSIY GNNVLSNSTT FKDGDQVYVS DQTKTVGGVS YSQVSPKSKN DANSSNIWVK
361 TSALVKPAGD TNVKTYPVMV DSRAYDKNGN YLGHMYYAYD NIDIVPTWT INGKTYYKVA 421 NKDEYVRVTN ITGNQRTLKH NAYIYWSSYR RTPGTGKMYR GQTVTTYGPQ MKFKNGKKYY 481 RIEGCRNNNK RYIKAVNFY
SEQ ID NO: 4 (Genbank Accession No. P35829)
1 MKKNLRIVSA AAAALLAVAP VAASAVSTVS AATTINASSS AINTNTNAKY DVDVTPSVSA 61 VAANTANNTP AIAGNLTGTI SASYNGKTYT ANLKADTENA TITAAGSTTA VKPAELAAGV 121 AYTVTVNDVS FNFGSENAGK TVTLGSANSN VKFTGTNSDN QTETNVSTLK VKLDQNGVAS 181 LTNVSIANVY AINTTDNSNV NFYDVTSGAT VTNGAVSVNA DNQGQVNVAN WAAINSKYF 241 AAQYADKKLN TRTANTEDAI KAALKDQKID VNSVGYFKAP HTFTVNVKAT SNTNGKSATL 301 PVWTVPNVA EPTVASVSKR IMHNAYYYDK DAKRVGTDSV KRYNSVSVLP NTTTINGKTY 361 YQWENGKAV DKYINAANID GTKRTLKHNA YVYASSKKRA NKWLKKGEV VTTYGASYTF 421 KNGQKYYKIG DNTDKTYVKV ANFR
SEQ ID NO: 47 Uniprot Access Number C2HR60
AATTINASSSAINTNTNAKYDVDVTPSVSAVAAVAANTANNTPAIAGNLTGTI SASYNGK TYTANLKADTENATITAAGSTTAVKPAELAAGVAYTVTVNDVSFNFGSENAGKTVTLGSA NSNVKFTGTNSDNQTETNVSTLKVKLDQNGVASLTNVS IANVYAINTTDNSNVNFYDVTS GATVTNGAVSVNADNQGQVNVANVVAAINSKYFAAQYADKKLNTRTANTEDAIKAALKDQ KIDVNSVGYFKAPHTFTVNVKATSNTNGKSATLPVVVTVPNVAEPTVA SEQ ID NO: 48 Uniprot Access Number P35829
MKKNLRIVSAAAAALLAVAPVAASAVSTVSAATTINASSSAINTNTNAKYDVDVTPSVSA VAANTANNTPAIAGNLTGTI SASYNGKTYTANLKADTENATITAAGSTTAVKPAELAAGV AYTVTVNDVSFNFGSENAGKTVTLGSANSNVKFTGTNSDNQTETNVSTLKVKLDQNGVAS LTNVSIANVYAINTTDNSNVNFYDVTSGATVTNGAVSVNADNQGQVNVANVVAAINSKYF AAQYADKKLNTRTANTEDAIKAALKDQKIDVNSVGYFKAPHTFTVNVKATSNTNGKSATL PVVVTVPNVAEPTVASVSKRIMHNAYYYDKDAKRVGTDSVKRYNSVSVLPNTTTINGKTY YQVVENGKAVDKYINAANIDGTKRTLKHNAYVYASSKKRANKVVLKKGEVVTTYGASYTF KNGQKYYKIGDNTDKTYVKVANFR
SEQ ID NO: 49 Uniprot Access Number G1UE81
MFGGRKIMQSSLKKSLYLGLAALSFAGVAAVSTTASAKSYATAGAYTTLKTDATKRNVEA TGTNALYTKPGTVKGAKVVASKATMAKLASSKKSADYFRAYGVKTTNRGSVYYRVVSMDG KYRGYVYGGKSDTAFAGGIKSADTTTTATTPTRTTGYYLKDVSKNTLWTAPKNTQYKASK VSLYGVKSTDTFKVDSAATKTREGSLYYHVTDTQNTSVSGWIYAGKGYVAGATTQDLGGL SLTMSDAAATSDNSVKVVYRASGSQVGTATWVTAAAGTKAGATVGTTAVNAAGVKLADFV TNSLPSGYTTTGTVDTASATYGNTVYVDVTAAATSKVQLVADNVDNTASTTDNAVAGVLA NGAKLSSSDLSATLKEAGIKALTGTKGEAIGATNLATI SGAFDTAEINGSKTYYAANGDA YHYVFTYEPANFANDNRLATYGDTLTASFKAVLTKGAPSASSSNSSWIA
SEQ ID NO: 50 Uniprot Access Number Q9Z4J9
MKKNLRIVSAAAAALLAVAPVAASAVSVNAADNTVATTTNTANTVINADGTAINTPADAK YDVDVTPNLTATAASTVNGQTINGS ITGNITASYNGQSYTGTLDTKNGKVSVADSKGTAV TDFSKLTNGSYTVTVSGVSFNFGTANANKTITLGSKNSNVKFAGADGKFADTVKVELGQN GTLTTPI SVQVSNVNALDLSNANGVNFYNASNGSQVTKGSVNVTAGLIGRLNVSTVASEI
LKNCAAYQVSNGKPVSQLPDQKAVVADVNAALKAANI PVDNAGWFTAPI SLSVNVKASSS INGVGCYFTCTVNVANGKDMTVPSQSKTIMHNAYYYDKDAKRVGTDKLTRYNSVTVAMNT TTINGKAYYEVIENGKATGKFINADNIDGTKRTLKHNAYVYKTSKKRANKVTLKKGTEVT TYGGTYTFKNGKQYYKIGNNTDKTYVKASNF
SEQ ID NO: 51 Uniprot Access Number H6VTN4
MKKNLRIVSAAAAALLAVAPVAAAGVSSVTASS IEFVGSSNSSLLPEVNDHTVNFGINFN AIGAYGNVPSSVSATAEVTINGQKTTINLPENQKSYIYYATTNESVDASKLVAGQKYYTG INNASLNLGSPNHDKDITLEGSNVSFKTNDSDPYTKTLKVNTDKNGVI SNLS IKSANFDA VDVNNARTVSFYDADTGNIVTSGALEINAGPNAQMNVQTILAKFEQKYQAAQLNNAGTTN NVSYNNDLI STTPADLAAQLKKAGYSVDNNGYFTAKHSFTVNFSAKSGQNGYTTTMPVTV TVPNVAEETVPSQIRTVMHNAFFYDKNGKRVGSDKVTRYNSATVAMNTTTI IGKAYYEVI ENGKATGKFINAANIDGTKRTLKHNAYVYKSSKKRANKVVLKKGETVVTYGGAYTFKNGK QYYKIGNNTDKTYVKVANF
SEQ ID NO: 52 Uniprot Access Number Q09FM2
MKKNLRIVSAAAAALLAVAPVAASAVSVNAASSSAVQTATNIGTVLPLTDGSTVNVKPNI SLNTSAYEGVKANI SVSFSATVDGTTATSNFTPNASTIELWKNEKNKVTQVTYLQQVTSS NAGATYQVKMTQVGLNFGSQNANKKVTLTFPEGDMFKTADTSLAQSHEVKLDQNGTITLP EVVMNVTAKDFANPAVVNWYNTATNAVVSTGNIELFAGSDAGKMNVAQVVSATEKKYHAS NYGTKANQESSTI SYTNNLKDALKAMNVDVDAQGWFVAPKSFTFNMTAKANNNDASSTLA VTVSVPNGKDMTVPSQSKTVMHNAFFYDKNGKRVGSDKVTRYNSATVAMNTTTINGKAYY EVIENGKATGKFINAANIDGTKRTLKHNAYVYKSSKKRANKVVLKKGTEVVTYGGAYTFK NGKQYYKIGNNTDKTYVKVSNF SEQ ID NO: 53 Uniprot Access Number L7YE91
SVSESKDTVNVTPSFTLTSAI PAKGVPATLQGS IEASLNGTSVTADVADVAKDVTLTDGN KTVYSYNERENKVDNNLSAVEASKEYTMTLSGVGFSFGKANAGKTLTFKLPKNVKVNDTS NDVKVSLDQYGNATNLKFVI SNIKAYDSANTNAVSFYAAKSGLVATQGSYMTLADENGNL NVNTLLDKLKGKYEAMQFKDSKFETVNVNTTADDVKAELEKAGIKVDAANNFEAPDTFTV TLNAKSDVNGKTASLPVVVTVPNGKSTVVPSQSKTIMHNAYYYDKDAKRVGTDKVTRYNA VTVAMNTTKLANGI SYYEVIEN SEQ ID NO : 54 Uniprot Access Number K8DVK7
ADSAINANTNAKYDVDVTPS I SAIAAVAKSDTMPAI PGSLTGS I SASYNGKSYTANLPKD SGNATITDSNNNTVKPAKLEADKAYTVTVPDVSFNFGSENAGKVITIGSANPNVTFTKKT GDQPASTVKVTLDQDGVAKLSSVQIKNVYAIDTTYNSNVNFYDVTTGAIVTTGAVS IDAD NQGQLNITSVVAAINSKYFAAQYDKKQLTNDVTFDTETAVKDALKAQKIEVSSVGYFKAP HTFTVNVKATSNKNGKSATLPVTVTVPNVADPVVPSQSKTIMHNAYFYDKDAKRVGTDKV TRYNTVTVAMNTTKLANGI SYYEVIENGKA
SEQ ID NO: 55 Uniprot Access Number F0NUB7
MDHVSKGFVHYRLLSHAEPMAYYIFYI SRRKDHMKKNLRIVSAAAAALLAVAPVAATAMP VNAATTINADSAINANTNAKYDVDVTPS I SAIAKVTGSATI PGSLTGS I SASYNGKSYTA NLPKDSGNATIADKHGNPVKPADLEADKAYTVTVPDVSFNFGSENAGKEITIGSANQNVT FTTKDSQSGSTVSGSTVKVTLDQDGVAKLSSVQIKDVYAIDTTYNSNVNFYDVTTGAIVT TGAVS IDADNQGQLNTASVVAAI SSKYFAAQYADKNLTSDNVTYNIETAVKDALKAQKIE VSSVGYFKAPHTFTVNVKATSNKNGKSATLPVTVTVPNVADPVVPSQSKTIMHNAYFYDK DAKRVGTDKVTRYNTVTVAMNTTKLANGI SYYEVIENGKATGKYINADNIDGTKRTLKHN
AYVYKTSKKRANKVVLKKGTEVTTYGGSYKFKNGKKYYKIGADTKKTYVRVENFD
REFERENCES
Ahern, P.P., Faith, J.J., and Gordon, J.I. (2014). Mining the Human Gut Microbiota for Effector Strains that Shape the Immune System. Immunity 40, 815-823.
Atarashi, K., Tanoue, T., Oshima, K., Suda, W., Nagano, Y., Nishikawa, H., Fukuda, S., Saito, T., Narushima, S., Hase, K., et al. (2013). Treg induction by a rationally selected mixture of Clostridia strains from the human microbiota. Nature 500, 232- 236.
Avail- Jaaskelainen, S., Lindholm, A., Palva, A. (2003). Surface display of the receptor- binding region of the Lactobacillus brevis S-layer protein in Lactococcus lactis provides nonadhesive lactococci with the ability to adhere to intestinal epithelial cells. Appl Environ Microbiol; 69:2230-6.
Avail- Jaaskelainen, S., Palva, A. (2005). Lactobacillus surface layers and their applications.
FEMS Microbiol Rev; 29:511-29.
Belkaid, Y., Hand, T.W. (2014). Role of the microbiota in immunity and inflammation. Cell;
157: 121-41.
Bergeron, R.J., Bharti, N., Singh, S., McManis, J.S., Wiegand, J., Green, L.G. (2009).
Vibriobactin antibodies: a vaccine strategy. J Med Chem; 52:3801-13.
Center, S.A. (2007). Interpretation of liver enzymes. Vet Clin North Am Small Anim Pract;
37:297-333, vii.
Cheng, S.X., Lightfoot, Y.L., Yang, T., Zadeh, M., Tang, L., Sahay, B., Wang, G.P., Owen,
J.L., and Mohamadzadeh, M. (2014). Epithelial CaSR deficiency alters intestinal integrity and promotes proinflammatory immune responses. FEBS Lett.
Coccia, M., Harrison, O.J., Schiering, C, Asquith, M.J., Becher, B., Powrie, F., and Maloy, K.J. (2012). IL-Ιβ mediates chronic intestinal inflammation by promoting the accumulation of IL-17A secreting innate lymphoid cells and CD4(+) Thl7 cells. J
Exp Med 209, 1595-1609.
Ehlers, S. (2010). DC-SIGN and mannosylated surface structures of Mycobacterium tuberculosis: a deceptive liaison. Eur J Cell Biol 89, 95-101.
Engering, A., Geijtenbeek, T.B., and van Kooyk, Y. (2002). Immune escape through C-type lectins on dendritic cells. Trends Immunol 23, 480-485.
Eriksson, M., Johannssen, T., von Smolinski, D., Gruber, A.D., Seeberger, P.H., and
Lepenies, B. (2013). The C-Type Lectin Receptor SIGNR3 Binds to Fungi Present in Commensal Microbiota and Influences Immune Regulation in Experimental Colitis. Front Immunol 4, 196.
Frank, D.N., St Amand, A.L., Feldman, R.A., Boedeker, E.C., Harpaz, N., and Pace, N.R.
(2007). Molecular-phylogenetic characterization of microbial community imbalances in human inflammatory bowel diseases. Proc Natl Acad Sci U S A 104, 13780-13785.
Geremia, A., Biancheri, P., Allan, P., Corazza, G.R., and Di Sabatino, A. (2014). Innate and adaptive immunity in inflammatory bowel disease. Autoimmun Rev; 13:3-10.
Goh, Y.J., Azcarate-Peril, M.A., O'Flaherty, S., Durmaz, E., Valence, F., Jardin, J., Lortal, S., and Klaenhammer, T.R. (2009). Development and application of a upp-based counterselective gene replacement system for the study of the S-layer protein SlpX of Lactobacillus acidophilus NCFM. Appl Environ Microbiol 75, 3093-3105.
Hold, G.L., Smith, M., Grange, C, Watt, E.R., El-Omar, E.M., and Mukhopadhya, I. (2014).
Role of the gut microbiota in inflammatory bowel disease pathogenesis: what have we learnt in the past 10 years? World J Gastroenterol 20, 1192-1210.
Hovhannisyan, Z., Treatman, J., Littman, D.R., and Mayer, L. (2011). Characterization of interleukin-17-producing regulatory T cells in inflamed intestinal mucosa from patients with inflammatory bowel diseases. Gastroenterology 140, 957-965.
Huttenhower, C, Kostic, A.D., and Xavier, R.J. (2014). Inflammatory Bowel Disease as a Model for Translating the Microbiome. Immunity 40, 843-854.
Iliev, I.D., Funari, V.A., Taylor, K.D., Nguyen, Q., Reyes, C.N., Strom, S.P., Brown, J., Becker, C.A., Fleshner, P.R., Dubinsky, M., et al. (2012). Interactions between commensal fungi and the C-type lectin receptor Dectin-1 influence colitis. Science 336, 1314-1317.
Ivanov, I.I., and Honda, K. (2012). Intestinal commensal microbes as immune modulators.
Cell Host Microbe 12, 496-508.
Johnson, B., Selle, K., O'Flaherty, S., Goh, Y.J., and Klaenhammer, T. (2013). Identification of extracellular surface-layer associated proteins in Lactobacillus acidophilus NCFM.
Microbiology 159, 2269-2282.
Kappelman, M.D., Moore, K.R., Allen, J.K., Cook, S.F. (2013). Recent trends in the prevalence of Crohn's disease and ulcerative colitis in a commercially insured US population. Dig Dis Sci; 58:519-25.
Kappelman, M.D., Rifas-Shiman SL, Kleinman K, Ollendorf D, Bousvaros A, Grand RJ, et al. (2007). The prevalence and geographic distribution of Crohn's disease and ulcerative colitis in the United States. Clinical gastroenterology and hepatology : the official clinical practice journal of the American Gastroenterological Association; 5: 1424-9.
Khazaie, K., Zadeh, M., Khan, M.W., Bere, P., Gounari, F., Dennis, K., Blatner, N.R., Owen,
J.L., Klaenhammer, T.R., and Mohamadzadeh, M. (2012). Abating colon cancer polyposis by Lactobacillus acidophilus deficient in lipoteichoic acid. Proc Natl Acad
Sci USA 109, 10462-10467.
Konstantinov, S.R., Smidt, H., de Vos, W.M., Bruijns, S.C., Singh, S.K., Valence, F., Molle,
D., Lortal, S., Altermann, E., Klaenhammer, T.R., et al. (2008a). S layer protein A of
Lactobacillus acidophilus NCFM regulates immature dendritic cell and T cell functions. Proc Natl Acad Sci U S A 105, 19474-19479.
Konstantinov, S.R., Smidt, H., Akkermans, A.D., Casini, L., Trevisi. P., Mazzoni, M., et al
(2008b). Feeding of Lactobacillus sobrius reduces Escherichia coli F4 levels in the gut and promotes growth of infected piglets. FEMS Microbiol Ecol; 66:599-607 Khan, M.W., Zadeh, M., Bere, P., Gounaris, E., Owen, J., Klaenhammer, T., et al (2012).
Modulating intestinal immune responses by lipoteichoic acid-deficient Lactobacillus acidophilus . Immunotherapy; 4: 151-61.
Kuhn, R., Lohler, J., Rennick, D., Rajewsky, K., and Muller, W. (1993). Interleukin-10- deficient mice develop chronic enterocolitis. Cell 75, 263-274.
Lee, Y.K., Mazmanian, S.K. (2010). Has the microbiota played a critical role in the evolution of the adaptive immune system? Science; 330: 1768-73.
Lefevre, L., Lugo-Villarino, G., Meunier, E., Valentin, A., Olagnier, D., Authier, H., Duval,
C, Dardenne, C, Bernad, J., Lemesre, J.L., et al. (2013). The C-type lectin receptors dectin-1, MR, and SIGNR3 contribute both positively and negatively to the macrophage response to Leishmania infantum. Immunity 38, 1038-1049.
Ley, R.E., Peterson, D.A., and Gordon, J.I. (2006). Ecological and evolutionary forces shaping microbial diversity in the human intestine. Cell 124, 837-848.
Lightfoot, Y.L., Yang, T., Sahay, B., Mohamadzadeh, M. (2012). Targeting aberrant colon cancer-specific DNA methylation with lipoteichoic acid-deficient Lactobacillus acidophilus. Gut Microbes; 4.
Lightfoot, Y.L., and Mohamadzadeh, M. (2013). Tailoring gut immune responses with lipoteichoic aciddeficient Lactobacillus acidophilus. Front Immunol 4, 25. Lightfoot, Y.L., Yang, T., Sahay, B., Zadeh, M., Cheng, S.X., Wang, G.P., Owen, J.L., and Mohamadzadeh, M. (2014). Colonic Immune Suppression, Barrier Dysfunction, and Dysbiosis by Gastrointestinal Bacillus anthracis Infection. PLoS One 9, el00532.
Lightfoot YL, Selle K, Yang T, Goh YJ, Sahay B, Zadeh M, et al. (2015). SIGNR3- dependent immune regulation by Lactobacillus acidophilus surface layer protein A in colitis. EMBO J.; 34(7): 829-973.
Major, G., Spiller, R. (2014). Irritable bowel syndrome, inflammatory bowel disease and the microbiome. Curr Opin Endocrinol Diabetes Obes; 21 : 15-21.
Maslowski, K.M., and Mackay, C.R. (2011). Diet, gut microbiota and immune responses. Nat Immunol 12, 5-9.
McDermott, A.J., and Huffnagle, G.B. (2014). The microbiome and regulation of mucosal immunity. Immunology 142, 24-31.
Mohamadzadeh, M., Pfeiler, E.A., Brown, J.B., Zadeh, M., Gramarossa, M., Managlia, E.,
Bere, P., Sarraj, B., Khan, M.W., Pakanati, K.C., et al. (201 la). Regulation of induced colonic inflammation by Lactobacillus acidophilus deficient in lipoteichoic acid. Proc
Natl Acad Sci U S A 108 Suppl 1, 4623-4630.
Mohamadzadeh, M., Owen, J.L. (2011b). Reprogramming intestinal immunity is the answer to induced pathogenic inflammation. Immunotherapy; 3: 1415-7.
Napolitano, L.M., Koruda, M.J., Meyer, A.A., and Baker, C.C. (1996). The impact of femur fracture with associated soft tissue injury on immune function and intestinal permeability. Shock 5, 202-207.
Neurath, M.F. (2014). Cytokines in inflammatory bowel disease. Nat Rev Immunol 14, 329-
342.
Nicholson, J.K., Holmes, E., Kinross, J., Burcelin, R., Gibson, G., Jia, W., and Pettersson, S.
(2012). Host-gut microbiota metabolic interactions. Science 336, 1262-1267.
Osorio, F., and Reis e Sousa, C. (2011). Myeloid C-type lectin receptors in pathogen recognition and host defense. Immunity 34, 651-664.
Powlesland, A.S., Ward, E.M., Sadhu, S.K., Guo, Y., Taylor, M.E., and Drickamer, K.
(2006). Widely divergent biochemical properties of the complete set of mouse DC-
SIGN-related proteins. The Journal of biological chemistry 281, 20440-20449.
Qin, J., Li, R., Raes, J., Arumugam, M., Burgdorf, K.S., Manichanh, C, Nielsen, T., Pons,
N., Levenez, F., Yamada, T., et al. (2010). A human gut microbial gene catalogue established by metagenomic sequencing. Nature 464, 59-65. Saber, R., Zadeh, M., Pakanati, K.C., Bere, P., Klaenhammer, T., Mohamadzadeh, M. (2011).
Lipoteichoic acid-deficient Lactobacillus acidophilus regulates downstream signals.
Immunotherapy 2011; 3:337-47.
Sara, M., Sleytr, U.B. (2000). S -Layer proteins. J Bacteriol; 182:859-68.
Saunders, S.P., Barlow, J.L., Walsh, CM., Bellsoi, A., Smith, P., McKenzie, A.N., and
Fallon, P.G. (2010). C-type lectin SIGN-R1 has a role in experimental colitis and responsiveness to lipopolysaccharide. J Immunol 184, 2627-2637.
Searle BC. (2010). Scaffold: a bioinformatic tool for validating MS/MS-based proteomic studies. Proteomics; 10: 1265-9.
Simrell, C.R., Klein, P.A. (1979). Antibody responses of tumor-bearing mice to their own tumors captured and perpetuated as hybridomas. J Immunol; 123:2386-94.
Snelgrove, R.J., Jackson, P.L., Hardison, M.T., Noerager, B.D., Kinloch, A., Gaggar, A.,
Shastry, S., Rowe, S.M., Shim, Y.M., Hussell, T., et al. (2010). A critical role for
LTA4H in limiting chronic pulmonary neutrophilic inflammation. Science 330, 90-94. Sokol, FL, Seksik, P., Rigottier-Gois, L., Lay, C, Lepage, P., Podglajen, I., Marteau, P., and
Dore, J. (2006). Specificities of the fecal microbiota in inflammatory bowel disease.
Infiamm Bowel Dis 12, 106-111.
Subramanian, S., Huq, S., Yatsunenko, T., Haque, R., Mahfuz, M., Alam, M.A., Benezra, A.,
DeStefano, J., Meier, M.F., Muegge, B.D., et al. (2014). Persistent gut microbiota immaturity in malnourished Bangladeshi children. Nature 509, 417-421.
Tanne, A., Ma, B., Boudou, F., Tailleux, L., Botella, FL, Badell, E., Levillain, F., Taylor,
M.E., Drickamer, K., Nigou, J., et al. (2009). A murine DC-SIGN homologue contributes to early host defense against Mycobacterium tuberculosis. J Exp Med 206,
2205-2220.
Thrall, M.A., Weiser, G., Allison, R.W., Campbell, T.W., eds (2012). Veterinary Hematology and Clinical Chemistry. Ames, Iowa: Wiley-Blackwell.
Tobin, D.M., Vary, J.C., Jr., Ray, J.P., Walsh, G.S., Dunstan, S.J., Bang, N.D., Hagge, D.A.,
Khadge, S., King, M.C., Hawn, T.R., et al. (2010). The lta4h locus modulates susceptibility to mycobacterial infection in zebrafish and humans. Cell 140, 717-730. Underhill, D.M., Ozinsky, A. (2002). Toll-like receptors: key mediators of microbe detection.
Curr Opin Immunol; 14: 103-10.
van Kooyk, Y., and Geijtenbeek, T.B. (2003). DC-SIGN: escape mechanism for pathogens.
Nat Rev Immunol 3, 697-709. Varley, K.E., Mitra, R.D. (2010). Bisulfite Patch PCR enables multiplexed sequencing of promoter methylation across cancer samples. Genome Res; 20: 1279-87.
Weis, W.I., Taylor, M.E., Drickamer, K. (1998). The C-type lectin superfamily in the immune system. Immunol Rev; 163: 19-34.
Yang, T., Owen, J.L., Lightfoot, Y.L., Kladde, M.P., Mohamadzadeh, M. (2013). Microbiota impact on the epigenetic regulation of colorectal cancer. Trends Mol Med; 19:714-25. Yang, Y., Torchinsky, M.B., Gobert, M., Xiong, H., Xu, M., Linehan, J.L., Alonzo, F., Ng,
C, Chen, A., Lin, X., et al. (2014). Focused specificity of intestinal TH17 cells towards commensal bacterial antigens. Nature 510, 152-156.
Zadeh, M., Khan, M.W., Goh, Y.J., Selle, K., Owen, J.L., Klaenhammer, T., et al (2012).
Induction of intestinal proinflammatory immune responses by lipoteichoic acid. J
Inflamm (Lond); 9:7.

Claims

CLAIMS We claim:
1. An isolated bacterial SlpA protein or a non-naturally occurring protein derivative thereof.
2. The isolated bacterial SlpA protein of claim 1, wherein the protein has the amino acid sequence of SEQ ID NO: 4 or 47-55 or the protein has the amino acid sequence at least 95% identical to the sequence of SEQ ID NO: 4 or 47-55.
3. The non-naturally occurring SlpA protein derivative according to claim 1 or 2, wherein the non-naturally occurring protein SlpA derivative comprises:
a) a molecular label conjugated to the non-naturally occurring SlpA protein, b) one or more mutations in the naturally occurring sequence of the SlpA protein, or c) a multimer of SlpA protein.
4. The non-naturally occurring protein derivative of SlpA according to claim 3, wherein the molecular label is a radiolabel, fluorescent label, affinity label or targeting label.
5. The multimer of SlpA protein according to claim 3, wherein the multimer is a dimer, trimer, tetramer, pentamer, hexamer, heptamer, octamer, nonamer or decamer.
6. The multimer of SlpA protein according to claim 3, wherein the multimer comprises more than ten SlpA molecules.
7. A composition comprising the naturally or non-naturally occurring SlpA protein derivative of claims 1-7 and a pharmaceutically acceptable carrier and/or excipient, said composition optionally containing sulfasalazine, cyclosporine, prednisone, methylprednisone, budesonide, mesalamine, azathioprine, TNF inhibitors, methotrexate, or 6- mercaptopurine, a corticosteroid, infliximab or combinations thereof.
8. A method of treating an inflammation mediated disease of the gastrointestinal system in a subject, the method comprising, administering to the subject a therapeutically effective amount of the composition of claim 7.
9. The method of claim 8, wherein the composition is orally administered to the subject.
10. The method of claim 8, wherein the inflammation mediated disease is IBD.
11. The method of claim 10, wherein the IBD is Crohn's disease or ulcerative colitis.
12. A recombinant bacterium, the recombinant bacterium being:
a) genetically modified to decrease or eliminate the display of lipoteichoic acid (LTA), surface layer protein B (SlpB) and surface layer protein X (SlpX) on the surface of said bacterium and genetically modified to express to express surface layer protein A (SlpA) on its surface; or b) lacking expression of LTA, SlpB and SlpX on the cell surface and genetically modified to express to express surface layer protein A (SlpA) on its surface.
13. The recombinant bacterium of claim 12, wherein said recombinant bacterium has been genetically modified to:
a) express a protein that has the amino acid sequence of SEQ ID NO: 4 or the protein has the amino acid sequence at least 70%, 80%, 90%, 95%, 97%, 98%, or 99% identical to the sequence of SEQ ID NO: 4; and decrease or eliminate the expression of:
(i) a polypeptide comprising the amino acid sequence of SEQ ID NO: 1 or a polypeptide having at least 70%, 80%, 90%, 95%, 97%, 98%, or 99% sequence identity to the amino acid sequence of SEQ ID NO: 1;
(ii) a polypeptide comprising the amino acid sequence of SEQ ID NO: 2 or a polypeptide comprising the amino acid sequence having at least 70%>, 80%>, 90%), 95%), 97%), 98% , or 99% sequence identity to the amino acid sequence of SEQ ID NO: 2; and (iii) a polypeptide comprising the amino acid sequence of SEQ ID NO: 3 or a polypeptide having at least 70%, 80%, 90%, 95%, 97%, 98%, or 99% sequence identity to the amino acid sequence of SEQ ID NO: 3; b) express a protein that has the amino acid sequence of SEQ ID NO: 4 or a protein that has the amino acid sequence at least 70%, 80%, 90%, 95%, 97%, 98%, or 99% identical to the sequence of SEQ ID NO: 4 and lacks genes encoding SEQ ID NO: 1, 2 and 3 or orthologs thereof.
14. The recombinant bacterium of claim 12 or 13, wherein said recombinant bacterium is selected from the group consisting of L. acidophilus, L. amylolyticus, L. amylovorus, L. brevis, L. brevis ssp gravesensis, L. buchneri, L. crispatus, L. gallinarum, L. gigeriorum, L. helveticus/suntoryeus, L. hilgardii, L. kefiranofaciens, L. pasteurii, L. lactis and L. ultunensis.
15. The recombinant bacterium of claim 12 or 13, wherein said bacterium is a lactic acid bacterium.
16. The recombinant bacterium of claim 15, wherein said lactic acid bacterium is a Lactobacillus.
17. The recombinant bacterium of claim 16, wherein said recombinant bacterium is L. acidophilus or L. lactis.
18. A probiotic food comprising the recombinant bacterium of claims 12-17.
19. The probiotic food of claim 18, wherein the food is yogurt, fermented vegetable, kefir, sauerkraut, miso soup, pickle, tempeh or kimchi.
20. A method of treating and/or preventing an inflammation mediated disease of the gastrointestinal system in a subject, the method comprising, administering to the subject a therapeutically effective amount of the recombinant bacterium of claims 12-17 or a composition comprising said recombinant bacterium.
21. The method of claim 20, wherein the recombinant bacterium is orally administered to the subject.
22. The method of claim 20, wherein the inflammation mediated disease is inflammatory bowel disease (IBD).
23. The method of claim 22, wherein the IBD is Crohn's disease or ulcerative colitis.
24. A method of purifying SlpA comprising growing SlpA expressing bacterial cells, pelleting said bacterial cells from culture medium containing said bacterial cells, resuspending said bacterial cells in 5M NaCl for a period of 5 minutes to 24 hours to form an extraction composition, removing bacterial cells from said extraction composition by centrifugation to form a composition containing SlpA and dialyzing or filtering said composition using a dialysis bag or ultrafiltrating device having a molecular weight cut-off of 30 kDa to reduce the salt content of said composition containing SlpA.
25. The method of claim 24, wherein said SlpA expressing bacterial cells do not express LTA, SlpB or orthologs thereof or SlpX or orthologs thereof.
26. The method of claim 24, wherein said SlpA expressing bacterial cells do not express phosphoglycerol transferase or orthologs thereof.
27. The method of claims 24, 25 or 26, wherein said bacterial cells:
a) express a protein that has the amino acid sequence of SEQ ID NO: 4 or the protein has the amino acid sequence at least 70%, 80%, 90%, 95%, 97%, 98%, or 99% identical to the sequence of SEQ ID NO: 4; and:
b) do not express (i) a polypeptide comprising the amino acid sequence of SEQ ID NO: 1 or a polypeptide having at least 70%, 80%, 90%, 95%, 97%, 98%, or 99% sequence identity to the amino acid sequence of SEQ ID NO: 1; (ii) a polypeptide comprising the amino acid sequence of SEQ ID NO: 2 or a polypeptide comprising the amino acid sequence having at least 70%, 80%, 90%, 95%, 97%, 98%, or 99% sequence identity to the amino acid sequence of SEQ ID NO: 2; and (iii) a polypeptide comprising the amino acid sequence of SEQ ID NO: 3 or a polypeptide having at least 70%, 80%, 90%, 95%, 97%, 98%, or 99% sequence identity to the amino acid sequence of SEQ ID NO: 3;
28. The method of claims 24-37, wherein said bacterial cells are a Lactobacillus strain.
29. The method of claim 28, wherein said Lacotbacillus strain is selected from the group consisting of L. acidophilus, L. amylolyticus, L. amylovorus, L. brevis, L. brevis ssp gravesensis, L. buchneri, L. crispatus, L. gallinarum, L. gigeriorum, L. helveticus/suntoryeus, L. hilgardii, L. kefiranofaciens, L. pasteurii, L. lactis and L. ultunensis.
30. The method of any preceding claim, said method further comprising the precipitation of SlpA protein in said dialyzed composition comprising SlpA.
31. The method of claim 30, said wherein SlpA is precipitated with 1M NaCl.
32. The method of claim 31, said method further comprising the washing of said precipitated SlpA with water or a buffer.
33. The method of claim 33, said method further comprising the lyophilization of said washed SlpA.
34. A method of treating an inflammatory disease in a subject, the method comprising, administering to the subject a therapeutically effective amount of the composition of claim 7.
35. The method of claim 34, wherein the composition is orally administered to the subject.
36. The method of claims 34-35, wherein the inflammatory disease is selected from the group consisting of allergies, ankylosing spondylitis, Crohn's disease, diabetes, Type I diabetes, gastroesophageal reflux disease, Hashimoto's thyroiditis, hyperthyroidism, hypothyroidism, Irritable Bowel Syndrome (IBS), interstitial cystitis (IC), Lofgren's syndrome, lupus erythematosis, myasthenia gravis, multiple sclerosis, osteoarthritis, polymyalgia rheumatica, prostatitis, psoriasis, psoriatic arthritis, Raynaud's syndrome/phenomenon, reactive arthritis (Reiter syndrome), restless leg syndrome, reflex sympathetic dystrophy (RSD), rheumatoid arthritis, scleroderma, Sjogren's syndrome, ulcerative colitis and uveitis.
37. A method of treating an inflammatory disease in a subject, the method comprising administering to the subject a therapeutically effective amount of the recombinant bacterium of claims 12-17 or a composition comprising said recombinant bacterium.
38. The method of claim 37, wherein the recombinant bacterium is orally administered to the subject.
39. The method of claims 37-38, wherein the inflammatory disease is selected from the group consisting of allergies, ankylosing spondylitis, Crohn's disease, diabetes, Type I diabetes, gastroesophageal reflux disease, Hashimoto's thyroiditis, hyperthyroidism, hypothyroidism, Irritable Bowel Syndrome (IBS), interstitial cystitis (IC), Lofgren's syndrome, lupus erythematosis, myasthenia gravis, multiple sclerosis, osteoarthritis, polymyalgia rheumatica, prostatitis, psoriasis, psoriatic arthritis, Raynaud's syndrome/phenomenon, reactive arthritis (Reiter syndrome), restless leg syndrome, reflex sympathetic dystrophy (RSD), rheumatoid arthritis, scleroderma, Sjogren's syndrome, ulcerative colitis and uveitis.
40. A composition comprising the recombinant bacterium of claims 12-17 and a pharmaceutically acceptable carrier and/or excipient and, optionally, sulfasalazine, cyclosporine, prednisone, methylprednisone, budesonide, mesalamine, azathioprine, TNF inhibitors, methotrexate, or 6-mercaptopurine, a corticosteroid, infliximab or combinations thereof.
PCT/US2015/055620 2014-10-24 2015-10-15 Lactobacillus acidophilus surface layer protein a (slpa) as a therapeutic agent for the treatment of inflammatory diseases Ceased WO2016064643A1 (en)

Priority Applications (4)

Application Number Priority Date Filing Date Title
US15/521,418 US10562943B2 (en) 2014-10-24 2015-10-15 Lactobacillus acidophilus surface layer protein A (SlpA) as a therapeutic agent for the treatment of inflammatory diseases
US16/790,793 US11098088B2 (en) 2014-10-24 2020-02-14 Lactobacillus acidophilus surface layer protein A (SLPA) as a therapeutic agent for the treatment of inflammatory diseases
US16/804,020 US11028135B2 (en) 2014-10-24 2020-02-28 Lactobacillus acidophilus surface layer protein a (SlpA) as a therapeutic agent for the treatment of inflammatory diseases
US17/340,141 US20210300973A1 (en) 2014-10-24 2021-06-07 Lactobacillus acidophilus surface layer protein a (slpa) as a therapeutic agent for the treatment of inflammatory diseases

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201462068338P 2014-10-24 2014-10-24
US62/068,338 2014-10-24

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US15/521,418 A-371-Of-International US10562943B2 (en) 2014-10-24 2015-10-15 Lactobacillus acidophilus surface layer protein A (SlpA) as a therapeutic agent for the treatment of inflammatory diseases
US16/790,793 Division US11098088B2 (en) 2014-10-24 2020-02-14 Lactobacillus acidophilus surface layer protein A (SLPA) as a therapeutic agent for the treatment of inflammatory diseases

Publications (1)

Publication Number Publication Date
WO2016064643A1 true WO2016064643A1 (en) 2016-04-28

Family

ID=55761344

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2015/055620 Ceased WO2016064643A1 (en) 2014-10-24 2015-10-15 Lactobacillus acidophilus surface layer protein a (slpa) as a therapeutic agent for the treatment of inflammatory diseases

Country Status (2)

Country Link
US (4) US10562943B2 (en)
WO (1) WO2016064643A1 (en)

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2018122762A1 (en) * 2016-12-28 2018-07-05 Metis Healthcare S.R.L. Oral preparation comprising a probiotic preparation of lactobacilluls helveticus
CN115551524A (en) * 2020-03-31 2022-12-30 赛瓦图斯有限公司 Combination therapy for inflammatory bowel disease
EP4351720A4 (en) * 2021-06-11 2025-11-26 Univ Florida Surface layer protein A (SLPA) as a therapeutic agent for the treatment of inflammatory diseases

Families Citing this family (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2016064643A1 (en) * 2014-10-24 2016-04-28 University Of Florida Research Foundation, Incorporated Lactobacillus acidophilus surface layer protein a (slpa) as a therapeutic agent for the treatment of inflammatory diseases
KR20210141920A (en) * 2018-12-21 2021-11-23 킴벌리-클라크 월드와이드, 인크. Compositions and methods for preventing or treating incontinence, overactive bladder, or menstrual cramps
CN117018185A (en) * 2022-03-18 2023-11-10 江苏靶标生物医药研究所有限公司 Application of TNF-alpha nano antibody and PGE2 in preparation of ulcerative colitis medicines

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7348420B2 (en) * 2003-04-25 2008-03-25 North Carolina State University Lactobacillus acidophilus nucleic acid sequences encoding cell surface protein homologues and uses therefore
US20120308994A1 (en) * 2008-05-26 2012-12-06 Roche Diagnostics Operations, Inc. Slpa as a tool for recombinant protein and enzyme technology

Family Cites Families (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2016064643A1 (en) * 2014-10-24 2016-04-28 University Of Florida Research Foundation, Incorporated Lactobacillus acidophilus surface layer protein a (slpa) as a therapeutic agent for the treatment of inflammatory diseases

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7348420B2 (en) * 2003-04-25 2008-03-25 North Carolina State University Lactobacillus acidophilus nucleic acid sequences encoding cell surface protein homologues and uses therefore
US20120308994A1 (en) * 2008-05-26 2012-12-06 Roche Diagnostics Operations, Inc. Slpa as a tool for recombinant protein and enzyme technology

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
LIGHTFOOT YAIMA L. ET AL.: "Tailoring gut immune responses with lipoteichoic acid-deficient Lactobacillus acidophilus", FRONTIERS IN IMMUNOLOGY, vol. 4, no. Article 25, 2013, pages 1 - 6 *
WANG FU-JUN ET AL.: "Tandem multimer expression and preparation of hypoglycemic peptide MC 6 from Momordica charantia in Escherichia coli", APPL BIOCHEM BIOTECHNOL, vol. 166, 2012, pages 612 - 619 *

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2018122762A1 (en) * 2016-12-28 2018-07-05 Metis Healthcare S.R.L. Oral preparation comprising a probiotic preparation of lactobacilluls helveticus
CN115551524A (en) * 2020-03-31 2022-12-30 赛瓦图斯有限公司 Combination therapy for inflammatory bowel disease
EP4351720A4 (en) * 2021-06-11 2025-11-26 Univ Florida Surface layer protein A (SLPA) as a therapeutic agent for the treatment of inflammatory diseases

Also Published As

Publication number Publication date
US20200172582A1 (en) 2020-06-04
US11028135B2 (en) 2021-06-08
US11098088B2 (en) 2021-08-24
US20200207814A1 (en) 2020-07-02
US10562943B2 (en) 2020-02-18
US20190016762A1 (en) 2019-01-17
US20210300973A1 (en) 2021-09-30

Similar Documents

Publication Publication Date Title
US11098088B2 (en) Lactobacillus acidophilus surface layer protein A (SLPA) as a therapeutic agent for the treatment of inflammatory diseases
Lightfoot et al. SIGNR3‐dependent immune regulation by Lactobacillus acidophilus surface layer protein A in colitis
CN102947441A (en) Cellular constituents from bacteroides, compositions thereof, and therapeutic methods employing bacteroides or cellular constituents thereof
Longman et al. Microbiota: host interactions in mucosal homeostasis and systemic autoimmunity
US20240016861A1 (en) Combination therapy for treating or preventing cancer
WO2018209149A1 (en) Methods and compositions for treating and diagnosing autoimmune diseases
KR20120138769A (en) Antibody against serotype b lipopolysaccharide of pseudomonas aeruginosa
US20070036734A1 (en) Therapeutic agent for periodontal disease
KR20200110342A (en) Combination therapy to treat or prevent cancer
AU2011313811A1 (en) Methods and compositions using anti-lps ligands for the treatment and prevention of inflammatory disorders
US20210060093A1 (en) Combination therapy for treating or preventing cancer
US11718661B2 (en) Composition for the treatment of antibody deficiencies
KR20200110343A (en) Combination therapy to treat or prevent cancer
US20190161534A1 (en) Anti-galactan ii monoclonal antibodies targeting klebsiella pneumoniae
WO2018029346A1 (en) Klebsiella pneumoniae o3 specific antibodies
KR20170134199A (en) A monoclonal antibody inhibiting immunosuppressive functions of pathogens, antigen-binding fragment thereof, and hybridomas producing such antibody
US20210395343A1 (en) Ivig composition and method of treatment of antibody deficient patients
TW202608478A (en) Combinations and applications of microorganisms and antibodies
EP3062801A1 (en) Anti-lps enriched immunoglobulin for use in treatment and/or prophylaxis of fibrosis
Student Ph. D. in Biology Cycle XXXII
Lopes Exploring the Immunobiological Basis of Prospective Strategies Towards Two Human Neonatal Pathogens: Group B Streptococcus and Escherichia Coli
Gujral Antibody-based diagnostic and therapeutic approaches on gluten-sensitive enteropathy
Ortiz Use of a Listeria Monocytogenes Protein to Stimulate Immune Responses and Anti-Tumor Effects
Wroblewska et al. Immune Homeostasis of the Gut
Garaicoechea et al. VHH Technology: A Potential Passive Immune Therapy to Control Rotavirus Infections in Human Infants

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 15853150

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 15853150

Country of ref document: EP

Kind code of ref document: A1