WO2016049656A1 - Biosynthesis and engineering of lanthipeptides - Google Patents

Biosynthesis and engineering of lanthipeptides Download PDF

Info

Publication number
WO2016049656A1
WO2016049656A1 PCT/US2015/052724 US2015052724W WO2016049656A1 WO 2016049656 A1 WO2016049656 A1 WO 2016049656A1 US 2015052724 W US2015052724 W US 2015052724W WO 2016049656 A1 WO2016049656 A1 WO 2016049656A1
Authority
WO
WIPO (PCT)
Prior art keywords
lanthipeptide
phage
peptide
display
phagemid
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2015/052724
Other languages
French (fr)
Inventor
Wilfred A. Van Der Donk
Ayse OKESLI
Xiao Yang
Mark Walker
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
University of Illinois at Urbana Champaign
University of Illinois System
Original Assignee
University of Illinois at Urbana Champaign
University of Illinois System
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by University of Illinois at Urbana Champaign, University of Illinois System filed Critical University of Illinois at Urbana Champaign
Priority to US15/326,751 priority Critical patent/US11149270B2/en
Priority to CA2961285A priority patent/CA2961285A1/en
Publication of WO2016049656A1 publication Critical patent/WO2016049656A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/10Processes for the isolation, preparation or purification of DNA or RNA
    • C12N15/1034Isolating an individual clone by screening libraries
    • C12N15/1037Screening libraries presented on the surface of microorganisms, e.g. phage display, E. coli display
    • CCHEMISTRY; METALLURGY
    • C40COMBINATORIAL TECHNOLOGY
    • C40BCOMBINATORIAL CHEMISTRY; LIBRARIES, e.g. CHEMICAL LIBRARIES
    • C40B40/00Libraries per se, e.g. arrays, mixtures
    • C40B40/04Libraries containing only organic compounds
    • C40B40/10Libraries containing peptides or polypeptides, or derivatives thereof

Definitions

  • the present disclosure relates to molecular reagents and genetic methods of synthesizing engineered lanthipeptides in vivo from recombinant organisms.
  • Nisin is a polycyclic antibacterial peptide with 34 amino acid residues and five cyclic thioether cross-links of varying sizes.
  • the cross-links are installed by sequential actions of the enzymes NisB and NisC on NisA (FIG. 1).
  • the mature lantibiotic is formed through the cleavage of the leader peptide located at the N-terminus of NisA by NisP, a serine protease (FIG. 1).
  • Cyclic peptides are promising candidates to use as molecular scaffolds for peptide libraries, which in turn may provide powerful tools for drug design and investigation and disruption of protein-protein interactions.
  • the characteristic thioether crosslinks of lanthipeptides provide stability to different physical conditions (pH, temperature), resistance to proteases, and form scaffolds to selectively and tightly bind to small molecules such as lipid II and phosphotidylethanolamine (PE).
  • Phostidylethanolamine PE
  • Phage display is widely used for identification of peptide/protein-binders from large libraries of peptides.
  • introduction of post- translational modifications onto the phage-displayed peptides is a fairly new concept.
  • Three approaches can be used to introduce modifications on a phage-displayed peptide.
  • One way to alter the structure of a phage-displayed peptide is chemical modification by reagents that selectively react with the peptide.
  • phage designed to display a specific 15 amino acid long substrate on their pill protein was biotinylated by the Escherichia coli (E. coli) enzyme called biotin holoenzyme synthetase (BHS; product of the birA gene) in vivo.
  • E. coli Escherichia coli
  • BHS biotin holoenzyme synthetase
  • a platform for bacterial phage display of a lanthipeptide includes: a phagemid including a lanthipeptide display system; a helper phage; and a bacterial host organism configured to express one or more lanthipeptide biosynthesis enzymes.
  • a phage for displaying a lanthipeptide is provided.
  • the phage is made according to the platform of the first aspect.
  • the phage is configured to infect a bacterial host organism including a Gram-positive bacterium.
  • a platform for cell surface display of a lanthipeptide includes: a lanthipeptide display system; and a yeast host organism configured to express one or more lanthipeptide biosynthesis enzymes.
  • a lanthipeptide display system includes a gene chimera encoding a fusion peptide including a lanthipeptide display peptide and a presentation peptide.
  • the presentation peptide anchors the
  • lanthipeptide display peptide on an outer biological surface.
  • a lanthipeptide library display system includes a lanthipeptide expression library having a plurality of gene chimeras. Each member of the plurality of gene chimeras encodes a fusion peptide including a lanthipeptide display peptide and a presentation peptide. The presentation peptide anchors the lanthipeptide display peptide on an outer biological surface.
  • a method of identifying a lanthipeptide display peptide expressed in vivo from a biological host organism includes several steps.
  • the first step includes preparing a biological host library, wherein each member of the biological host library expresses a gene chimera encoding a fusion peptide including a lanthipeptide display peptide and a presentation peptide.
  • the presentation peptide anchors the lanthipeptide display peptide on an outer biological surface of the biological host organism.
  • the second step includes sorting the biological host library to form a candidate subset of the biological hosts that express the lanthipeptide display peptide.
  • a phagemid including a lanthipeptide display system is provided.
  • FIG. 1 depicts posttranslational modifications in nisin biosynthesis.
  • NisB dehydrates eight threonines/serines in NisA, whereas NisC forms five thioether crosslinks by Michael- type addition of cysteine thiols onto the dehydrated amino acids.
  • Dha dehydroalanine
  • Dhb dehydrobutyrine
  • Abu 2-aminobutyric acid.
  • FIG. 2A depicts an exemplary phagemid engineered to encode for a fusion protein to pill (encoded by gill). It consists of an origin of replication in E. coli (dsDNA ori; double stranded DNA origin) and the fl origin that is used for propagation of phage. Key: Amp R : ampicillin resistance gene; and gill: gene III.
  • FIG. 2B depicts an exemplary helper phage including a single stranded DNA encoding for phage proteins including pill, used for display of the lantibiotic nisin. M13K07 helper phage genome is shown in red. Other genes on the genome are not shown.
  • the phagemid depicted in FIG. 2A was used to display a peptide whose C-terminus is fused to the N-terminus of truncated pill. Key: Kan R : kanamycin resistance gene; gill: gene III; pill, protein III; pVII: protein VII; pIX: protein IX; pVIII: protein VIII; and pVI: protein VI.
  • FIG. 2C depicts an exemplary schematic of a modification plasmid that provides biosynthetic genes necessary for modification of the LanA including but not limited to dehydration and thioether crosslink formation.
  • FIG. 3 depicts an exemplary schematic of precursor peptide synthesis, modification, and assembly on phage as well as ensuing phage propagation in Ml 3 phage display via helper phage.
  • the red part in the final drawing represents the posttranslationally modified NisA peptide (for structure see FIG. 1).
  • FIG. 4A depicts an exemplary SDS-PAGE analysis of an IMAC-purified cytoplasmic peptide from E. coli SS320 expressing the phagemid and the modification plasmid in the lane labeled "cytoplasmic.” It also depicts SDS-PAGE analysis of phage created using the scheme outlined above in the lane labeled "phage.”
  • the purified cytoplasmic fraction contains a band at ⁇ 40 kDa that likely corresponds to NisC and a band at -100 kDa that likely corresponds to NisB. These proteins are frequently co-purified with NisA.
  • phage coat proteins pVI, pVII, pVIII, and pIX are observed as a smear between 10 and 15 kDa.
  • the NisA-pIII fusion is again observed at ⁇ 25 kDa.
  • pill runs at approximately 60 kDa consistent with the literature (van Wezenbeek, P.M.G.F., Hulsebos, T.J.M., and Schoenmakers, J.G.G.
  • FIG. 4B depicts an exemplary MALDI-TOF-MS spectrum of modified NisA displayed on phage.
  • the modified NisA was extracted from an excised, trypsin-digested SDS-PAGE gel fragment corresponding to NisA-pIII fusion. Expected mass of NisA [M+H- 8H 2 0] 3352.5 Da. Observed mass 3353.4 Da.
  • the peak marked with * is an oxidation peak [M+H-8H 2 0+16].
  • the peak marked with ⁇ may represent a single dehydration of NisA or may be a trypsin-related peak.
  • FIG. 4C depicts the molecular structure of nisin (for a shorthand notation, see FIG. 1). Trypsin cleavage sites within nisin are shown in red. When modifications are introduced trypsin does not readily cleave after the designated lysines. Hence, since the leader peptide ends in Arg, and since the last residue of nisin is Lys, treatment of nisin-displaying phage with trypsin, releases the mature nisin (provided it has been posttranslationally modified) as shown in FIG. 4B. [31] FIG.
  • 4D depicts a comparison of exemplary MALDI-MS spectra of authentic nisin containing fully and partially dehydrated nisin, trypsin-digested nisin intermediates purified from the cytoplasmic portion of E. coli SS320 expressing the phagemid and the modification plasmid, and modified NisA extracted from an excised, trypsin-digested SDS-PAGE gel fragment corresponding to NisA-pIII fusion displayed on phage.
  • FIG. 5A depicts the process in which wild type Ml 3 phage infects the Gram-negative bacteria E. coli that display the F pilus, adapted from Bennett, N.J.; Gagic, D.; Sutherland- Smith, A.J.; Rakonjac, J., "Characterization of a dual-function domain that mediates membrane insertion and excision of Ff filamentous bacteriophage," J. Mol. Biol. 411, 972- 985 (2011).
  • FIG. 5B depicts the proposed process in which phage displaying modified NisA may infect Gram-positive bacteria, leveraging the affinity of modified NisA for the diphosphate moiety of lipid II as a primary receptor in lieu of the F pilus.
  • FIG. 5C depicts exemplary culture plates of Micrococcus luteus DSM1790
  • the bacteria are grown on plates containing the antibiotic ampicillin, to which all three strains are sensitive.
  • the phage produced using the coexpression system designed above packages the phagemid which contains a beta lactamase gene, successful infection by the phage endows the bacteria with ampicillin resistance.
  • FIG. 5D depicts an exemplary culture plate of Streptomyces cattleya DSM46488.
  • the phagemid construct here was augmented to include a Streptomyces origin pSG5 as well as an apramycin resistance cassette.
  • FIG. 5E depicts a 1% agarose electrophoresis gel amplifying the NisA through beta lactamase portion of the phagemid out of the Bacillus subtilis ATCC 6633 transformed by the phage system described above indicating successful transformation; lane key: 1, 21og DNA ladder markers 2, phage-transformed B. subtilis; 3, non-transformed B. subtilis.
  • FIG. 6 depicts an exemplary peptide design for cyclic peptides containing a double ring structure in which a ProcA2.8 leader peptide was attached to a core region to lead to the formation of two rings.
  • FIG. 7B depicts tandem mass spectrometry analysis of the peptide presented in FIG. 7A.
  • FIG. 7D depicts tandem mass spectrometry analysis of the peptide presented in FIG. 7C.
  • FIG. 7F depicts tandem mass spectrometry analysis of the peptide presented in FIG. 7E.
  • FIG. 8A depicts an approach for yeast surface display of lanthipeptides, wherein peptides must be heterologously expressed in yeast, transferred to the secretion machinery, and modified prior to being displayed on the yeast surface.
  • FIG. 8B depicts prochlorosin 1.1 (panel (i)), which can be used as scaffolds (panels (ii) and (iii)) for library production, with randomized amino acids incorporated at various locations within their structures (red circles). Sequences within rings or between rings can be randomized, or amino acids within rings or between rings can be deleted or inserted.
  • FIG. 8C depicts prochlorosin 2.8 (panel (i)), which can be used as scaffolds (panel (ii)) for library production, with randomized amino acids incorporated at various locations within their structures (red circles). An example is shown of inserting amino acids in the left ring and deleting amino acids in the right ring.
  • FIG. 9A depicts one construct for surface display of lanthipeptides, wherein the N- terminal LanA anchoring construct contains Aga2 followed by an Strep-tag II, a serine and glycine linker region, and the leader and core of the LanA (note that Aga2-LctA secretion is directed by Aga2's native secretion signal).
  • FIG. 9A depicts one construct for surface display of lanthipeptides, wherein the N- terminal LanA anchoring construct contains Aga2 followed by an Strep-tag II, a serine and glycine linker region, and the leader and core of the LanA (note that Aga2-LctA secretion is directed by Aga2's native secretion signal).
  • 9B depicts one construct for surface display of lanthipeptides, wherein the C-terminal LanA anchoring construct contains a secretion signal, the leader peptide of the LanA, a KEX2 cleavage site for in vivo removal of the leader peptide, the LanA core peptide, a serine and glycine linker region, Aga2, and HA epitope tad and a 10 histidine tag to facilitate purification.
  • the C-terminal LanA anchoring construct contains a secretion signal, the leader peptide of the LanA, a KEX2 cleavage site for in vivo removal of the leader peptide, the LanA core peptide, a serine and glycine linker region, Aga2, and HA epitope tad and a 10 histidine tag to facilitate purification.
  • FIG. 9C depicts a representation for LanMs, wherein a secretion signal is present to target them to the ER and a retention tag to prevent them from being secreted.
  • FIG. 10A depicts exemplary mass spectroscopy analysis of core peptides of Aga2- LctA N-terminal LanA fusion protein in the absence (panel ( )) or presence (panel (ii)) of N-ethylmaleimide (NEM) treatment.
  • the N-terminal Aga2-LanA fusion construct exhibits the mass of the core peptide after protease digestion (LctA M+H: 3,594) with the expected losses of water (LctA: 4) and no NEM adducts illustrating full cyclization.
  • FIG. 10B depicts exemplary mass spectroscopy analysis of core peptides of Aga2- ProcA 2.8 N-terminal LanA fusion protein in the absence (panel ( )) or presence (panel (ii)) of N-ethylmaleimide (NEM) treatment.
  • the N-terminal Aga2 -ProcA 2.8 fusion construct exhibits the mass of the core peptide after protease digestion (ProcA 2.8 M+H: 2,527) with the expected losses of water (ProcA 2.8: 2) and no NEM adducts illustrating full cyclization.
  • FIG. IOC depicts exemplary mass spectroscopy analysis of core peptides of
  • Aga2-HalA2 2.8 N-terminal LanA fusion protein in the absence (panel (i)) or presence (panel (ii)) of N-ethylmaleimide (NEM) treatment.
  • the N-terminal Aga2-HalA2 fusion construct exhibits the mass of the core peptide after protease digestion (HalA2 M+H: 3,554) with the expected losses of water (HalA2: 7) and no NEM adducts illustrating full cyclization.
  • FIG. 10D depicts an exemplary mass spectroscopy analysis of core peptides of C-terminal LctA fusion proteins in the absence (panel (i)) or presence (panel (ii)) of
  • NEM N-ethylmaleimide
  • FIG. 10E depicts structural representation of lacticin 481 (panel (i)), cinnamycin (panel (ii)) and Hala (panel (iii)), one of the two components of haloduracin.
  • Dha dehydroalanine
  • Dhb dehydrobutyrine
  • Abu 2-aminobutyric acid.
  • FIG. 11A depicts an exemplary flow cytometry analysis showing no Aga2-LctA presentation on the surface of uninduced yeast.
  • FIG. 11B depicts an exemplary flow cytometry analysis showing the Aga2-LctA construct is displayed on the surface of the yeast induced to co-express Aga2-LctA and the respective LctM.
  • FIG. llC depicts an exemplary flow cytometry analysis showing the Aga2-ProcA 2.8 construct is displayed on the surface of the yeast induced to co-express Aga2-ProcA 2.8 and the respective ProcM.
  • FIG. 11D depicts an exemplary flow cytometry analysis showing the Aga2-HalA2 construct is displayed on the surface of the yeast induced to co-express Aga2-HalA2 and the respective HalM2.
  • FIG. HE depicts an exemplary flow cytometry analysis showing the LctA-Aga2 construct is displayed on the surface of the yeast induced to co-express LctA-Aga2 and LctM.
  • FIG. 11F depicts an exemplary MALDI-TOF MS analysis showing the core peptide from Aga2-HalA2 is 7-fold dehydrated and no iodoacetamide (IAA) adducts are observed indicating full cyclization.
  • IAA iodoacetamide
  • a range includes each individual member.
  • a group having 1-3 members refers to groups having 1, 2, or 3 members.
  • a group having 6 members refers to groups having 1, 2, 3, 4, or 6 members, and so forth.
  • the modal verb "may” refers to the preferred use or selection of one or more options or choices among the several described aspects or features contained within the same. Where no options or choices are disclosed regarding a particular aspect or feature contained in the same, the modal verb "may” refers to an affirmative act regarding how to make or use and aspect of a described aspect or feature contained in the same, or a definitive decision to use a specific skill regarding a described aspect or feature contained in the same. In this latter context, the modal verb "may” has the same meaning and connotation as the auxiliary verb "can.”
  • the articles “a” and “an” refer to one or to more than one (for example, to at least one) of the grammatical object of the article.
  • “About” and “approximately” shall generally mean an acceptable degree of error for the quantity measured given the nature or precision of the measurements. Exemplary degrees of error are within 20-25 percent (%), typically, within 10%, and more typically, within 5% of a given value or range of values.
  • phagemid refers to a plasmid having at least a bacteriophage fl origin of replication and optionally a bacterial origin of replication.
  • phagemids or phasmids can include additional genetic elements, such as a gene encoding a polypeptide capable of conferring an antibiotic resistance phenotype to a recipient host organism, as well as genes encoding additional polypeptides or chimera polypeptides.
  • a platform for displaying lanthipeptides on Ml 3 phage is provided.
  • the utility of the platform is demonstrated for displaying the lantibiotic nisin on Ml 3 phage.
  • a previously developed nisin production system can be adapted for this purpose, in which the precursor peptide NisA is modified by the enzymes NisB and NisC in E. coli. (Shi, Y., Yang, X., Garg, N., and van der Donk, W. A. "Production of lantipeptides in Escherichia coli " J. Am. Chem. Soc.
  • Phage display of nisin was envisioned by heterologous expression of the precursor peptide NisA fused to a phage display protein in the presence of the modifying enzymes NisB and NisC and the genes required for forming other phage components in E. coli.
  • the NisA peptide fused to the phage display protein was modified in E. coli and incorporated with the phage components into phage displaying the corresponding lantibiotic. It is possible that the leader peptide of the modified NisA, once exported into the periplasm, may be cleaved by the OmpT protease. This would not affect the display of the nisin structure.
  • M13 phage contains three to five pill proteins on Ml 3 phage that are responsible for the attachment of phage on to the pilus of E. coli during the infection process with which the phage propagates. This protein is the most common protein used for display of peptides, however fusing a peptide onto pill impairs its ability to recognize its native primary and secondary receptors. In conventional phage display, phagemid encodes for pill proteins that are fused to the displaying peptide, whereas helper phage M13K07 or VCSM13 encode for wild type pill sustaining the infection function.
  • the phage display technique generally utilizes two main components.
  • One is a phagemid or phasmid, which is a plasmid that contains an fl origin of replication enabling single stranded DNA replication observed in fl phage as well as a double-stranded origin of replication, which allows propagation as a plasmid in a bacterial host.
  • a phagemid can replicate as a plasmid, and also can provide single stranded DNA that can be packaged into viral particles (FIG. 2A).
  • the second component is a helper phage M13K07, which is an Ml 3 phage derivative with the mutation Met40Ile in pll.
  • helper phage carries an origin of replication from the pl5A plasmid and the kanamycin (Kan) resistance gene from Tn903 both inserted within the Ml 3 origin of replication, thus disrupting the M13 origin (FIG. 2B).
  • Kan kanamycin
  • M13K07 contains an E. coli origin and can replicate; however, in the absence of phagemid DNA, M13K07 will package the M13K07 plasmid in produced phage. In the presence of a phagemid bearing a wild-type M13 or fl origin, single-stranded phagemid is packaged preferentially over helper phage DNA and secreted into the culture medium.
  • phage display the genetic material for synthesis of the phage structural genes is provided by infection of bacteria (for example E. coli cells), which are harboring a phagemid containing a fusion gene encoding the display peptide fused to a phage surface protein, by the helper phage (FIG. 2C).
  • bacteria for example E. coli cells
  • helper phage FOG. 2C
  • This approach allows expression of phage proteins and peptide- phage protein fusion in E. coli, which results in the assembly of phage displaying peptide- phage protein on their surfaces.
  • phagemid over helper phage DNA is favored as packaging of wild-type Ml 3 or f 1 origin on the phagemid is more efficient than packaging of the helper phage genome due to its distorted phage origin (FIG. 2C).
  • Peptides can be displayed either fused directly to the N-terminus of truncated pill via the peptide C-terminus or through fusion on the peptide N-terminus to a presentation peptide, which then hybridizes to the truncated pill (Sachdev S, S. "Engineering M13 for phage display,” Biomol. Eng. 18:57-63 (2001).)
  • An N-terminal display was chosen through direct fusion of the C-terminus of NisA to the truncated pill.
  • the modifying enzymes were expected to accept their substrates fused directly to pill and augmented on the N-terminus with a signal peptide and hexahistidine tag.
  • NisA was coexpressed with NisB and NisC at 30 °C.
  • Analysis of the isolated NisA peptide by MALDI-ToF MS showed that the NisA was completely modified demonstrating that this temperature can be successfully employed for nisin production.
  • FIG. 3 depicts a preferred embodiment of the phage system.
  • the gene encoding the precursor peptide NisA was successfully cloned into the designed phagemid.
  • M13K07 was added to a multiplicity of infection of approximately 7 to provide the phage structural genes
  • isopropyl ⁇ -D-l-thiogalactopyranoside (IPTG) was added to a final concentration of 0.8 mM to induced expression of the NisA-pIII fusion protein
  • arabinose was added to a final concentration of 0.04% w/v to induce expression of T7 polymerase which in turn expressed NisB and NisC.
  • Cells were then allowed to grow for one hour at 37 °C to ensure infection. Kanamycin was then added to kill any uninfected cells and the temperature was reduced to 30 °C to ensure optimal production of phage. The culture was allowed to continue to grow overnight, then the cells were removed by centrifugation. The phage was then isolated from the supernatant of the cell culture via PEG precipitation.
  • the phage was resolved into its component proteins by SDS-PAGE prior to mass spectrometry analysis. Phage was denatured by boiling in Laemmli buffer for 5 minutes, and the denatured phage proteins were loaded onto a 4-20% Tris-glycine gel and separated by SDS-PAGE. Comparison of the bands separated via SDS-PAGE to a ladder of proteins of known molecular weight showed that both wild type pill and the NisA-pIII fusion peptide were expressed and present on the phage (FIG. 4A).
  • NisA-pIII fusion peptide comparison of the NisA-pIII fusion peptide to that isolated from the cytoplasm of a cell expressing the phagemid and modification plasmid but not infected with helper phage provided additional verification that the observed protein was indeed the expected fusion of NisA-pIII.
  • FIG. 4B Trypsin does not cut inside fully modified nisin (FIG. 4C).
  • coli is known to transport large molecules such as proteins which are only fully-folded in the cytoplasm (Berks, B., Sargent, F., and Palmer, T. "The Tat protein export pathway," Mol Microbiol 35:260 - 274 (2000)), allowing more time in the cytoplasm before the export. (Thomas, J. D., Daniel, R. A., Errington, J., and Robinson, C. "Export of active green fluorescent protein to the periplasm by the twin- arginine translocase (Tat) pathway in Escherichia coli," Mol. Microbiol.
  • E. coli SS320 was transformed with the phagemid and the modification plasmid.
  • the bacterial culture was then grown at 37 °C to OD 6 oo nm between 0.3 and 0.5, after which isopropyl ⁇ -D-l- thiogalactopyranoside (IPTG) was added to a final concentration of 0.8 mM to induce expression of the NisA-pIII fusion protein, and arabinose was added to a final concentration of 0.04% w/v to induce expression of T7 polymerase which in turn expressed NisB and NisC. Cells were then allowed to grow overnight at 30 °C.
  • IPTG isopropyl ⁇ -D-l- thiogalactopyranoside
  • the cells were pelleted by centrifugation.
  • the cells were resuspended in denaturing buffer (8M urea, 100 mM Tris-Cl, pH 8.0) and lysed by freezing at -80 °C and thawing.
  • the lysate was clarified by centrifugation and then loaded onto Ni-NTA resin.
  • the resin was washed with wash buffer (8M urea, 100 mM Tris-Cl, pH 6.3) and eluted in elution buffer (8M urea, 100 mM Tris-Cl, pH 4.5).
  • the resulting eluent was diluted, digested with trypsin, and analyzed with MALDI-MS.
  • the analysis revealed a trypsin fragment, which corresponds to 7-fold dehydrated NisA rather than the full 8-fold dehydrated peptide, which was observed on the phage (FIG. 4D).
  • the build up of 7- fold dehydrated NisA inside the E. coli cells but not on the phage suggests that the 7-fold dehydrated NisA is not readily exported via the Tat pathway.
  • the absence of 8-fold dehydrated NisA inside the E. coli cells suggests that the fully dehydrated species is readily exported via the Tat pathway and hence not observed in the cytoplasmic fraction.
  • Nl and N2 recognize the TolA and F pilus receptors, respectively, and after engaging these secondary and primary receptors the C-terminal portion of pill interacts with either the TolQ or TolR protein to insert into the inner membrane of E. coli and inject the DNA (FIG. 5A).
  • phage displaying modified NisA may be capable of infecting Gram-positive bacteria by using the diphosphate of lipid II as the primary receptor site and then allowing the C-terminal portion of pill to mediate infection through the conserved TolQ/TolR proteins (FIG. 5B).
  • Successful infection of bacteria by the phage would transfer the phagemid including its ampicillin resistance gene into the infected bacteria. Expression of this gene would lead to resistance in the bacteria against ampicillin. Phage was made as above then incubated with bacteria in exponential phase growth for 30 minutes to 1 hour.
  • the bacteria were then pelleted, resuspended in a minimal amount of media, and spread on one half of an agar plate containing ampicillin (FIG. 5C).
  • the modification plasmid was not transformed into the system and phage was thus made displaying the linear NisA-pIII peptide only. These cells were plated on the second half of the plate. Results indicated that the phage displaying modified NisA and not the phage displaying linear NisA was capable of infecting bacteria (FIG. 5C).
  • the phagemid was augmented with the pSG5 origin and apramycin resistance cassette from the pCRISPomyces-2 plasmid (Cobb, R.E., Wang, Y., Zhao, H., "High-Efficiency Multiplex Genome Editing of Streptomyces Species Using an Engineered CRISPR/Cas System," ACS Synth. Biol., 4 (6), 723-728 (2015).
  • phage was produced both with and without expression of the modification plasmid in order to generate phage displaying modified NisA and linear NisA respectively.
  • Streptomyces cattleya DSM46488 was then incubated for 6 to 12 hours with the indicated phage and plated on selective media. The result again confirmed that the phage displaying the modified NisA was significantly more infective than the phage displaying the linear NisA (FIG. 5D).
  • Phage display libraries can be designed for use of the highly promiscuous enzyme ProcM.
  • This enzyme has 30 natural substrates composed of a highly conserved leader domain attached to highly diverse core regions containing serines/threonines and cysteines at different positions.
  • ProcM was considered a good candidate for constructing a library of peptides containing two lanthionine crosslinks (FIG. 6).
  • the peptides in the library consisted of the ProcA2.8 wild type leader sequence attached to a core region coding for C(X)5SMPPS(X)5C (SEQ ID NO.: 9), where X is an amino acid encoded by the NWY degenerate codon.
  • the peptides were encoded in a pPvSFDuet-1 vector containing the gene encoding for ProcM.
  • the NWY codon was selected for the library because it does not encode for Cys or Ser/Thr, and therefore would not complicate lanthionine formation at the designed positions. Twenty clones were investigated as shown in Table 1.
  • Peptides 2.8-5, 2.8-9, and 2.8-10 were coexpressed with ProcM and purified by IMAC followed by RP-HPLC.
  • the analysis of the peptides by MALDI-ToF tandem mass spectrometry after GluC endoproteinase cleavage showed that ProcM dehydrated and cyclized all three peptides (FIG. 7A-F).
  • Phage display of lanthipeptides can enable the preparation of thioether-containing cyclic peptide libraries to advance or alter current properties of lantibiotics and/or to select for binders to new targets.
  • Phage display of nisin may be useful for finding binders to molecules with structures similar to the pyrophosphate on lipid II and/or to solve nisin ' s instability problem at physiological conditions by forming phage libraries displaying nisin- like peptides.
  • the inventors have successfully produced prochlorosins, cinnamycin, haloduracin, and lacticin 481 in E. coli and the processing enzymes have been shown to have high tolerance for different substrates.
  • the lanthionine synthetase of prochlorosins may be very valuable to prepare lanthionine-containing peptide libraries as it can naturally process 30 substrates with rings that vary in size and place.
  • lanthipeptide expression by yeast surface display is provided.
  • lanthipeptides are genetically encoded, they lend themselves to the facile production of libraries through combinatorial DNA synthesis.
  • the high throughput nature of yeast display and fluorescent activated cell sorting (FACS) in conjunction with the lanthipeptide biosynthetic machinery can provide for the directed evolution of new lanthipeptides that can disrupt specific protein-protein interactions.
  • FACS fluorescent activated cell sorting
  • Agglutinin is a heterodimer with the two subunits covalently linked through two disulfide bridges.
  • One subunit, Agal is covalently anchored to the cell wall and the other subunit, Aga2, is anchored to it via the disulfide linkages. Fusions can be made on the N- terminus or C-terminus of Aga2 for display.
  • FACS fluorescence-activated cell sorting
  • This system is being used to display the well-characterized lanthipeptides lacticin 481, prochlorosin 2.8, and haloduracin ⁇ on the surface of yeast cells.
  • Our initial approach to library construction is to use the prochlorosins 1.1 and 2.8 as scaffolds as these have been shown to be robust and amenable to library generation. Libraries can be generated through degenerate DNA synthesis to encode for randomized amino acids within their native rings and between their rings, as well as insertions or deletions within their native rings and between their rings. Peptides from these libraries will be examined for their extent of cyclization and their ability to bind fluorescently labeled proteins or small molecules like lipid II will be determined using FACS.
  • the construct N-terminal anchoring of lacticin 481, Aga2-LctA, prochlorosin 2.8, Aga2-ProcA 2.8, and haloduracin ⁇ , Aga2-HalA2, and C- terminal anchoring of lacticin 481, LctA-Aga2, were cloned into E. coli expression plasmids and coexpressed with the cognate LanM, LctM, ProcM, and HalM2, respectively.
  • IMAC immobilized metal affinity chromatography
  • NEM N- ethylmaleimide
  • the yeast cells were assayed for the presence of surface displayed LanA by FACS based on detecting the HA epitope or Strep-Tag II. The presence of displayed protein was detected for all constructs (FIG. 11A-F).
  • Aga2-HalA2 was then freed from the surface of the yeast by treatment with tris(2-carboxyethyl)phosphine (TCEP), enriched by streptactin chromatography, digested with Glu-C and analyzed by MALDI-TOF MS. A mass corresponding to the 7-fold dehydrated core peptide could be observed FIG. 11F), indicating dehydrated Aga2-HalA2 is being displayed on the yeast surface.
  • IAA iodoacetamide
  • Filamentous phage displaying modified NisA overcomes many of these natural limitations of lytic phage. Since a filamentous phage can be engineered to introduce any desired gene into bacteria that it can infect, the filamentous phage can avoid the potential of wholesale lysis and release of infectious proteins by introducing a gene deletion system to target a specific virulence factor or a key metabolic pathway of a single species of bacteria. Such a phage would also introduce less stringent selective pressure for bacterial variants that could avoid phage infection since the phage would render the bacteria less harmful rather than kill it. Additionally, documented nisin resistance among Gram-positive bacteria is remarkably low and the phage leverages a nisin or nisin-like moiety for infection.
  • platforms, phage, phagemid, systems and methods are provided for identifying engineered lanthipeptide display peptides expressed in vivo from biological organisms.
  • a platform for bacterial phage display of a lanthipeptide includes: a phagemid including a lanthipeptide display system; a helper phage; and a bacterial host organism configured to express one or more lanthipeptide biosynthesis enzymes.
  • the lanthipeptide display system includes a fusion gene encoding an open reading frame having a N-terminal secretion signal, a lanthipeptide display peptide and a pill protein.
  • the lanthipeptide display peptide includes a nisin peptide.
  • the phagemid is capable of being rescued by the helper phage, wherein the helper phage includes a M13 phage.
  • the M13 phage is M13K07.
  • the platform includes a bacterial host organism being E. coli.
  • the one or more lanthipeptide biosynthesis enzymes include NisB or NisC, or a combination thereof.
  • a phage for displaying a lanthipeptide is provided.
  • the phage is made according to the platform of any of the respects of the first aspect.
  • the phage is configured to infect a bacterial host organism including a Gram-positive bacterium.
  • a platform for cell surface display of a lanthipeptide includes: a lanthipeptide display system; and a yeast host organism configured to express one or more lanthipeptide biosynthesis enzymes.
  • the lanthipeptide display system includes a fusion gene encoding an open reading frame having a lanthipeptide display peptide and an Aga2 protein.
  • the yeast host organism is S. cerevisiae.
  • the one or more lanthipeptide biosynthesis enzymes include a LanM family enzyme.
  • a lanthipeptide display system includes a gene chimera encoding a fusion peptide including a lanthipeptide display peptide and a presentation peptide.
  • the presentation peptide anchors the
  • the lanthipeptide display peptide on an outer biological surface.
  • the outer biological surface of the cell is selected from a phage surface or a host organism membrane.
  • the gene chimera encoding a fusion peptide including a lanthipeptide display peptide and a presentation peptide is expressed from one of a phagemid, a plasmid, a cosmid and a chromosome.
  • a lanthipeptide library display system includes a lanthipeptide expression library having a plurality of gene chimeras. Each member of the plurality of gene chimeras encodes a fusion peptide including a lanthipeptide display peptide and a presentation peptide.
  • the presentation peptide anchors the lanthipeptide display peptide on an outer biological surface. In this latter respect, the outer biological surface is selected from a phage surface or a host organism membrane.
  • each member of the plurality of gene chimeras is expressed from a uniform lanthipeptide expression library selected from one system consisting of a phagemid, a plasmid, a cosmid, and a chromosome.
  • a method of identifying a lanthipeptide display peptide expressed in vivo from a biological host organism includes several steps.
  • the first step includes preparing a biological host library, wherein each member of the biological host library expresses a gene chimera encoding a fusion peptide including a lanthipeptide display peptide and a presentation peptide.
  • the presentation peptide anchors the lanthipeptide display peptide on an outer biological surface of the biological host organism.
  • the second step includes sorting the biological host library to form a candidate subset of the biological hosts that express the lanthipeptide display peptide.
  • the sorting includes using fluorescence-activated cell sorting.
  • the sorting includes using immunoassay.
  • a phagemid including a lanthipeptide display system includes a fusion gene encoding an open reading frame having a N-terminal secretion signal, a lanthipeptide display peptide and a pill protein.
  • the lanthipeptide display peptide includes a nisin peptide.
  • the phagemid is capable of being rescued by the helper phage, wherein the helper phage includes a M13 phage. In these latter respects, the M13 phage is M13K07.
  • the phagemid is configured to produce a phage when propagated in a suitable bacterial host organism, wherein the phage is configured to infect a bacterial host organism including a Gram-positive bacterium.
  • Oligonucleotide primers for mutagenesis were synthesized by Operon Technologies or Integrated DNA Technologies. A listing of primers is provided in Tables 2 and 3.
  • Taq and Platinum Pfx DNA polymerases, Dpnl, restriction endonucleases, and bacteriophage T4 DNA ligase were purchased from Invitrogen. Phusion DNA polymerase was purchased from New England Bio labs (NEB). Cloning vectors (pET and pDuet) were obtained from Novagen. Agarose gel extraction, plasmid mini-prep, and PCR purification kits were purchased from Qiagen. HisTrap IMAC resin was purchased from GE Healthcare Life Sciences. Strep-Tactin resin was purchased from IBA. M13K07 helper phage (N0315S), and anti-M13 pill monoclonal antibody (E8033S) were obtained from NEB.
  • Monoclonal anti-flag M2 antibody produced in mouse was purchased from Sigma (F3165).
  • HA epitope tag antibody was purchased from Thermo Fisher Scientific.
  • Alexa Fluor 488 goat anti-mouse antibody was purchased from Life Technologies.
  • StrepMAB classic anti-StrepTag II antibody was purchased from IBA.
  • Substrate for the HRP for western blot analysis was clarity western ECL substrate from Bio-rad (170-5060). All strains were grown in media acquired from Difco laboratories or Fisher Scientific.
  • IPTG isopropyl-l-thio-D- galactopyranoside
  • IAA iodoacetamide
  • TCEP tris(2- carboxyethyl) phosphine hydrochloride
  • DTT dithiothreitol
  • E. coli SS320 (Lucigen Corporation) was used for phage production
  • E. coli BL21 (DE3) cells (Stratagene) were used for protein expression.
  • S. cerevisiae EBYIOO cells were used for yeast surface display.
  • MALDI-ToF MS analyses were conducted at the Mass Spectrometry Facility (UIUC) using an UltrafleXtreme TOF/TOF (Bruker Daltonics).
  • LC/ESI-MS/MS Liquid chromatography electrospray ionization tandem mass spectrometry
  • the Tat signal peptide -hexahistidine tag-NisA construct was cloned out of a synthetic gene block (Integrated DNA Technologies) containing the Tat signal sequence from the trimethylamine N-oxide reductase protein followed by a hexahistidine tag and the precursor NisA peptide gene.
  • the pJF3H phagemid was used to provide the backbone of the phagemid including the truncated pill protein (containing only residues 274-424), phage origin, beta lactamase, and dsDNA origin genes.
  • KJH_NisA_pTSP3H_RP were used to clone the Tat-His 6 -NisA gene.
  • KJH_pTSP3H_FP and KJH_pTSP3H_RP were used to clone the necessary genes from pJF3H.
  • the PCRs 50 ⁇ included l HF buffer (NEB), Phusion DNA Polymerase (NEB) (0.02 unit ⁇ L), dNTPs (1 mM), template DNA, and primers (0.5 ⁇ each).
  • the amplification was conducted via 30 to 34 cycles of denaturing (98 °C for 15 s), annealing (temperature determined based on the NEB annealing temperature calculator and annealed for 30 s), and extending (72 °C for 45 to 120 s depending on the length of the amplified fragment), then a final elongation step (72 °C for 10 minutes).
  • Both fragments were purified on a 1% agarose gel, purified using the QIAquik gel purification kit (QIAGEN), and a Gibson assembly was then performed to anneal the two cloned fragments into a singe phagemid.
  • the entire Gibson reaction was then transformed into chemically-competent E. coli DH10B cells via heat shock, plated on an LB agar plate with 100 ⁇ g/mL ampicillin, and grown at 37 °C for 8-18 h.
  • Colonies were picked and incubated in 5 mL of LB-ampicillin medium at 37 °C for 12-20 h, followed by isolation of the plasmids using a QIAprep Spin Miniprep Kit (QIAGEN). The sequences of the resulting plasmids were confirmed by DNA sequencing.
  • the resulting DNA fragment and the pSEX81 vector were digested in 1 x NEBuffer 4 (New England Biolabs) with NcoI-HF and Notl-HF at 37 °C (for 15 h).
  • the digested products were purified by agarose gel electrophoresis followed by use of a QIAquick gel extraction kit (QIAGEN).
  • QIAGEN QIAquick gel extraction kit
  • the resulting DNA insert was ligated with the digested pSEX81 vector at 16 °C for 15 h using T4 DNA ligase.
  • the ligation reaction mixture was diluted 5 times with water prior to
  • E. coli DH5 cells were transformed with the ligation product via heat shock, plated on LB- ampicilin/0.2 % glucose agar plates, and grown at 37 °C for 15 h. Colonies were picked and incubated in 5 mL of LB-ampicillin medium at 37 °C for 15 h, followed by isolation of the plasmids using a QIAprep Spin Miniprep Kit (QIAGEN). The correct sequences of the resulting plasmids were confirmed by DNA sequencing.
  • Example 5 Preparation of phage-displaying NisA and modified NisA
  • M13K07 was added to a multiplicity of infection of approximately 7 to provide the phage structural genes and isopropyl ⁇ -D-l-thiogalactopyranoside (IPTG) was added to a final concentration of 0.8 mM to induced expression of the NisA-pIII fusion protein.
  • IPTG isopropyl ⁇ -D-l-thiogalactopyranoside
  • Cells were then allowed to grow for one hour with shaking at 37 °C to ensure infection.
  • Kanamycin was then added to kill any uninfected cells and the temperature was reduced to 30 °C to ensure optimal production of phage.
  • the culture was allowed to continue to grow overnight, then the cells were removed by centrifugation at 10500 x g. The supernatant was then filtered through 0.22 ⁇ sterile filter to remove any remaining E.
  • TBS tris-buffer saline
  • the phage was then collected by centrifugation at 10500 x g followed by aspiration of the supernatant.
  • the phage pellet was resuspended in a minimal amount of TBS, generally 0.25 to 0.5 mL, and the concentration was determined via a previously determined UV measurement technique (Wiseman, R.L., Berkowitz, S.A. and Day, L.A., "Different arrangements of protein subunits and single- stranded circular DNA in the filamentous bacterial viruses fd and Pfl ,” J. Mol. Biol., 102, 549 - 561 (1976); Smith, G.P., "Absorption Spectroscopy and Quantitation of Filamentous Phage" from
  • the phage was precipitated from the culture supernatant by adding back 1 ⁇ 4 of the total volume as 2.5 M NaCl / 20% w/v PEG8000. This was mixed well and allowed to precipitate on ice overnight. The phage was then pelleted by centrifugation at 10500 x g. The supernatant was aspirated off and the phage was resuspended in 1.5 mL TBS solution. The phage was precipitated a second time by adding back 1 ⁇ 4 of the total volume as 2.5 M NaCl / 20% w/v PEG8000. This was mixed well and allowed to precipitate on ice for at least one hour.
  • the phage was then collected by centrifugation at 10500 x g followed by aspiration of the supernatant.
  • the phage pellet was resuspended in a minimal amount of TBS, generally 0.25 to 0.5 mL, and the concentration was determined via a previously determined UV measurement technique.
  • Phage (15 pL, l x lO 12 to l lO 13 phage/mL) was mixed with Laemmli protein loading dye. After 5 min incubation at 100 °C, 15 ⁇ ⁇ of this solution was loaded on a 4-20% Tris- Glycine polyacrylamide gel (Bio-Rad). After electrophoresis, the gel was stained with Coomassie blue dye for 15 to 30 minutes then destained for 2 hours or overnight. Bands of interest were excised with a razor blade and placed in separate eppendorf tubes. The
  • Coomassie stain was removed by covering the gel slice in a solution of 50 mM NH 4 HCO 3 in 50% acetonitrile 10 minutes, then aspirating all of the liquid. This step was repeated until the wash liquid no longer appeared blue.
  • the gel slice was flash-frozen and lyophilized until dry, typically 3 hours to overnight.
  • the band was then removed from the lyophilizer and submerged in an ice-cold solution of 100 mM NH 4 HCO 3 with 0.0125 mg/mL trypsin. This mixture was placed on ice and allowed to swell the gel for 1 hour.
  • the tube containing the gel slice swelled in the trypsin digestion mixture was then placed at 37 °C for 12 to 24 hours.
  • the digestion mixture was removed and set aside for later analysis.
  • the slice was then submerged in 20 mM NH 4 HCO 3 and sonicated in a water bath for 20 minutes. This solution was then removed and set aside for later analysis.
  • the gel slice was then submerged in 5% formic acid in 50% acetonitrile and again sonicated in a water bath for 20 minutes. This solution was then either spotted directly for MALDI analysis or lyophilized to dryness to save for later analysis.
  • Aqueous trypsin-digested peptide solutions extracted from the gel were concentrated via Zip Tip (Millipore) then eluted directly onto the MALDI plate in a 2,5-dihydroxybenzoic acid matrix (DHB; 20 ⁇ g/ ⁇ L DHB in 70:30 ACN: 0.1% trifluoroacetic acid).
  • the extract from the SDS-PAGE excised band in 5% formic acid in 50% acetonitrile was directly spotted (1 ⁇ ) into 2,5-dihydroxybenzoic acid matrix (1 ⁇ .) and analyzed via MALDI-ToF MS.
  • a set of cyclic lanthipeptide libraries were generated by taking advantage of the great sequence tolerance of ProcM.
  • the ProcA peptides contain a leader peptide that is not modified and a core peptide where the posttranslational modifications take place.
  • the modification process of ProcM is likely guided by the conserved leader sequence of the 29 ProcA substrates (Table 4). Therefore, multiple libraries of lanthipeptide substrates were generated by replacing the ProcA core sequence with a peptide sequence of similar length with a partially randomized sequence, while the leader sequence was kept unchanged.
  • the N-terminal leader sequence has high sequence identity, while the C-terminal core peptide is hypervariable.
  • the SEQ ID NOs. for these sequences are as follows: 1.1 [SEQ ID NO.: 45]; 1.2 [SEQ ID NO.: 46]; 1.3 [SEQ ID NO.: 47]; 1.4 [SEQ ID NO.: 48]; 1.5 [SEQ ID NO.: 49]; 1.6 [SEQ ID NO.: 50]; 1.7 [SEQ ID NO.: 51]; 2.1 [SEQ ID NO.: 52]; 2.2 [SEQ ID NO.: 53]; 2.3 [SEQ ID NO.: 54]; 2.4 [SEQ ID NO.: 55]; 2.5 [SEQ ID NO.: 56]; 2.6 [SEQ ID NO.: 57]; 2.7 [SEQ ID NO.: 58]; 2.8 [SEQ ID NO.: 59]; 2.9 [SEQ ID NO.: 60]; 2.10 [SEQ ID NO.: 61]; 2.11 [S
  • lanthipeptides are ribosomally synthesized peptides
  • RTHS genetic reverse two-hybrid system
  • the next step was to design the DNA triplet codons that encode the randomized amino acids within the rings.
  • the randomized amino acids preferably do not contain Ser/Thr/Cys that might disturb the original ring scaffold by forming additional/alternative rings;
  • the randomized amino acids do not contain potential stop codons that will result in truncated peptides;
  • all encoded amino acids should be as equally represented as possible in a first round; (4) we strived for reasonable diversity of the library, ideally close to or greater than 10 8 library variants which is normally the limitation resulting from transformation efficiency in E. coli.
  • pPvSFDuet-1 vector with procM inserted into MCS2 was used for library vector construction.
  • pRSFDUET-1 vector containing the procA2.8 leader sequence was used as template for PCR amplification of ProcA2.8 leader followed by randomized library sequences.
  • Library PCR primers (Table 3, synthesized using the hand-mixing option and PAGE purification by IDT) were designed that added an EcoRI restriction site to the 5' end and a NotI restriction site to the 3' end.
  • the PCR products were digested with the appropriate restriction enzymes and purified using a Qiagen PCR purification kit.
  • the pRSFDUET-1 vector was digested with the same restriction enzymes and an additional enzyme Sbfl to minimize vector self-ligation, dephosphorylated with alkaline phosphatase, and gel-purified.
  • the digested vector was added to a ligation reaction containing T4 ligase and the insert DNA.
  • Electrocompetent E. coli DH5 cells were transformed with the ligation mixture and plated on LB-agar containing kanamycin (50 mg L "1 ) to screen for positive clones. Clones were sequenced at ACGT, Inc.
  • Example 11 Overexpression, purification and modification assay for library samples.
  • a 5- ⁇ aliquot of the above assay mixture was added to 15 of IAA assay buffer with a final concentration of 50 mM Tris, 50 mM IAA, 1-3 mM TCEP, pH 8.5, or NEM assay buffer with a final concentration of 50 mM Tris, 25 mM NEM, 1-3 mM TCEP, pH 6.3.
  • the assay solution was incubated in the dark at RT for 4 h (for IAA assay) or 37°C for 10 min (for NEM assay) and subjected to MALDI-ToF MS.
  • a sample of 5 of each protease cleavage reaction mixture was injected to a BEH C8 column (1.7 ⁇ , 1.0 x 100 mm), and the fully modified product was purified by UPLC using a gradient of 3% mobile phase B (0.1% formic acid in methanol) to 97% mobile phase B in mobile phase A (0.1% formic acid in water) over 12 min.
  • Mass spectra were acquired in ESI positive mode in the range of 50-2000 m/z.
  • the capillary voltage was 3500 V, and the cone voltage was 40 V.
  • the other parameters used were as follows: 120 °C source temperature; 300 °C desolvation temperature, 150 L/h cone gas flow, and 600 L/h desolvation gas flow.
  • a transfer collision energy of 4 V was used for both MS and tandem MS, while the trap collision energy was set to 6 V for MS and a 20-55 V ramp for MSMS depending on the peptide.
  • Glu-fibrinopeptide B (Sigma) was directly infused as the lock mass.
  • the tandem mass spectra were processed with MaxEnt3 and analyzed by Protein/Peptide Editor in BioLynx 4.1.
  • the software for analyzing both precursor-ion and fragment-ion mass was set to report any mass within 0.3 amu of the calculated expected values.
  • aGluC cleavage sites inside the ring are underlined.
  • bAs determined by reactions with electrophiles iodoacetamide (IAA) or N-ethylmaleimide (NEM).
  • Library 2 can generate cyclic peptides as desired, it may not be as stable against proteolytic degradation as the other libraries.
  • PCR products were inserted into the BamHI and Xhol sites of pETDuet (Aga2-LctA, Aga2- ProcA 2.8), the Ndel and EcoRI sites of pET28 (Aga2-HalA2), or the Ncol and Xhol sites of pET28 (LctA-Aga2) by isothermal assembly. All constructs were confirmed by DNA sequencing.
  • Example 14 Coexpression of LanA fusions and LanMs in E. coli.
  • E. coli BL21(de3) cells were transformed with the appropriate Aga2 LanA fusion expression plasmid and that of the associated LanM.
  • Example 15 Purification and characterization of Aga2 LanA fusions from E. coli.
  • the incubation was allowed to run at room temperature overnight.
  • the cleaved core peptide was purified by reverse phase HPLC and analyzed by MALDI-TOF mass spectrometry.
  • the NEM assays were performed on these peptides as described above.
  • Example 16 Expression and analysis of Aga2 LanA fusions in yeast.
  • S. cerevisiae EBY100 was transformed with the appropriate Aga2 LanA fusion expression plasmid and that of the associated LanM.
  • the cell pellet was washed with leucine and tryptophan synthetic dropout media with galactose as the carbon source and resuspended in the same (5 mL) to induce protein expression.
  • the cultures were incubated at 20 °C with shaking for 48 h.
  • Approximately 1 10 7 cells were harvested by brief centrifugation and washed with 1 mL of phosphate buffered saline with 0.1% (w/v) bovine serum albumin (PBS+BSA). Cells were resuspended in 100 PBS+BSA.
  • StrepMAB (4 of 1 mg/mL stock) was added to the cells which were then incubated at room temperature for 1 h.
  • Cells were pelleted and washed with 1 mL of ice cold PBS+BSA and resuspended in 100 ⁇ . of ice cold PBS+BSA.
  • Alexa Fluor 488 goat anti- mouse antibody (4 ⁇ , of 1 mg/mL stock) was added to the cells and they were incubated on ice and in the dark for 30 min.
  • the cells were again pelleted and washed with 1 mL of ice cold PBS+BSA and analyzed on a BD LSR II flow cytometer using the instrument's default settings for Alexa Fluor 488.
  • the resin was washed with buffer consisting of 100 mM Tris and 150 mM sodium chloride, pH 8 until the A 2 so of the eluent dropped below 0.05.
  • the protein of interest was then eluted from the column with buffer consisting of 100 mM Tris, 8 M urea, and 2.5 mM desthiobiotin pH 8.
  • the eluent was pooled and concentrated in an Amicon spin concentrator with a molecular weight cutoff of 30 kDa.
  • the Aga2-HalA2 was then digested and analyzed MALDI-TOF MS as described above.

Landscapes

  • Life Sciences & Earth Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • General Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biomedical Technology (AREA)
  • Organic Chemistry (AREA)
  • Biotechnology (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • Crystallography & Structural Chemistry (AREA)
  • Plant Pathology (AREA)
  • Molecular Biology (AREA)
  • Microbiology (AREA)
  • Virology (AREA)
  • Physics & Mathematics (AREA)
  • Biochemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Biophysics (AREA)
  • Peptides Or Proteins (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)

Abstract

Platforms, systems and methods are provided for identifying engineered lanthipeptide display peptides expressed in vivo from biological organisms.

Description

BIOSYNTHESIS AND ENGINEERING OF LANTHIPEPTIDES
CROSS-REFERENCE TO RELATED APPLICATIONS
[01] This application claims benefit of priority under 35 U.S. C. 119 to U.S. provisional patent application serial numbers 62/056216, filed September 26, 2014, and entitled
"BIOSYNTHESIS AND ENGINEERING OF LANTHIPEPTIDES," the contents of which are herein incorporated by reference in its entirety.
STATEMENT OF GOVERNMENT INTEREST
[02] This invention was made with government support under GM-58822 awarded by the National Institutes of Health. The government has certain rights in the invention.
SEQUENCE LISTING
[03] The instant application contains a Sequence Listing that has been submitted in ASCII format via EFS-Web and is hereby incorporated by reference in its entirety. The ASCII copy, created on September 25, 2015, is named UIU01-018-PCT_ST25.txt, and is 52,604 bytes in size.
FIELD
[04] The present disclosure relates to molecular reagents and genetic methods of synthesizing engineered lanthipeptides in vivo from recombinant organisms.
BACKGROUND
[05] Natural products produced by living organisms such as animals, plants, and microbes often have valuable biological activities and thus, they have been employed in a variety of areas including medicine, cosmetics, and the food industry. (Clardy, J., Fischbach, M. A., and Walsh, C. T. "New antibiotics from bacterial natural products," Nat. Biotechnol. 24:1541- 1550 (2006).) The isolation and discovery of pharmaceutically valuable compounds for the use of humans began during the 1940's with the discovery of antibiotics and peaked in the period of 1970-1980. (Koehn, F. E., and Carter, G. T. "The evolving role of natural products in drug discovery," Nat. Rev. Drug Discov. 4:206-220 (2005); Fischbach, M. A., and Walsh, C. T. "Antibiotics for Emerging Pathogens," Science 325: 1089-1093 (2009).) The lack of new approaches to isolate new natural products in addition to a long and expensive development process has caused pharmaceutical companies to retract from this field in recent years. (Koehn, F. E., and Carter, G. T. "The evolving role of natural products in drug discovery," Nat. Rev. Drug Discov. 4:206-220 (2005).)
[06] A new urgency for the discovery of new antibiotics that operate with different mechanisms of action compared to current antibiotics emerged as antibiotic-resistant infectious bacterial strains, such as methicillin-resistant Staphyloccocus aureus (MRSA) and vancomycin-resistant Enterococci (VRE), have started to appear in clinical settings.
((Fischbach, M. A., and Walsh, C. T. "Antibiotics for Emerging Pathogens," Science
325: 1089-1093 (2009).) Many studies have demonstrated a clear relationship between exposure time to an antibiotic and the appearance of resistant strains. (Tacconelli, E., De Angelis, G, Cataldo, M. A., Pozzi, E., and Cauda, R. "Does antibiotic exposure increase the risk of methicillin-resistant Staphylococcus aureus (MRSA) isolation? A systematic review and meta-analysis," J. Antimicrob. Chemother. 61:26-38 (2008).) Higher usage of an antibiotic leads to development of resistant bacterial strains, requiring the continual discovery of new pharmaceutically available antibiotics. A need therefore exists to create new methodology for discovering new antibiotics and other natural products having therapeutic or diagnostic value.
[07] Lanthipeptide biosynthesis
[08] Nisin is a polycyclic antibacterial peptide with 34 amino acid residues and five cyclic thioether cross-links of varying sizes. After the precursor peptide NisA is synthesized by the ribosome, the cross-links are installed by sequential actions of the enzymes NisB and NisC on NisA (FIG. 1). Then, the mature lantibiotic is formed through the cleavage of the leader peptide located at the N-terminus of NisA by NisP, a serine protease (FIG. 1). (van der Meer, J. R., Polman, J., Beerthuyzen, M. M., Siezen, R. J., Kuipers, O. P., and de Vos, W. M.
"Characterization of the Lactococcus lactis nisin A operon genes nisP, encoding a subtilisin- like serine protease involved in precursor processing, and nisR, encoding a regulatory protein involved in nisin biosynthesis," J. Bacteriol. 175:2578- 2588 (1993).) NisB dehydrates threonines and serines in the core region of NisA whereas NisC forms the five thioether cross-links by Michael-type addition of cysteine thiols to the dehydrated Thr/Ser. Nisin specifically binds to the pyrophosphate group of lipid II and forms pores in the cell membrane to kill gram positive bacteria (Hsu, S. T., Breukink, E., Tischenko, E., Lutters, M. A., De Kruijff, B., Kaptein, R., Bonvin, A. M., and Van Nuland, N. A. "The nisin-lipid II complex reveals a pyrophosphate cage that provides a blueprint for novel antibiotics," Nat. Struct. Mol. Biol. 11:963-967 (2004)). [09] Cyclic peptides are promising candidates to use as molecular scaffolds for peptide libraries, which in turn may provide powerful tools for drug design and investigation and disruption of protein-protein interactions. The characteristic thioether crosslinks of lanthipeptides provide stability to different physical conditions (pH, temperature), resistance to proteases, and form scaffolds to selectively and tightly bind to small molecules such as lipid II and phosphotidylethanolamine (PE). (Oman, T. J., Lupoli, T. J., Wang, T. S. A., Kahne, D., Walker, S., and van der Donk, W.A. "Haloduracin a binds the peptidoglycan precursor lipid II with 2: 1 stoichiometry," J. Am. Chem. Soc. 133: 17544 (2011); Makino, A., Baba, T., Fujimoto, K., Iwamoto, K., Yano, Y., Terada, N., Ohno, S., Sato, S. B., Ohta, A., Umeda, M., Matsuzaki, K., and Kobayashi, T. "Cinnamycin (Ro 09-0198) promotes cell binding and toxicity by inducing transbilayer lipid movement," J. Biol. Chem. 278:3204-3209 (2003); Hasper, H. E., de Kruijff, B., and Breukink, E. "Assembly and stability of nisin-lipid II pores," Biochemistry 43: 11567-11575 (2004); Knerr, P. J., and van der Donk, W. A.
"Discovery, Biosynthesis, and Engineering of Lantipeptides," Annu. Rev. Biochem. 81:479- 505 (2012).) These crosslinks are necessary for the activity of antimicrobial lanthipeptides, called lantibiotics, as in the absence of these modifications, binding to their target is not observed. Previous studies showed that the solubility, stability, and therapeutic effect of lanthipeptides can be improved by replacement of amino acids at different positions in the sequence with natural and/or unnatural residues. (Knerr, P. J., Oman, T. J., Garcia De Gonzalo, C. V., Lupoli, T. J., Walker, S., and van der Donk, W.A. "Non-proteinogenic Amino Acids in Lacticin 481 Analogues Result in More Potent Inhibition of Peptidoglycan Transglycosylation," ACS Chem. Biol. 7: 1791-1795 (2012); Field, D., Begley, M., O'Connor, P. M., Daly, K. M., Hugenholtz, F., Cotter, P. D., Hill, C, and Ross, R. P. "Bioengineered Nisin A Derivatives with Enhanced Activity against Both Gram Positive and Gram Negative Pathogens," PLoS ONE 7:e46884 (2012).) However, only a few systematic methods for discovery of new, pharmaceutically valuable lanthipeptides are available such as bacterial display, and in vitro non-ribosomal translation of lanthipeptides with designed ring structures. (Hofmann, F. T., Szostak, J. W., and Seebeck, F. P. "In Vitro Selection of Functional
Lantipeptides," J. Am. Chem. Soc. 134:8038-8041 (2012); Bosma, T., Kuipers, A., Bulten, E., de Vries, L., Rink, R., and Moll, G. N. "Bacterial Display and Screening of
Posttranslationally Thioether-Stabilized Peptides," Appl. Environ. Microb. 77:6794-6801 (2011). [10] Phage display systems
[11] Phage display is widely used for identification of peptide/protein-binders from large libraries of peptides. (Sachdev S, S. (2001) Engineering M13 for phage display, Biomol. Eng. 18, 57-63 (2001); Bratkovic, T. "Progress in phage display: evolution of the technique and its applications," Cell. Mol. Life Sci. 67:749-767 (2010)). However, introduction of post- translational modifications onto the phage-displayed peptides is a fairly new concept. Three approaches can be used to introduce modifications on a phage-displayed peptide. One way to alter the structure of a phage-displayed peptide is chemical modification by reagents that selectively react with the peptide. (Li, K., Chen, Y., Li, S., Nguyen, H. G., Niu, Z., You, S., Mello, C. M., Lu, X., and Wang, Q. "Chemical Modification of M13 Bacteriophage and Its Application in Cancer Cell Imaging," Bioconjugate Chem. 21:1369- 1377 (2010); Heinis, C, Rutherford, T., Freund, S., and Winter, G. "Phage-encoded combinatorial chemical libraries based on bicyclic peptides," Nat. Chem. Biol. 5:502-507 (2009); Ng, S., Jafari, M. R., and Derda, R. "Bacteriophages and Viruses as a Support for Organic Synthesis and
Combinatorial Chemistry," ACS Chem. Biol. 7: 123-138 (2011).) For example, in a recent study peptides containing three cysteine residues separated by several random amino acid residues were fused to the phage pill protein and reacted with tris-(bromomethyl)benzene to form bicyclic peptide libraries on phage. (Heinis, C, Rutherford, T., Freund, S., and Winter, G. "Phage-encoded combinatorial chemical libraries based on bicyclic peptides," Nat. Chem. Biol. 5:502-507 (2009).)
[12] Another way to modify phage-displayed peptides is attachment of both the substrate peptide and the modifying enzyme onto the phage surface so that the enzyme catalyzes the formation of the product on phage. This method has been used to engineer enzymes catalyzing desired reactions through directed mutagenesis. (Love, K. R., Swoboda, J. G., Noren, C. J., and Walker, S. "Enabling Glycosyltransferase Evolution: A Facile Substrate- Attachment Strategy for Phage-Display Enzyme Evolution," ChemBioChem 7:753-756 (2006); Sunbul, M., Emerson, N., and Yin, J. "Enzyme-Catalyzed Substrate Attachment to Phage Surfaces for the Selection of Catalytic Activities," ChemBioChem 12:380-386 (2011).)
[13] Finally, the third method that has been successful to modify the peptide displayed on phage is in vitro modification of the peptide by an enzyme. (Hess, G. T., Cragnolini, J. J., Popp, M. W., Allen, M. A., Dougan, S. K., Spooner, E., Ploegh, H. L., Belcher, A. M., and Guimaraes, C. P. "Ml 3 Bacteriophage Display Framework That Allows Sortase-Mediated Modification of Surface-Accessible Phage Proteins," Bioconjugate Chem. 23: 1478-1487 (2012).) The drawbacks of these methods include the necessity of reconstitution of the enzyme activity in vitro, and efficient substrate recognition and/or appropriate folding of the enzyme attached to the phage surface.
[14] Previous studies showed that a naturally occurring enzyme in phage infected bacteria can modify peptides fused to a phage protein in vivo, which are then displayed on the newly formed phage. (Edgar, R., McKinstry, M., Hwang, J., Oppenheim, A. B., Fekete, R. A., Giulian, G., Merril, C, Nagashima, K., and Adhya, S. "High-sensitivity bacterial detection using biotin-tagged phage and quantum-dot nanocomplexes," Proc. Nat. Acad. Sci. USA 103:4841-4845 (2006).) For example, phage designed to display a specific 15 amino acid long substrate on their pill protein was biotinylated by the Escherichia coli (E. coli) enzyme called biotin holoenzyme synthetase (BHS; product of the birA gene) in vivo. (Smelyanski, L., and Gershoni, J. "Site directed biotinylation of filamentous phage structural proteins," Virol. J. 8:495 (2011).)
SUMMARY
[15] In a first aspect, a platform for bacterial phage display of a lanthipeptide is provided. The platform includes: a phagemid including a lanthipeptide display system; a helper phage; and a bacterial host organism configured to express one or more lanthipeptide biosynthesis enzymes.
[16] In a second aspect, a phage for displaying a lanthipeptide is provided. The phage is made according to the platform of the first aspect. The phage is configured to infect a bacterial host organism including a Gram-positive bacterium.
[17] In a third aspect, a platform for cell surface display of a lanthipeptide is provided. The platform includes: a lanthipeptide display system; and a yeast host organism configured to express one or more lanthipeptide biosynthesis enzymes.
[18] In a fourth respect, a lanthipeptide display system is provided. The lanthipeptide display system includes a gene chimera encoding a fusion peptide including a lanthipeptide display peptide and a presentation peptide. The presentation peptide anchors the
lanthipeptide display peptide on an outer biological surface.
[19] In a fifth aspect, a lanthipeptide library display system is provided. The lanthipeptide library display system includes a lanthipeptide expression library having a plurality of gene chimeras. Each member of the plurality of gene chimeras encodes a fusion peptide including a lanthipeptide display peptide and a presentation peptide. The presentation peptide anchors the lanthipeptide display peptide on an outer biological surface.
[20] In a sixth aspect, a method of identifying a lanthipeptide display peptide expressed in vivo from a biological host organism is provided. The method includes several steps. The first step includes preparing a biological host library, wherein each member of the biological host library expresses a gene chimera encoding a fusion peptide including a lanthipeptide display peptide and a presentation peptide. The presentation peptide anchors the lanthipeptide display peptide on an outer biological surface of the biological host organism. The second step includes sorting the biological host library to form a candidate subset of the biological hosts that express the lanthipeptide display peptide.
[21] In a seventh aspect, a phagemid including a lanthipeptide display system is provided.
[22] These and other features, objects and advantages of the present invention will become better understood from the description that follows. In the description, reference is made to the accompanying drawings, which form a part hereof and in which there is shown by way of illustration, not limitation, aspects of the invention.
BRIEF DESCRIPTION OF THE DRAWINGS
[23] FIG. 1 depicts posttranslational modifications in nisin biosynthesis. NisB dehydrates eight threonines/serines in NisA, whereas NisC forms five thioether crosslinks by Michael- type addition of cysteine thiols onto the dehydrated amino acids. Dha, dehydroalanine; Dhb, dehydrobutyrine; Abu, 2-aminobutyric acid.
[24] FIG. 2A depicts an exemplary phagemid engineered to encode for a fusion protein to pill (encoded by gill). It consists of an origin of replication in E. coli (dsDNA ori; double stranded DNA origin) and the fl origin that is used for propagation of phage. Key: AmpR: ampicillin resistance gene; and gill: gene III.
[25] FIG. 2B depicts an exemplary helper phage including a single stranded DNA encoding for phage proteins including pill, used for display of the lantibiotic nisin. M13K07 helper phage genome is shown in red. Other genes on the genome are not shown. The phagemid depicted in FIG. 2A was used to display a peptide whose C-terminus is fused to the N-terminus of truncated pill. Key: KanR: kanamycin resistance gene; gill: gene III; pill, protein III; pVII: protein VII; pIX: protein IX; pVIII: protein VIII; and pVI: protein VI. [26] FIG. 2C depicts an exemplary schematic of a modification plasmid that provides biosynthetic genes necessary for modification of the LanA including but not limited to dehydration and thioether crosslink formation.
[27] FIG. 3 depicts an exemplary schematic of precursor peptide synthesis, modification, and assembly on phage as well as ensuing phage propagation in Ml 3 phage display via helper phage. The red part in the final drawing represents the posttranslationally modified NisA peptide (for structure see FIG. 1).
[28] FIG. 4A depicts an exemplary SDS-PAGE analysis of an IMAC-purified cytoplasmic peptide from E. coli SS320 expressing the phagemid and the modification plasmid in the lane labeled "cytoplasmic." It also depicts SDS-PAGE analysis of phage created using the scheme outlined above in the lane labeled "phage." In addition to the expected NisA-pIII fusion peptide at ~25 kDa, the purified cytoplasmic fraction contains a band at ~40 kDa that likely corresponds to NisC and a band at -100 kDa that likely corresponds to NisB. These proteins are frequently co-purified with NisA. In the phage lane, phage coat proteins pVI, pVII, pVIII, and pIX are observed as a smear between 10 and 15 kDa. The NisA-pIII fusion is again observed at ~25 kDa. Note that pill runs at approximately 60 kDa, consistent with the literature (van Wezenbeek, P.M.G.F., Hulsebos, T.J.M., and Schoenmakers, J.G.G.
"Nucleotide sequence of the filamentous bacteriophage M13 DNA genome: comparison with phage fd," Gene. 11: 129-148 (1980)).
[29] FIG. 4B depicts an exemplary MALDI-TOF-MS spectrum of modified NisA displayed on phage. The modified NisA was extracted from an excised, trypsin-digested SDS-PAGE gel fragment corresponding to NisA-pIII fusion. Expected mass of NisA [M+H- 8H20] 3352.5 Da. Observed mass 3353.4 Da. The peak marked with * is an oxidation peak [M+H-8H20+16]. The peak marked with♦ may represent a single dehydration of NisA or may be a trypsin-related peak.
[30] FIG. 4C depicts the molecular structure of nisin (for a shorthand notation, see FIG. 1). Trypsin cleavage sites within nisin are shown in red. When modifications are introduced trypsin does not readily cleave after the designated lysines. Hence, since the leader peptide ends in Arg, and since the last residue of nisin is Lys, treatment of nisin-displaying phage with trypsin, releases the mature nisin (provided it has been posttranslationally modified) as shown in FIG. 4B. [31] FIG. 4D depicts a comparison of exemplary MALDI-MS spectra of authentic nisin containing fully and partially dehydrated nisin, trypsin-digested nisin intermediates purified from the cytoplasmic portion of E. coli SS320 expressing the phagemid and the modification plasmid, and modified NisA extracted from an excised, trypsin-digested SDS-PAGE gel fragment corresponding to NisA-pIII fusion displayed on phage.
[32] FIG. 5A depicts the process in which wild type Ml 3 phage infects the Gram-negative bacteria E. coli that display the F pilus, adapted from Bennett, N.J.; Gagic, D.; Sutherland- Smith, A.J.; Rakonjac, J., "Characterization of a dual-function domain that mediates membrane insertion and excision of Ff filamentous bacteriophage," J. Mol. Biol. 411, 972- 985 (2011).
[33] FIG. 5B depicts the proposed process in which phage displaying modified NisA may infect Gram-positive bacteria, leveraging the affinity of modified NisA for the diphosphate moiety of lipid II as a primary receptor in lieu of the F pilus.
[34] FIG. 5C depicts exemplary culture plates of Micrococcus luteus DSM1790,
Staphylococcus epidermidis ATCC 12228, and Bacillus subtilis ATCC 6633 infected with either phage displaying modified NisA or phage displaying unmodified (linear) NisA. The bacteria are grown on plates containing the antibiotic ampicillin, to which all three strains are sensitive. As the phage produced using the coexpression system designed above packages the phagemid which contains a beta lactamase gene, successful infection by the phage endows the bacteria with ampicillin resistance.
[35] FIG. 5D depicts an exemplary culture plate of Streptomyces cattleya DSM46488. As the genus Streptomyces is naturally resistant to ampicillin, the phagemid construct here was augmented to include a Streptomyces origin pSG5 as well as an apramycin resistance cassette.
[36] FIG. 5E depicts a 1% agarose electrophoresis gel amplifying the NisA through beta lactamase portion of the phagemid out of the Bacillus subtilis ATCC 6633 transformed by the phage system described above indicating successful transformation; lane key: 1, 21og DNA ladder markers 2, phage-transformed B. subtilis; 3, non-transformed B. subtilis.
[37] FIG. 6 depicts an exemplary peptide design for cyclic peptides containing a double ring structure in which a ProcA2.8 leader peptide was attached to a core region to lead to the formation of two rings. [38] FIG. 7 A depicts mass spectrometry analysis of the peptide 2.8-5 modified by ProcM in E. coli and treated with GluC. Calculated mass for M - 2 H2O + H for peptide 2.8-5: 2460.6 - 2 * 18 + 1 = 2425.6 Da, Obsrvd: 2424.1 Da.
[39] FIG. 7B depicts tandem mass spectrometry analysis of the peptide presented in FIG. 7A.
[40] FIG. 7C depicts mass spectrometry analysis of the peptide 2.8-9 modified by ProcM in E. coli and treated with GluC. Calculated mass for M - 2 H2O + H for peptide 2.8-9: 2438 - 2 * 18 + 1 = 2403 Da, Obsrvd 2402 Da.
[41] FIG. 7D depicts tandem mass spectrometry analysis of the peptide presented in FIG. 7C.
[42] FIG. 7E depicts mass spectrometry analysis of the peptide 2.8-10 modified by ProcM in E. coli and treated with GluC. Calculated mass for M - 2 H2O + H for peptide 2.8-10: 2468.8- 2 * 18 + 1 = 2432.8 Da, Obsrvd: 2432 Da.
[43] FIG. 7F depicts tandem mass spectrometry analysis of the peptide presented in FIG. 7E.
[44] FIG. 8A depicts an approach for yeast surface display of lanthipeptides, wherein peptides must be heterologously expressed in yeast, transferred to the secretion machinery, and modified prior to being displayed on the yeast surface.
[45] FIG. 8B depicts prochlorosin 1.1 (panel (i)), which can be used as scaffolds (panels (ii) and (iii)) for library production, with randomized amino acids incorporated at various locations within their structures (red circles). Sequences within rings or between rings can be randomized, or amino acids within rings or between rings can be deleted or inserted.
[46] FIG. 8C depicts prochlorosin 2.8 (panel (i)), which can be used as scaffolds (panel (ii)) for library production, with randomized amino acids incorporated at various locations within their structures (red circles). An example is shown of inserting amino acids in the left ring and deleting amino acids in the right ring.
[47] FIG. 9A depicts one construct for surface display of lanthipeptides, wherein the N- terminal LanA anchoring construct contains Aga2 followed by an Strep-tag II, a serine and glycine linker region, and the leader and core of the LanA (note that Aga2-LctA secretion is directed by Aga2's native secretion signal). [48] FIG. 9B depicts one construct for surface display of lanthipeptides, wherein the C-terminal LanA anchoring construct contains a secretion signal, the leader peptide of the LanA, a KEX2 cleavage site for in vivo removal of the leader peptide, the LanA core peptide, a serine and glycine linker region, Aga2, and HA epitope tad and a 10 histidine tag to facilitate purification.
[49] FIG. 9C depicts a representation for LanMs, wherein a secretion signal is present to target them to the ER and a retention tag to prevent them from being secreted.
[50] FIG. 10A depicts exemplary mass spectroscopy analysis of core peptides of Aga2- LctA N-terminal LanA fusion protein in the absence (panel ( )) or presence (panel (ii)) of N-ethylmaleimide (NEM) treatment. The N-terminal Aga2-LanA fusion construct exhibits the mass of the core peptide after protease digestion (LctA M+H: 3,594) with the expected losses of water (LctA: 4) and no NEM adducts illustrating full cyclization.
[51] FIG. 10B depicts exemplary mass spectroscopy analysis of core peptides of Aga2- ProcA 2.8 N-terminal LanA fusion protein in the absence (panel ( )) or presence (panel (ii)) of N-ethylmaleimide (NEM) treatment. The N-terminal Aga2 -ProcA 2.8 fusion construct exhibits the mass of the core peptide after protease digestion (ProcA 2.8 M+H: 2,527) with the expected losses of water (ProcA 2.8: 2) and no NEM adducts illustrating full cyclization.
[52] FIG. IOC depicts exemplary mass spectroscopy analysis of core peptides of
Aga2-HalA2 2.8 N-terminal LanA fusion protein in the absence (panel (i)) or presence (panel (ii)) of N-ethylmaleimide (NEM) treatment. The N-terminal Aga2-HalA2 fusion construct exhibits the mass of the core peptide after protease digestion (HalA2 M+H: 3,554) with the expected losses of water (HalA2: 7) and no NEM adducts illustrating full cyclization.
[53] FIG. 10D depicts an exemplary mass spectroscopy analysis of core peptides of C-terminal LctA fusion proteins in the absence (panel (i)) or presence (panel (ii)) of
N-ethylmaleimide (NEM) treatment. The LctA-Aga2 construct exhibits the mass of the core peptide following protease digestion (M+H: 3,129) with a loss of 4 waters and a small amount of a single NEM adduct.
[54] FIG. 10E depicts structural representation of lacticin 481 (panel (i)), cinnamycin (panel (ii)) and Hala (panel (iii)), one of the two components of haloduracin. Dha, dehydroalanine; Dhb, dehydrobutyrine; Abu, 2-aminobutyric acid. The shorthand notation introduced in FIG. 1 is used. [55] FIG. 11A depicts an exemplary flow cytometry analysis showing no Aga2-LctA presentation on the surface of uninduced yeast.
[56] FIG. 11B depicts an exemplary flow cytometry analysis showing the Aga2-LctA construct is displayed on the surface of the yeast induced to co-express Aga2-LctA and the respective LctM.
[57] FIG. llC depicts an exemplary flow cytometry analysis showing the Aga2-ProcA 2.8 construct is displayed on the surface of the yeast induced to co-express Aga2-ProcA 2.8 and the respective ProcM.
[58] FIG. 11D depicts an exemplary flow cytometry analysis showing the Aga2-HalA2 construct is displayed on the surface of the yeast induced to co-express Aga2-HalA2 and the respective HalM2.
[59] FIG. HE depicts an exemplary flow cytometry analysis showing the LctA-Aga2 construct is displayed on the surface of the yeast induced to co-express LctA-Aga2 and LctM.
[60] FIG. 11F depicts an exemplary MALDI-TOF MS analysis showing the core peptide from Aga2-HalA2 is 7-fold dehydrated and no iodoacetamide (IAA) adducts are observed indicating full cyclization.
[61] While the present invention is amenable to various modifications and alternative forms, exemplary aspects thereof are shown by way of example in the drawings and are herein described in detail. It should be understood, however, that the description of exemplary aspects is not intended to limit the invention to the particular forms disclosed, but on the contrary, the intention is to cover all modifications, equivalents and alternatives falling within the spirit and scope of the invention as defined by the aspects above and the claims below. Reference should therefore be made to the aspects and claims herein for interpreting the scope of the invention.
DETAILED DESCRIPTION
[62] The methods now will be described more fully hereinafter with reference to the accompanying drawings, in which some, but not all permutations and variations of aspects of the invention are shown. Indeed, the invention may be embodied in many different forms and should not be construed as limited to the aspects set forth herein. These aspects are provided in sufficient written detail to describe and enable one skilled in the art to make and use the invention, along with disclosure of the best mode for practicing the invention, as defined by the claims and equivalents thereof.
[63] Likewise, many modifications and other aspects of the methods described herein will come to mind to one of skill in the art to which the invention pertains having the benefit of the teachings presented in the foregoing descriptions and the associated drawings. Therefore, it is to be understood that the invention is not to be limited to the specific aspects disclosed and that modifications and other aspects are intended to be included within the scope of the appended claims. Although specific terms are employed herein, they are used in a generic and descriptive sense only and not for purposes of limitation.
[64] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of skill in the art to which the invention pertains. Although any methods and materials similar to or equivalent to those described herein can be used in the practice or testing of the present invention, the preferred methods and materials are described herein.
[65] Certain terms are first defined. Additional terms are defined throughout the specification.
[66] Terms used herein are intended as "open" terms (for example, the term "including" should be interpreted as "including but not limited to," the term "having" should be interpreted as "having at least," the term "includes" should be interpreted as "includes but is not limited to," etc.).
[67] Furthermore, in those instances where a convention analogous to "at least one of A, B and C, etc." is used, in general such a construction is intended in the sense of one having ordinary skill in the art would understand the convention (for example, "a system having at least one of A, B and C" would include but not be limited to systems that have A alone, B alone, C alone, A and B together, A and C together, B and C together, and/or A, B, and C together.). It will be further understood by those within the art that virtually any disjunctive word and/or phrase presenting two or more alternative terms, whether in the description or figures, should be understood to contemplate the possibilities of including one of the terms, either of the terms, or both terms. For example, the phrase "A or B" will be understood to include the possibilities of "A" or Έ or "A and B." [68] All language such as "from," "to," "up to," "at least," "greater than," "less than," and the like, include the number recited and refer to ranges which can subsequently be broken down into sub-ranges as discussed above.
[69] A range includes each individual member. Thus, for example, a group having 1-3 members refers to groups having 1, 2, or 3 members. Similarly, a group having 6 members refers to groups having 1, 2, 3, 4, or 6 members, and so forth.
[70] The modal verb "may" refers to the preferred use or selection of one or more options or choices among the several described aspects or features contained within the same. Where no options or choices are disclosed regarding a particular aspect or feature contained in the same, the modal verb "may" refers to an affirmative act regarding how to make or use and aspect of a described aspect or feature contained in the same, or a definitive decision to use a specific skill regarding a described aspect or feature contained in the same. In this latter context, the modal verb "may" has the same meaning and connotation as the auxiliary verb "can."
[71] As used herein, the articles "a" and "an" refer to one or to more than one (for example, to at least one) of the grammatical object of the article.
[72] "About" and "approximately" shall generally mean an acceptable degree of error for the quantity measured given the nature or precision of the measurements. Exemplary degrees of error are within 20-25 percent (%), typically, within 10%, and more typically, within 5% of a given value or range of values.
[73] As used herein, "phagemid" or "phasmid" refers to a plasmid having at least a bacteriophage fl origin of replication and optionally a bacterial origin of replication. As disclosed herein, phagemids or phasmids can include additional genetic elements, such as a gene encoding a polypeptide capable of conferring an antibiotic resistance phenotype to a recipient host organism, as well as genes encoding additional polypeptides or chimera polypeptides.
[74] Headings, for example, (a), (b), (i) etc., are presented merely for ease of reading the specification and claims. The use of headings in the specification or claims does not require the steps or elements be performed in alphabetical or numerical order or the order in which they are presented. [75] The present disclosure describes robust platforms, systems and methods for synthesizing engineered lanthipeptides in vivo from recombinant organisms using phage display in bacteria and host surface display in yeast. The methods use lanthipeptide libraries as molecular reagents to survey diverse lanthipeptide species in which novel lanthipeptides are expressed in vivo in recombinant host organisms expressing lanthipeptide biosynthetic enzymes.
[76] Lanthipeptide-based phage display platforms
[77] In a first aspect, a platform for displaying lanthipeptides on Ml 3 phage is provided. The utility of the platform is demonstrated for displaying the lantibiotic nisin on Ml 3 phage. A previously developed nisin production system can be adapted for this purpose, in which the precursor peptide NisA is modified by the enzymes NisB and NisC in E. coli. (Shi, Y., Yang, X., Garg, N., and van der Donk, W. A. "Production of lantipeptides in Escherichia coli " J. Am. Chem. Soc. 133:2338-2341 (2010).) Phage display of nisin was envisioned by heterologous expression of the precursor peptide NisA fused to a phage display protein in the presence of the modifying enzymes NisB and NisC and the genes required for forming other phage components in E. coli. In this strategy, the NisA peptide fused to the phage display protein was modified in E. coli and incorporated with the phage components into phage displaying the corresponding lantibiotic. It is possible that the leader peptide of the modified NisA, once exported into the periplasm, may be cleaved by the OmpT protease. This would not affect the display of the nisin structure.
[78] M13 phage contains three to five pill proteins on Ml 3 phage that are responsible for the attachment of phage on to the pilus of E. coli during the infection process with which the phage propagates. This protein is the most common protein used for display of peptides, however fusing a peptide onto pill impairs its ability to recognize its native primary and secondary receptors. In conventional phage display, phagemid encodes for pill proteins that are fused to the displaying peptide, whereas helper phage M13K07 or VCSM13 encode for wild type pill sustaining the infection function.
[79] The phage display technique generally utilizes two main components. One is a phagemid or phasmid, which is a plasmid that contains an fl origin of replication enabling single stranded DNA replication observed in fl phage as well as a double-stranded origin of replication, which allows propagation as a plasmid in a bacterial host. In other words, a phagemid can replicate as a plasmid, and also can provide single stranded DNA that can be packaged into viral particles (FIG. 2A). The second component is a helper phage M13K07, which is an Ml 3 phage derivative with the mutation Met40Ile in pll. This helper phage carries an origin of replication from the pl5A plasmid and the kanamycin (Kan) resistance gene from Tn903 both inserted within the Ml 3 origin of replication, thus disrupting the M13 origin (FIG. 2B). (Qi, H., Lu, H., Qiu, H.-J., Petrenko, V., and Liu, A. "Phagemid Vectors for Phage Display: Properties, Characteristics and Construction," J. Mol. Biol. 417: 129-143 (2012).) M13K07 contains an E. coli origin and can replicate; however, in the absence of phagemid DNA, M13K07 will package the M13K07 plasmid in produced phage. In the presence of a phagemid bearing a wild-type M13 or fl origin, single-stranded phagemid is packaged preferentially over helper phage DNA and secreted into the culture medium.
[80] In phage display, the genetic material for synthesis of the phage structural genes is provided by infection of bacteria (for example E. coli cells), which are harboring a phagemid containing a fusion gene encoding the display peptide fused to a phage surface protein, by the helper phage (FIG. 2C). This approach allows expression of phage proteins and peptide- phage protein fusion in E. coli, which results in the assembly of phage displaying peptide- phage protein on their surfaces. In addition, preferential packaging of the phagemid over helper phage DNA is favored as packaging of wild-type Ml 3 or f 1 origin on the phagemid is more efficient than packaging of the helper phage genome due to its distorted phage origin (FIG. 2C).
[81] Peptides can be displayed either fused directly to the N-terminus of truncated pill via the peptide C-terminus or through fusion on the peptide N-terminus to a presentation peptide, which then hybridizes to the truncated pill (Sachdev S, S. "Engineering M13 for phage display," Biomol. Eng. 18:57-63 (2001).) An N-terminal display was chosen through direct fusion of the C-terminus of NisA to the truncated pill. It was believed such a fusion would still allow modification of NisA by NisB and NisC since modification of NisA fused to a membrane anchor protein has been previously reported (Bosma, T., Kuipers, A., Bulten, E., de Vries, L., Rink, R., and Moll, G. N. "Bacterial Display and Screening of Post- translationally ThioetherStabilized Peptides," Appl. Environ. Microb. 77:6794-6801 (2011)). Moreover, such a display would expose the N-terminus of NisA, thereby allowing it to interact with its natural target since the N-terminus of nisin binds to lipid II (Hsu, S. T., Breukink, E., Tischenko, E., Lutters, M. A., De Kruijff, B., Kaptein, R., Bonvin, A. M., and Van Nuland, N. A. "The nisin-lipid II complex reveals a pyrophosphate cage that provides a blueprint for novel antibiotics," Nat. Struct. Mol. Biol. 11:963-967 (2004)). Additionally, it would allow removal of the leader peptide, which could be accomplished either by cleavage from an endogenous protease in E. coli or through incubation of the final construct with a protease, while maintaining modified NisA fused to the phage. Previous studies showed that addition of N-terminal tags such as histidine tags to the lanthipeptide precursor peptides did not prevent the activity of lanthipeptide synthetases. (Chatterjee, C, Paul, M., Xie, L., and van der Donk, W. A. "Biosynthesis and Mode of Action of Lantibiotics," Chem. Rev.
105:633- 684 (2005).) Therefore, the modifying enzymes were expected to accept their substrates fused directly to pill and augmented on the N-terminus with a signal peptide and hexahistidine tag.
[82] Phage propagates at 30 °C instead of 18 °C, which is the temperature used for the E. coli coexpression system described for the lantibiotics employed in this study. (Okesli, A., Cooper, L. E., Fogle, E. J., and van der Donk, W.A. "Nine Post-translational Modifications during the Biosynthesis of Cinnamycin," J. Am. Chem. Soc. 133: 13753-13760 (2011); Shi, Y., Yang, X., Garg, N., and van der Donk, W.A. "Production of lantipeptides in Escherichia coli," J. Am. Chem. Soc. 133:2338-2341 (2010).) Therefore, one potential concern was incomplete modification of the peptides displayed on phage due to non- functioning enzymes at 30 °C. In order to test whether the enzymes can work at 30 °C, NisA was coexpressed with NisB and NisC at 30 °C. Analysis of the isolated NisA peptide by MALDI-ToF MS showed that the NisA was completely modified demonstrating that this temperature can be successfully employed for nisin production.
[83] FIG. 3 depicts a preferred embodiment of the phage system. The gene encoding the precursor peptide NisA was successfully cloned into the designed phagemid. Modified NisA was displayed on phage by transforming E. coli SS320 with the phagemid and the modification plasmid, then growing the bacteria at 37 °C to OD6oonm between 0.3 and 0.5 as the infectivity of the helper phage drops precipitously above OD6oonm = 0.5. Then M13K07 was added to a multiplicity of infection of approximately 7 to provide the phage structural genes, isopropyl β-D-l-thiogalactopyranoside (IPTG) was added to a final concentration of 0.8 mM to induced expression of the NisA-pIII fusion protein, and arabinose was added to a final concentration of 0.04% w/v to induce expression of T7 polymerase which in turn expressed NisB and NisC. Cells were then allowed to grow for one hour at 37 °C to ensure infection. Kanamycin was then added to kill any uninfected cells and the temperature was reduced to 30 °C to ensure optimal production of phage. The culture was allowed to continue to grow overnight, then the cells were removed by centrifugation. The phage was then isolated from the supernatant of the cell culture via PEG precipitation.
[84] As the NisA-pIII fusion protein represents an exceedingly small portion of the total phage proteins isolated, the phage was resolved into its component proteins by SDS-PAGE prior to mass spectrometry analysis. Phage was denatured by boiling in Laemmli buffer for 5 minutes, and the denatured phage proteins were loaded onto a 4-20% Tris-glycine gel and separated by SDS-PAGE. Comparison of the bands separated via SDS-PAGE to a ladder of proteins of known molecular weight showed that both wild type pill and the NisA-pIII fusion peptide were expressed and present on the phage (FIG. 4A). Additionally, comparison of the NisA-pIII fusion peptide to that isolated from the cytoplasm of a cell expressing the phagemid and modification plasmid but not infected with helper phage provided additional verification that the observed protein was indeed the expected fusion of NisA-pIII.
[85] In order to verify that the dehydration modification had indeed occurred, the band corresponding to the NisA-pIII fusion on phage was excised from the polyacrylamide gel. The excised gel slice was then digested with trypsin and the tryptic peptides extracted using a protocol adapted from the literature (Lavigne, R., Ceyssens, P. -J., Robben, J., "Phage
Proteomics: Applications of Mass Spectrometry." In: Clokie, M.R.J., and Kropinski, A.M. (Eds.), Bacteriohpages: Methods and Protocols, Volume 2: Molecular and Applied Aspects, vol. 502. Humana Press, New York, NY, 2009, pp. 239-254). The excised slice was analyzed via MALDI-TOF-MS and contained a fragment corresponding to fully dehydrated NisA
(FIG. 4B). Trypsin does not cut inside fully modified nisin (FIG. 4C).
[86] SecA accepts unfolded proteins and threads them through the transmembrane channel and is known to not accept molecules larger than 2.8 nm. (Bonardi, F., Halza, E., Walko, M., Du Plessis, F., Nouwen, N., Feringa, B. L., and Driessen, A. J. M. "Probing the SecYEG translocation pore size with preproteins conjugated with sizable rigid spherical molecules," P. Natl. Acad. Sci. 108:7775-7780 (2011).) On the other hand the twin-arginine transport (tat) pathway, another major export pathway in E. coli, is known to transport large molecules such as proteins which are only fully-folded in the cytoplasm (Berks, B., Sargent, F., and Palmer, T. "The Tat protein export pathway," Mol Microbiol 35:260 - 274 (2000)), allowing more time in the cytoplasm before the export. (Thomas, J. D., Daniel, R. A., Errington, J., and Robinson, C. "Export of active green fluorescent protein to the periplasm by the twin- arginine translocase (Tat) pathway in Escherichia coli," Mol. Microbiol. 39:47-53 (2001).) Therefore, in order to display fully-modified nisin on phage, we focused on transporting nisin via twin arginine transport (tat)-pathway. This would increase the contact time between NisA and the enzymes NisB and NisC before the export into the periplasm, and help the formation of fully-modified nisin before the export.
[87] As a comparison to the peptide displayed on phage, E. coli SS320 was transformed with the phagemid and the modification plasmid. The bacterial culture was then grown at 37 °C to OD6oonm between 0.3 and 0.5, after which isopropyl β-D-l- thiogalactopyranoside (IPTG) was added to a final concentration of 0.8 mM to induce expression of the NisA-pIII fusion protein, and arabinose was added to a final concentration of 0.04% w/v to induce expression of T7 polymerase which in turn expressed NisB and NisC. Cells were then allowed to grow overnight at 30 °C. Then the cells were pelleted by centrifugation. The cells were resuspended in denaturing buffer (8M urea, 100 mM Tris-Cl, pH 8.0) and lysed by freezing at -80 °C and thawing. The lysate was clarified by centrifugation and then loaded onto Ni-NTA resin. The resin was washed with wash buffer (8M urea, 100 mM Tris-Cl, pH 6.3) and eluted in elution buffer (8M urea, 100 mM Tris-Cl, pH 4.5). The resulting eluent was diluted, digested with trypsin, and analyzed with MALDI-MS. Surprisingly, the analysis revealed a trypsin fragment, which corresponds to 7-fold dehydrated NisA rather than the full 8-fold dehydrated peptide, which was observed on the phage (FIG. 4D). The build up of 7- fold dehydrated NisA inside the E. coli cells but not on the phage suggests that the 7-fold dehydrated NisA is not readily exported via the Tat pathway. The absence of 8-fold dehydrated NisA inside the E. coli cells suggests that the fully dehydrated species is readily exported via the Tat pathway and hence not observed in the cytoplasmic fraction.
[88] In wild type M13 bacteriophage, the N-terminal domains of pill (denoted "Nl" and "N2") recognize the TolA and F pilus receptors, respectively, and after engaging these secondary and primary receptors the C-terminal portion of pill interacts with either the TolQ or TolR protein to insert into the inner membrane of E. coli and inject the DNA (FIG. 5A). Based on the known affinity of nisin for the diphosphate moiety of lipid II, it was believed that phage displaying modified NisA may be capable of infecting Gram-positive bacteria by using the diphosphate of lipid II as the primary receptor site and then allowing the C-terminal portion of pill to mediate infection through the conserved TolQ/TolR proteins (FIG. 5B). Successful infection of bacteria by the phage would transfer the phagemid including its ampicillin resistance gene into the infected bacteria. Expression of this gene would lead to resistance in the bacteria against ampicillin. Phage was made as above then incubated with bacteria in exponential phase growth for 30 minutes to 1 hour. The bacteria were then pelleted, resuspended in a minimal amount of media, and spread on one half of an agar plate containing ampicillin (FIG. 5C). As a negative control, the modification plasmid was not transformed into the system and phage was thus made displaying the linear NisA-pIII peptide only. These cells were plated on the second half of the plate. Results indicated that the phage displaying modified NisA and not the phage displaying linear NisA was capable of infecting bacteria (FIG. 5C).
[89] These results suggest that the posttranslational modifications to NisA are necessary for the infectivity of the phage, consistent with the interaction between lipid II and nisin displayed on phage mediating the transformation. Furthermore, a minimal biocontainment advantage is afforded by the system. Since the NisB and NisC genes are not on the phagemid that is packaged in the phage, any NisA produced in phage generations post nisin-mediated infection of a host would be in the linear form and unable to interact with its target, thus eliminating the general nisin-mediated infectivity. Non-infectivity is also ensured by the absence of phage genes on the phagemid.
[90] In order to broaden the range of bacteria which could be infected by the phage, the phagemid was augmented with the pSG5 origin and apramycin resistance cassette from the pCRISPomyces-2 plasmid (Cobb, R.E., Wang, Y., Zhao, H., "High-Efficiency Multiplex Genome Editing of Streptomyces Species Using an Engineered CRISPR/Cas System," ACS Synth. Biol., 4 (6), 723-728 (2015). Using procedures similar to those described above, phage was produced both with and without expression of the modification plasmid in order to generate phage displaying modified NisA and linear NisA respectively. Streptomyces cattleya DSM46488 was then incubated for 6 to 12 hours with the indicated phage and plated on selective media. The result again confirmed that the phage displaying the modified NisA was significantly more infective than the phage displaying the linear NisA (FIG. 5D).
[91] To demonstrate that the phagemid DNA was indeed transferred into the bacteria, a sample of B. subtilis ATCC6633 transformed by the phage displaying NisBC-modified NisA was grown overnight in a liquid culture of LB with 25 g/mL ampicillin. A separate culture of B. subtilis ATCC6633 which was not incubated with phage was also grown overnight. A PCR reaction was then performed which amplified the phagemid DNA sequence from the start of the NisA gene to the end of the beta lactamase gene. Both of these cultures of B. subtilis ATCC6633 were used as a template in separate PCR reactions. A 2 kbp fragment was only amplified from the culture of B. subtilis ATCC6633 transformed with the phage (FIG. 5E). This suggests that the phagemid DNA is indeed delivered into the bacteria and is responsible for the resistance.
[92] Phage display libraries can be designed for use of the highly promiscuous enzyme ProcM. This enzyme has 30 natural substrates composed of a highly conserved leader domain attached to highly diverse core regions containing serines/threonines and cysteines at different positions. (Li, B., Sher, D., Kelly, L., Shi, Y., Huang K., Knerr P. J., Joewono I., Rusch D. Chisholm, S.W., and van der Donk, W.A. (2010) "Catalytic promiscuity in the biosynthesis of cyclic peptide secondary metabolites in planktonic marine cyanobacteria," Proc. Natl. Acad. Sci., USA 107: 10430-10435 (2010) Zhang, Q., Yang, X., Wang, H., van der Donk, W.A. (2014) "High divergence of the precursor peptides in combinatorial
lanthipeptide biosynthesis" ACS Chem. Biol. 2686-2694.) Therefore, ProcM was considered a good candidate for constructing a library of peptides containing two lanthionine crosslinks (FIG. 6).
[93] The peptides in the library consisted of the ProcA2.8 wild type leader sequence attached to a core region coding for C(X)5SMPPS(X)5C (SEQ ID NO.: 9), where X is an amino acid encoded by the NWY degenerate codon. The peptides were encoded in a pPvSFDuet-1 vector containing the gene encoding for ProcM. The NWY codon was selected for the library because it does not encode for Cys or Ser/Thr, and therefore would not complicate lanthionine formation at the designed positions. Twenty clones were investigated as shown in Table 1.
[94] Table 1. Randomized peptides possessing the ProcA 2 .8 wild type leader peptide attached to a core region with the sequence C(XXX)sS MPP S(XXX)5 C.
Major
ID dehydraIAA/NEM
Core peptide sequence Conclusion
[SEQ ID NO.: -] tions by alkylation
MS
Library 2A
2.8- -1 [SEQ ID NO.: 10] AACFNVHISMPPSHNNVHC -2 H20 No IAA adduct 2 rinj
2.8- -2 [SEQ ID NO.: 11] AACDVNLHSMPPSLDFFVC -2 H20 No IAA adduct 2 rinj
2.8- -3 [SEQ ID NO.: 12] AACVFHFDSMPPSYLDDDC -2 H20 No IAA adduct 2 rinj
2.8- -4 [SEQ ID NO.: 13] AACNIDFLSMPPSIHHILC -2 H20 No NEM adduct 2 rinj
2.8- -5 [SEQ ID NO.: 14] AACNIYYISMPPSHHFVYC -2 H20 No NEM adduct 2 rinj
2.8- -6 [SEQ ID NO.: 15] AACHDNNNSMPPSFYHIFC -2 H20 No NEM adduct 2 rinj
2.8- -7 [SEQ ID NO.: 16] AACHLNYNSMPPSFHILFC -2 H20 No NEM adduct 2 rinj
2.8- -8 [SEQ ID NO.: 17] AACLNNLVSMPPSNIVVYC -2 H20 No NEM adduct 2 rinj
2.8- -9 [SEQ ID NO.: 18] AACNIHIYSMPPSNNHFNC -2 H20 No NEM adduct 2 rinj
2.8- -10 [SEQ ID NO. .: 19] AACHDINLSMPPSFLNVIC -2 H20 No NEM adduct 2 rinj
2.8- -11 [SEQ ID NO. .: 20] AACILYLISMPPSNIFNDC -2 H20 No NEM adduct 2 rinj
2.8- -12 [SEQ ID NO. .: 21] AACFFDINSMPPSDDLYLC -2 H20 No NEM adduct 2 rinj
2.8- -13 [SEQ ID NO. .: 22] AACLIVDYSMPPSIDNHLC -2 H20 No NEM adduct 2 rinj
2.8- -14 [SEQ ID NO. .: 23] AACHINRISMPPSDIVDFC -2 H20 No NEM adduct 2 rinj Major
ID dehydraIAA/NEM
Core peptide sequence Conclusion
[SEQ ID NO.:. -] tions by alkylation
MS
2.8-15 [SEQ ID NO.: : 24] AACHHNNLSMPPSDYFVLC -2 H20 No NEM adduct 2 rinj
2.8-16 [SEQ ID NO.: : 25] AACNDNNISMPPSIVFDFC -2 H20 No NEM adduct 2 rinj
2.8-17 [SEQ ID NO.: : 26] AACIVNYHSMPPSLNILYC -2 H20 No NEM adduct 2 rinj
2.8-18 [SEQ ID NO.: : 27] AACHLHILSMPPSVYIFLC -2 H20 No NEM adduct 2 rinj
2.8-19 [SEQ ID NO.: : 28] AACNFLVDSMPPSLFVIIC -2 H20 No NEM adduct 2 rinj
Figure imgf000022_0001
examples that were tested for dehydration and cyclization.
[95] Peptides 2.8-5, 2.8-9, and 2.8-10 were coexpressed with ProcM and purified by IMAC followed by RP-HPLC. The analysis of the peptides by MALDI-ToF tandem mass spectrometry after GluC endoproteinase cleavage showed that ProcM dehydrated and cyclized all three peptides (FIG. 7A-F).
[96] Previous attempts to produce nisin using export via sec-pathway in its producing strain Lactococcus lactis and in B. subtilis failed to isolate any bioactive material although fully-dehydrated NisA peptide was obtained from this system. (Kuipers, A., Wierenga, J., Rink, R., Kluskens, L. D., Driessen, A. J. M., Kuipers, O. P., and Moll, G. N. "Sec-Mediated Transport of Posttranslationally Dehydrated Peptides in Lactococcus lactis," Applied and Environmental Microbiology 72:7626-7633 ((2006).) In another study however, sec-pathway in E. coli was shown to export post-translationally biotinylated and phosphopantethemylated recombinant proteins successfully, suggesting that sec-transport mechanism can carry post- translationally modified molecules across the membrane. (Chen, N., Hong, F. L., Wang, H. H., Yuan, Q. H., Ma, W. Y., Gao, X. N., Shi, R., Zhang, R. J., Sun, C. S., and Wang, S. B. "Modified Recombinant Proteins Can Be Exported via the Sec Pathway in Escherichia coli," PLoS ONE 7:e42519 (2012).)
[97] Phage display of lanthipeptides can enable the preparation of thioether-containing cyclic peptide libraries to advance or alter current properties of lantibiotics and/or to select for binders to new targets. Phage display of nisin may be useful for finding binders to molecules with structures similar to the pyrophosphate on lipid II and/or to solve nisin's instability problem at physiological conditions by forming phage libraries displaying nisin- like peptides. To this end the inventors have successfully produced prochlorosins, cinnamycin, haloduracin, and lacticin 481 in E. coli and the processing enzymes have been shown to have high tolerance for different substrates. Especially ProcM, the lanthionine synthetase of prochlorosins, may be very valuable to prepare lanthionine-containing peptide libraries as it can naturally process 30 substrates with rings that vary in size and place. (Tang, W., and van der Donk, W. A. "Structural Characterization of Four Prochlorosins: A Novel Class of Lantipeptides Produced by Planktonic Marine Cyanobacteria," Biochemistry
51:4271-4279 (2012); Li, B. et al. (2010). Zhang, Q. et al. (2014)). In addition, as described above, ProcM successfully processed all 20 non-natural ProcA analogs tested. Therefore, this method can be expanded for phage display of other lanthipeptides, which would enable preparation of cyclic peptide libraries with thioether crosslinks providing different scaffolds.
[98] Yeast surface display of lanthipeptides
[99] In another aspect, a platform for lanthipeptide expression by yeast surface display is provided. As lanthipeptides are genetically encoded, they lend themselves to the facile production of libraries through combinatorial DNA synthesis. The high throughput nature of yeast display and fluorescent activated cell sorting (FACS) in conjunction with the lanthipeptide biosynthetic machinery can provide for the directed evolution of new lanthipeptides that can disrupt specific protein-protein interactions.
[100] Two obstacles must be overcome for the robust utilization of this technique. First, a system must be developed to install post-translational modifications in the peptides prior to their export and anchoring to the cell surface. Second, one must determine an appropriate scaffold or scaffolds to generate these cyclic peptide libraries (FIG. 8). The inventors have focused on a well-established method of yeast display where the protein of interest is fused to a subunit of the yeast mating protein, agglutinin. (Boder, E. T.; Wittrup, K. D. "Yeast surface display for screening combinatorial polypeptide libraries," Nat Biotechnol 15:553-7 (1997).) Agglutinin is a heterodimer with the two subunits covalently linked through two disulfide bridges. One subunit, Agal, is covalently anchored to the cell wall and the other subunit, Aga2, is anchored to it via the disulfide linkages. Fusions can be made on the N- terminus or C-terminus of Aga2 for display. This system in conjunction with fluorescence-activated cell sorting (FACS) has been used successfully for the directed evolution of bioreceptors such as antibodies (Boder, E. T.; Midelfort, K. S.; Wittrup, K. D., "Directed evolution of antibody fragments with monovalent femtomolar antigen-binding affinity," Proc Natl Acad Sci USA 2000, 97: 10701-5 (2000)) and T cell receptors (Kieke, M. C; Shusta, E. V.; Boder, E. T.; Teyton, L.; Wittrup, K. D.; Kranz, D. M., "Selection of functional T cell receptor mutants from a yeast surface-display library," Proc Natl Acad Sci U SA 96:5651-6 (1999)). This system is being used to display the well-characterized lanthipeptides lacticin 481, prochlorosin 2.8, and haloduracin β on the surface of yeast cells. By tuning the subcellular localization of the modifying enzymes, the timing of expression of these modifying enzymes and their substrate peptides, and their overall expression levels, fully modified lanthipeptides can be produced as determined by comparison to authentic standards. Our initial approach to library construction is to use the prochlorosins 1.1 and 2.8 as scaffolds as these have been shown to be robust and amenable to library generation. Libraries can be generated through degenerate DNA synthesis to encode for randomized amino acids within their native rings and between their rings, as well as insertions or deletions within their native rings and between their rings. Peptides from these libraries will be examined for their extent of cyclization and their ability to bind fluorescently labeled proteins or small molecules like lipid II will be determined using FACS.
[101] Synthetic genes codon optimized for expression in S. cerevisiae encoding LanAs and LanMs have been produced for each system. Both N-terminal (FIG. 9A) and C-terminal (FIG. 9B) Aga2 fusions were tested for anchoring the LanA to the cell surface. The genes encoding LanMs contain an N-terminal secretion signal as well as a C-terminal endoplasmic reticulum (ER) retention signal (FIG. 9C). To determine whether the LanA-Aga2 fusion proteins are still a substrate for a LanM, the construct N-terminal anchoring of lacticin 481, Aga2-LctA, prochlorosin 2.8, Aga2-ProcA 2.8, and haloduracin β, Aga2-HalA2, and C- terminal anchoring of lacticin 481, LctA-Aga2, were cloned into E. coli expression plasmids and coexpressed with the cognate LanM, LctM, ProcM, and HalM2, respectively. After purification by immobilized metal affinity chromatography (IMAC), digestion by the appropriate proteases, trypsin for Aga2-LctA, Glu-C for Aga2-ProcA 2.8 and Aga2-HalA2, and trypsin and Glu-C for LctA-Aga2, and further purification by reverse phase
chromatography, the LanA core peptides were examined my matrix-assisted laser desorption/ionization time of flight mass spectrometry (MALDI-TOF MS) to determine the extent of dehydration. All peptides exhibited masses corresponding to the expected number of dehydrations from the respective wild type lanthipeptides (FIG. 10A-E); the Aga2-LctA construct also exhibited a species corresponding to 5 dehydrations. Treatment with N- ethylmaleimide (NEM), which will react with cysteines not involved in thioether crosslinks, showed no changes in mass for the Aga2-LanA core peptides and a small amount of a single NEM adduct for the LctA-Aga2 core peptide (FIG. 10), indicating the core peptides are being cyclized as well as dehydrated. [102] With evidence of successful dehydration and cyclization in hand we proceeded to construct S. cerevisiae expression vectors for Aga2-LctA, Aga2-ProcA 2.8, Aga2-HalA2, and LctA-Aga2 with and without the respective LanM coexpression. After induction of expression, the yeast cells were assayed for the presence of surface displayed LanA by FACS based on detecting the HA epitope or Strep-Tag II. The presence of displayed protein was detected for all constructs (FIG. 11A-F). Aga2-HalA2 was then freed from the surface of the yeast by treatment with tris(2-carboxyethyl)phosphine (TCEP), enriched by streptactin chromatography, digested with Glu-C and analyzed by MALDI-TOF MS. A mass corresponding to the 7-fold dehydrated core peptide could be observed FIG. 11F), indicating dehydrated Aga2-HalA2 is being displayed on the yeast surface. Treatment with
iodoacetamide (IAA), which will react with cysteines not involved in thioether crosslinks, showed no change in mass, suggesting Aga2-HalA2 displayed on the yeast surface is fully cyclized as well. These studies demonstrate the feasibility of displaying lanthipeptides on the surface of yeast cells to be used for the directed evolution of lanthipeptides capable of binding novel targets.
[103] Clinical Applications
[104] In addition to its potential as an agent for the transformation of bacteria in a laboratory setting, such infectious phage could be leveraged in a clinical setting as a novel means of bacteriophage therapy. Current strategies for bacteriophage therapies primarily leverage lytic phage to lyse the infectious bacteria. Such strategies share many liabilities, including the potential to induce septic shock in the patient by the rapid lysis and release of virulence factors from many bacteria, the uncertain concentration of the phage in the body following the initial dosing since the lytic phage uses its host bacteria to replicate, the narrow range of bacteria on which a given lytic phage can act due to its receptor specificity, and the rapid development of resistance to the phage (Labrie, S.J., Samson, J.E., Moineau, S., "Bacteriophage Resistance Mechanisms," Nat. Rev. Microbiol. 8: 317-327 (2010)).
Filamentous phage displaying modified NisA overcomes many of these natural limitations of lytic phage. Since a filamentous phage can be engineered to introduce any desired gene into bacteria that it can infect, the filamentous phage can avoid the potential of wholesale lysis and release of infectious proteins by introducing a gene deletion system to target a specific virulence factor or a key metabolic pathway of a single species of bacteria. Such a phage would also introduce less stringent selective pressure for bacterial variants that could avoid phage infection since the phage would render the bacteria less harmful rather than kill it. Additionally, documented nisin resistance among Gram-positive bacteria is remarkably low and the phage leverages a nisin or nisin-like moiety for infection. Thus, a low incidence of resistance is expected despite the phage having a wide range of infectivity among Gram- positive bacteria. This offers the additional benefit to circumvent the clinical diagnosis challenge of determining which phage will effectively infect the pathogenic bacteria prior to treatment. Moreover, as the modified NisA-displaying phage is unable to replicate, the amount of phage dosed is the amount of phage present in the patient and biocontainment is assured.
[105] In view of the foregoing, platforms, phage, phagemid, systems and methods are provided for identifying engineered lanthipeptide display peptides expressed in vivo from biological organisms.
[106] In a first aspect, a platform for bacterial phage display of a lanthipeptide is provided. The platform includes: a phagemid including a lanthipeptide display system; a helper phage; and a bacterial host organism configured to express one or more lanthipeptide biosynthesis enzymes.
[107] In the first respect, the lanthipeptide display system includes a fusion gene encoding an open reading frame having a N-terminal secretion signal, a lanthipeptide display peptide and a pill protein. In one respect, the lanthipeptide display peptide includes a nisin peptide. In another respect, the phagemid is capable of being rescued by the helper phage, wherein the helper phage includes a M13 phage. In this respect, the M13 phage is M13K07. In several respects, the platform includes a bacterial host organism being E. coli. In several respects, the one or more lanthipeptide biosynthesis enzymes include NisB or NisC, or a combination thereof.
[108] In a second aspect, a phage for displaying a lanthipeptide is provided. The phage is made according to the platform of any of the respects of the first aspect. The phage is configured to infect a bacterial host organism including a Gram-positive bacterium.
[109] In a third aspect, a platform for cell surface display of a lanthipeptide is provided. The platform includes: a lanthipeptide display system; and a yeast host organism configured to express one or more lanthipeptide biosynthesis enzymes.
[110] In one respect, the lanthipeptide display system includes a fusion gene encoding an open reading frame having a lanthipeptide display peptide and an Aga2 protein. In another respect, the yeast host organism is S. cerevisiae. In another respect, the one or more lanthipeptide biosynthesis enzymes include a LanM family enzyme.
[Ill] In a fourth respect, a lanthipeptide display system is provided. The lanthipeptide display system includes a gene chimera encoding a fusion peptide including a lanthipeptide display peptide and a presentation peptide. The presentation peptide anchors the
lanthipeptide display peptide on an outer biological surface. In one respect, the outer biological surface of the cell is selected from a phage surface or a host organism membrane. In another respect, the gene chimera encoding a fusion peptide including a lanthipeptide display peptide and a presentation peptide is expressed from one of a phagemid, a plasmid, a cosmid and a chromosome.
[112] In a fifth aspect, a lanthipeptide library display system is provided. The lanthipeptide library display system includes a lanthipeptide expression library having a plurality of gene chimeras. Each member of the plurality of gene chimeras encodes a fusion peptide including a lanthipeptide display peptide and a presentation peptide. The presentation peptide anchors the lanthipeptide display peptide on an outer biological surface. In this latter respect, the outer biological surface is selected from a phage surface or a host organism membrane. In other respects, each member of the plurality of gene chimeras is expressed from a uniform lanthipeptide expression library selected from one system consisting of a phagemid, a plasmid, a cosmid, and a chromosome.
[113] In a sixth aspect, a method of identifying a lanthipeptide display peptide expressed in vivo from a biological host organism is provided. The method includes several steps. The first step includes preparing a biological host library, wherein each member of the biological host library expresses a gene chimera encoding a fusion peptide including a lanthipeptide display peptide and a presentation peptide. The presentation peptide anchors the lanthipeptide display peptide on an outer biological surface of the biological host organism. The second step includes sorting the biological host library to form a candidate subset of the biological hosts that express the lanthipeptide display peptide. In some respects of the method, the sorting includes using fluorescence-activated cell sorting. In other respects of the method, the sorting includes using immunoassay.
[114] In a seventh aspect, a phagemid including a lanthipeptide display system is provided. In some respects, the lanthipeptide display system includes a fusion gene encoding an open reading frame having a N-terminal secretion signal, a lanthipeptide display peptide and a pill protein. In some respects, the lanthipeptide display peptide includes a nisin peptide. In other respects, the phagemid is capable of being rescued by the helper phage, wherein the helper phage includes a M13 phage. In these latter respects, the M13 phage is M13K07. In other respects, the phagemid is configured to produce a phage when propagated in a suitable bacterial host organism, wherein the phage is configured to infect a bacterial host organism including a Gram-positive bacterium.
EXAMPLES
Example 1. Molecular reagents
[115] Oligonucleotide primers for mutagenesis were synthesized by Operon Technologies or Integrated DNA Technologies. A listing of primers is provided in Tables 2 and 3.
[116] Table 2. Primers for Phage Display Aspects
Figure imgf000028_0001
[117] Table 3. Primer sequences for random lanthipeptide libraries 1 and 2 (5'-3')a
Name
[SEQ ID NO.:_] SEQUENCE (5' -» 3')
Lib2.8 2 EcoRI-5' AGC CAG GAT CCG AAT TCG ATG TCA GAA GAG CAA
[SEQ ID NO.: 41] CTG AAG GCA TTC CTC AC
Lib2.8 leader NotI-3'
TCC CCC AGC CAC ACC TTC CAG CTC
[SEQ ID NO.: 42]
TAA ATA TTG CGG CCG CTT AGC ARW NRW NRW NRW
Libl_2.8 _NWY_NotI-3'
NGG ATG GAG GCA TAG ARW NRW NRW NRW NRW
[SEQ ID NO.: 43]
NAC AGG CCG CTC CCC CAG CCA CAC
TAA ATA TTG CGG CCG CTT AGT AGC A W BMW BMW
Lib2 2C10S VWK NotI-3'
BMW BMW BMW BMW BMW BMW BMW BMW BAC TGT
[SEQ ID NO.: 44]
TGT AGT GAT GGT ATC CCC CAG CC
aN = A, T, C, G (25% molar ratio of each base); R = A, G (50% molar ratio of each base); W = A, T (50% molar ratio of each base); B = C, G, T (33.3% molar ratio of each base).
[118] Taq and Platinum Pfx DNA polymerases, Dpnl, restriction endonucleases, and bacteriophage T4 DNA ligase were purchased from Invitrogen. Phusion DNA polymerase was purchased from New England Bio labs (NEB). Cloning vectors (pET and pDuet) were obtained from Novagen. Agarose gel extraction, plasmid mini-prep, and PCR purification kits were purchased from Qiagen. HisTrap IMAC resin was purchased from GE Healthcare Life Sciences. Strep-Tactin resin was purchased from IBA. M13K07 helper phage (N0315S), and anti-M13 pill monoclonal antibody (E8033S) were obtained from NEB. Monoclonal anti-flag M2 antibody produced in mouse was purchased from Sigma (F3165). HA epitope tag antibody was purchased from Thermo Fisher Scientific. Alexa Fluor 488 goat anti-mouse antibody was purchased from Life Technologies. StrepMAB classic anti-StrepTag II antibody was purchased from IBA. ELISA plates (Nunc), and substrate for enzyme horseradish peroxidase (HRP) in ELISA studies, 1-step ultra TMB-ELISA (34028), was obtained from Thermo Fisher Scientific. Substrate for the HRP for western blot analysis was clarity western ECL substrate from Bio-rad (170-5060). All strains were grown in media acquired from Difco laboratories or Fisher Scientific. Other items procured include isopropyl-l-thio-D- galactopyranoside (IPTG, CalBiochem), iodoacetamide (IAA, Acros Organics), tris(2- carboxyethyl) phosphine hydrochloride (TCEP, Aldrich), and dithiothreitol (DTT, Sigma). Endoproteinases LysC, trypsin, GluC, and Factor Xa were purchased from Roche Applied Science.
Example 2. General methods
[119] Molecular biological manipulations were carried out using standard techniques. PCR was performed using an automatic thermocycler (PTC 150, MJ Research) and DNA sequencing was performed at the Biotechnology Center of the University of Illinois at Urbana-Champaign (UIUC) or by ACGT, Inc. E. coli DH5a cells (UIUC Cell Media
Facility) or DH10B-T1R (New England BioLabs) were used for plasmid preparation. E. coli SS320 (Lucigen Corporation) was used for phage production, and E. coli BL21 (DE3) cells (Stratagene) were used for protein expression. S. cerevisiae EBYIOO cells were used for yeast surface display. MALDI-ToF MS analyses were conducted at the Mass Spectrometry Facility (UIUC) using an UltrafleXtreme TOF/TOF (Bruker Daltonics). Liquid chromatography electrospray ionization tandem mass spectrometry (LC/ESI-MS/MS) was carried out and processed using a Synapt ESI quadrupole ToF Mass Spectrometry System (Waters) equipped with an Acquity Ultra Performance Liquid Chromatography (UPLC) system (Waters).
ELISA readings were performed with a Synergy H4 reader. Flow cytometry was carried out using a LSR II Flow Cytometer (BD Biosciences).
Example 3. Construction of a NisA-containing phagemid.
[120] The Tat signal peptide -hexahistidine tag-NisA construct was cloned out of a synthetic gene block (Integrated DNA Technologies) containing the Tat signal sequence from the trimethylamine N-oxide reductase protein followed by a hexahistidine tag and the precursor NisA peptide gene. The pJF3H phagemid was used to provide the backbone of the phagemid including the truncated pill protein (containing only residues 274-424), phage origin, beta lactamase, and dsDNA origin genes. Primers KJH_NisA_pTSP3H_FP and
KJH_NisA_pTSP3H_RP were used to clone the Tat-His6-NisA gene. Primers
KJH_pTSP3H_FP and KJH_pTSP3H_RP were used to clone the necessary genes from pJF3H. The PCRs (50 μΐ) included l HF buffer (NEB), Phusion DNA Polymerase (NEB) (0.02 unit^L), dNTPs (1 mM), template DNA, and primers (0.5 μΜ each). The amplification was conducted via 30 to 34 cycles of denaturing (98 °C for 15 s), annealing (temperature determined based on the NEB annealing temperature calculator and annealed for 30 s), and extending (72 °C for 45 to 120 s depending on the length of the amplified fragment), then a final elongation step (72 °C for 10 minutes). Both fragments were purified on a 1% agarose gel, purified using the QIAquik gel purification kit (QIAGEN), and a Gibson assembly was then performed to anneal the two cloned fragments into a singe phagemid. The entire Gibson reaction was then transformed into chemically-competent E. coli DH10B cells via heat shock, plated on an LB agar plate with 100 μg/mL ampicillin, and grown at 37 °C for 8-18 h.
Colonies were picked and incubated in 5 mL of LB-ampicillin medium at 37 °C for 12-20 h, followed by isolation of the plasmids using a QIAprep Spin Miniprep Kit (QIAGEN). The sequences of the resulting plasmids were confirmed by DNA sequencing.
Example 4. Preparation of the constructs for peptides attached to the ProcA leader 2.8
[121] Cloning of the genes encoding the library of peptides attached to the ProcA 2.8 leader peptide (Table 1) into pSEX81 was performed by using Ncol and Notl cut sites using the primers in Table 5.2, Flag_2.8_ProcA_ldr_pSEX81_NcoI_FP and
2.8_ProcA_ldr_Xiao_library_ pept._l_pSEX81_NotI_RP (or 2.8_ProcA_ldr_Xiao_ library_pept._l /Factor Xa/pSEX81_NotI RP) primers were used as forward and reverse primers to amplify the ProcA 2.8 leader peptide library 1 sequence from template 2.8- peptide l/pRSFDuet-l (see Table 2). The PCRs (50 μί) included l HF buffer
(Finnzymes), DMSO (4%), Fusion DNA Polymerase (Finnzymes) (0.02 unit^L), dNTPs (1 mM), template DNA, and primers (1 μΜ each). The amplification was conducted via 30 cycles of denaturing (98 °C for 10 s), annealing (60 °C for 30 s), and extending (72 °C for 15 s). The final PCR product was confirmed by 2% agarose gel electrophoresis, and the products were purified using QIAquick PCR purification kits (QIAGEN). The resulting DNA fragment and the pSEX81 vector were digested in 1 x NEBuffer 4 (New England Biolabs) with NcoI-HF and Notl-HF at 37 °C (for 15 h). The digested products were purified by agarose gel electrophoresis followed by use of a QIAquick gel extraction kit (QIAGEN). The resulting DNA insert was ligated with the digested pSEX81 vector at 16 °C for 15 h using T4 DNA ligase. The ligation reaction mixture was diluted 5 times with water prior to
transformation. E. coli DH5 cells were transformed with the ligation product via heat shock, plated on LB- ampicilin/0.2 % glucose agar plates, and grown at 37 °C for 15 h. Colonies were picked and incubated in 5 mL of LB-ampicillin medium at 37 °C for 15 h, followed by isolation of the plasmids using a QIAprep Spin Miniprep Kit (QIAGEN). The correct sequences of the resulting plasmids were confirmed by DNA sequencing. Example 5. Preparation of phage-displaying NisA and modified NisA
[122] Chemically competent E. coli SS320 cells (50 μί) were transformed with 50-100 ng of phagemid containing the desired gene, and plated on an LB agar plate containing Amp (100 μg/ml), Tet (10 μg/ml), and l%w/v glucose. In this step, Amp is required for the phagemid, Tet is required for the F episome coding for the F pilus, which is needed for helper phage infection, and glucose is to prevent the expression of NisA-pIII since it slows down the cell growth overnight at 37°C. After the plates were incubated overnight at 37 °C, a colony was picked and grown in 5 mL of 2><YT media (1.6% tryptone, 1.0% yeast extract, 0.5% NaCl, pH: 7, autoclaved) supplemented with Amp (100 μg/ml), Tet (5 μg/ml), and 1% glucose with shaking at 37 °C. Then, a 1 :20 inoculation of overnight liquid culture into fresh 2xYT media supplemented with Amp (100 μg/ml) was performed to make a culture of total volume 50 or 100 mL. The culture was grown to O.D.6oonm of 0.3-0.5. Then M13K07 was added to a multiplicity of infection of approximately 7 to provide the phage structural genes and isopropyl β-D-l-thiogalactopyranoside (IPTG) was added to a final concentration of 0.8 mM to induced expression of the NisA-pIII fusion protein. Cells were then allowed to grow for one hour with shaking at 37 °C to ensure infection. Kanamycin was then added to kill any uninfected cells and the temperature was reduced to 30 °C to ensure optimal production of phage. The culture was allowed to continue to grow overnight, then the cells were removed by centrifugation at 10500xg. The supernatant was then filtered through 0.22 μΜ sterile filter to remove any remaining E. coli SS320 contamination and the phage was precipitated from the culture supernatant by adding back ¼ of the total volume as 2.5 M NaCl/ 20% w/v PEG8000. This was mixed well and allowed to precipitate on ice overnight. The phage was then pelleted by centrifugation at 10500xg. The supernatant was aspirated off and the phage was resuspended in 1.5 mL tris-buffer saline (TBS; 50 mM Tris-Cl (pH 7.5), 250 mM NaCl, autoclaved) solution. The phage was precipitated a second time by adding back ¼ of the total volume as 2.5 M NaCl / 20% w/v PEG8000. This was mixed well and allowed to precipitate on ice for at least one hour. The phage was then collected by centrifugation at 10500xg followed by aspiration of the supernatant. The phage pellet was resuspended in a minimal amount of TBS, generally 0.25 to 0.5 mL, and the concentration was determined via a previously determined UV measurement technique (Wiseman, R.L., Berkowitz, S.A. and Day, L.A., "Different arrangements of protein subunits and single- stranded circular DNA in the filamentous bacterial viruses fd and Pfl ," J. Mol. Biol., 102, 549 - 561 (1976); Smith, G.P., "Absorption Spectroscopy and Quantitation of Filamentous Phage" from
http://www.biosci.missouri.edu/smithgp/PhageDisplayWebsite/AbsorptionSpectrum.doc accessed on 19 Aug 2015).
[123] For coexpression of NisA and NisB/C, chemically competent E. coli SS320 cells (50 μί) were transformed with 50-100 ng of phagemid containing the desired gene, and plated on an LB agar plate containing Amp (100 μg/ml), Tet (10 μg/ml), chloramphenicol (25 μg/ml), and l%w/v glucose. In this step, Amp is required for the phagemid, Tet is required for the F episome coding for the F pilus, which is needed for helper phage infection, and glucose is to prevent the expression of NisA-pIII since it slows down the cell growth overnight at 37°C. After the plates were incubated overnight at 37 °C, a colony was picked and grown in 5 mL of 2xYT media (1.6% tryptone, 1.0% yeast extract, 0.5% NaCl, pH: 7, autoclaved) supplemented with Amp (100 μg/ml), Tet (5 μg/ml), chloramphenicol (25 μg/ml), and 1%> glucose with shaking at 37 °C. Then, a 1 :20 inoculation of overnight liquid culture to fresh 2xYT media supplemented with Amp (100 μg/ml) and chloramphenicol (25 μg/ml) was performed to make a culture of total volume 50 or 100 mL. The culture was grown to O.D.6oonm of 0.3-0.5. Then M13K07 was added to a multiplicity of infection of
approximately 7 to provide the phage structural genes, arabinose was added to a final concentration of 0.04%> w/v, and isopropyl β-D-l- thiogalactopyranoside (IPTG) was added to a final concentration of 0.8 mM to induce expression of the NisA-pIII fusion protein. Cells were then allowed to grow for one hour at 37 °C with shaking to ensure infection. Kanamycin was then added to kill any uninfected cells and the temperature was reduced to 30 °C to ensure optimal production of phage. The culture was allowed to continue to grow overnight, then the cells were removed by centrifugation at 10500xg. The supernatant was then filtered through 0.22 μΜ sterile filter to remove any remaining E. coli SS320
contamination and the phage was precipitated from the culture supernatant by adding back ¼ of the total volume as 2.5 M NaCl / 20% w/v PEG8000. This was mixed well and allowed to precipitate on ice overnight. The phage was then pelleted by centrifugation at 10500xg. The supernatant was aspirated off and the phage was resuspended in 1.5 mL TBS solution. The phage was precipitated a second time by adding back ¼ of the total volume as 2.5 M NaCl / 20% w/v PEG8000. This was mixed well and allowed to precipitate on ice for at least one hour. The phage was then collected by centrifugation at 10500xg followed by aspiration of the supernatant. The phage pellet was resuspended in a minimal amount of TBS, generally 0.25 to 0.5 mL, and the concentration was determined via a previously determined UV measurement technique.
Example 6. SDS-PAGE analysis and band excision
[124] Phage (15 pL, l x lO12 to l lO13 phage/mL) was mixed with Laemmli protein loading dye. After 5 min incubation at 100 °C, 15 μΐ^ of this solution was loaded on a 4-20% Tris- Glycine polyacrylamide gel (Bio-Rad). After electrophoresis, the gel was stained with Coomassie blue dye for 15 to 30 minutes then destained for 2 hours or overnight. Bands of interest were excised with a razor blade and placed in separate eppendorf tubes. The
Coomassie stain was removed by covering the gel slice in a solution of 50 mM NH4HCO3 in 50% acetonitrile 10 minutes, then aspirating all of the liquid. This step was repeated until the wash liquid no longer appeared blue. Next, the gel slice was flash-frozen and lyophilized until dry, typically 3 hours to overnight. The band was then removed from the lyophilizer and submerged in an ice-cold solution of 100 mM NH4HCO3 with 0.0125 mg/mL trypsin. This mixture was placed on ice and allowed to swell the gel for 1 hour. The tube containing the gel slice swelled in the trypsin digestion mixture was then placed at 37 °C for 12 to 24 hours. After completion of digestion, the digestion mixture was removed and set aside for later analysis. The slice was then submerged in 20 mM NH4HCO3 and sonicated in a water bath for 20 minutes. This solution was then removed and set aside for later analysis. The gel slice was then submerged in 5% formic acid in 50% acetonitrile and again sonicated in a water bath for 20 minutes. This solution was then either spotted directly for MALDI analysis or lyophilized to dryness to save for later analysis.
Example 7. Mass spectrometry analysis of phage displayed peptides
[125] Aqueous trypsin-digested peptide solutions extracted from the gel were concentrated via Zip Tip (Millipore) then eluted directly onto the MALDI plate in a 2,5-dihydroxybenzoic acid matrix (DHB; 20 μg/μL DHB in 70:30 ACN: 0.1% trifluoroacetic acid). The extract from the SDS-PAGE excised band in 5% formic acid in 50% acetonitrile was directly spotted (1 μί) into 2,5-dihydroxybenzoic acid matrix (1 μΐ.) and analyzed via MALDI-ToF MS.
Example 8. Coexpression studies for nisin, lacticin 481, haloduracin, and prochlorosins
[126] Production of lanthipeptides nisin, lacticin 481 , haloduracin, and prochlorosins and their derivatives such as ProcA2.8-pIII in E. coli was performed as described before (Shi, Y. et al. (2012)); however, instead of using 18 °C, the cells were grown at 30 °C overnight. Example 9. Considerations for lanthipeptide library construction
[127] A set of cyclic lanthipeptide libraries were generated by taking advantage of the great sequence tolerance of ProcM. The ProcA peptides contain a leader peptide that is not modified and a core peptide where the posttranslational modifications take place. The modification process of ProcM is likely guided by the conserved leader sequence of the 29 ProcA substrates (Table 4). Therefore, multiple libraries of lanthipeptide substrates were generated by replacing the ProcA core sequence with a peptide sequence of similar length with a partially randomized sequence, while the leader sequence was kept unchanged.
[128] Table 4. Sequence alignment of naturally occurring ProcAs.1
Figure imgf000035_0001
xThe N-terminal leader sequence has high sequence identity, while the C-terminal core peptide is hypervariable. The SEQ ID NOs. for these sequences are as follows: 1.1 [SEQ ID NO.: 45]; 1.2 [SEQ ID NO.: 46]; 1.3 [SEQ ID NO.: 47]; 1.4 [SEQ ID NO.: 48]; 1.5 [SEQ ID NO.: 49]; 1.6 [SEQ ID NO.: 50]; 1.7 [SEQ ID NO.: 51]; 2.1 [SEQ ID NO.: 52]; 2.2 [SEQ ID NO.: 53]; 2.3 [SEQ ID NO.: 54]; 2.4 [SEQ ID NO.: 55]; 2.5 [SEQ ID NO.: 56]; 2.6 [SEQ ID NO.: 57]; 2.7 [SEQ ID NO.: 58]; 2.8 [SEQ ID NO.: 59]; 2.9 [SEQ ID NO.: 60]; 2.10 [SEQ ID NO.: 61]; 2.11 [SEQ ID NO.: 62]; 3.1 [SEQ ID NO.: 63]; 3.2 [SEQ ID NO.: 64]; 3.3 [SEQ ID NO.: 65]; 3.4 [SEQ ID NO.: 66]; 3.5 [SEQ ID NO.: 67]; 4.1 [SEQ ID NO.: 68]; 4.2 [SEQ ID NO.: 69]; 4.3 [SEQ ID NO.: 70]; 4.4 [SEQ ID NO.: 71]; s.l [SEQ ID NO.: 72]; s.2 [SEQ ID NO.: 73]; and t.l [SEQ ID NO.: 74].
[129] Considering that lanthipeptides are ribosomally synthesized peptides, we focused on constructing a genetically encoded library, by co-expressing the precursor lanthipeptide substrates with ProcM in heterologous host cells, which generated the modified lanthipeptides in vivo. This library can be directly applied to in vivo selection system such as genetic reverse two-hybrid system (RTHS), which couples disruption of protein complexes to the expression of reporter genes required for cell survival, or it can be used to display peptides on the surface of the host or phage.
[130] To ensure the quality of ring formation, our initial strategy utilized a fixed scaffold of specific thioether ring structures, while randomizing the amino acid sequence within the rings. For this example, scaffolds were developed based on ProcA2.8 and 2C10S, which generated two 7-amino acid rings and one 14-residue ring, respectively (Table 5).
[131] Table 5. Types of lanthipeptide libraries
Figure imgf000036_0001
For triplet codons, X = NWY, wherein N is A, G, C or T; W is A or T; and Y is T or C, and X = VWK where V is G, C or A; W is A or T; and K is G or T.
2procA2.8 leader:
MSEEQLKAFLTKVQADTSLQEQLKIEGADVVAIAKAAGFSITTEDLNSHRQNLSDDE LEGVAGG [SEQ ID NO.: 77].
These scaffolds were employed to construct two libraries with rings at fixed positions. Other scaffolds based on the other 28 ProcA sequences can readily be devised.
[132] The next step was to design the DNA triplet codons that encode the randomized amino acids within the rings. There are four criteria that need to be met to ensure the quality of the libraries: (1) the randomized amino acids preferably do not contain Ser/Thr/Cys that might disturb the original ring scaffold by forming additional/alternative rings; (2) the randomized amino acids do not contain potential stop codons that will result in truncated peptides; (3) there should not be significant bias encoding certain amino acids over others. In other words, all encoded amino acids should be as equally represented as possible in a first round; (4) we strived for reasonable diversity of the library, ideally close to or greater than 108 library variants which is normally the limitation resulting from transformation efficiency in E. coli. [133] Taking all four considerations together, the initial optimized DNA triplet codons that encode each randomized amino acid were designed as NWY (GATC, AT, TC) for library 1 and VWK (GCA, AT, GT) for library 2, resulting in the utilization of unique sets of amino acids as shown in Table 6A, B. Other triplet codon sets can easily be devised.
[134] Table 6A. Predicted amino acid composition for each library codon for Library la
Figure imgf000037_0001
aNWY, wherein N=GACT, W=AT, Y=TC; number of possible codon variants: 16; number of possible amino acid variants: 8.
[135] Table 6B. Predicted amino acid composition for each library codon for Library 2b
Figure imgf000037_0002
bVWK, wherein V=GAC, W=AT, K=GT; number of possible codon variants: 12; number of possible amino acid variants: 10.
Example 10. Construction of lanthipeptide library
[136] The pPvSFDuet-1 vector with procM inserted into MCS2 was used for library vector construction. pRSFDUET-1 vector containing the procA2.8 leader sequence was used as template for PCR amplification of ProcA2.8 leader followed by randomized library sequences. Library PCR primers (Table 3, synthesized using the hand-mixing option and PAGE purification by IDT) were designed that added an EcoRI restriction site to the 5' end and a NotI restriction site to the 3' end. The PCR products were digested with the appropriate restriction enzymes and purified using a Qiagen PCR purification kit. The pRSFDUET-1 vector was digested with the same restriction enzymes and an additional enzyme Sbfl to minimize vector self-ligation, dephosphorylated with alkaline phosphatase, and gel-purified. The digested vector was added to a ligation reaction containing T4 ligase and the insert DNA. Electrocompetent E. coli DH5 cells were transformed with the ligation mixture and plated on LB-agar containing kanamycin (50 mg L"1) to screen for positive clones. Clones were sequenced at ACGT, Inc.
Example 11. Overexpression, purification and modification assay for library samples.
[137] The library samples were overexpressed and purified using the method described in Shi, Y. Yang, X. Garg, N.; van der Donk, W. J Am Chem Soc. 133:2338-41 (2011). Soluble peptides typically yielded about 10 mg of final product per liter of overexpressed cells from LB broth.
[138] To monitor dehydration, select purified library peptides were dissolved (final concentration 1 mg mL"1) in LysC or GluC assay buffer containing 50 mM HEPES, pH 7.5- 8.0. LysC/GluC was added to a final concentration of 0.05 mg mL"1 to remove most of the leader peptide. Cleavage reactions were incubated at RT for 3 h and subjected to MALDI- ToF MS analysis.
[139] To monitor cyclization, a chemical modification step following the enzymatic assay is required since cyclization does not result in a change in mass. For most applications using MALDI-TOF MS, modification has been accomplished using the thiol modification agents iodoacetamide (IAA) or N-ethylmaleimide (NEM) that allow analysis of cyclization at two different pH values. A 5-μΕ aliquot of the above assay mixture was added to 15 of IAA assay buffer with a final concentration of 50 mM Tris, 50 mM IAA, 1-3 mM TCEP, pH 8.5, or NEM assay buffer with a final concentration of 50 mM Tris, 25 mM NEM, 1-3 mM TCEP, pH 6.3. The assay solution was incubated in the dark at RT for 4 h (for IAA assay) or 37°C for 10 min (for NEM assay) and subjected to MALDI-ToF MS. Non-enzymatic cyclization under these conditions is very slow and not important (Mukherjee S, van der Donk WA: Mechanistic Studies on the Substrate-Tolerant Lanthipeptide Synthetase ProcM. J. Am. Chem. Soc. 2014, 136: 10450-10459). [140] The ring topology of select lanthipeptides can be deduced from their MS fragmentation pattern. A sample of 5 of each protease cleavage reaction mixture was injected to a BEH C8 column (1.7 μιη, 1.0 x 100 mm), and the fully modified product was purified by UPLC using a gradient of 3% mobile phase B (0.1% formic acid in methanol) to 97% mobile phase B in mobile phase A (0.1% formic acid in water) over 12 min. Mass spectra were acquired in ESI positive mode in the range of 50-2000 m/z. The capillary voltage was 3500 V, and the cone voltage was 40 V. The other parameters used were as follows: 120 °C source temperature; 300 °C desolvation temperature, 150 L/h cone gas flow, and 600 L/h desolvation gas flow. A transfer collision energy of 4 V was used for both MS and tandem MS, while the trap collision energy was set to 6 V for MS and a 20-55 V ramp for MSMS depending on the peptide. Glu-fibrinopeptide B (Sigma) was directly infused as the lock mass. The tandem mass spectra were processed with MaxEnt3 and analyzed by Protein/Peptide Editor in BioLynx 4.1. The software for analyzing both precursor-ion and fragment-ion mass was set to report any mass within 0.3 amu of the calculated expected values.
[141] Following library construction, 6-7 samples from each library were tested for dehydration and cyclization. Each of them yielded the desired ring formation, indicating that the scaffolds are robust (see Table 7).
[142] Table 7. Results of the Libraries 1 and 2
Major Cyclization
ID dehydration product by „ . .
Core peptide sequence' ,„ Conclusion
[SEQ ID NO.:_] product by
MS
No IAA
2.8-1 jFNVHI MPPSHNNVHl -2 H20 2 rings
adduct
[SEQ ID NO.: 78]
No IAA
2.8-10 NHLLiMPPSLNDLNl -2 H20 2 rings
adduct
[SEQ ID NO.: 79]
No IAA
2.8-1 1 jDVNLHiMPPSLDFFV! -2 H20 2 rings
adduct
[SEQ ID NO.: 80]
No IAA
2.8-15 'FHFDSMPPSYLDDDi -2 H20 2 rings
adduct
[SEQ ID NO.: 81]
No NEM
2.8-3 IDFLlMPPllHHILl -2 H20 2 rings
adduct
[SEQ ID NO.: 82]
No NEM
2.8-5 IYYI MPPlHHFVYl -2 H20 2 rings
adduct
[SEQ ID NO.: 83]
No NEM
HFFLiMPPlHVLDIS -2 H20 2 rings
Hit 3-3 adduct Major Cyclization
ID dehydration product by
Core peptide sequence3 Conclusion
[SEQ ID NO. :_] product by MSb
MS
[SEQ ID NO.: 84]
No IAA
2C10 YHHYN|YNFNLFNNYNNN|Y -1 H20 1 ring
adduct
[SEQ ID NO.: 85]
No IAA
2C10S YHHYN|YNFNLFNNYNNN|Y -1 H20 1 ring
adduct
[SEQ ID NO.: 86]
1 ring; no
2C10-3
YHHYN|DVLLDLKKNDLE|Y GluC: -1 H20 No IAA proteolysis [SEQ ID NO.: 87]
in ring
2C10-10 1 ring; 1
YHHYN|VINHLNDLQEKL|Y GluC: -0 H20 No IAA
[SEQ ID NO.: 88] proteolysis adduct
in ring0
1 ring; no
2C10-1 1 No IAA
YHHYN|QQVVI IQDNQVD|Y GluC: -1 H20 proteolysis [SEQ ID NO.: 89] adduct
in ring
1 ring; 1
2C10-14 No IAA proteloysis
YHHYNpMIKHKEHDHMI ΐ|γ GluC: -1 H20,
[SEQ ID NO.: 90] adduct in ring0
-0 H20
aGluC cleavage sites inside the ring are underlined.
bAs determined by reactions with electrophiles iodoacetamide (IAA) or N-ethylmaleimide (NEM).
cIf proteolysis is observed in the ring, it provides additional evidence for cyclization since the mass of the peptide increases by 18 Da (H20) without cleavage of the peptide (because the thioether holds the two proteolytic fragements together).
[143] Proteolytic cleavage inside the 14-residue ring was observed during leader peptide removal by GluC in two samples from Library 2 (Table 7). This further confirmed the ring had been formed. When glutamate was immediately next to the lanthionine, no cleavage was observed. The higher sensitivity of the larger ring structures may be due to the less restricted conformation of the loop region of the 14-residue ring, which makes it more likely to fit in the active site of the protease. Comparatively, very few proteolytic cleavages were observed for the smaller 7-residue rings. This observation indicates that although Library 2 can generate cyclic peptides as desired, it may not be as stable against proteolytic degradation as the other libraries. This illustrates the advantages of poly eye lie peptides over monocyclic peptides and/or the advantages of smaller rings over larger rings. Example 12. Construction of yeast expression plasmids.
[144] Synthetic double stranded DNA containing yeast-codon optimized genes for the expression of Aga2-LctA, Aga2 -ProcA 2.8, Aga2-HalA2, and LctA-Aga2 were obtained from Integrated DNA Technologies and inserted into the EcoRI and Xhol sites of pCT302 by isothermal assembly. The constructs were confirmed by DNA sequencing.
[145] Synthetic double stranded DNA containing yeast codon optimized genes encoding LctM, ProcM, and HalM2 with an N-terminal secretion signal from mating factor a, and a C- terminal endoplasmic reticulum retention tag were obtained from Integrated DNA
Technologies and inserted into the Xbal and Xhol sites of pAG415-Gal-ccdB-DsRed by isothermal assembly. The constructs were confirmed by DNA sequencing.
Example 13. Construction of Aga2-LanA and LanA-Aga2 E. coli expression plasmids.
[146] The genes encoding Aga2-LctA, Aga2 -ProcA 2.8, Aga2-HalA2, and LctA-Aga2 were amplified from their yeast expression constructs using primers pET_Aga2-lctA Strep Fl/Rl, pET_Aga2-2.8 Fl/Rl, pET_HalA2 F/R, and lctA-Aga2 F1/R2 respectively (Table 8). The PCR products were inserted into the BamHI and Xhol sites of pETDuet (Aga2-LctA, Aga2- ProcA 2.8), the Ndel and EcoRI sites of pET28 (Aga2-HalA2), or the Ncol and Xhol sites of pET28 (LctA-Aga2) by isothermal assembly. All constructs were confirmed by DNA sequencing.
[147] The genes encoding LctM, ProcM, and HalM2 were amplified from pETDuet-LctM, pET28-ProcM, and pRSFDuet-HalM2 respectively with primers pTRC33-lctM Fl/Rl, trcProcM Fl/Rl, and pTRC-HalM2 F/R respectively (Table 8). The PCR products were inserted into the BamHI and Hindlll sites of pTRC33 by isothermal assembly. All constructs were confirmed by DNA sequencing.
Example 14. Coexpression of LanA fusions and LanMs in E. coli.
[148] E. coli BL21(de3) cells were transformed with the appropriate Aga2 LanA fusion expression plasmid and that of the associated LanM. Overnight Terrific Broth (TB) cultures (5 mL) of the freshly transformed cells were used to inoculate TB cultures (1L) in 4 L shake flasks to OD6oo = 0.05. The cultures were grown at 37 °C with shaking at 200 rpm until they reached OD6oo = 0.8, at which point they were chilled on ice for 20 min. Protein expression was then induced by the addition of IPTG (0.2 mM) and the cultures were incubated overnight at 18 °C. Cell pellets were harvested by centrifugation at 4,500 x g for 20 min at 4 °C and stored at -80 °C until use.
Example 15. Purification and characterization of Aga2 LanA fusions from E. coli.
[149] Frozen cell pellets were thawed and resuspended in lysis buffer (8 M urea, 100 mM sodium phosphate, 10 mM Tris, pH 8.0) at 5 mL/g cell paste. Cells were then lysed by sonication and insoluble material was removed by centrifugation at 12,000 x g for 20 min at 4 °C. The supernatant was passed over HisTrap IMAC resin (~ 1 mL resin/g cell paste). The resin was then washed with 20 - 25 column volumes of lysis buffer, washed further with 20 - 25 column volumes of lysis buffer adjusted to pH 6.3, and the protein of interest was eluted with lysis buffer adjusted to pH 4.5. Fractions containing the protein of interest were identified by absorbance at 280 nm, pooled, and concentrated in an Amicon spin concentrator with a molecular weight cutoff of 15 kDa to a concentration of approximately 5 - 10 mg/mL. The Aga2 LanA fusions were then diluted 4-fold to give a urea concentration of 2 M and incubated with the appropriate protease (Aga2-LctA: trypsin; Aga2-ProcA 2.8 and Aga2- HalA2: Glu-C; LctA-Aga2: trypsin and Glu-C) at a ratio of 10: 1 Aga2 LanA fusion:protease and 1 mM TCEP. The incubation was allowed to run at room temperature overnight. The cleaved core peptide was purified by reverse phase HPLC and analyzed by MALDI-TOF mass spectrometry. The NEM assays were performed on these peptides as described above.
Example 16. Expression and analysis of Aga2 LanA fusions in yeast.
[150] S. cerevisiae EBY100 was transformed with the appropriate Aga2 LanA fusion expression plasmid and that of the associated LanM. Overnight cultures (5 mL) were grown from a single colony in synthetic dropout media lacking leucine and tryptophan with glucose as the carbon source. These culture were used to inoculate cultures of the same media to OD6oo = 1 and the cultures were incubated at 30 °C with shaking at 250 rpm. When cultures reached OD6oo = 6, the cells were harvested by centrifugation at 3,000 x g for 5 min at room temperature. The cell pellet was washed with leucine and tryptophan synthetic dropout media with galactose as the carbon source and resuspended in the same (5 mL) to induce protein expression. The cultures were incubated at 20 °C with shaking for 48 h. Approximately 1 107 cells were harvested by brief centrifugation and washed with 1 mL of phosphate buffered saline with 0.1% (w/v) bovine serum albumin (PBS+BSA). Cells were resuspended in 100 PBS+BSA. StrepMAB (4 of 1 mg/mL stock) was added to the cells which were then incubated at room temperature for 1 h. Cells were pelleted and washed with 1 mL of ice cold PBS+BSA and resuspended in 100 ΐ. of ice cold PBS+BSA. Alexa Fluor 488 goat anti- mouse antibody (4 ΐ, of 1 mg/mL stock) was added to the cells and they were incubated on ice and in the dark for 30 min. The cells were again pelleted and washed with 1 mL of ice cold PBS+BSA and analyzed on a BD LSR II flow cytometer using the instrument's default settings for Alexa Fluor 488.
Example 17. Isolation of surface displayed Aga2-HalA2.
[151] Expression of Aga2-HalA2 and HalM2 was induced as described above in a 1 L culture. Cells were harvested by centrifugation at 3,000 x g for 20 min at 4 °C. The cells were then washed with 100 mL of 150 mM sodium chloride and resuspended in buffer containing 1 M sorbitol, 100 mM Tris, and 1 mM TCEP at pH 8 at 5 mL/g cell paste. The cells were subsequently incubated at 4 °C for 1 h with gentle shaking. The cells were then removed by centrifugation and the supernatant was loaded onto Strep-Tactin resin
(approximately 1 mL). The resin was washed with buffer consisting of 100 mM Tris and 150 mM sodium chloride, pH 8 until the A2so of the eluent dropped below 0.05. The protein of interest was then eluted from the column with buffer consisting of 100 mM Tris, 8 M urea, and 2.5 mM desthiobiotin pH 8. The eluent was pooled and concentrated in an Amicon spin concentrator with a molecular weight cutoff of 30 kDa. The Aga2-HalA2 was then digested and analyzed MALDI-TOF MS as described above.
[152] Table 8. Oligonucleotides used for the yeast display aspects.
Figure imgf000043_0001
Figure imgf000044_0001
[153] All of the patents, patent applications, patent application publications and other publications recited herein are hereby incorporated by reference as if set forth in their entirety.
[154] The present invention has been described in connection with what are presently considered to be the most practical and preferred aspects. However, the invention has been presented by way of illustration and is not intended to be limited to the disclosed aspects. Accordingly, one of skill in the art will realize that the invention is intended to encompass all modifications and alternative arrangements within the spirit and scope of the invention as set forth in the appended claims.

Claims

CLAIMS What is claimed is:
1. A platform for bacterial phage display of a lanthipeptide, comprising:
a phagemid comprising a lanthipeptide display system;
a helper phage; and
a bacterial host organism configured to express one or more lanthipeptide
biosynthesis enzymes.
2. The platform of claim 1, wherein the lanthipeptide display system comprises:
a fusion gene encoding an open reading frame having a N-terminal secretion signal; a lanthipeptide display peptide; and
a pill protein.
3. The platform of claim 2, wherein the lanthipeptide display peptide comprises a nisin peptide.
4. The platform of any of the preceding claims, wherein the phagemid is capable of being rescued by the helper phage, wherein the helper phage comprises a Ml 3 phage.
5. The platform of claim 4, wherein the M13 phage is M13K07.
6. The platform of any of the preceding claims, wherein the bacterial host organism is E. coli.
7. The platform of any of the preceding claims, wherein the one or more lanthipeptide biosynthesis enzymes comprises NisB or NisC, or a combination thereof.
8. A phage for displaying a lanthipeptide, wherein the phage is made according to the platform of any of the preceding claims, further wherein the phage is configured to infect a bacterial host organism comprising a Gram-positive bacterium.
9. A platform for cell surface display of a lanthipeptide, comprising:
a lanthipeptide display system; and
a yeast host organism configured to express one or more lanthipeptide biosynthesis enzymes.
10. The platform of claim 9, wherein the lanthipeptide display system comprises a fusion gene encoding an open reading frame having a lanthipeptide display peptide and an Aga2 protein.
11. The platform of claims 9 or 10, wherein the yeast host organism is S. cerevisiae.
12. The platform of claims 9, 10 or 11, wherein the one or more lanthipeptide biosynthesis enzymes comprises a LanM family enzyme.
13. A lanthipeptide display system, comprising:
a gene chimera encoding a fusion peptide comprising a lanthipeptide display peptide and a presentation peptide,
wherein the presentation peptide anchors the lanthipeptide display peptide on an outer biological surface.
14. The lanthipeptide display system of claim 13, wherein the outer biological surface is selected from a phage surface or a host organism membrane.
15. The lanthipeptide display system of claims 13 or 14, wherein the gene chimera encoding a fusion peptide comprising a lanthipeptide display peptide and a presentation peptide is expressed from one of a phagemid, a plasmid, a cosmid, and a chromosome.
16. A lanthipeptide library display system, comprising:
a lanthipeptide expression library comprising a plurality of gene chimeras, wherein each member of the plurality of gene chimeras encodes a fusion peptide comprising a lanthipeptide display peptide and a presentation peptide,
wherein the presentation peptide anchors the lanthipeptide display peptide on an outer biological surface.
17. The lanthipeptide library display system of claim 16, wherein the outer biological surface is selected from a phage surface or a host organism membrane.
18. The lanthipeptide library display system of claims 16 or 17, wherein each member of the plurality of gene chimeras is expressed from a uniform lanthipeptide expression library selected from one system consisting of a phagemid, a plasmid, a cosmid and a chromosome.
19. A method of identifying a lanthipeptide display peptide expressed in vivo from a biological host organism, comprising:
preparing a biological host library, wherein each member of the biological host library expresses a gene chimera encoding a fusion peptide comprising a lanthipeptide display peptide and a presentation peptide, wherein the presentation peptide anchors the lanthipeptide display peptide on an outer biological surface of the biological host organism; and
sorting the biological host library to form a candidate subset of the biological hosts that express the lanthipeptide display peptide.
20. The method of claim 19, wherein the sorting comprises using fluorescence-activated cell sorting.
21. The method of claims 19 or 20, wherein the sorting comprises using immunoassay.
22. A phagemid comprising a lanthipeptide display system.
23. The phagemid according to claim 22, wherein the lanthipeptide display system comprises a fusion gene encoding an open reading frame having a N-terminal secretion signal, a lanthipeptide display peptide and a pill protein.
24. The phagemid according to claim 23, wherein the lanthipeptide display peptide comprises a nisin peptide.
25. The phagemid according to any of the claims 22, 23 or 24, wherein the phagemid is capable of being rescued by a helper phage, wherein the helper phage comprises a Ml 3 phage.
26. The phagemid according to claim 25, wherein the M13 phage is M13K07.
27. The phagemid according to any of the claims 22, 23, 24, 25 or 26, wherein the phagemid is configured to produce a phage when propagated in a suitable bacterial host organism, wherein the phage is configured to infect a bacterial host organism comprising a Gram- positive bacterium.
PCT/US2015/052724 2014-09-26 2015-09-28 Biosynthesis and engineering of lanthipeptides Ceased WO2016049656A1 (en)

Priority Applications (2)

Application Number Priority Date Filing Date Title
US15/326,751 US11149270B2 (en) 2014-09-26 2015-09-28 Biosynthesis and engineering of lanthipeptides
CA2961285A CA2961285A1 (en) 2014-09-26 2015-09-28 Biosynthesis and engineering of lanthipeptides

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201462056216P 2014-09-26 2014-09-26
US62/056,216 2014-09-26

Publications (1)

Publication Number Publication Date
WO2016049656A1 true WO2016049656A1 (en) 2016-03-31

Family

ID=54266678

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2015/052724 Ceased WO2016049656A1 (en) 2014-09-26 2015-09-28 Biosynthesis and engineering of lanthipeptides

Country Status (3)

Country Link
US (1) US11149270B2 (en)
CA (1) CA2961285A1 (en)
WO (1) WO2016049656A1 (en)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2019073011A1 (en) * 2017-10-12 2019-04-18 Deinove Enzymatic synthesis of lipolanthipeptides
WO2021252975A3 (en) * 2020-06-12 2022-02-17 Massachusetts Institute Of Technology Split intein-based selection for peptide binders

Families Citing this family (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20160100778A1 (en) * 2014-10-10 2016-04-14 Korea Institute Of Science And Technology Biosensor and wearable device for detecting bioinformation including hybrid electronic sheet
WO2016102434A1 (en) * 2014-12-22 2016-06-30 Morphosys Ag Novel methods for displaying cyclic peptides on bacteriophage particles
KR101878358B1 (en) 2015-04-02 2018-07-16 한국과학기술연구원 Pressure seonsor comprising hybrid electronic sheets and wearable device comprising thereof
CN112851773B (en) * 2021-02-03 2022-08-09 河北省科学院生物研究所 Antibacterial lantibide Amylocin C and preparation method and application thereof
WO2023164788A1 (en) * 2022-03-01 2023-09-07 中国科学院深圳理工大学(筹) Method for high-throughput screening of lantibiotics

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20090143295A1 (en) * 2007-11-30 2009-06-04 E. I. Du Pont De Nemours And Company Peptide-based antiacne reagents
EP2405008A1 (en) * 2010-07-06 2012-01-11 LanthioPep B.V. Bacterial surface display of thioether-bridge-containing peptides

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20090143295A1 (en) * 2007-11-30 2009-06-04 E. I. Du Pont De Nemours And Company Peptide-based antiacne reagents
EP2405008A1 (en) * 2010-07-06 2012-01-11 LanthioPep B.V. Bacterial surface display of thioether-bridge-containing peptides

Non-Patent Citations (57)

* Cited by examiner, † Cited by third party
Title
BENNETT, N.J.; GAGIC, D.; SUTHERLAND-SMITH, A.J.; RAKONJAC, J.: "Characterization of a dual-function domain that mediates membrane insertion and excision of Ff filamentous bacteriophage", J. MOL. BIOL., vol. 411, 2011, pages 972 - 985
BERKS, B.; SARGENT, F.; PALMER, T.: "The Tat protein export pathway", MOL MICROBIOL, vol. 35, 2000, pages 260 - 274
BODER E T ET AL: "YEAST SURFACE DISPLAY FOR SCREENING COMBINATORIAL POLYPEPTIDE LIBRARIES", NATURE BIOTECHNOLOGY, NATURE PUBLISHING GROUP, US, vol. 15, 1 June 1997 (1997-06-01), pages 553 - 557, XP001147402, ISSN: 1087-0156, DOI: 10.1038/NBT0697-553 *
BODER, E. T.; MIDELFORT, K. S.; WITTRUP, K. D.: "Directed evolution of antibody fragments with monovalent femtomolar antigen-binding affinity", PROC NATL ACAD SCI U S A 2000, vol. 97, 2000, pages 10701 - 5
BODER, E. T.; WITTRUP, K. D.: "Yeast surface display for screening combinatorial polypeptide libraries", NAT BIOTECHNOL, vol. 15, 1997, pages 553 - 7
BONARDI, F.; HALZA, E.; WALKO, M.; DU PLESSIS, F.; NOUWEN, N.; FERINGA, B. L.; DRIESSEN, A. J. M.: "Probing the SecYEG translocation pore size with preproteins conjugated with sizable rigid spherical molecules", P. NATL. ACAD. SCI., vol. 108, 2011, pages 7775 - 7780
BOSMA TJIBBE ET AL: "Bacterial Display and Screening of Posttranslationally Thioether-Stabilized Peptides", APPLIED AND ENVIRONMENTAL MICROBIOLOGY, AMERICAN SOCIETY FOR MICROBIOLOGY, US, vol. 77, no. 19, 1 October 2011 (2011-10-01), pages 6794 - 6801, XP009153580, ISSN: 0099-2240 *
BOSMA, T.; KUIPERS, A.; BULTEN, E.; DE VRIES, L.; RINK, R.; MOLL, G. N.: "Bacterial Display and Screening of Post-translationally ThioetherStabilized Peptides", APPL. ENVIRON. MICROB., vol. 77, 2011, pages 6794 - 6801
BOSMA, T.; KUIPERS, A.; BULTEN, E.; DE VRIES, L.; RINK, R.; MOLL, G. N.: "Bacterial Display and Screening of Posttranslationally Thioether-Stabilized Peptides", APPL. ENVIRON. MICROB., vol. 77, 2011, pages 6794 - 6801
BRATKOVIC, T.: "Progress in phage display: evolution of the technique and its applications", CELL. MOL. LIFE SCI., vol. 67, 2010, pages 749 - 767
CHATTERJEE, C.; PAUL, M.; XIE, L.; VAN DER DONK, W. A.: "Biosynthesis and Mode of Action of Lantibiotics", CHEM. REV., vol. 105, 2005, pages 633 - 684
CHEN, N.; HONG, F. L.; WANG, H. H.; YUAN, Q. H.; MA, W. Y.; GAO, X. N.; SHI, R.; ZHANG, R. J.; SUN, C. S.; WANG, S. B.: "Modified Recombinant Proteins Can Be Exported via the Sec Pathway in Escherichia coli", PLOS ONE, vol. 7, 2012, pages E42519
CLARDY, J.; FISCHBACH, M. A.; WALSH, C. T.: "New antibiotics from bacterial natural products", NAT. BIOTECHNOL., vol. 24, 2006, pages 1541 - 1550
COBB, R.E.; WANG, Y.; ZHAO, H.: "High-Efficiency Multiplex Genome Editing of Streptomyces Species Using an Engineered CRISPR/Cas System", ACS SYNTH. BIOL., vol. 4, no. 6, 2015, pages 723 - 728
EDGAR, R.; MCKINSTRY, M.; HWANG, J.; OPPENHEIM, A. B.; FEKETE, R. A.; GIULIAN, G.; MERRIL, C.; NAGASHIMA, K.; ADHYA, S.: "High-sensitivity bacterial detection using biotin-tagged phage and quantum-dot nanocomplexes", PROC. NAT. ACAD. SCI. USA, vol. 103, 2006, pages 4841 - 4845
FIELD, D.; BEGLEY, M.; O'CONNOR, P. M.; DALY, K. M.; HUGENHOLTZ, F.; COTTER, P. D.; HILL, C.; ROSS, R. P.: "Bioengineered Nisin A Derivatives with Enhanced Activity against Both Gram Positive and Gram Negative Pathogens", PLOS ONE, vol. 7, 2012, pages E46884
FISCHBACH, M. A.; WALSH, C. T.: "Antibiotics for Emerging Pathogens", SCIENCE, vol. 325, 2009, pages 1089 - 1093
HASPER, H. E.; DE KRUIJFF, B.; BREUKINK, E.: "Assembly and stability of nisin-lipid II pores", BIOCHEMISTRY, vol. 43, 2004, pages 11567 - 11575
HEINIS, C.; RUTHERFORD, T.; FREUND, S.; WINTER, G.: "Phage-encoded combinatorial chemical libraries based on bicyclic peptides", NAT. CHEM. BIOL., vol. 5, 2009, pages 502 - 507
HESS, G. T.; CRAGNOLINI, J. J.; POPP, M. W.; ALLEN, M. A.; DOUGAN, S. K.; SPOONER, E.; PLOEGH, H. L.; BELCHER, A. M.; GUIMARAES, C: "M13 Bacteriophage Display Framework That Allows Sortase-Mediated Modification of Surface-Accessible Phage Proteins", BIOCONJUGATE CHEM., vol. 23, 2012, pages 1478 - 1487
HOFMANN, F. T.; SZOSTAK, J. W.; SEEBECK, F. P.: "In Vitro Selection of Functional Lantipeptides", J. AM. CHEM. SOC., vol. 134, 2012, pages 8038 - 8041
HSU, S. T.; BREUKINK, E.; TISCHENKO, E.; LUTTERS, M. A.; DE KRUIJFF, B.; KAPTEIN, R.; BONVIN, A. M.; VAN NULAND, N. A.: "The nisin-lipid II complex reveals a pyrophosphate cage that provides a blueprint for novel antibiotics", NAT. STRUCT. MOL. BIOL., vol. 11, 2004, pages 963 - 967
JASMIN DISCHINGER ET AL: "Lantibiotics: Promising candidates for future applications in health care", INTERNATIONAL JOURNAL OF MEDICAL MICROBIOLOGY, vol. 304, no. 1, 1 January 2014 (2014-01-01), DE, pages 51 - 62, XP055228212, ISSN: 1438-4221, DOI: 10.1016/j.ijmm.2013.09.003 *
JOANNE M. WILLEY ET AL: "Lantibiotics: Peptides of Diverse Structure and Function", ANNUAL REVIEW OF MICROBIOLOGY, vol. 61, no. 1, 1 October 2007 (2007-10-01), US, pages 477 - 501, XP055228647, ISSN: 0066-4227, DOI: 10.1146/annurev.micro.61.080706.093501 *
KIEKE, M. C.; SHUSTA, E. V.; BODER, E. T.; TEYTON, L.; WITTRUP, K. D.; KRANZ, D. M.: "Selection of functional T cell receptor mutants from a yeast surface-display library", PROC NATL ACAD SCI USA, vol. 96, 1999, pages 5651 - 6
KNERR, P. J.; OMAN, T. J.; GARCIA DE GONZALO, C. V.; LUPOLI, T. J.; WALKER, S.; VAN DER DONK, W.A.: "Non-proteinogenic Amino Acids in Lacticin 481 Analogues Result in More Potent Inhibition of Peptidoglycan Transglycosylation", ACS CHEM. BIOL., vol. 7, 2012, pages 1791 - 1795
KNERR, P. J.; VAN DER DONK, W. A.: "Discovery, Biosynthesis, and Engineering of Lantipeptides", ANNU. REV. BIOCHEM., vol. 81, 2012, pages 479 - 505
KOEHN, F. E.; CARTER, G. T.: "The evolving role of natural products in drug discovery", NAT. REV. DRUG DISCOV., vol. 4, 2005, pages 206 - 220
KUIPERS, A.; WIERENGA, J.; RINK, R.; KLUSKENS, L. D.; DRIESSEN, A. J. M.; KUIPERS, O. P.; MOLL, G. N.: "Sec-Mediated Transport of Posttranslationally Dehydrated Peptides in Lactococcus lactis", APPLIED AND ENVIRONMENTAL MICROBIOLOGY, vol. 72, 2006, pages 7626 - 7633
LABRIE, S.J.; SAMSON, J.E.; MOINEAU, S.: "Bacteriophage Resistance Mechanisms", NAT. REV. MICROBIOL., vol. 8, 2010, pages 317 - 327
LAVIGNE, R.; CEYSSENS, P.-J.; PHAGE PROTEOMICS: APPLICATIONS OF MASS SPECTROMETRY: "Bacteriohpages: Methods and Protocols, Volume 2: Molecular and Applied Aspects", vol. 502, 2009, HUMANA PRESS, pages: 239 - 254
LI, B.; SHER, D.; KELLY, L.; SHI, Y.; HUANG K.; KNERR P.J.; JOEWONO I.; RUSCH D.; CHISHOLM, S.W.; VAN DER DONK, W.A.: "Catalytic promiscuity in the biosynthesis of cyclic peptide secondary metabolites in planktonic marine cyanobacteria", PROC. NATL. ACAD. SCI., USA, vol. 107, 2010, pages 10430 - 10435
LI, K.; CHEN, Y.; LI, S.; NGUYEN, H. G.; NIU, Z.; YOU, S.; MELLO, C. M.; LU, X.; WANG, Q.: "Chemical Modification of M13 Bacteriophage and Its Application in Cancer Cell Imaging", BIOCONJUGATE CHEM., vol. 21, 2010, pages 1369 - 1377
LOVE, K. R.; SWOBODA, J. G.; NOREN, C. J.; WALKER, S.: "Enabling Glycosyltransferase Evolution: A Facile Substrate-Attachment Strategy for Phage-Display Enzyme Evolution", CHEMBIOCHEM, vol. 7, 2006, pages 753 - 756
MAKINO, A.; BABA, T.; FUJIMOTO, K.; IWAMOTO, K.; YANO, Y.; TERADA, N.; OHNO, S.; SATO, S. B.; OHTA, A.; UMEDA, M.: "Cinnamycin (Ro 09-0198) promotes cell binding and toxicity by inducing transbilayer lipid movement", J. BIOL. CHEM., vol. 278, 2003, pages 3204 - 3209
MONTALBÁN-LÓPEZ MANUEL ET AL: "Increasing the success rate of lantibiotic drug discovery by Synthetic Biology.", EXPERT OPINION ON DRUG DISCOVERY AUG 2012, vol. 7, no. 8, August 2012 (2012-08-01), pages 695 - 709, XP002750948, ISSN: 1746-045X *
MUKHERIEE S; VAN DER DONK WA: "Mechanistic Studies on the Substrate-Tolerant Lanthipeptide Synthetase ProcM", J. AM. CHEM. SOC., vol. 136, 2014, pages 10450 - 10459
NG, S.; JAFARI, M. R.; DERDA, R.: "Bacteriophages and Viruses as a Support for Organic Synthesis and Combinatorial Chemistry", ACS CHEM. BIOL., vol. 7, 2011, pages 123 - 138
OKESLI, A.; COOPER, L. E.; FOGLE, E. J.; VAN DER DONK, W.A.: "Nine Post-translational Modifications during the Biosynthesis of Cinnamycin", J. AM. CHEM. SOC., vol. 133, 2011, pages 13753 - 13760
OMAN, T. J.; LUPOLI, T. J.; WANG, T. S. A.; KAHNE, D.; WALKER, S.; VAN DER DONK, W.A.: "Haloduracin a binds the peptidoglycan precursor lipid II with 2:1 stoichiometry", J. AM. CHEM. SOC., vol. 133, 2011, pages 17544
PATRICK J. KNERR ET AL: "Discovery, Biosynthesis, and Engineering of Lantipeptides", ANNUAL REVIEW OF BIOCHEMISTRY, vol. 81, no. 1, 7 July 2012 (2012-07-07), pages 479 - 505, XP055055933, ISSN: 0066-4154, DOI: 10.1146/annurev-biochem-060110-113521 *
QI, H.; LU, H.; QIU, H.-J.; PETRENKO, V.; LIU, A.: "Phagemid Vectors for Phage Display: Properties, Characteristics and Construction", J. MOL. BIOL., vol. 417, 2012, pages 129 - 143
SACHDEV S, S.: "Engineering M13 for phage display", BIOMOL. ENG., vol. 18, 2001, pages 57 - 63
SHI, Y.; YANG, X.; GARG, N.; VAN DER DONK, W. A.: "Production of lantipeptides in Escherichia coli", J. AM. CHEM. SOC., vol. 133, 2010, pages 2338 - 2341
SHI, Y.; YANG, X.; GARG, N.; VAN DER DONK, W., JAM CHEM SOC., vol. 133, 2011, pages 2338 - 41
SHI, Y.; YANG, X.; GARG, N.; VAN DER DONK, W.A.: "Production of lantipeptides in Escherichia coli", J. AM. CHEM. SOC., vol. 133, 2010, pages 2338 - 2341
SMELYANSKI, L.; GERSHONI, J.: "Site directed biotinylation of filamentous phage structural proteins", VIROL. J., vol. 8, 2011, pages 495
SMITH, G.P., ABSORPTION SPECTROSCOPY AND QUANTITATION OF FILAMENTOUS PHAGE, 19 August 2015 (2015-08-19), Retrieved from the Internet <URL:http://www.biosci.missouri.edu/smithgp/PhageDisplayWebsite/AbsorptionSpectrum>
SUNBUL, M.; EMERSON, N.; YIN, J.: "Enzyme-Catalyzed Substrate Attachment to Phage Surfaces for the Selection of Catalytic Activities", CHEMBIOCHEM, vol. 12, 2011, pages 380 - 386
TACCONELLI, E.; DE ANGELIS, G.; CATALDO, M. A.; POZZI, E.; CAUDA, R.: "Does antibiotic exposure increase the risk of methicillin-resistant Staphylococcus aureus (MRSA) isolation? A systematic review and meta-analysis", J. ANTIMICROB. CHEMOTHER., vol. 61, 2008, pages 26 - 38
TANG, W.; VAN DER DONK, W. A.: "Structural Characterization of Four Prochlorosins: A Novel Class of Lantipeptides Produced by Planktonic Marine Cyanobacteria", BIOCHEMISTRY, vol. 51, 2012, pages 4271 - 4279
THOMAS, J. D.; DANIEL, R. A.; ERRINGTON, J.; ROBINSON, C.: "Export of active green fluorescent protein to the periplasm by the twin-arginine translocase (Tat) pathway in Escherichia coli", MOL. MICROBIOL., vol. 39, 2001, pages 47 - 53
TOMAZ BRATKOVIC: "Progress in phage display: evolution of the technique and its applications", CMLS CELLULAR AND MOLECULAR LIFE SCIENCES, BIRKHÄUSER-VERLAG, BA, vol. 67, no. 5, 15 November 2009 (2009-11-15), pages 749 - 767, XP019797909, ISSN: 1420-9071 *
VAN DER MEER, J. R.; POLMAN, J.; BEERTHUYZEN, M. M.; SIEZEN, R. J.; KUIPERS, O. P.; DE VOS, W. M.: "Characterization of the Lactococcus lactis nisin A operon genes nisP, encoding a subtilisin-like serine protease involved in precursor processing, and nisR, encoding a regulatory protein involved in nisin biosynthesis", J. BACTERIOL., vol. 175, 1993, pages 2578 - 2588
VAN WEZENBEEK, P.M.G.F.; HULSEBOS, T.J.M.; SCHOENMAKERS, J.G.G.: "Nucleotide sequence of the filamentous bacteriophage M13 DNA genome: comparison with phage fd", GENE, vol. 11, 1980, pages 129 - 148
WISEMAN, R.L.; BERKOWITZ, S.A.; DAY, L.A.: "Different arrangements of protein subunits and single-stranded circular DNA in the filamentous bacterial viruses fd and Pfl", J. MOL. BIOL., vol. 102, 1976, pages 549 - 561
ZHANG, Q.; YANG, X.; WANG, H.; VAN DER DONK, W.A.: "High divergence of the precursor peptides in combinatorial lanthipeptide biosynthesis", ACS CHEM. BIOL., 2014, pages 2686 - 2694

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2019073011A1 (en) * 2017-10-12 2019-04-18 Deinove Enzymatic synthesis of lipolanthipeptides
WO2021252975A3 (en) * 2020-06-12 2022-02-17 Massachusetts Institute Of Technology Split intein-based selection for peptide binders

Also Published As

Publication number Publication date
CA2961285A1 (en) 2016-03-31
US11149270B2 (en) 2021-10-19
US20170204400A1 (en) 2017-07-20

Similar Documents

Publication Publication Date Title
US11149270B2 (en) Biosynthesis and engineering of lanthipeptides
US11078479B2 (en) Polypeptide display libraries and methods of making and using thereof
KR101268939B1 (en) Phage display using cotranslational translocation of fusion polypeptides
Urban et al. Phage display and selection of lanthipeptides on the carboxy-terminus of the gene-3 minor coat protein
Wang et al. Cerecidins, novel lantibiotics from Bacillus cereus with potent antimicrobial activity
KR20190141229A (en) Protein and peptide tag with improved spontaneous isopeptide bond formation rate and use thereof
US20200385705A1 (en) Novel methods for displaying cyclic peptides on bacteriophage particles
US20170240883A1 (en) Cyclic peptides expressed by a genetic package
Wang et al. Bovicin HJ50-like lantibiotics, a novel subgroup of lantibiotics featured by an indispensable disulfide bridge
JP2017035101A (en) Modified peptide display
JP7549881B2 (en) Evolved proteases and protease cleavage site selection systems
Hetrick Development of lanthipeptide engineering strategies
JP2019535298A (en) Isolated polynucleotides and polypeptides and methods of using them to express expression products of interest
HK1243126A1 (en) Novel methods for displaying cyclic peptides on bacteriophage particles
Ali Analyzing the engineering potential of subtilosin A by probing the substrate promiscuity of the thioether forming sactisynthase AlbA
Whan finalrepport
Chang Scaffolding-Mediated Capsid Size Determination In Bacteriophages

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 15777831

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 15326751

Country of ref document: US

ENP Entry into the national phase

Ref document number: 2961285

Country of ref document: CA

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 15777831

Country of ref document: EP

Kind code of ref document: A1