WO2016028573A1 - Antigen binding proteins that bind cxcr5 - Google Patents
Antigen binding proteins that bind cxcr5 Download PDFInfo
- Publication number
- WO2016028573A1 WO2016028573A1 PCT/US2015/044926 US2015044926W WO2016028573A1 WO 2016028573 A1 WO2016028573 A1 WO 2016028573A1 US 2015044926 W US2015044926 W US 2015044926W WO 2016028573 A1 WO2016028573 A1 WO 2016028573A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- called
- disease
- variable domain
- chain variable
- Prior art date
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2866—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for cytokines, lymphokines, interferons
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/04—Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/16—Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
- A61P11/06—Antiasthmatics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P13/00—Drugs for disorders of the urinary system
- A61P13/12—Drugs for disorders of the urinary system of the kidneys
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
- A61P17/02—Drugs for dermatological disorders for treating wounds, ulcers, burns, scars, keloids, or the like
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
- A61P17/06—Antipsoriatics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
- A61P17/14—Drugs for dermatological disorders for baldness or alopecia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/02—Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/08—Antiepileptics; Anticonvulsants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/14—Drugs for disorders of the nervous system for treating abnormal movements, e.g. chorea, dyskinesia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/14—Drugs for disorders of the nervous system for treating abnormal movements, e.g. chorea, dyskinesia
- A61P25/16—Anti-Parkinson drugs
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/18—Antipsychotics, i.e. neuroleptics; Drugs for mania or schizophrenia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/28—Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P27/00—Drugs for disorders of the senses
- A61P27/02—Ophthalmic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
- A61P31/08—Antibacterial agents for leprosy
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
- A61P31/16—Antivirals for RNA viruses for influenza or rhinoviruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
- A61P31/18—Antivirals for RNA viruses for HIV
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/20—Antivirals for DNA viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P33/00—Antiparasitic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P33/00—Antiparasitic agents
- A61P33/02—Antiprotozoals, e.g. for leishmaniasis, trichomoniasis, toxoplasmosis
- A61P33/06—Antimalarials
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/08—Antiallergic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P5/00—Drugs for disorders of the endocrine system
- A61P5/14—Drugs for disorders of the endocrine system of the thyroid hormones, e.g. T3, T4
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
- A61P7/02—Antithrombotic agents; Anticoagulants; Platelet aggregation inhibitors
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
- A61P7/06—Antianaemics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/10—Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
Definitions
- the present disclosure provides compositions and methods relating to or derived from anti-CXCR5 antibodies. More specifically, the present disclosure provides human antibodies that bind CXCR5, CXCR5-binding fragments and derivatives of such antibodies, and CXCR5- binding polypeptides comprising such fragments. Further still, the present disclosure provides nucleic acids encoding such antibodies, antibody fragments and derivatives and polypeptides, cells comprising such polynucleotides, methods of making such antibodies, antibody fragments and derivatives and polypeptides, and methods of using such antibodies, antibody fragments and derivatives and polypeptides, including methods of treating or diagnosing subjects having CXCR5 related disorders or conditions, including various inflammatory disorders and various cancers.
- CXCR5 also known as Burkitt lymphoma receptor (BLR1), CD185, MDR15 and
- MGC117347 is a G protein-coupled receptor which is a member of the CXC chemokine receptor family.
- a ligand is BLC, also known as CXCL13, which is a B cell chemoattractant.
- the unprocessed CXCR5 precursor is 372 amino acids in length with a molecular weight of 42 KD- CXCR5 has a role in B cell migration and localization within particular anatomic compartments. Knockout mice lack peripheral lymph nodes, have fewer Peyer's patches and have decreased B cell levels.
- the present disclosure provides a fully human antibody of an IgG class that binds to an CXCR5 epitope with a binding affinity of at least 10 "6 M, which has a heavy chain variable domain sequence that is at least 95% identical to the amino acid sequences selected from the group consisting of SEQ ID NO. 1, SEQ ID NO. 3, SEQ ID NO. 5, SEQ ID NO. 7, SEQ ID NO. 9, SEQ ID NO. 11, SEQ ID NO. 13, SEQ ID NO. 15, SEQ ID NO. 17, SEQ ID NO. 19, SEQ ID NO. 21, SEQ ID NO. 23, SEQ ID NO. 25, SEQ ID NO. 27, SEQ ID NO. 29, SEQ ID NO. 31, SEQ ID NO. 33, SEQ ID NO. 35, SEQ ID NO. 37, SEQ ID NO.
- SEQ ID NO. 41 SEQ ID NO. 43, SEQ ID NO. 45, SEQ ID NO. 47, SEQ ID NO.50, SEQ ID NO. 52, SEQ ID NO. 54, SEQ ID NO. 56, SEQ ID NO. 58, SEQ ID NO. 60, SEQ ID NO. 62, SEQ ID NO. 64, SEQ ID NO. 66, SEQ ID NO. 68, SEQ ID NO. 70, SEQ ID NO. 72, SEQ ID NO. 74, SEQ ID NO. 76, SEQ ID NO. 78, SEQ ID NO. 80, SEQ ID NO. 82, SEQ ID NO. 84, SEQ ID NO. 87, SEQ ID NO. 89, SEQ ID NO.
- SEQ ID NO. 92 SEQ ID NO. 94, SEQ ID NO. 96, SEQ ID NO. 98, SEQ ID NO. 100, SEQ ID NO. 102, SEQ ID NO. 104, SEQ ID NO. 106, SEQ ID NO. 108, SEQ ID NO. 110, SEQ ID NO. 112, SEQ ID NO. 114, SEQ ID NO. 116, SEQ ID NO. 118, SEQ ID NO. 120, SEQ ID NO. 122, SEQ ID NO. 124, SEQ ID NO. 126, SEQ ID NO. 128, SEQ ID NO. 130, SEQ ID NO. 132, SEQ ID NO. 134, SEQ ID NO. 136, SEQ ID NO. 138, SEQ ID NO.
- SEQ ID NO. 141 SEQ ID NO. 143, SEQ ID NO. 145, SEQ ID NO. 147, SEQ ID NO. 149, SEQ ID NO. 151, SEQ ID NO. 154, SEQ ID NO. 156, SEQ ID NO. 158, SEQ ID NO. 160, SEQ ID NO. 162, SEQ ID NO. 164, SEQ ID NO. 176, SEQ ID NO. 179, SEQ ID NO. 181, SEQ ID NO. 183, SEQ ID NO. 185, SEQ ID NO. 187, SEQ ID NO. 189, SEQ ID NO. 191, SEQ ID NO. 193, SEQ ID NO.
- SEQ ID NO. 2 SEQ ID NO. 4, SEQ ID NO. 6, SEQ ID NO. 8, SEQ ID NO. 10, SEQ ID NO. 12, SEQ ID NO. 14, SEQ ID NO. 16, SEQ ID NO. 18, SEQ ID NO. 20, SEQ ID NO. 22, SEQ ID NO. 24, SEQ ID NO. 26, SEQ ID NO. 28, SEQ ID NO. 30, SEQ ID NO. 32, SEQ ID NO. 34, SEQ ID NO. 36, SEQ ID NO. 38, SEQ ID NO. 40, SEQ ID NO. 42, SEQ ID NO. 44, SEQ ID NO. 46, SEQ ID NO.
- SEQ ID NO. 49 SEQ ID NO. 51, SEQ ID NO. 53, SEQ ID NO. 55, SEQ ID NO. 57, SEQ ID NO. 59, SEQ ID NO. 61, SEQ ID NO. 63, SEQ ID NO. 67, SEQ ID NO. 69, SEQ ID NO. 71, SEQ ID NO. 73, SEQ ID NO. 75, SEQ ID NO. 77, SEQ ID NO. 79, SEQ ID NO. 81, SEQ ID NO. 83, SEQ ID NO. 85, SEQ ID NO. 86, SEQ ID NO. 88, SEQ ID NO. 90, SEQ ID NO. 91, SEQ ID NO. 93, SEQ ID NO. 95, SEQ ID NO.
- SEQ ID NO. 99 SEQ ID NO. 101, SEQ ID NO. 103, SEQ ID NO. 105, SEQ ID NO. 107, SEQ ID NO. 109, SEQ ID NO. I l l, SEQ ID NO. 113, SEQ ID NO. 115, SEQ ID NO. 117, SEQ ID NO. 119, SEQ ID NO. 121, SEQ ID NO. 123, SEQ ID NO. 125, SEQ ID NO. 127, SEQ ID NO. 129, SEQ ID NO. 131, SEQ ID NO. 133, SEQ ID NO. 135, SEQ ID NO. 137, SEQ ID NO. 139, SEQ ID NO. 140, SEQ ID NO. 142, SEQ ID NO.
- SEQ ID NO. 146 SEQ ID NO. 148, SEQ ID NO. 150, SEQ ID NO. 152, SEQ ID NO. 153, SEQ ID NO. 155, SEQ ID NO. 157, SEQ ID NO. 159, SEQ ID NO. 161, SEQ ID NO. 163, SEQ ID NO. 165, SEQ ID NO. 167, SEQ ID NO. 169, SEQ ID NO. 171, SEQ ID NO. 173, SEQ ID NO. 175, SEQ ID NO. 177, SEQ ID NO. 178, SEQ ID NO. 180, SEQ ID NO. 182, SEQ ID NO. 184, SEQ ID NO. 186, SEQ ID NO. 188, SEQ ID NO. 190, SEQ ID NO.
- the fully human antibody has both a heavy chain and a light chain wherein the antibody has a heavy chain/light chain variable domain sequence selected from the group consisting of SEQ ID NO. 1/SEQ ID NO. 2 (called 52A9 herein), SEQ ID NO. 3/SEQ ID NO. 4 (called 52A10 herein), SEQ ID NO. 5/SEQ ID NO. 6 (called 52B10 herein), SEQ ID NO. 7/SEQ ID NO. 8 (called 52C6 herein), SEQ ID NO. 9/SEQ ID NO. 10 (called 52D6 herein), SEQ ID NO. 11/SEQ ID NO.
- SEQ ID NO. 31/SEQ ID NO. 32 (called A8 herein), SEQ ID NO. 33/SEQ ID NO. 34 (called A12 herein), SEQ ID NO. 35/SEQ ID NO. 36 (called B3 herein), SEQ ID NO. 37/SEQ ID NO. 38 (called C8 herein), SEQ ID NO. 39/SEQ ID NO. 40 (called F8 or 10G9 herein), SEQ ID NO. 41/SEQ ID NO. 42 (called Gl 1 herein), SEQ ID NO. 43/SEQ ID NO. 44 (called H3 herein), SEQ ID NO. 45/SEQ ID NO. 46 (called H5 herein), SEQ ID NO. 47/SEQ ID NO.
- SEQ ID NO. 48 (called H6 herein), SEQ ID NO. 25/SEQ ID NO. 49 (called 2D3 herein), SEQ ID NO. 50/SEQ ID NO. 51 (called 3 Al l herein), SEQ ID NO. 52/SEQ ID NO. 53 (called 3B9 herein), SEQ ID NO. 54/SEQ ID NO. 55 (called 3D11 herein), SEQ ID NO. 56/SEQ ID NO. 57 (called 3D12 or 4E12 herein), SEQ ID NO. 58/SEQ ID NO. 59 (called 3E7 herein), SEQ ID NO. 60/SEQ ID NO. 61 (called 3E12 herein), SEQ ID NO. 62/SEQ ID NO. 63 (called 3F7 herein), SEQ ID NO.
- SEQ ID NO. 81 (called 5F1 herein), SEQ ID NO. 82/SEQ ID NO. 83 (called 6A4 herein), SEQ ID NO. 84/SEQ ID NO. 85 (called 6F9 herein), SEQ ID NO. 15/SEQ ID NO. 86 (called 6G5 herein), SEQ ID NO. 87/SEQ ID NO. 88 (called 7B11 or 8B2 herein), SEQ ID NO. 89/SEQ ID NO. 90 (called 7H10 herein), SEQ ID NO. 15/SEQ ID NO. 91 (called 8D12 herein), SEQ ID NO. 92/SEQ ID NO. 93 (called 8H5 herein), SEQ ID NO. 94/SEQ ID NO.
- SEQ ID NO. 95 (called 9A10 herein), SEQ ID NO. 96/SEQ ID NO. 97 (called 10A12 herein), SEQ ID NO. 98/SEQ ID NO. 99 (called 10B2 herein), SEQ ID NO. 100/SEQ ID NO. 101 (called 10C3 herein), SEQ ID NO. 102/SEQ ID NO. 103 (called 10C7 herein), SEQ ID NO. 104/SEQ ID NO. 105 (called 11E3 herein), SEQ ID NO. 106/SEQ ID NO. 107 (called 11 A12 herein), SEQ ID NO. 108/SEQ ID NO. 109 (called 11A7 herein), SEQ ID NO. 110/SEQ ID NO.
- the present disclosure provides a fully human antibody Fab fragment, having a variable domain region from a heavy chain and a variable domain region from a light chain, wherein the heavy chain variable domain sequence that is at least 95% identical to the amino acid sequences selected from the group consisting of SEQ ID NO. 1, SEQ ID NO. 3, SEQ ID NO. 5, SEQ ID NO. 7, SEQ ID NO. 9, SEQ ID NO. 11, SEQ ID NO. 13, SEQ ID NO. 15,
- SEQ ID NO. 17 SEQ ID NO. 19, SEQ ID NO. 21, SEQ ID NO. 23, SEQ ID NO. 25, SEQ ID NO. 27, SEQ ID NO. 29, SEQ ID NO. 31, SEQ ID NO. 33, SEQ ID NO. 35, SEQ ID NO. 37, SEQ ID NO. 39, SEQ ID NO. 41, SEQ ID NO. 43, SEQ ID NO. 45, SEQ ID NO. 47, SEQ ID NO.50, SEQ ID NO. 52, SEQ ID NO. 54, SEQ ID NO. 56, SEQ ID NO. 58, SEQ ID NO. 60, SEQ ID NO. 62, SEQ ID NO. 64, SEQ ID NO. 66, SEQ ID NO. 68, SEQ ID NO. 70, SEQ ID NO.
- SEQ ID NO. 124 SEQ ID NO. 126, SEQ ID NO. 128, SEQ ID NO. 130, SEQ ID NO. 132, SEQ ID NO. 134, SEQ ID NO. 136, SEQ ID NO. 138, SEQ ID NO. 141, SEQ ID NO. 143, SEQ ID NO. 145, SEQ ID NO. 147, SEQ ID NO. 149, SEQ ID NO. 151, SEQ ID NO. 154, SEQ ID NO. 156, SEQ ID NO. 158, SEQ ID NO. 160, SEQ ID NO. 162, SEQ ID NO. 164, SEQ ID NO. 176, SEQ ID NO. 179, SEQ ID NO. 181, SEQ ID NO.
- SEQ ID NO. 185 SEQ ID NO. 187, SEQ ID NO. 189, SEQ ID NO. 191, SEQ ID NO. 193, SEQ ID NO. 195, and combinations thereof, and that has a light chain variable domain sequence that is at least 95% identical to the amino acid sequences selected from the group consisting of SEQ ID NO. 2, SEQ ID NO. 4, SEQ ID NO. 6, SEQ ID NO. 8, SEQ ID NO. 10, SEQ ID NO. 12, SEQ ID NO. 14, SEQ ID NO. 16, SEQ ID NO. 18, SEQ ID NO. 20, SEQ ID NO. 22, SEQ ID NO. 24, SEQ ID NO. 26, SEQ ID NO. 28, SEQ ID NO. 30, SEQ ID NO. 32, SEQ ID NO. 34, SEQ ID NO.
- SEQ ID NO. 38 SEQ ID NO. 40, SEQ ID NO. 42, SEQ ID NO. 44, SEQ ID NO. 46, SEQ ID NO. 48, SEQ ID NO. 49, SEQ ID NO. 51, SEQ ID NO. 53, SEQ ID NO. 55, SEQ ID NO. 57, SEQ ID NO. 59, SEQ ID NO. 61, SEQ ID NO. 63, SEQ ID NO. 67, SEQ ID NO. 69, SEQ ID NO. 71, SEQ ID NO. 73, SEQ ID NO. 75, SEQ ID NO. 77, SEQ ID NO. 79, SEQ ID NO. 81, SEQ ID NO. 83, SEQ ID NO. 85, SEQ ID NO.
- the fully human antibody Fab fragment has both a heavy chain variable domain region and a light chain variable domain region wherein the antibody has a heavy chain/light chain variable domain sequence selected from the group consisting of SEQ ID NO. 1/SEQ ID NO. 2, SEQ ID NO. 3/SEQ ID NO. 4, SEQ ID NO. 5/SEQ ID NO. 6, SEQ ID NO. 7/SEQ ID NO. 8, SEQ ID NO. 9/SEQ ID NO. 10, SEQ ID NO.
- SEQ ID NO. 40 SEQ ID NO. 41/SEQ ID NO. 42, SEQ ID NO. 43/SEQ ID NO. 44, SEQ ID NO. 45/SEQ ID NO. 46, SEQ ID NO. 47/SEQ ID NO. 48, SEQ ID NO. 25/SEQ ID NO. 49, SEQ ID NO. 50/SEQ ID NO. 51, SEQ ID NO. 52/SEQ ID NO. 53, SEQ ID NO. 54/SEQ ID NO. 55, SEQ ID NO. 56/SEQ ID NO. 57, SEQ ID NO. 58/SEQ ID NO. 59, SEQ ID NO. 60/SEQ ID NO. 61, SEQ ID NO. 62/SEQ ID NO. 63, SEQ ID NO.
- SEQ ID NO. 89/SEQ ID NO. 90 SEQ ID NO. 15/SEQ ID NO. 91, SEQ ID NO. 92/SEQ ID NO. 93, SEQ ID NO. 94/SEQ ID NO. 95, SEQ ID NO. 96/SEQ ID NO. 97, SEQ ID NO. 98/SEQ ID NO. 99, SEQ ID NO. 100/SEQ ID NO. 101, SEQ ID NO. 102/SEQ ID NO. 103, SEQ ID NO. 104/SEQ ID NO. 105, SEQ ID NO. 106/SEQ ID NO. 107, SEQ ID NO. 108/SEQ ID NO. 109, SEQ ID NO. 110/SEQ ID NO.
- SEQ ID NO. 136/SEQ ID NO. 137 SEQ ID NO. 138/SEQ ID NO. 139, SEQ ID NO. 114/SEQ ID NO. 140, SEQ ID NO. 141/SEQ ID NO. 142, SEQ ID NO. 143/SEQ ID NO. 144, SEQ ID NO. 145/SEQ ID NO. 146, SEQ ID NO. 147/SEQ ID NO. 148, SEQ ID NO. 149/SEQ ID NO. 150, SEQ ID NO. 151/SEQ ID NO. 152, SEQ ID NO. 25/SEQ ID NO. 153, SEQ ID NO. 154/SEQ ID NO. 155, SEQ ID NO. 156/SEQ ID NO.
- SEQ ID NO. 158/SEQ ID NO. 159 SEQ ID NO. 160/SEQ ID NO. 161, SEQ ID NO. 162/SEQ ID NO. 163, SEQ ID NO. 164/SEQ ID NO. 165, SEQ ID NO. 1664/SEQ ID NO. 167, SEQ ID NO. 168/SEQ ID NO. 169, SEQ ID NO. 170/SEQ ID NO. 171, SEQ ID NO. 172/SEQ ID NO. 173, SEQ ID NO. 174/SEQ ID NO. 175, SEQ ID NO. 176/SEQ ID NO. 177, SEQ ID NO. 19/SEQ ID NO. 178, SEQ ID NO. 179/SEQ ID NO. 180, SEQ ID NO.
- the present disclosure provides a single chain human antibody, having a variable domain region from a heavy chain and a variable domain region from a light chain and a peptide linker connection the heavy chain and light chain variable domain regions, wherein the heavy chain variable domain sequence that is at least 95% identical to the amino acid sequences selected from the group consisting of SEQ ID NO. 1, SEQ ID NO. 3, SEQ ID NO.
- SEQ ID NO. 7 SEQ ID NO. 9, SEQ ID NO. 11, SEQ ID NO. 13, SEQ ID NO. 15, SEQ ID NO. 17, SEQ ID NO. 19, SEQ ID NO. 21, SEQ ID NO. 23, SEQ ID NO. 25, SEQ ID NO. 27, SEQ ID NO. 29, SEQ ID NO. 31, SEQ ID NO. 33, SEQ ID NO. 35, SEQ ID NO. 37, SEQ ID NO. 39, SEQ ID NO. 41, SEQ ID NO. 43, SEQ ID NO. 45, SEQ ID NO. 47, SEQ ID NO.50, SEQ ID NO. 52, SEQ ID NO. 54, SEQ ID NO. 56, SEQ ID NO. 58, SEQ ID NO. 60, SEQ ID NO. 62, SEQ ID NO.
- SEQ ID NO. 176 SEQ ID NO. 179, SEQ ID NO. 181, SEQ ID NO. 183, SEQ ID NO. 185, SEQ ID NO. 187, SEQ ID NO. 189, SEQ ID NO. 191, SEQ ID NO. 193, SEQ ID NO. 195, and combinations thereof, and that has a light chain variable domain sequence that is at least 95% identical to the amino acid sequences selected from the group consisting of SEQ ID NO. 2, SEQ ID NO. 4, SEQ ID NO.
- SEQ ID NO. 6 SEQ ID NO. 8, SEQ ID NO. 10, SEQ ID NO. 12, SEQ ID NO. 14, SEQ ID NO. 16, SEQ ID NO. 18, SEQ ID NO. 20, SEQ ID NO. 22, SEQ ID NO. 24, SEQ ID NO. 26, SEQ ID NO. 28, SEQ ID NO. 30, SEQ ID NO. 32, SEQ ID NO. 34, SEQ ID NO. 36, SEQ ID NO. 38, SEQ ID NO. 40, SEQ ID NO. 42, SEQ ID NO. 44, SEQ ID NO. 46, SEQ ID NO. 48, SEQ ID NO. 49, SEQ ID NO. 51, SEQ ID NO. 53, SEQ ID NO. 55, SEQ ID NO. 57, SEQ ID NO. 59, SEQ ID NO.
- SEQ ID NO. 63 SEQ ID NO. 67, SEQ ID NO. 69, SEQ ID NO. 71, SEQ ID NO. 73, SEQ ID NO. 75, SEQ ID NO. 77, SEQ ID NO. 79, SEQ ID NO. 81, SEQ ID NO. 83, SEQ ID NO. 85, SEQ ID NO. 86, SEQ ID NO. 88, SEQ ID NO. 90, SEQ ID NO. 91, SEQ ID NO. 93, SEQ ID NO. 95, SEQ ID NO. 97, SEQ ID NO. 99, SEQ ID NO. 101, SEQ ID NO. 103, SEQ ID NO. 105, SEQ ID NO. 107, SEQ ID NO. 109, SEQ ID NO. I l l, SEQ ID NO. 113, SEQ ID NO.
- the fully human single chain antibody has both a heavy chain variable domain region and a light chain variable domain region, wherein the single chain fully human antibody has a heavy chain/light chain variable domain sequence selected from the group consisting of SEQ ID NO. 1/SEQ ID NO. 2, SEQ ID NO. 3/SEQ ID NO. 4, SEQ ID NO. 5/SEQ ID NO. 6, SEQ ID NO. 7/SEQ ID NO. 8, SEQ ID NO. 9/SEQ ID NO. 10, SEQ ID NO. 11/SEQ ID NO. 12, SEQ ID NO. 13/SEQ ID NO. 14, SEQ ID NO. 15/SEQ ID NO. 16, SEQ ID NO.
- SEQ ID NO. 115 SEQ ID NO. 116/SEQ ID NO. 117, SEQ ID NO. 118/SEQ ID NO. 119, SEQ ID NO. 120/SEQ ID NO. 121, SEQ ID NO. 122/SEQ ID NO. 123, SEQ ID NO. 124/SEQ ID NO. 125, SEQ ID NO. 126/SEQ ID NO. 127, SEQ ID NO. 128/SEQ ID NO. 129, SEQ ID NO. 130/SEQ ID NO. 131, SEQ ID NO. 132/SEQ ID NO. 133, SEQ ID NO. 134/SEQ ID NO. 135, SEQ ID NO. 136/SEQ ID NO. 137, SEQ ID NO. 138/SEQ ID NO. 139, SEQ ID NO.
- the present disclosure further provides a method for treating an inflammatory disease, comprising administering an effective amount of an anti-CXCR5 polypeptide, wherein the anti-CXCR5 polypeptide is selected from the group consisting of a fully human antibody of an IgG class that binds to a CXCR5 epitope with a binding affinity of at least 10 "6 M, a fully human antibody Fab fragment, having a variable domain region from a heavy chain and a variable domain region from a light chain, a single chain human antibody, having a variable domain region from a heavy chain and a variable domain region from a light chain and a peptide linker connection the heavy chain and light chain variable domain regions, and combinations thereof;
- the fully human antibody has a heavy chain variable domain sequence that is at least 95% identical to the amino acid sequences selected from the group consisting of SEQ ID NO. 1, SEQ ID NO. 3, SEQ ID NO. 5, SEQ ID NO. 7, SEQ ID NO. 9, SEQ ID NO. 11, SEQ ID NO. 13, SEQ ID NO. 15, SEQ ID NO. 17, SEQ ID NO. 19, SEQ ID NO. 21, SEQ ID NO. 23, SEQ ID NO. 25, SEQ ID NO. 27, SEQ ID NO. 29, SEQ ID NO. 31, SEQ ID NO. 33, SEQ ID NO. 35, SEQ ID NO. 37, SEQ ID NO. 39, SEQ ID NO. 41, SEQ ID NO. 43, SEQ ID NO. 45, SEQ ID NO.
- SEQ ID NO.50 SEQ ID NO. 52, SEQ ID NO. 54, SEQ ID NO. 56, SEQ ID NO. 58, SEQ ID NO. 60, SEQ ID NO. 62, SEQ ID NO. 64, SEQ ID NO. 66, SEQ ID NO. 68, SEQ ID NO. 70, SEQ ID NO. 72, SEQ ID NO. 74, SEQ ID NO. 76, SEQ ID NO. 78, SEQ ID NO. 80, SEQ ID NO. 82, SEQ ID NO. 84, SEQ ID NO. 87, SEQ ID NO. 89, SEQ ID NO. 92, SEQ ID NO. 94, SEQ ID NO. 96, SEQ ID NO. 98, SEQ ID NO.
- SEQ ID NO. 102 SEQ ID NO. 104, SEQ ID NO. 106, SEQ ID NO. 108, SEQ ID NO. 110, SEQ ID NO. 112, SEQ ID NO. 114, SEQ ID NO. 116, SEQ ID NO. 118, SEQ ID NO. 120, SEQ ID NO. 122, SEQ ID NO. 124, SEQ ID NO. 126, SEQ ID NO. 128, SEQ ID NO. 130, SEQ ID NO. 132, SEQ ID NO. 134, SEQ ID NO. 136, SEQ ID NO. 138, SEQ ID NO. 141, SEQ ID NO. 143, SEQ ID NO. 145, SEQ ID NO. 147, SEQ ID NO.
- SEQ ID NO. 149 SEQ ID NO. 151, SEQ ID NO. 154, SEQ ID NO. 156, SEQ ID NO. 158, SEQ ID NO. 160, SEQ ID NO. 162, SEQ ID NO. 164, SEQ ID NO. 176, SEQ ID NO. 179, SEQ ID NO. 181, SEQ ID NO. 183, SEQ ID NO. 185, SEQ ID NO. 187, SEQ ID NO. 189, SEQ ID NO. 191, SEQ ID NO. 193, SEQ ID NO. 195, and combinations thereof, and that has a light chain variable domain sequence that is at least 95% identical to the amino acid sequences selected from the group consisting of SEQ ID NO. 2, SEQ ID NO. 4, SEQ ID NO. 6, SEQ ID NO.
- SEQ ID NO. 8 SEQ ID NO. 10
- SEQ ID NO. 67 SEQ ID NO. 69, SEQ ID NO. 71, SEQ ID NO. 73, SEQ ID NO. 75, SEQ ID NO. 77, SEQ ID NO. 79, SEQ ID NO. 81, SEQ ID NO. 83, SEQ ID NO. 85, SEQ ID NO. 86, SEQ ID NO. 88, SEQ ID NO. 90, SEQ ID NO. 91, SEQ ID NO. 93, SEQ ID NO. 95, SEQ ID NO. 97, SEQ ID NO. 99, SEQ ID NO. 101, SEQ ID NO. 103, SEQ ID NO. 105, SEQ ID NO. 107, SEQ ID NO. 109, SEQ ID NO.
- SEQ ID NO. 159 SEQ ID NO. 161, SEQ ID NO. 163, SEQ ID NO. 165, SEQ ID NO. 167, SEQ ID NO. 169, SEQ ID NO. 171, SEQ ID NO. 173, SEQ ID NO. 175, SEQ ID NO. 177, SEQ ID NO. 178, SEQ ID NO. 180, SEQ ID NO. 182, SEQ ID NO. 184, SEQ ID NO. 186, SEQ ID NO. 188, SEQ ID NO. 190, SEQ ID NO. 192, SEQ ID NO. 194, SEQ ID NO. 196, and combinations thereof;
- the fully human antibody Fab fragment has the heavy chain variable domain sequence that is at least 95% identical to the amino acid sequences selected from the group consisting of SEQ ID NO. 1, SEQ ID NO. 3, SEQ ID NO. 5, SEQ ID NO. 7, SEQ ID NO. 9, SEQ ID NO. 11, SEQ ID NO. 13, SEQ ID NO. 15, SEQ ID NO. 17, SEQ ID NO. 19, SEQ ID NO. 21, SEQ ID NO. 23, SEQ ID NO. 25, SEQ ID NO. 27, SEQ ID NO. 29, SEQ ID NO. 31, SEQ ID NO. 33, SEQ ID NO. 35, SEQ ID NO. 37, SEQ ID NO. 39, SEQ ID NO. 41, SEQ ID NO. 43, SEQ ID NO. 45, SEQ ID NO.
- SEQ ID NO.50 SEQ ID NO. 52, SEQ ID NO. 54, SEQ ID NO. 56, SEQ ID NO. 58, SEQ ID NO. 60, SEQ ID NO. 62, SEQ ID NO. 64, SEQ ID NO. 66, SEQ ID NO. 68, SEQ ID NO. 70, SEQ ID NO. 72, SEQ ID NO. 74, SEQ ID NO. 76, SEQ ID NO. 78, SEQ ID NO. 80, SEQ ID NO. 82, SEQ ID NO. 84, SEQ ID NO. 87, SEQ ID NO. 89, SEQ ID NO. 92, SEQ ID NO. 94, SEQ ID NO. 96, SEQ ID NO. 98, SEQ ID NO.
- SEQ ID NO. 102 SEQ ID NO. 104, SEQ ID NO. 106, SEQ ID NO. 108, SEQ ID NO. 110, SEQ ID NO. 112, SEQ ID NO. 114, SEQ ID NO. 116, SEQ ID NO. 118, SEQ ID NO. 120, SEQ ID NO. 122, SEQ ID NO. 124, SEQ ID NO. 126, SEQ ID NO. 128, SEQ ID NO. 130, SEQ ID NO. 132, SEQ ID NO. 134, SEQ ID NO. 136, SEQ ID NO. 138, SEQ ID NO. 141, SEQ ID NO. 143, SEQ ID NO. 145, SEQ ID NO. 147, SEQ ID NO.
- SEQ ID NO. 149 SEQ ID NO. 151, SEQ ID NO. 154, SEQ ID NO. 156, SEQ ID NO. 158, SEQ ID NO. 160, SEQ ID NO. 162, SEQ ID NO. 164, SEQ ID NO. 176, SEQ ID NO. 179, SEQ ID NO. 181, SEQ ID NO. 183, SEQ ID NO. 185, SEQ ID NO. 187, SEQ ID NO. 189, SEQ ID NO. 191, SEQ ID NO. 193, SEQ ID NO. 195, and combinations thereof, and that has the light chain variable domain sequence that is at least 95% identical to the amino acid sequences selected from the group consisting of SEQ ID NO. 2, SEQ ID NO. 4, SEQ ID NO. 6, SEQ ID NO.
- SEQ ID NO. 8 SEQ ID NO. 10
- SEQ ID NO. 67 SEQ ID NO. 69, SEQ ID NO. 71, SEQ ID NO. 73, SEQ ID NO. 75, SEQ ID NO. 77, SEQ ID NO. 79, SEQ ID NO. 81, SEQ ID NO. 83, SEQ ID NO. 85, SEQ ID NO. 86, SEQ ID NO. 88, SEQ ID NO. 90, SEQ ID NO. 91, SEQ ID NO. 93, SEQ ID NO. 95, SEQ ID NO. 97, SEQ ID NO. 99, SEQ ID NO. 101, SEQ ID NO. 103, SEQ ID NO. 105, SEQ ID NO. 107, SEQ ID NO. 109, SEQ ID NO.
- SEQ ID NO. 159 SEQ ID NO. 161, SEQ ID NO. 163, SEQ ID NO. 165, SEQ ID NO. 167, SEQ ID NO. 169, SEQ ID NO. 171, SEQ ID NO. 173, SEQ ID NO. 175, SEQ ID NO. 177, SEQ ID NO. 178, SEQ ID NO. 180, SEQ ID NO. 182, SEQ ID NO. 184, SEQ ID NO. 186, SEQ ID NO. 188, SEQ ID NO. 190, SEQ ID NO. 192, SEQ ID NO. 194, SEQ ID NO. 196, and combinations thereof; and
- the single chain human antibody has the heavy chain variable domain sequence that is at least 95% identical to the amino acid sequences selected from the group consisting of SEQ ID NO. 1, SEQ ID NO. 3, SEQ ID NO. 5, SEQ ID NO. 7, SEQ ID NO. 9, SEQ ID NO. 11, SEQ ID NO. 13, SEQ ID NO. 15, SEQ ID NO. 17, SEQ ID NO. 19, SEQ ID NO. 21, SEQ ID NO. 23, SEQ ID NO. 25, SEQ ID NO. 27, SEQ ID NO. 29, SEQ ID NO. 31, SEQ ID NO. 33, SEQ ID NO. 35, SEQ ID NO. 37, SEQ ID NO. 39, SEQ ID NO. 41, SEQ ID NO. 43, SEQ ID NO. 45, SEQ ID NO.
- SEQ ID NO.50 SEQ ID NO. 52, SEQ ID NO. 54, SEQ ID NO. 56, SEQ ID NO. 58, SEQ ID NO. 60, SEQ ID NO. 62, SEQ ID NO. 64, SEQ ID NO. 66, SEQ ID NO. 68, SEQ ID NO. 70, SEQ ID NO. 72, SEQ ID NO. 74, SEQ ID NO. 76, SEQ ID NO. 78, SEQ ID NO. 80, SEQ ID NO. 82, SEQ ID NO. 84, SEQ ID NO. 87, SEQ ID NO. 89, SEQ ID NO. 92, SEQ ID NO. 94, SEQ ID NO. 96, SEQ ID NO. 98, SEQ ID NO.
- SEQ ID NO. 102 SEQ ID NO. 104, SEQ ID NO. 106, SEQ ID NO. 108, SEQ ID NO. 110, SEQ ID NO. 112, SEQ ID NO. 114, SEQ ID NO. 116, SEQ ID NO. 118, SEQ ID NO. 120, SEQ ID NO. 122, SEQ ID NO. 124, SEQ ID NO. 126, SEQ ID NO. 128, SEQ ID NO. 130, SEQ ID NO. 132, SEQ ID NO. 134, SEQ ID NO. 136, SEQ ID NO. 138, SEQ ID NO. 141, SEQ ID NO. 143, SEQ ID NO. 145, SEQ ID NO. 147, SEQ ID NO.
- SEQ ID NO. 149 SEQ ID NO. 151, SEQ ID NO. 154, SEQ ID NO. 156, SEQ ID NO. 158, SEQ ID NO. 160, SEQ ID NO. 162, SEQ ID NO. 164, SEQ ID NO. 176, SEQ ID NO. 179, SEQ ID NO. 181, SEQ ID NO. 183, SEQ ID NO. 185, SEQ ID NO. 187, SEQ ID NO. 189, SEQ ID NO. 191, SEQ ID NO. 193, SEQ ID NO. 195, and combinations thereof, and that has the light chain variable domain sequence that is at least 95% identical to the amino acid sequences selected from the group consisting of SEQ ID NO. 2, SEQ ID NO. 4, SEQ ID NO. 6, SEQ ID NO.
- SEQ ID NO. 8 SEQ ID NO. 10
- SEQ ID NO. 67 SEQ ID NO. 69, SEQ ID NO. 71, SEQ ID NO. 73, SEQ ID NO. 75, SEQ ID NO. 77, SEQ ID NO. 79, SEQ ID NO. 81, SEQ ID NO. 83, SEQ ID NO. 85, SEQ ID NO. 86, SEQ ID NO. 88, SEQ ID NO. 90, SEQ ID NO. 91, SEQ ID NO. 93, SEQ ID NO. 95, SEQ ID NO. 97, SEQ ID NO. 99, SEQ ID NO. 101, SEQ ID NO. 103, SEQ ID NO. 105, SEQ ID NO. 107, SEQ ID NO. 109, SEQ ID NO.
- SEQ ID NO. 188 SEQ ID NO. 190, SEQ ID NO. 192, SEQ ID NO. 194, SEQ ID NO. 196, and combinations thereof.
- the fully human antibody has both a heavy chain and a light chain wherein the antibody has a heavy chain/light chain variable domain sequence selected from the group consisting of SEQ ID NO. 1/SEQ ID NO. 2 (called 52A9 herein), SEQ ID NO. 3/SEQ ID NO. 4 (called 52A10 herein), SEQ ID NO. 5/SEQ ID NO. 6 (called 52B10 herein), SEQ ID NO. 7/SEQ ID NO. 8 (called 52C6 herein), SEQ ID NO. 9/SEQ ID NO. 10 (called 52D6 herein), SEQ ID NO. 11/SEQ ID NO. 12 (called 52D7 herein), SEQ ID NO. 13/SEQ ID NO.
- SEQ ID NO. 33/SEQ ID NO. 34 (called A12 herein), SEQ ID NO. 35/SEQ ID NO. 36 (called B3 herein), SEQ ID NO. 37/SEQ ID NO. 38 (called C8 herein), SEQ ID NO. 39/SEQ ID NO. 40 (called F8 or 10G9 herein), SEQ ID NO. 41/SEQ ID NO. 42 (called Gl 1 herein), SEQ ID NO. 43/SEQ ID NO. 44 (called H3 herein), SEQ ID NO. 45/SEQ ID NO. 46 (called H5 herein), SEQ ID NO. 47/SEQ ID NO. 48 (called H6 herein), SEQ ID NO. 25/SEQ ID NO.
- SEQ ID NO. 50/SEQ ID NO. 51 (called 3A11 herein), SEQ ID NO. 52/SEQ ID NO. 53 (called 3B9 herein), SEQ ID NO. 54/SEQ ID NO. 55 (called 3D11 herein), SEQ ID NO. 56/SEQ ID NO. 57 (called 3D12 or 4E12 herein), SEQ ID NO. 58/SEQ ID NO. 59 (called 3E7 herein), SEQ ID NO. 60/SEQ ID NO. 61 (called 3E12 herein), SEQ ID NO. 62/SEQ ID NO. 63 (called 3F7 herein), SEQ ID NO. 64/SEQ ID NO. 65 (called 3G2 herein), SEQ ID NO.
- SEQ ID NO. 150 (called 14E5 herein), SEQ ID NO. 151/SEQ ID NO. 152 (called 14B11 herein), SEQ ID NO. 25/SEQ ID NO. 153 (called 14B4 herein), SEQ ID NO. 154/SEQ ID NO. 155 (called 14C10 herein), SEQ ID NO. 156/SEQ ID NO. 157 (called 14C11 herein), SEQ ID NO. 158/SEQ ID NO. 159 (called 14C3 herein), SEQ ID NO. 160/SEQ ID NO. 161 (called 14D7 herein), SEQ ID NO. 162/SEQ ID NO. 163 (called 14F11 herein), SEQ ID NO. 164/SEQ ID NO.
- SEQ ID NO. 1664/SEQ ID NO. 167 (called 15C9 herein), SEQ ID NO. 168/SEQ ID NO. 169 (called 15D7 herein), SEQ ID NO. 170/SEQ ID NO. 171 (called 14D9 herein), SEQ ID NO. 172/SEQ ID NO. 173 (called 15F9 herein), SEQ ID NO. 174/SEQ ID NO. 175 (called 15G11 herein), SEQ ID NO. 176/SEQ ID NO. 177 (called 15G7 herein), SEQ ID NO. 19/SEQ ID NO. 178 (called 15G9 herein), SEQ ID NO. 179/SEQ ID NO.
- the fully human antibody Fab fragment has both a heavy chain variable domain region and a light chain variable domain region wherein the antibody has a heavy chain/light chain variable domain sequence selected from the group consisting of SEQ ID NO. 1/SEQ ID NO. 2 (called 52A9 herein), SEQ ID NO. 3/SEQ ID NO. 4 (called 52A10 herein), SEQ ID NO. 5/SEQ ID NO. 6 (called 52B10 herein), SEQ ID NO. 7/SEQ ID NO. 8 (called 52C6 herein), SEQ ID NO. 9/SEQ ID NO. 10 (called 52D6 herein), SEQ ID NO. 11/SEQ ID NO.
- SEQ ID NO. 31/SEQ ID NO. 32 (called A8 herein), SEQ ID NO. 33/SEQ ID NO. 34 (called A12 herein), SEQ ID NO. 35/SEQ ID NO. 36 (called B3 herein), SEQ ID NO. 37/SEQ ID NO. 38 (called C8 herein), SEQ ID NO. 39/SEQ ID NO. 40 (called F8 or 10G9 herein), SEQ ID NO. 41/SEQ ID NO. 42 (called Gl 1 herein), SEQ ID NO. 43/SEQ ID NO. 44 (called H3 herein), SEQ ID NO. 45/SEQ ID NO. 46 (called H5 herein), SEQ ID NO. 47/SEQ ID NO.
- SEQ ID NO. 81 (called 5F1 herein), SEQ ID NO. 82/SEQ ID NO. 83 (called 6A4 herein), SEQ ID NO. 84/SEQ ID NO. 85 (called 6F9 herein), SEQ ID NO. 15/SEQ ID NO. 86 (called 6G5 herein), SEQ ID NO. 87/SEQ ID NO. 88 (called 7B11 or 8B2 herein), SEQ ID NO. 89/SEQ ID NO. 90 (called 7H10 herein), SEQ ID NO. 15/SEQ ID NO. 91 (called 8D12 herein), SEQ ID NO. 92/SEQ ID NO. 93 (called 8H5 herein), SEQ ID NO. 94/SEQ ID NO.
- the fully human single chain antibody has both a heavy chain variable domain region and a light chain variable domain region, wherein the single chain fully human antibody has a heavy chain/light chain variable domain sequence selected from the group consisting of SEQ ID NO.
- SEQ ID NO. 2 1/SEQ ID NO. 2, SEQ ID NO. 3/SEQ ID NO. 4, SEQ ID NO. 5/SEQ ID NO. 6, SEQ ID NO. 7/SEQ ID NO. 8, SEQ ID NO. 9/SEQ ID NO. 10, SEQ ID NO. 11/SEQ ID NO. 12, SEQ ID NO. 13/SEQ ID NO. 14, SEQ ID NO.
- SEQ ID NO. 16 SEQ ID NO. 17/SEQ ID NO. 18, SEQ ID NO. 19/SEQ ID NO. 20, SEQ ID NO. 21/SEQ ID NO. 22, SEQ ID NO. 23/SEQ ID NO. 24, SEQ ID NO. 25/SEQ ID NO. 26, SEQ ID NO. 27/SEQ ID NO. 28, SEQ ID NO. 29/SEQ ID NO. 30, SEQ ID NO. 31/SEQ ID NO. 32, SEQ ID NO. 33/SEQ ID NO. 34, SEQ ID NO. 35/SEQ ID NO. 36, SEQ ID NO. 37/SEQ ID NO. 38, SEQ ID NO. 39/SEQ ID NO. 40, SEQ ID NO. 41/SEQ ID NO. 42, SEQ ID NO.
- SEQ ID NO. 91 SEQ ID NO. 92/SEQ ID NO. 93, SEQ ID NO. 94/SEQ ID NO. 95, SEQ ID NO. 96/SEQ ID NO. 97, SEQ ID NO. 98/SEQ ID NO. 99, SEQ ID NO. 100/SEQ ID NO. 101, SEQ ID NO. 102/SEQ ID NO. 103, SEQ ID NO. 104/SEQ ID NO. 105, SEQ ID NO. 106/SEQ ID NO. 107, SEQ ID NO. 108/SEQ ID NO. 109, SEQ ID NO. 110/SEQ ID NO. I l l, SEQ ID NO. 112/SEQ ID NO. 113, SEQ ID NO. 114/SEQ ID NO.
- SEQ ID NO. 114/SEQ ID NO. 140 SEQ ID NO. 141/SEQ ID NO. 142, SEQ ID NO. 143/SEQ ID NO. 144, SEQ ID NO. 145/SEQ ID NO. 146, SEQ ID NO. 147/SEQ ID NO. 148, SEQ ID NO. 149/SEQ ID NO. 150, SEQ ID NO. 151/SEQ ID NO. 152, SEQ ID NO. 25/SEQ ID NO. 153, SEQ ID NO. 154/SEQ ID NO. 155, SEQ ID NO. 156/SEQ ID NO. 157, SEQ ID NO. 158/SEQ ID NO. 159, SEQ ID NO. 160/SEQ ID NO. 161, SEQ ID NO.
- SEQ ID NO. 187/SEQ ID NO. 188 SEQ ID NO. 189/SEQ ID NO. 190, SEQ ID NO. 191/SEQ ID NO. 192, SEQ ID NO. 193/SEQ ID NO. 194, SEQ ID NO. 195/SEQ ID NO. 196, and combinations thereof.
- the disease to be treated is selected from the group consisting of rheumatoid arthritis, osteoarthritis, juvenile chronic arthritis, septic arthritis, Lyme arthritis, psoriatic arthritis, reactive arthritis, spondyloarthropathy, systemic lupus erythematosus, Crohn's disease, ulcerative colitis, inflammatory bowel disease, insulin dependent diabetes mellitus, thyroiditis, asthma, allergic diseases, psoriasis, dermatitis scleroderma, graft versus host disease, organ transplant rejection, acute or chronic immune disease associated with organ transplantation, sarcoidosis, atherosclerosis, disseminated intravascular coagulation,
- Kawasaki's disease Grave's disease, nephrotic syndrome, chronic fatigue syndrome, Wegener's granulomatosis, Henoch-Schoenlein purpurea, microscopic vasculitis of the kidneys, chronic active hepatitis, uveitis, septic shock, toxic shock syndrome, sepsis syndrome, cachexia, infectious diseases, parasitic diseases, acquired immunodeficiency syndrome, acute transverse myelitis, Huntington's chorea, Parkinson's disease, Alzheimer's disease, stroke, primary biliary cirrhosis, hemolytic anemia, malignancies, heart failure, myocardial infarction, Addison's disease, sporadic, polyglandular deficiency type I and polyglandular deficiency type II, Schmidt's syndrome, adult (acute) respiratory distress syndrome, alopecia, alopecia greata, seronegative arthopathy, arthropathy, Reiter's disease, psoriatic arthropathy, ulcerative
- immunodeficiency common variable hypogammaglobulinaemia
- dilated cardiomyopathy female infertility, ovarian failure, premature ovarian failure, fibrotic lung disease, cryptogenic fibrosing alveolitis, post-inflammatory interstitial lung disease, interstitial pneumonitis, connective tissue disease associated interstitial lung disease, mixed connective tissue disease associated lung disease, systemic sclerosis associated interstitial lung disease, rheumatoid arthritis associated interstitial lung disease, systemic lupus erythematosus associated lung disease, dermatomyositis/polymyositis associated lung disease, Sjogren's disease associated lung disease, ankylosing spondylitis associated lung disease, vasculitic diffuse lung disease, haemosiderosis associated lung disease, drug-induced interstitial lung disease, fibrosis, radiation fibrosis, bronchiolitis obliterans, chronic eosinophilic pneumonia, lymphocytic infiltrative
- atrophic autoimmune hypothyroidism atrophic autoimmune hypothyroidism, primary myxoedema, phacogenic uveitis, primary vasculitis, vitiligo acute liver disease, chronic liver diseases, alcoholic cirrhosis, alcohol-induced liver injury, choleosatatis, idiosyncratic liver disease, Drug-Induced hepatitis, Non-alcoholic Steatohepatitis, allergy and asthma, group B streptococci (GBS) infection, mental disorders (e.g., depression and schizophrenia), Th2 Type and Thl Type mediated diseases, acute and chronic pain (different forms of pain), and cancers such as lung, breast, stomach, bladder, colon, pancreas, ovarian, prostate and rectal cancer and hematopoietic malignancies (leukemia and lymphoma) Abetalipoprotemia, Acrocyanosis, acute and chronic parasitic or infectious processes, acute leukemia, acute lymphoblastic leukemia (ALL
- infection/HIV neuropathy Hodgkin's disease, hyperkinetic movement disorders, hypersensitity reactions, hypersensitivity pneumonitis, hypertension, hypokinetic movement disorders, hypothalamic -pituitary-adrenal axis evaluation, idiopathic Addison's disease, idiopathic pulmonary fibrosis, antibody mediated cytotoxicity, Asthenia, infantile spinal muscular atrophy, inflammation of the aorta, influenza a, ionizing radiation exposure,
- iridocyclitis/uveitis/optic neuritis ischemia-reperfusion injury, ischemic stroke, juvenile rheumatoid arthritis, juvenile spinal muscular atrophy, Kaposi's sarcoma, kidney transplant rejection, legionella, leishmaniasis, leprosy, lesions of the corticospinal system, lipedema, liver transplant rejection, lymphedema, malaria, malignamt Lymphoma, malignant histiocytosis, malignant melanoma, meningitis, meningococcemia, metabolic/idiopathic, migraine headache, mitochondrial multi. system disorder, mixed connective tissue disease, monoclonal
- gammopathy multiple myeloma, multiple systems degenerations (Mencel Dejerine-Thomas Shi-Drager and Machado-Joseph), myasthenia gravis, mycobacterium avium intracellulare, mycobacterium tuberculosis, myelodyplastic syndrome, myocardial infarction, myocardial ischemic disorders, nasopharyngeal carcinoma, neonatal chronic lung disease, nephritis, nephrosis, neurodegenerative diseases, neurogenic I muscular atrophies, neutropenic fever, non-hodgkins lymphoma, occlusion of the abdominal aorta and its branches, occulsive arterial disorders, okt3 therapy, orchitis/epidydimitis, orchitis/vasectomy reversal procedures, organomegaly, osteoporosis, pancreas transplant rejection, pancreatic carcinoma,
- thromboangitis obliterans thrombocytopenia, toxicity, transplants, trauma/hemorrhage, type III hypersensitivity reactions, type IV hypersensitivity, unstable angina, uremia, urosepsis, urticaria, valvular heart diseases, varicose veins, vasculitis, venous diseases, venous thrombosis, ventricular fibrillation, viral and fungal infections, vital encephalitis/aseptic meningitis, vital-associated hemaphagocytic syndrome, Wernicke-Korsakoff syndrome, Wilson's disease, and xenograft rejection of any organ or tissue.
- Figure 1 shows the binding of various IgGl clones over time.
- the present disclosure provides a fully human antibody of an IgG class that binds to a CXCR5 epitope with a binding affinity of 10 "6 M or less, that has a heavy chain variable domain sequence that is at least 95% identical to the amino acid sequences selected from the group consisting of SEQ ID NO. 1, SEQ ID NO. 3, SEQ ID NO. 5, SEQ ID NO. 7, SEQ ID NO. 9, SEQ ID NO. 11, SEQ ID NO. 13, SEQ ID NO. 15, SEQ ID NO. 17, SEQ ID NO. 19, SEQ ID NO. 21, SEQ ID NO. 23, SEQ ID NO. 25, SEQ ID NO. 27, SEQ ID NO. 29, SEQ ID NO. 31, SEQ ID NO. 33, SEQ ID NO. 35, SEQ ID NO.
- SEQ ID NO. 39 SEQ ID NO. 41, SEQ ID NO. 43, SEQ ID NO. 45, SEQ ID NO. 47, SEQ ID NO.50, SEQ ID NO. 52, SEQ ID NO. 54, SEQ ID NO. 56, SEQ ID NO. 58, SEQ ID NO. 60, SEQ ID NO. 62, SEQ ID NO. 64, SEQ ID NO. 66, SEQ ID NO. 68, SEQ ID NO. 70, SEQ ID NO. 72, SEQ ID NO. 74, SEQ ID NO. 76, SEQ ID NO. 78, SEQ ID NO. 80, SEQ ID NO. 82, SEQ ID NO. 84, SEQ ID NO. 87, SEQ ID NO.
- SEQ ID NO. 141 SEQ ID NO. 143, SEQ ID NO. 145, SEQ ID NO. 147, SEQ ID NO. 149, SEQ ID NO. 151, SEQ ID NO. 154, SEQ ID NO. 156, SEQ ID NO. 158, SEQ ID NO. 160, SEQ ID NO. 162, SEQ ID NO. 164, SEQ ID NO. 176, SEQ ID NO. 179, SEQ ID NO. 181, SEQ ID NO. 183, SEQ ID NO. 185, SEQ ID NO. 187, SEQ ID NO. 189, SEQ ID NO. 191, SEQ ID NO. 193, SEQ ID NO.
- SEQ ID NO. 2 SEQ ID NO. 4, SEQ ID NO. 6, SEQ ID NO. 8, SEQ ID NO. 10, SEQ ID NO. 12, SEQ ID NO. 14, SEQ ID NO. 16, SEQ ID NO. 18, SEQ ID NO. 20, SEQ ID NO. 22, SEQ ID NO. 24, SEQ ID NO. 26, SEQ ID NO. 28, SEQ ID NO. 30, SEQ ID NO. 32, SEQ ID NO. 34, SEQ ID NO. 36, SEQ ID NO. 38, SEQ ID NO. 40, SEQ ID NO. 42, SEQ ID NO. 44, SEQ ID NO. 46, SEQ ID NO.
- SEQ ID NO. 49 SEQ ID NO. 51, SEQ ID NO. 53, SEQ ID NO. 55, SEQ ID NO. 57, SEQ ID NO. 59, SEQ ID NO. 61, SEQ ID NO. 63, SEQ ID NO. 67, SEQ ID NO. 69, SEQ ID NO. 71, SEQ ID NO. 73, SEQ ID NO. 75, SEQ ID NO. 77, SEQ ID NO. 79, SEQ ID NO. 81, SEQ ID NO. 83, SEQ ID NO. 85, SEQ ID NO. 86, SEQ ID NO. 88, SEQ ID NO. 90, SEQ ID NO. 91, SEQ ID NO. 93, SEQ ID NO. 95, SEQ ID NO. 97, SEQ ID NO. 99, SEQ ID NO. 101, SEQ ID NO. 103, SEQ ID NO. 105, SEQ ID NO.
- the fully human antibody has both a heavy chain and a light chain wherein the antibody has a heavy chain/light chain variable domain sequence selected from the group consisting of SEQ ID NO. 1/SEQ ID NO. 2 (called 52A9 herein), SEQ ID NO. 3/SEQ ID NO. 4 (called 52A10 herein), SEQ ID NO. 5/SEQ ID NO. 6 (called 52B10 herein), SEQ ID NO. 7/SEQ ID NO. 8 (called 52C6 herein), SEQ ID NO. 9/SEQ ID NO. 10 (called 52D6 herein), SEQ ID NO. 11/SEQ ID NO. 12 (called 52D7 herein), SEQ ID NO.
- SEQ ID NO. 50/SEQ ID NO. 51 (called 3 Al l herein), SEQ ID NO. 52/SEQ ID NO. 53 (called 3B9 herein), SEQ ID NO. 54/SEQ ID NO. 55 (called 3D11 herein), SEQ ID NO. 56/SEQ ID NO. 57 (called 3D12 or 4E12 herein), SEQ ID NO. 58/SEQ ID NO. 59 (called 3E7 herein), SEQ ID NO. 60/SEQ ID NO. 61 (called 3E12 herein), SEQ ID NO. 62/SEQ ID NO. 63 (called 3F7 herein), SEQ ID NO. 64/SEQ ID NO.
- SEQ ID NO. 65 (called 3G2 herein), SEQ ID NO. 66/SEQ ID NO. 67 (called 3G7 herein), SEQ ID NO. 68/SEQ ID NO. 69 (called 4A5 herein), SEQ ID NO. 70/SEQ ID NO. 71 (called 4E9 herein), SEQ ID NO. 72/SEQ ID NO. 73 (called 4F1 herein), SEQ ID NO. 74/SEQ ID NO. 75 (called 4F4 herein), SEQ ID NO. 76/SEQ ID NO. 77 (called 4H2 herein), SEQ ID NO. 78/SEQ ID NO. 79 (called 5A8 herein), SEQ ID NO. 80/SEQ ID NO.
- SEQ ID NO. 81 (called 5F1 herein), SEQ ID NO. 82/SEQ ID NO. 83 (called 6A4 herein), SEQ ID NO. 84/SEQ ID NO. 85 (called 6F9 herein), SEQ ID NO. 15/SEQ ID NO. 86 (called 6G5 herein), SEQ ID NO. 87/SEQ ID NO. 88 (called 7B11 or 8B2 herein), SEQ ID NO. 89/SEQ ID NO. 90 (called 7H10 herein), SEQ ID NO. 15/SEQ ID NO. 91 (called 8D12 herein), SEQ ID NO. 92/SEQ ID NO. 93 (called 8H5 herein), SEQ ID NO. 94/SEQ ID NO.
- SEQ ID NO. 95 (called 9A10 herein), SEQ ID NO. 96/SEQ ID NO. 97 (called 10A12 herein), SEQ ID NO. 98/SEQ ID NO. 99 (called 10B2 herein), SEQ ID NO. 100/SEQ ID NO. 101 (called 10C3 herein), SEQ ID NO. 102/SEQ ID NO. 103 (called 10C7 herein), SEQ ID NO. 104/SEQ ID NO. 105 (called 11E3 herein), SEQ ID NO. 106/SEQ ID NO. 107 (called 11A12 herein), SEQ ID NO. 108/SEQ ID NO. 109 (called 11 A7 herein), SEQ ID NO. 110/SEQ ID NO.
- the present disclosure provides a fully human antibody Fab fragment, having a variable domain region from a heavy chain and a variable domain region from a light chain, wherein the heavy chain variable domain sequence that is at least 95% identical to the amino acid sequences selected from the group consisting of SEQ ID NO. 1, SEQ ID NO. 3, SEQ ID NO. 5, SEQ ID NO. 7, SEQ ID NO. 9, SEQ ID NO. 11, SEQ ID NO. 13, SEQ ID NO. 15, SEQ ID NO. 17, SEQ ID NO. 19, SEQ ID NO. 21, SEQ ID NO. 23, SEQ ID NO. 25, SEQ ID NO. 27, SEQ ID NO. 29, SEQ ID NO. 31, SEQ ID NO. 33, SEQ ID NO. 35, SEQ ID NO. 37, SEQ ID NO.
- SEQ ID NO. 41 SEQ ID NO. 43, SEQ ID NO. 45, SEQ ID NO. 47, SEQ ID NO.50, SEQ ID NO. 52, SEQ ID NO. 54, SEQ ID NO. 56, SEQ ID NO. 58, SEQ ID NO. 60, SEQ ID NO. 62, SEQ ID NO. 64, SEQ ID NO. 66, SEQ ID NO. 68, SEQ ID NO. 70, SEQ ID NO. 72, SEQ ID NO. 74, SEQ ID NO. 76, SEQ ID NO. 78, SEQ ID NO. 80, SEQ ID NO. 82, SEQ ID NO. 84, SEQ ID NO. 87, SEQ ID NO. 89, SEQ ID NO.
- SEQ ID NO. 92 SEQ ID NO. 94, SEQ ID NO. 96, SEQ ID NO. 98, SEQ ID NO. 100, SEQ ID NO. 102, SEQ ID NO. 104, SEQ ID NO. 106, SEQ ID NO. 108, SEQ ID NO. 110, SEQ ID NO. 112, SEQ ID NO. 114, SEQ ID NO. 116, SEQ ID NO. 118, SEQ ID NO. 120, SEQ ID NO. 122, SEQ ID NO. 124, SEQ ID NO. 126, SEQ ID NO. 128, SEQ ID NO. 130, SEQ ID NO. 132, SEQ ID NO. 134, SEQ ID NO. 136, SEQ ID NO. 138, SEQ ID NO.
- SEQ ID NO. 141 SEQ ID NO. 143, SEQ ID NO. 145, SEQ ID NO. 147, SEQ ID NO. 149, SEQ ID NO. 151, SEQ ID NO. 154, SEQ ID NO. 156, SEQ ID NO. 158, SEQ ID NO. 160, SEQ ID NO. 162, SEQ ID NO. 164, SEQ ID NO. 176, SEQ ID NO. 179, SEQ ID NO. 181, SEQ ID NO. 183, SEQ ID NO. 185, SEQ ID NO. 187, SEQ ID NO. 189, SEQ ID NO. 191, SEQ ID NO. 193, SEQ ID NO.
- SEQ ID NO. 2 SEQ ID NO. 4, SEQ ID NO. 6, SEQ ID NO. 8, SEQ ID NO. 10, SEQ ID NO. 12, SEQ ID NO. 14, SEQ ID NO. 16, SEQ ID NO. 18, SEQ ID NO. 20, SEQ ID NO. 22, SEQ ID NO. 24, SEQ ID NO. 26, SEQ ID NO. 28, SEQ ID NO. 30, SEQ ID NO. 32, SEQ ID NO. 34, SEQ ID NO. 36, SEQ ID NO. 38, SEQ ID NO. 40, SEQ ID NO. 42, SEQ ID NO. 44, SEQ ID NO. 46, SEQ ID NO.
- SEQ ID NO. 49 SEQ ID NO. 51, SEQ ID NO. 53, SEQ ID NO. 55, SEQ ID NO. 57, SEQ ID NO. 59, SEQ ID NO. 61, SEQ ID NO. 63, SEQ ID NO. 67, SEQ ID NO. 69, SEQ ID NO. 71, SEQ ID NO. 73, SEQ ID NO. 75, SEQ ID NO. 77, SEQ ID NO. 79, SEQ ID NO. 81, SEQ ID NO. 83, SEQ ID NO. 85, SEQ ID NO. 86, SEQ ID NO. 88, SEQ ID NO. 90, SEQ ID NO. 91, SEQ ID NO. 93, SEQ ID NO. 95, SEQ ID NO.
- the fully human antibody Fab fragment has both a heavy chain variable domain region and a light chain variable domain region wherein the antibody has a heavy chain/light chain variable domain sequence selected from the group consisting of SEQ ID NO. 1/SEQ ID NO. 2, SEQ ID NO. 3/SEQ ID NO. 4, SEQ ID NO. 5/SEQ ID NO. 6, SEQ ID NO. 7/SEQ ID NO. 8, SEQ ID NO. 9/SEQ ID NO. 10, SEQ ID NO. 11/SEQ ID NO. 12, SEQ ID NO. 13/SEQ ID NO. 14, SEQ ID NO. 15/SEQ ID NO. 16, SEQ ID NO. 17/SEQ ID NO.
- SEQ ID NO. 19/SEQ ID NO. 20 SEQ ID NO. 21/SEQ ID NO. 22, SEQ ID NO. 23/SEQ ID NO. 24, SEQ ID NO. 25/SEQ ID NO. 26, SEQ ID NO. 27/SEQ ID NO. 28, SEQ ID NO. 29/SEQ ID NO. 30, SEQ ID NO.
- SEQ ID NO. 58/SEQ ID NO. 59 SEQ ID NO. 60/SEQ ID NO. 61, SEQ ID NO. 62/SEQ ID NO. 63, SEQ ID NO. 64/SEQ ID NO. 65, SEQ ID NO. 66/SEQ ID NO. 67, SEQ ID NO. 68/SEQ ID NO. 69, SEQ ID NO. 70/SEQ ID NO. 71, SEQ ID NO. 72/SEQ ID NO. 73, SEQ ID NO. 74/SEQ ID NO. 75, SEQ ID NO. 76/SEQ ID NO. 77, SEQ ID NO. 78/SEQ ID NO. 79, SEQ ID NO. 80/SEQ ID NO.
- SEQ ID NO. 81 SEQ ID NO. 82/SEQ ID NO. 83, SEQ ID NO. 84/SEQ ID NO. 85, SEQ ID NO. 15/SEQ ID NO. 86, SEQ ID NO. 87/SEQ ID NO. 88, SEQ ID NO. 89/SEQ ID NO. 90, SEQ ID NO. 15/SEQ ID NO. 91, SEQ ID NO. 92/SEQ ID NO. 93, SEQ ID NO. 94/SEQ ID NO. 95, SEQ ID NO. 96/SEQ ID NO. 97, SEQ ID NO. 98/SEQ ID NO. 99, SEQ ID NO. 100/SEQ ID NO. 101, SEQ ID NO. 102/SEQ ID NO. 103, SEQ ID NO.
- SEQ ID NO. 105 SEQ ID NO. 106/SEQ ID NO. 107, SEQ ID NO. 108/SEQ ID NO. 109, SEQ ID NO. 110/SEQ ID NO. I l l, SEQ ID NO. 112/SEQ ID NO. 113, SEQ ID NO. 114/SEQ ID NO. 115, SEQ ID NO. 116/SEQ ID NO. 117, SEQ ID NO. 118/SEQ ID NO. 119, SEQ ID NO. 120/SEQ ID NO. 121, SEQ ID NO. 122/SEQ ID NO. 123, SEQ ID NO. 124/SEQ ID NO. 125, SEQ ID NO. 126/SEQ ID NO. 127, SEQ ID NO.
- SEQ ID NO. 152 SEQ ID NO. 25/SEQ ID NO. 153, SEQ ID NO. 154/SEQ ID NO. 155, SEQ ID NO. 156/SEQ ID NO. 157, SEQ ID NO. 158/SEQ ID NO. 159, SEQ ID NO. 160/SEQ ID NO. 161, SEQ ID NO. 162/SEQ ID NO. 163, SEQ ID NO. 164/SEQ ID NO. 165, SEQ ID NO. 1664/SEQ ID NO. 167, SEQ ID NO. 168/SEQ ID NO. 169, SEQ ID NO.
- the present disclosure provides a single chain human antibody, having a variable domain region from a heavy chain and a variable domain region from a light chain and a peptide linker connection the heavy chain and light chain variable domain regions, wherein the heavy chain variable domain sequence that is at least 95% identical to the amino acid sequences selected from the group consisting of SEQ ID NO. 1, SEQ ID NO. 3, SEQ ID NO. 5, SEQ ID NO. 7, SEQ ID NO. 9, SEQ ID NO. 11, SEQ ID NO. 13, SEQ ID NO. 15, SEQ ID NO. 17, SEQ ID NO. 19, SEQ ID NO. 21, SEQ ID NO. 23, SEQ ID NO. 25, SEQ ID NO. 27, SEQ ID NO. 29, SEQ ID NO. 31, SEQ ID NO. 33, SEQ ID NO.
- SEQ ID NO. 37 35, SEQ ID NO. 37, SEQ ID NO. 39, SEQ ID NO. 41, SEQ ID NO. 43, SEQ ID NO. 45, SEQ ID NO. 47, SEQ ID NO.50, SEQ ID NO. 52, SEQ ID NO. 54, SEQ ID NO. 56, SEQ ID NO. 58, SEQ ID NO. 60, SEQ ID NO. 62, SEQ ID NO. 64, SEQ ID NO. 66, SEQ ID NO. 68, SEQ ID NO. 70, SEQ ID NO. 72, SEQ ID NO. 74, SEQ ID NO. 76, SEQ ID NO. 78, SEQ ID NO. 80, SEQ ID NO. 82, SEQ ID NO. 84, SEQ ID NO. 87, SEQ ID NO.
- SEQ ID NO. 141 SEQ ID NO. 143, SEQ ID NO. 145, SEQ ID NO. 147, SEQ ID NO. 149, SEQ ID NO. 151, SEQ ID NO. 154, SEQ ID NO. 156, SEQ ID NO. 158, SEQ ID NO. 160, SEQ ID NO. 162, SEQ ID NO. 164, SEQ ID NO. 176, SEQ ID NO. 179, SEQ ID NO. 181, SEQ ID NO. 183, SEQ ID NO. 185, SEQ ID NO. 187, SEQ ID NO. 189, SEQ ID NO. 191, SEQ ID NO. 193, SEQ ID NO.
- SEQ ID NO. 2 SEQ ID NO. 4, SEQ ID NO. 6, SEQ ID NO. 8, SEQ ID NO. 10, SEQ ID NO. 12, SEQ ID NO. 14, SEQ ID NO. 16, SEQ ID NO. 18, SEQ ID NO. 20, SEQ ID NO. 22, SEQ ID NO. 24, SEQ ID NO. 26, SEQ ID NO. 28, SEQ ID NO. 30, SEQ ID NO. 32, SEQ ID NO. 34, SEQ ID NO. 36, SEQ ID NO. 38, SEQ ID NO. 40, SEQ ID NO. 42, SEQ ID NO. 44, SEQ ID NO. 46, SEQ ID NO.
- SEQ ID NO. 49 SEQ ID NO. 51, SEQ ID NO. 53, SEQ ID NO. 55, SEQ ID NO. 57, SEQ ID NO. 59, SEQ ID NO. 61, SEQ ID NO. 63, SEQ ID NO. 67, SEQ ID NO. 69, SEQ ID NO. 71, SEQ ID NO. 73, SEQ ID NO. 75, SEQ ID NO. 77, SEQ ID NO. 79, SEQ ID NO. 81, SEQ ID NO. 83, SEQ ID NO. 85, SEQ ID NO. 86, SEQ ID NO. 88, SEQ ID NO. 90, SEQ ID NO. 91, SEQ ID NO. 93, SEQ ID NO. 95, SEQ ID NO.
- SEQ ID NO. 99 SEQ ID NO. 101, SEQ ID NO. 103, SEQ ID NO. 105, SEQ ID NO. 107, SEQ ID NO. 109, SEQ ID NO. I l l, SEQ ID NO. 113, SEQ ID NO. 115, SEQ ID NO. 117, SEQ ID NO. 119, SEQ ID NO. 121, SEQ ID NO. 123, SEQ ID NO. 125, SEQ ID NO. 127, SEQ ID NO. 129, SEQ ID NO. 131, SEQ ID NO. 133, SEQ ID NO. 135, SEQ ID NO. 137, SEQ ID NO. 139, SEQ ID NO. 140, SEQ ID NO. 142, SEQ ID NO.
- SEQ ID NO. 146 SEQ ID NO. 148, SEQ ID NO. 150, SEQ ID NO. 152, SEQ ID NO. 153, SEQ ID NO. 155, SEQ ID NO. 157, SEQ ID NO. 159, SEQ ID NO. 161, SEQ ID NO. 163, SEQ ID NO. 165, SEQ ID NO. 167, SEQ ID NO. 169, SEQ ID NO. 171, SEQ ID NO. 173, SEQ ID NO. 175, SEQ ID NO. 177, SEQ ID NO. 178, SEQ ID NO. 180, SEQ ID NO. 182, SEQ ID NO. 184, SEQ ID NO. 186, SEQ ID NO. 188, SEQ ID NO. 190, SEQ ID NO.
- the fully human single chain antibody has both a heavy chain variable domain region and a light chain variable domain region, wherein the single chain fully human antibody has a heavy chain/light chain variable domain sequence selected from the group consisting of SEQ ID NO. 1/SEQ ID NO. 2, SEQ ID NO. 3/SEQ ID NO. 4, SEQ ID NO. 5/SEQ ID NO. 6, SEQ ID NO. 7/SEQ ID NO. 8, SEQ ID NO. 9/SEQ ID NO. 10, SEQ ID NO. 11/SEQ ID NO. 12, SEQ ID NO. 13/SEQ ID NO. 14, SEQ ID NO. 15/SEQ ID NO. 16, SEQ ID NO. 17/SEQ ID NO.
- SEQ ID NO. 19/SEQ ID NO. 20 SEQ ID NO. 21/SEQ ID NO. 22, SEQ ID NO. 23/SEQ ID NO. 24, SEQ ID NO. 25/SEQ ID NO. 26, SEQ ID NO. 27/SEQ ID NO. 28, SEQ ID NO. 29/SEQ ID NO. 30, SEQ ID NO. 31/SEQ ID NO. 32, SEQ ID NO. 33/SEQ ID NO. 34, SEQ ID NO. 35/SEQ ID NO. 36, SEQ ID NO. 37/SEQ ID NO. 38, SEQ ID NO. 39/SEQ ID NO. 40, SEQ ID NO. 41/SEQ ID NO. 42, SEQ ID NO. 43/SEQ ID NO. 44, SEQ ID NO. 45/SEQ ID NO.
- SEQ ID NO. 47/SEQ ID NO. 48 SEQ ID NO. 25/SEQ ID NO. 49, SEQ ID NO. 50/SEQ ID NO. 51, SEQ ID NO. 52/SEQ ID NO. 53, SEQ ID NO. 54/SEQ ID NO. 55, SEQ ID NO. 56/SEQ ID NO. 57, SEQ ID NO. 58/SEQ ID NO. 59, SEQ ID NO. 60/SEQ ID NO. 61, SEQ ID NO. 62/SEQ ID NO. 63, SEQ ID NO. 64/SEQ ID NO. 65, SEQ ID NO. 66/SEQ ID NO. 67, SEQ ID NO. 68/SEQ ID NO. 69, SEQ ID NO. 70/SEQ ID NO.
- SEQ ID NO. 72/SEQ ID NO. 73 SEQ ID NO. 74/SEQ ID NO. 75, SEQ ID NO. 76/SEQ ID NO. 77, SEQ ID NO. 78/SEQ ID NO. 79, SEQ ID NO. 80/SEQ ID NO. 81, SEQ ID NO. 82/SEQ ID NO. 83, SEQ ID NO. 84/SEQ ID NO. 85, SEQ ID NO. 15/SEQ ID NO. 86, SEQ ID NO. 87/SEQ ID NO. 88, SEQ ID NO. 89/SEQ ID NO. 90, SEQ ID NO. 15/SEQ ID NO. 91, SEQ ID NO. 92/SEQ ID NO.
- SEQ ID NO. 118/SEQ ID NO. 119 SEQ ID NO. 120/SEQ ID NO. 121, SEQ ID NO. 122/SEQ ID NO. 123, SEQ ID NO. 124/SEQ ID NO. 125, SEQ ID NO. 126/SEQ ID NO. 127, SEQ ID NO. 128/SEQ ID NO. 129, SEQ ID NO. 130/SEQ ID NO. 131, SEQ ID NO. 132/SEQ ID NO. 133, SEQ ID NO. 134/SEQ ID NO. 135, SEQ ID NO. 136/SEQ ID NO. 137, SEQ ID NO. 138/SEQ ID NO. 139, SEQ ID NO. 114/SEQ ID NO.
- SEQ ID NO. 141/SEQ ID NO. 142 SEQ ID NO. 143/SEQ ID NO. 144, SEQ ID NO. 145/SEQ ID NO. 146, SEQ ID NO. 147/SEQ ID NO. 148, SEQ ID NO. 149/SEQ ID NO. 150, SEQ ID NO. 151/SEQ ID NO. 152, SEQ ID NO. 25/SEQ ID NO. 153, SEQ ID NO. 154/SEQ ID NO. 155, SEQ ID NO. 156/SEQ ID NO. 157, SEQ ID NO. 158/SEQ ID NO. 159, SEQ ID NO. 160/SEQ ID NO. 161, SEQ ID NO. 162/SEQ ID NO. 163, SEQ ID NO.
- SEQ ID NO. 165 SEQ ID NO. 1664/SEQ ID NO. 167, SEQ ID NO. 168/SEQ ID NO. 169, SEQ ID NO. 170/SEQ ID NO. 171, SEQ ID NO. 172/SEQ ID NO. 173, SEQ ID NO. 174/SEQ ID NO. 175, SEQ ID NO. 176/SEQ ID NO. 177, SEQ ID NO. 19/SEQ ID NO. 178, SEQ ID NO. 179/SEQ ID NO. 180, SEQ ID NO. 181/SEQ ID NO. 182, SEQ ID NO. 183/SEQ ID NO. 184, SEQ ID NO. 185/SEQ ID NO. 186, SEQ ID NO. 187/SEQ ID NO.
- SEQ ID NO. 189/SEQ ID NO. 190 SEQ ID NO. 191/SEQ ID NO. 192, SEQ ID NO. 193/SEQ ID NO. 194, SEQ ID NO. 195/SEQ ID NO. 196, and combinations thereof.
- the present disclosure further provides a method for treating a broad spectrum of mammalian cancers or inflammatory diseases or autoimmune diseases, comprising
- an anti-CXCR5 polypeptide wherein the anti-CXCR5 polypeptide is selected from the group consisting of a fully human antibody of an IgG class that binds to a CXCR5 epitope with a binding affinity of at least 10 "6 M, a fully human antibody Fab fragment, having a variable domain region from a heavy chain and a variable domain region from a light chain, a single chain human antibody, having a variable domain region from a heavy chain and a variable domain region from a light chain and a peptide linker connection the heavy chain and light chain variable domain regions, and combinations thereof; wherein the fully human antibody has a heavy chain variable domain sequence that is at least 95% identical to the amino acid sequences selected from the group consisting of SEQ ID NO.
- SEQ ID NO. 3 SEQ ID NO. 5, SEQ ID NO. 7, SEQ ID NO. 9, SEQ ID NO. 11, SEQ ID NO. 13, SEQ ID NO. 15, SEQ ID NO. 17, SEQ ID NO. 19, SEQ ID NO. 21, SEQ ID NO. 23, SEQ ID NO. 25, SEQ ID NO. 27, SEQ ID NO. 29, SEQ ID NO. 31, SEQ ID NO. 33, SEQ ID NO. 35, SEQ ID NO. 37, SEQ ID NO. 39, SEQ ID NO. 41, SEQ ID NO. 43, SEQ ID NO. 45, SEQ ID NO. 47, SEQ ID NO.50, SEQ ID NO. 52, SEQ ID NO. 54, SEQ ID NO. 56, SEQ ID NO. 58, SEQ ID NO.
- SEQ ID NO. 62 60, SEQ ID NO. 62, SEQ ID NO. 64, SEQ ID NO. 66, SEQ ID NO. 68, SEQ ID NO. 70, SEQ ID NO. 72, SEQ ID NO. 74, SEQ ID NO. 76, SEQ ID NO. 78, SEQ ID NO. 80, SEQ ID NO. 82, SEQ ID NO. 84, SEQ ID NO. 87, SEQ ID NO. 89, SEQ ID NO. 92, SEQ ID NO. 94, SEQ ID NO. 96, SEQ ID NO. 98, SEQ ID NO. 100, SEQ ID NO. 102, SEQ ID NO. 104, SEQ ID NO. 106, SEQ ID NO. 108, SEQ ID NO.
- SEQ ID NO. 112 SEQ ID NO. 114, SEQ ID NO. 116, SEQ ID NO. 118, SEQ ID NO. 120, SEQ ID NO. 122, SEQ ID NO. 124, SEQ ID NO. 126, SEQ ID NO. 128, SEQ ID NO. 130, SEQ ID NO. 132, SEQ ID NO. 134, SEQ ID NO. 136, SEQ ID NO. 138, SEQ ID NO. 141, SEQ ID NO. 143, SEQ ID NO. 145, SEQ ID NO. 147, SEQ ID NO. 149, SEQ ID NO. 151, SEQ ID NO. 154, SEQ ID NO. 156, SEQ ID NO. 158, SEQ ID NO.
- SEQ ID NO. 162 SEQ ID NO. 164, SEQ ID NO. 176, SEQ ID NO. 179, SEQ ID NO. 181, SEQ ID NO. 183, SEQ ID NO. 185, SEQ ID NO. 187, SEQ ID NO. 189, SEQ ID NO. 191, SEQ ID NO. 193, SEQ ID NO. 195, and combinations thereof, and that has a light chain variable domain sequence that is at least 95% identical to the amino acid sequences selected from the group consisting of SEQ ID NO. 2, SEQ ID NO. 4, SEQ ID NO. 6, SEQ ID NO. 8, SEQ ID NO. 10, SEQ ID NO. 12, SEQ ID NO. 14, SEQ ID NO. 16, SEQ ID NO. 18, SEQ ID NO.
- SEQ ID NO. 20 20
- SEQ ID NO. 22 SEQ ID NO. 24, SEQ ID NO. 26, SEQ ID NO. 28, SEQ ID NO. 30, SEQ ID NO. 32, SEQ ID NO. 34, SEQ ID NO. 36, SEQ ID NO. 38, SEQ ID NO. 40, SEQ ID NO. 42, SEQ ID NO. 44, SEQ ID NO. 46, SEQ ID NO. 48, SEQ ID NO. 49, SEQ ID NO. 51, SEQ ID NO. 53, SEQ ID NO. 55, SEQ ID NO. 57, SEQ ID NO. 59, SEQ ID NO. 61, SEQ ID NO. 63, SEQ ID NO. 67, SEQ ID NO. 69, SEQ ID NO. 71, SEQ ID NO. 73, SEQ ID NO.
- SEQ ID NO. 75 SEQ ID NO. 77, SEQ ID NO. 79, SEQ ID NO. 81, SEQ ID NO. 83, SEQ ID NO. 85, SEQ ID NO. 86, SEQ ID NO. 88, SEQ ID NO. 90, SEQ ID NO. 91, SEQ ID NO. 93, SEQ ID NO. 95, SEQ ID NO. 97, SEQ ID NO. 99, SEQ ID NO. 101, SEQ ID NO. 103, SEQ ID NO. 105, SEQ ID NO. 107, SEQ ID NO. 109, SEQ ID NO. I l l, SEQ ID NO. 113, SEQ ID NO. 115, SEQ ID NO. 117, SEQ ID NO. 119, SEQ ID NO.
- SEQ ID NO. 121 SEQ ID NO. 123, SEQ ID NO. 125, SEQ ID NO. 127, SEQ ID NO. 129, SEQ ID NO. 131, SEQ ID NO. 133, SEQ ID NO. 135, SEQ ID NO. 137, SEQ ID NO. 139, SEQ ID NO. 140, SEQ ID NO. 142, SEQ ID NO. 144, SEQ ID NO. 146, SEQ ID NO. 148, SEQ ID NO. 150, SEQ ID NO. 152, SEQ ID NO. 153, SEQ ID NO. 155, SEQ ID NO. 157, SEQ ID NO. 159, SEQ ID NO. 161, SEQ ID NO. 163, SEQ ID NO. 165, SEQ ID NO.
- SEQ ID NO. 169 SEQ ID NO. 171, SEQ ID NO. 173, SEQ ID NO. 175, SEQ ID NO. 177, SEQ ID NO. 178, SEQ ID NO. 180, SEQ ID NO. 182, SEQ ID NO. 184, SEQ ID NO. 186, SEQ ID NO. 188, SEQ ID NO. 190, SEQ ID NO. 192, SEQ ID NO. 194, SEQ ID NO. 196, and combinations thereof;
- the fully human antibody Fab fragment has the heavy chain variable domain sequence that is at least 95% identical to the amino acid sequences selected from the group consisting of SEQ ID NO. 1, SEQ ID NO. 3, SEQ ID NO. 5, SEQ ID NO. 7, SEQ ID NO. 9, SEQ ID NO. 11, SEQ ID NO. 13, SEQ ID NO. 15, SEQ ID NO. 17, SEQ ID NO. 19, SEQ ID NO. 21, SEQ ID NO. 23, SEQ ID NO. 25, SEQ ID NO. 27, SEQ ID NO. 29, SEQ ID NO. 31, SEQ ID NO. 33, SEQ ID NO. 35, SEQ ID NO. 37, SEQ ID NO. 39, SEQ ID NO. 41, SEQ ID NO. 43, SEQ ID NO. 45, SEQ ID NO.
- SEQ ID NO.50 SEQ ID NO. 52, SEQ ID NO. 54, SEQ ID NO. 56, SEQ ID NO. 58, SEQ ID NO. 60, SEQ ID NO. 62, SEQ ID NO. 64, SEQ ID NO. 66, SEQ ID NO. 68, SEQ ID NO. 70, SEQ ID NO. 72, SEQ ID NO. 74, SEQ ID NO. 76, SEQ ID NO. 78, SEQ ID NO. 80, SEQ ID NO. 82, SEQ ID NO. 84, SEQ ID NO. 87, SEQ ID NO. 89, SEQ ID NO. 92, SEQ ID NO. 94, SEQ ID NO. 96, SEQ ID NO. 98, SEQ ID NO.
- SEQ ID NO. 102 SEQ ID NO. 104, SEQ ID NO. 106, SEQ ID NO. 108, SEQ ID NO. 110, SEQ ID NO. 112, SEQ ID NO. 114, SEQ ID NO. 116, SEQ ID NO. 118, SEQ ID NO. 120, SEQ ID NO. 122, SEQ ID NO. 124, SEQ ID NO. 126, SEQ ID NO. 128, SEQ ID NO. 130, SEQ ID NO. 132, SEQ ID NO. 134, SEQ ID NO. 136, SEQ ID NO. 138, SEQ ID NO. 141, SEQ ID NO. 143, SEQ ID NO. 145, SEQ ID NO. 147, SEQ ID NO.
- SEQ ID NO. 149 SEQ ID NO. 151, SEQ ID NO. 154, SEQ ID NO. 156, SEQ ID NO. 158, SEQ ID NO. 160, SEQ ID NO. 162, SEQ ID NO. 164, SEQ ID NO. 176, SEQ ID NO. 179, SEQ ID NO. 181, SEQ ID NO. 183, SEQ ID NO. 185, SEQ ID NO. 187, SEQ ID NO. 189, SEQ ID NO. 191, SEQ ID NO. 193, SEQ ID NO. 195, and combinations thereof, and that has the light chain variable domain sequence that is at least 95% identical to the amino acid sequences selected from the group consisting of SEQ ID NO. 2, SEQ ID NO. 4, SEQ ID NO. 6, SEQ ID NO.
- SEQ ID NO. 8 SEQ ID NO. 10
- SEQ ID NO. 67 SEQ ID NO. 69, SEQ ID NO. 71, SEQ ID NO. 73, SEQ ID NO. 75, SEQ ID NO. 77, SEQ ID NO. 79, SEQ ID NO. 81, SEQ ID NO. 83, SEQ ID NO. 85, SEQ ID NO. 86, SEQ ID NO. 88, SEQ ID NO. 90, SEQ ID NO. 91, SEQ ID NO. 93, SEQ ID NO. 95, SEQ ID NO. 97, SEQ ID NO. 99, SEQ ID NO. 101, SEQ ID NO. 103, SEQ ID NO. 105, SEQ ID NO. 107, SEQ ID NO. 109, SEQ ID NO.
- SEQ ID NO. 159 SEQ ID NO. 161, SEQ ID NO. 163, SEQ ID NO. 165, SEQ ID NO. 167, SEQ ID NO. 169, SEQ ID NO. 171, SEQ ID NO. 173, SEQ ID NO. 175, SEQ ID NO. 177, SEQ ID NO. 178, SEQ ID NO. 180, SEQ ID NO. 182, SEQ ID NO. 184, SEQ ID NO. 186, SEQ ID NO. 188, SEQ ID NO. 190, SEQ ID NO. 192, SEQ ID NO. 194, SEQ ID NO.
- the single chain human antibody has the heavy chain variable domain sequence that is at least 95% identical to the amino acid sequences selected from the group consisting of SEQ ID NO. 1, SEQ ID NO. 3, SEQ ID NO. 5, SEQ ID NO. 7, SEQ ID NO. 9, SEQ ID NO. 11, SEQ ID NO. 13, SEQ ID NO. 15, SEQ ID NO. 17, SEQ ID NO. 19, SEQ ID NO. 21, SEQ ID NO. 23, SEQ ID NO. 25, SEQ ID NO. 27, SEQ ID NO. 29, SEQ ID NO. 31, SEQ ID NO. 33, SEQ ID NO. 35, SEQ ID NO. 37, SEQ ID NO. 39, SEQ ID NO. 41, SEQ ID NO. 43, SEQ ID NO. 45, SEQ ID NO.
- SEQ ID NO.50 SEQ ID NO. 52, SEQ ID NO. 54, SEQ ID NO. 56, SEQ ID NO. 58, SEQ ID NO. 60, SEQ ID NO. 62, SEQ ID NO. 64, SEQ ID NO. 66, SEQ ID NO. 68, SEQ ID NO. 70, SEQ ID NO. 72, SEQ ID NO. 74, SEQ ID NO. 76, SEQ ID NO. 78, SEQ ID NO. 80, SEQ ID NO. 82, SEQ ID NO. 84, SEQ ID NO. 87, SEQ ID NO. 89, SEQ ID NO. 92, SEQ ID NO. 94, SEQ ID NO. 96, SEQ ID NO. 98, SEQ ID NO.
- SEQ ID NO. 102 SEQ ID NO. 104, SEQ ID NO. 106, SEQ ID NO. 108, SEQ ID NO. 110, SEQ ID NO. 112, SEQ ID NO. 114, SEQ ID NO. 116, SEQ ID NO. 118, SEQ ID NO. 120, SEQ ID NO. 122, SEQ ID NO. 124, SEQ ID NO. 126, SEQ ID NO. 128, SEQ ID NO. 130, SEQ ID NO. 132, SEQ ID NO. 134, SEQ ID NO. 136, SEQ ID NO. 138, SEQ ID NO. 141, SEQ ID NO. 143, SEQ ID NO. 145, SEQ ID NO. 147, SEQ ID NO.
- SEQ ID NO. 149 SEQ ID NO. 151, SEQ ID NO. 154, SEQ ID NO. 156, SEQ ID NO. 158, SEQ ID NO. 160, SEQ ID NO. 162, SEQ ID NO. 164, SEQ ID NO. 176, SEQ ID NO. 179, SEQ ID NO. 181, SEQ ID NO. 183, SEQ ID NO. 185, SEQ ID NO. 187, SEQ ID NO. 189, SEQ ID NO. 191, SEQ ID NO. 193, SEQ ID NO. 195, and combinations thereof, and that has the light chain variable domain sequence that is at least 95% identical to the amino acid sequences selected from the group consisting of SEQ ID NO. 2, SEQ ID NO. 4, SEQ ID NO. 6, SEQ ID NO.
- SEQ ID NO. 8 SEQ ID NO. 10
- SEQ ID NO. 67 SEQ ID NO. 69, SEQ ID NO. 71, SEQ ID NO. 73, SEQ ID NO. 75, SEQ ID NO. 77, SEQ ID NO. 79, SEQ ID NO. 81, SEQ ID NO. 83, SEQ ID NO. 85, SEQ ID NO. 86, SEQ ID NO. 88, SEQ ID NO. 90, SEQ ID NO. 91, SEQ ID NO. 93, SEQ ID NO. 95, SEQ ID NO. 97, SEQ ID NO. 99, SEQ ID NO. 101, SEQ ID NO. 103, SEQ ID NO. 105, SEQ ID NO. 107, SEQ ID NO. 109, SEQ ID NO.
- SEQ ID NO. 159 SEQ ID NO. 161, SEQ ID NO. 163, SEQ ID NO. 165, SEQ ID NO. 167, SEQ ID NO. 169, SEQ ID NO. 171, SEQ ID NO. 173, SEQ ID NO. 175, SEQ ID NO. 177, SEQ ID NO. 178, SEQ ID NO. 180, SEQ ID NO. 182, SEQ ID NO. 184, SEQ ID NO. 186, SEQ ID NO. 188, SEQ ID NO. 190, SEQ ID NO. 192, SEQ ID NO. 194, SEQ ID NO. 196, and combinations thereof.
- the fully human antibody has both a heavy chain and a light chain wherein the antibody has a heavy chain/light chain variable domain sequence selected from the group consisting of SEQ ID NO. 1/SEQ ID NO. 2, SEQ ID NO. 3/SEQ ID NO. 4, SEQ ID NO.
- SEQ ID NO. 85 SEQ ID NO. 15/SEQ ID NO. 86, SEQ ID NO. 87/SEQ ID NO. 88, SEQ ID NO. 89/SEQ ID NO. 90, SEQ ID NO. 15/SEQ ID NO. 91, SEQ ID NO. 92/SEQ ID NO. 93, SEQ ID NO. 94/SEQ ID NO. 95, SEQ ID NO. 96/SEQ ID NO. 97, SEQ ID NO. 98/SEQ ID NO. 99, SEQ ID NO. 100/SEQ ID NO. 101, SEQ ID NO. 102/SEQ ID NO. 103, SEQ ID NO. 104/SEQ ID NO. 105, SEQ ID NO. 106/SEQ ID NO.
- SEQ ID NO. 108/SEQ ID NO. 109 SEQ ID NO. 110/SEQ ID NO. I l l
- SEQ ID NO. 112/SEQ ID NO. 113 SEQ ID NO. 114/SEQ ID NO. 115, SEQ ID NO. 116/SEQ ID NO. 117, SEQ ID NO. 118/SEQ ID NO. 119, SEQ ID NO. 120/SEQ ID NO. 121, SEQ ID NO. 122/SEQ ID NO. 123, SEQ ID NO. 124/SEQ ID NO. 125, SEQ ID NO. 126/SEQ ID NO. 127, SEQ ID NO. 128/SEQ ID NO. 129, SEQ ID NO. 130/SEQ ID NO. 131, SEQ ID NO. 132/SEQ ID NO. 133, SEQ ID NO. 134/SEQ ID NO. 135, SEQ ID NO. 136/SEQ ID NO. 137, SEQ ID NO.
- the fully human antibody Fab fragment has both a heavy chain variable domain region and a light chain variable domain region wherein the antibody has a heavy chain/light chain variable domain sequence selected from the group consisting of SEQ ID NO.
- SEQ ID NO. 67 SEQ ID NO. 68/SEQ ID NO. 69, SEQ ID NO. 70/SEQ ID NO. 71, SEQ ID NO. 72/SEQ ID NO. 73, SEQ ID NO. 74/SEQ ID NO. 75, SEQ ID NO. 76/SEQ ID NO. 77, SEQ
- the fully human single chain antibody has both a heavy chain variable domain region and a light chain variable domain region, wherein the single chain fully human antibody has a heavy chain/light chain variable domain sequence selected from the group consisting of SEQ ID NO. 1/SEQ ID NO. 2, SEQ ID NO. 3/SEQ ID NO. 4, SEQ ID NO. 5/SEQ ID NO. 6, SEQ ID NO. 7/SEQ ID NO. 8, SEQ ID NO. 9/SEQ ID NO. 10, SEQ ID NO. 11/SEQ ID NO. 12, SEQ ID NO. 13/SEQ ID NO. 14, SEQ ID NO. 15/SEQ ID NO. 16, SEQ ID NO. 17/SEQ ID NO. 18, SEQ ID NO. 19/SEQ ID NO. 20, SEQ ID NO.
- SEQ ID NO. 22 SEQ ID NO. 23/SEQ ID NO. 24, SEQ ID NO. 25/SEQ ID NO. 26, SEQ ID NO. 27/SEQ ID NO. 28, SEQ ID NO. 29/SEQ ID NO. 30, SEQ ID NO. 31/SEQ ID NO. 32, SEQ ID NO. 33/SEQ ID NO. 34, SEQ ID NO. 35/SEQ ID NO. 36, SEQ ID NO. 37/SEQ ID NO. 38, SEQ ID NO. 39/SEQ ID NO. 40, SEQ ID NO. 41/SEQ ID NO. 42, SEQ ID NO. 43/SEQ ID NO. 44, SEQ ID NO. 45/SEQ ID NO. 46, SEQ ID NO. 47/SEQ ID NO. 48, SEQ ID NO.
- SEQ ID NO. 49 SEQ ID NO. 50/SEQ ID NO. 51, SEQ ID NO. 52/SEQ ID NO. 53, SEQ ID NO. 54/SEQ ID NO. 55, SEQ ID NO. 56/SEQ ID NO. 57, SEQ ID NO. 58/SEQ ID NO. 59, SEQ ID NO. 60/SEQ ID NO. 61, SEQ ID NO. 62/SEQ ID NO. 63, SEQ ID NO. 64/SEQ ID NO. 65, SEQ ID NO.
- SEQ ID NO. 78/SEQ ID NO. 79 SEQ ID NO. 80/SEQ ID NO. 81, SEQ ID NO. 82/SEQ ID NO. 83, SEQ ID NO. 84/SEQ ID NO. 85, SEQ ID NO. 15/SEQ ID NO. 86, SEQ ID NO.
- the broad spectrum of mammalian cancers to be treated the cancer is an
- the broad spectrum of mammalian cancers to be treated is selected from the group consisting of cancinomas, prostate cancer, non-small cell lung cancer, breast cancer, endometrial cancer, ovarian cancer, gastric cancers, head and neck cancers, and colon cancer.
- an "antigen binding protein” is a protein comprising a portion that binds to an antigen and, optionally, a scaffold or framework portion that allows the antigen binding portion to adopt a conformation that promotes binding of the antigen binding protein to the antigen.
- antigen binding proteins include antibodies, antibody fragments (e.g., an antigen binding portion of an antibody), antibody derivatives, and antibody analogs.
- the antigen binding protein can comprise, for example, an alternative protein scaffold or artificial scaffold with grafted CDRs or CDR derivatives.
- Such scaffolds include, but are not limited to, antibody-derived scaffolds comprising mutations introduced to, for example, stabilize the three-dimensional structure of the antigen binding protein as well as wholly synthetic scaffolds comprising, for example, a biocompatible polymer.
- PAMs peptide antibody mimetics
- An antigen binding protein can have, for example, the structure of a naturally occurring immunoglobulin.
- An "immunoglobulin” is a tetrameric molecule. In a naturally occurring immunoglobulin, each tetramer is composed of two identical pairs of polypeptide chains, each pair having one "light” (about 25 kDa) and one "heavy" chain (about 50-70 kDa).
- the amino- terminal portion of each chain includes a variable region of about 100 to 110 or more amino acids primarily responsible for antigen recognition.
- the carboxy-terminal portion of each chain defines a constant region primarily responsible for effector function. Human light chains are classified as kappa or lambda light chains.
- Heavy chains are classified as mu, delta, gamma, alpha, or epsilon, and define the antibody's isotype as IgM, IgD, IgG, IgA, and IgE, respectively.
- the variable and constant regions are joined by a "J" region of about 12 or more amino acids, with the heavy chain also including a "D” region of about 10 more amino acids. See generally, Fundamental Immunology Ch. 7 (Paul, W., ed., 2nd ed. Raven Press, N.Y. (1989)) (incorporated by reference in its entirety for all purposes).
- the variable regions of each light/heavy chain pair form the antibody binding site such that an intact immunoglobulin has two binding sites.
- variable regions of naturally occurring immunoglobulin chains exhibit the same general structure of relatively conserved framework regions (FR) joined by three hypervariable regions, also called complementarity determining regions or CDRs. From N-terminus to C- terminus, both light and heavy chains comprise the domains FR1, CDR1, FR2, CDR2, FR3, CDR3 and FR4.
- the assignment of amino acids to each domain is in accordance with the definitions of Kabat et al. in Sequences of Proteins of Immunological Interest, 5 th Ed., US Dept. of Health and Human Services, PHS, NIH, NIH Publication no. 91-3242, 1991.
- Other numbering systems for the amino acids in immunoglobulin chains include IMGT.RTM.
- an “antibody” refers to an intact immunoglobulin or to an antigen binding portion thereof that competes with the intact antibody for specific binding, unless otherwise specified.
- Antigen binding portions may be produced by recombinant DNA techniques or by enzymatic or chemical cleavage of intact antibodies.
- Antigen binding portions include, inter alia, Fab, Fab', F(ab') 2 , Fv, domain antibodies (dAbs), and complementarity determining region (CDR) fragments, single-chain antibodies (scFv), chimeric antibodies, diabodies, triabodies, tetrabodies, and polypeptides that contain at least a portion of an immunoglobulin that is sufficient to confer specific antigen binding to the polypeptide.
- a Fab fragment is a monovalent fragment having the VL, VH, CL and CHI domains; a F(ab') 2 fragment is a bivalent fragment having two Fab fragments linked by a disulfide bridge at the hinge region; a Fd fragment has the VH and CHI domains; an Fv fragment has the VL and VH domains of a single arm of an antibody; and a dAb fragment has a VH domain, a VL domain, or an antigen-binding fragment of a VH or VL domain (U.S. Patents 6,846,634; 6,696,245, US Patent Applications 2002/02512; 2004/0202995; 2004/0038291 ;
- a single-chain antibody is an antibody in which a VL and a VH region are joined via a linker ⁇ e.g., a synthetic sequence of amino acid residues) to form a continuous protein chain wherein the linker is long enough to allow the protein chain to fold back on itself and form a monovalent antigen binding site (Bird et al., 1988, Science 242:423-26 and Huston et al., 1988, Proc. Natl. Acad. Sci. USA 85:5879-83).
- a linker ⁇ e.g., a synthetic sequence of amino acid residues
- Diabodies are bivalent antibodies comprising two polypeptide chains, wherein each polypeptide chain comprises VH and VL domains joined by a linker that is too short to allow for pairing between two domains on the same chain, thus allowing each domain to pair with a complementary domain on another polypeptide chain (Holliger et al., 1993, Proc. Natl. Acad. Sci. USA 90:6444-48, and Poljak et al., 1994, Structure 2: 1121-23). If the two polypeptide chains of a diabody are identical, then a diabody resulting from their pairing will have two identical antigen binding sites. Polypeptide chains having different sequences can be used to make a diabody with two different antigen binding sites.
- tribodies and tetrabodies are antibodies comprising three and four polypeptide chains, respectively, and forming three and four antigen binding sites, respectively, which can be the same or different.
- Complementarity determining regions (CDRs) and framework regions (FR) of a given antibody may be identified using the system described by Kabat et al. supra; Lefranc et al., supra and/or Honegger and Pluckthun, supra.
- One or more CDRs may be incorporated into a molecule either covalently or noncovalently to make it an antigen binding protein.
- An antigen binding protein may incorporate the CDR(s) as part of a larger polypeptide chain, may covalently link the CDR(s) to another polypeptide chain, or may incorporate the CDR(s) noncovalently.
- the CDRs permit the antigen binding protein to specifically bind to a particular antigen of interest.
- An antigen binding protein may have one or more binding sites. If there is more than one binding site, the binding sites may be identical to one another or may be different. For example, a naturally occurring human immunoglobulin typically has two identical binding sites, while a "bispecific" or "bifunctional” antibody has two different binding sites.
- human antibody includes all antibodies that have one or more variable and constant regions derived from human immunoglobulin sequences. In one embodiment, all of the variable and constant domains are derived from human immunoglobulin sequences (a fully human antibody). These antibodies may be prepared in a variety of ways, examples of which are described below, including through the immunization with an antigen of interest of a mouse that is genetically modified to express antibodies derived from human heavy and/or light chain-encoding genes.
- the framework regions may be derived from one of the same anti-CXCR5 antibodies, from one or more different antibodies, such as a human antibody, or from a humanized antibody.
- a portion of the heavy and/or light chain is identical with, homologous to, or derived from an antibody from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is/are identical with, homologous to, or derived from an antibody (-ies) from another species or belonging to another antibody class or subclass.
- fragments of such antibodies that exhibit the desired biological activity ⁇ i.e., the ability to specifically bind CXCR5).
- a “neutralizing antibody” or an “inhibitory antibody” is an antibody that inhibits the activation of CXCR5 when an excess of the anti-CXCR5 antibody reduces the amount of activation by at least about 20% using an assay such as those described herein in the Examples.
- the antigen binding protein reduces the amount of amount of activation of CXCR5 by at least 30%, 40%, 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 99%, and 99.9%.
- Fragments or analogs of antibodies can be readily prepared by those of ordinary skill in the art following the teachings of this specification and using techniques known in the art. Preferred amino- and carboxy-termini of fragments or analogs occur near boundaries of functional domains. Structural and functional domains can be identified by comparison of the nucleotide and/or amino acid sequence data to public or proprietary sequence databases.
- Computerized comparison methods can be used to identify sequence motifs or predicted protein conformation domains that occur in other proteins of known structure and/or function. Methods to identify protein sequences that fold into a known three-dimensional structure are known. See, Bowie et al., 1991, Science 253: 164.
- a “CDR grafted antibody” is an antibody comprising one or more CDRs derived from an antibody of a particular species or isotype and the framework of another antibody of the same or different species or isotype.
- a “multi-specific antibody” is an antibody that recognizes more than one epitope on one or more antigens.
- a subclass of this type of antibody is a "bi-specific antibody” which recognizes two distinct epitopes on the same or different antigens.
- An antigen binding protein "specifically binds" to an antigen (e.g., human CXCR5) if it binds to the antigen with a dissociation constant of 1 nanomolar or less.
- an “antigen binding domain,” “antigen binding region,” or “antigen binding site” is a portion of an antigen binding protein that contains amino acid residues (or other moieties) that interact with an antigen and contribute to the antigen binding protein's specificity and affinity for the antigen. For an antibody that specifically binds to its antigen, this will include at least part of at least one of its CDR domains.
- An “epitope” is the portion of a molecule that is bound by an antigen binding protein (e.g., by an antibody).
- An epitope can comprise non-contiguous portions of the molecule (e.g., in a polypeptide, amino acid residues that are not contiguous in the polypeptide's primary sequence but that, in the context of the polypeptide's tertiary and quaternary structure, are near enough to each other to be bound by an antigen binding protein).
- the "percent identity" of two polynucleotide or two polypeptide sequences is determined by comparing the sequences using the GAP computer program (a part of the GCG Wisconsin Package, version 10.3 (Accelrys, San Diego, Calif.)) using its default parameters.
- polynucleotide oligonucleotide
- nucleic acid oligonucleotide
- nucleic acid molecules e.g., cDNA or genomic DNA
- RNA molecules e.g., mRNA
- nucleotide analogs e.g., peptide nucleic acids and non-naturally occurring nucleotide analogs
- hybrids thereof e.g., peptide nucleic acids and non-naturally occurring nucleotide analogs
- the nucleic acid molecule can be single- stranded or double-stranded.
- the nucleic acid molecules of the invention comprise a contiguous open reading frame encoding an antibody, or a fragment, derivative, mutein, or variant thereof.
- Two single- stranded polynucleotides are "the complement" of each other if their sequences can be aligned in an anti -parallel orientation such that every nucleotide in one polynucleotide is opposite its complementary nucleotide in the other polynucleotide, without the introduction of gaps, and without unpaired nucleotides at the 5' or the 3' end of either sequence.
- a polynucleotide is "complementary" to another polynucleotide if the two polynucleotides can hybridize to one another under moderately stringent conditions.
- a polynucleotide can be complementary to another polynucleotide without being its complement.
- a “vector” is a nucleic acid that can be used to introduce another nucleic acid linked to it into a cell.
- a vector is a "plasmid,” which refers to a linear or circular double stranded DNA molecule into which additional nucleic acid segments can be ligated.
- a viral vector e.g., replication defective retroviruses, adenoviruses and adeno- associated viruses
- certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors comprising a bacterial origin of replication and episomal mammalian vectors).
- vectors e.g., non-episomal mammalian vectors
- An "expression vector” is a type of vector that can direct the expression of a chosen polynucleotide.
- a nucleotide sequence is "operably linked" to a regulatory sequence if the regulatory sequence affects the expression (e.g., the level, timing, or location of expression) of the nucleotide sequence.
- a "regulatory sequence” is a nucleic acid that affects the expression (e.g., the level, timing, or location of expression) of a nucleic acid to which it is operably linked.
- the regulatory sequence can, for example, exert its effects directly on the regulated nucleic acid, or through the action of one or more other molecules (e.g., polypeptides that bind to the regulatory sequence and/or the nucleic acid).
- Examples of regulatory sequences include promoters, enhancers and other expression control elements (e.g., polyadenylation signals).
- a "host cell” is a cell that can be used to express a nucleic acid, e.g., a nucleic acid of the invention.
- a host cell can be a prokaryote, for example, E. coli, or it can be a eukaryote, for example, a single-celled eukaryote (e.g., a yeast or other fungus), a plant cell (e.g., a tobacco or tomato plant cell), an animal cell (e.g., a human cell, a monkey cell, a hamster cell, a rat cell, a mouse cell, or an insect cell) or a hybridoma.
- host cells examples include the COS-7 line of monkey kidney cells (ATCC CRL 1651) (see Gluzman et al., 1981, Cell 23: 175), L cells, C127 cells, 3T3 cells (ATCC CCL 163), Chinese hamster ovary (CHO) cells or their derivatives such as Veggie CHO and related cell lines which grow in serum-free media (see Rasmussen et al., 1998, Cytotechnology 28:31) or CHO strain DX-B11, which is deficient in DHFR (see Urlaub et al., 1980, Proc. Natl. Acad. Sci.
- COS-7 line of monkey kidney cells ATCC CRL 1651
- L cells C127 cells
- 3T3 cells ATCC CCL 163
- CHO Chinese hamster ovary
- HeLa cells derived from the African green monkey kidney cell line CV1 (ATCC CCL 70) (see McMahan et al., 1991, EMBO J. 10:2821), human embryonic kidney cells such as 293,293 EBNA or MSR 293, human epidermal A431 cells, human Colo205 cells, other transformed primate cell lines, normal diploid cells, cell strains derived from in vitro culture of primary tissue, primary explants, HL-60, U937, HaK or Jurkat cells.
- a host cell is a cultured cell that can be transformed or transfected with a polypeptide-encoding nucleic acid, which can then be expressed in the host cell.
- the phrase "recombinant host cell” can be used to denote a host cell that has been transformed or transfected with a nucleic acid to be expressed.
- a host cell also can be a cell that comprises the nucleic acid but does not express it at a desired level unless a regulatory sequence is introduced into the host cell such that it becomes operably linked with the nucleic acid. It is understood that the term host cell refers not only to the particular subject cell but also to the progeny or potential progeny of such a cell. Because certain modifications may occur in succeeding generations due to, e.g., mutation or environmental influence, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope of the term as used herein. 95% Homology
- the present disclosure provides a number of antibodies structurally characterized by the amino acid sequences of their variable domain regions.
- the amino acid sequences can undergo some changes while retaining their high degree of binding to their specific targets. More specifically, many amino acids in the variable domain region can be changed with conservative substitutions and it is predictable that the binding characteristics of the resulting antibody will not differ from the binding characteristics of the wild type antibody sequence.
- the recombinant DNA can also include any type of protein tag sequence that may be useful for purifying the protein.
- protein tags include but are not limited to a histidine tag, a FLAG tag, a myc tag, an HA tag, or a GST tag.
- Appropriate cloning and expression vectors for use with bacterial, fungal, yeast, and mammalian cellular hosts can be found in Cloning Vectors: A Laboratory Manual, (Elsevier, N.Y., 1985).
- the expression construct is introduced into the host cell using a method appropriate to the host cell.
- a variety of methods for introducing nucleic acids into host cells are known in the art, including, but not limited to, electroporation; transfection employing calcium chloride, rubidium chloride, calcium phosphate, DEAE-dextran, or other substances; microprojectile bombardment; lipofection; and infection (where the vector is an infectious agent).
- Suitable host cells include prokaryotes, yeast, mammalian cells, or bacterial cells.
- Suitable bacteria include gram negative or gram positive organisms, for example, E. coli or Bacillus spp. Yeast, preferably from the Saccharomyces species, such as S. cerevisiae, may also be used for production of polypeptides.
- Various mammalian or insect cell culture systems can also be employed to express recombinant proteins. Baculovirus systems for production of heterologous proteins in insect cells are reviewed by Luckow and Summers, (Bio/Technology, 6:47, 1988).
- suitable mammalian host cell lines include endothelial cells, COS-7 monkey kidney cells, CV-1, L cells, C127, 3T3, Chinese hamster ovary (CHO), human embryonic kidney cells, HeLa, 293, 293T, and BHK cell lines.
- Purified polypeptides are prepared by culturing suitable host/vector systems to express the recombinant proteins. For many applications, the small size of many of the polypeptides disclosed herein would make expression in E. coli as the preferred method for expression. The protein is then purified from culture media or cell extracts.
- CXCR5 -binding polypeptides can also be produced by chemical synthesis (e.g., by the methods described in Solid Phase Peptide Synthesis, 2nd ed., 1984, The Pierce Chemical Co., Rockford, 111.). Modifications to the protein can also be produced by chemical synthesis.
- the polypeptides of the present disclosure can be purified by isolation/purification methods for proteins generally known in the field of protein chemistry.
- Non-limiting examples include extraction, recrystallization, salting out (e.g., with ammonium sulfate or sodium sulfate), centrifugation, dialysis, ultrafiltration, adsorption chromatography, ion exchange chromatography, hydrophobic chromatography, normal phase chromatography, reversed-phase chromatography, gel filtration, gel permeation chromatography, affinity chromatography, electrophoresis, countercurrent distribution or any combinations of these.
- polypeptides may be exchanged into different buffers and/or concentrated by any of a variety of methods known to the art, including, but not limited to, filtration and dialysis.
- the binding polypeptides of the invention may further comprise post-translational modifications.
- post-translational protein modifications include phosphorylation, acetylation, methylation, ADP-ribosylation, ubiquitination, glycosylation, carbonylation, sumoylation, biotinylation or addition of a polypeptide side chain or of a hydrophobic group.
- the modified soluble polypeptides may contain non- amino acid elements, such as lipids, poly- or mono-saccharide, and phosphates.
- a preferred form of glycosylation is sialylation, which conjugates one or more sialic acid moieties to the polypeptide. Sialic acid moieties improve solubility and serum half-life while also reducing the possible immunogeneticity of the protein. See Raju et al. Biochemistry. 2001 31 ; 40(30):8868- 76.
- modified forms of the subject soluble polypeptides comprise linking the subject soluble polypeptides to nonproteinaceous polymers.
- the polymer is polyethylene glycol ("PEG"), polypropylene glycol, or poly oxy alky lenes, in the manner as set forth in U.S. Patents 4,640,835; 4,496,689; 4,301, 144; 4,670,417; 4,791, 192 or 4,179,337.
- PEG is a water soluble polymer that is commercially available or can be prepared by ring-opening polymerization of ethylene glycol according to methods well known in the art (Sandler and Karo, Polymer Synthesis, Academic Press, New York, Vol. 3, pages 138-161).
- the term "PEG” is used broadly to encompass any polyethylene glycol molecule, without regard to size or to modification at an end of the PEG, and can be represented by the formula: X-C CHzCHzC n -lCHzCHzOH (1), where n is 20 to 2300 and X is H or a terminal modification, e.g., a C 1-4 alkyl.
- the PEG of the invention terminates on one end with hydroxy or methoxy, i.e., X is H or CH 3 ("methoxy PEG").
- a PEG can contain further chemical groups which are necessary for binding reactions; which results from the chemical synthesis of the molecule; or which is a spacer for optimal distance of parts of the molecule.
- such a PEG can consist of one or more PEG side-chains which are linked together. PEGs with more than one PEG chain are called multiarmed or branched PEGs. Branched PEGs can be prepared, for example, by the addition of polyethylene oxide to various polyols, including glycerol, pentaerythriol, and sorbitol.
- a four-armed branched PEG can be prepared from pentaerythriol and ethylene oxide.
- Branched PEG are described in, for example, EP-A 0 473 084 and U.S. Patent. 5,932,462.
- One form of PEGs includes two PEG side-chains (PEG2) linked via the primary amino groups of a lysine (Monfardini et al., Bioconjugate Chem. 6 (1995) 62-69).
- the pegylated 10F n3 polypeptide is produced by site-directed pegylation, particularly by conjugation of PEG to a cysteine moiety at the N- or C-terminus. Accordingly, the present disclosure provides a target-binding 10F n3 polypeptide with improved pharmacokinetic properties, the
- polypeptide comprising: a n3 domain having from about 80 to about 150 amino acids, wherein at least one of the loops of said 10F n3 domain participate in target binding; and a
- n3 polypeptide binds to the target with a KD of less than 100 nM and has a clearance rate of less than 30 mL/hr/kg in a mammal.
- n3 polypeptide may be attached to the n3 polypeptide by site directed pegylation, such as by attachment to a Cys residue, where the Cys residue may be positioned at the N-terminus of the
- a Cys residue may be situated at other positions as well, particularly any of the loops that do not participate in target binding.
- a PEG moiety may also be attached by other chemistry, including by conjugation to amines.
- PEG conjugation to peptides or proteins generally involves the activation of PEG and coupling of the activated PEG-intermediates directly to target proteins/peptides or to a linker, which is subsequently activated and coupled to target proteins/peptides (see Abuchowski et al., /. Biol. Chem., 252, 3571 (1977) and /. Biol. Chem., 252, 3582 (1977), Zalipsky, et al., and Harris et. al., in: Poly(ethylene glycol) Chemistry: Biotechnical and Biomedical Applications; (J. M. Harris ed.) Plenum Press: New York, 1992; Chap.21 and 22).
- a binding polypeptide containing a PEG molecule is also known as a conjugated protein, whereas the protein lacking an attached PEG molecule can be referred to as unconjugated.
- a variety of molecular mass forms of PEG can be selected, e.g., from about 1,000 Daltons (Da) to 100,000 Da (n is 20 to 2300), for conjugating to CXCR5-binding polypeptides.
- the number of repeating units "n" in the PEG is approximated for the molecular mass described in Daltons. It is preferred that the combined molecular mass of PEG on an activated linker is suitable for pharmaceutical use. Thus, in one embodiment, the molecular mass of the PEG molecules does not exceed 100,000 Da.
- each PEG molecule has the same molecular mass of 12,000 Da (each n is about 270)
- the total molecular mass of PEG on the linker is about 36,000 Da (total n is about 820).
- the molecular masses of the PEG attached to the linker can also be different, e.g., of three molecules on a linker two PEG molecules can be 5,000 Da each (each n is about 110) and one PEG molecule can be 12,000 Da (n is about 270).
- an CXCR5 binding polypeptide is covalently linked to one poly(ethylene glycol) group of the formula: — CO— (CH 2 ) X ⁇
- a binding polypeptide's 6- amino group of a lysine is the available (free) amino group.
- the pegylated binding polypeptides of the invention will preferably retain at least 25%, 50%, 60%, 70%, 80%, 85%, 90%, 95% or 100% of the biological activity associated with the unmodified protein.
- biological activity refers to its ability to bind to CXCR5, as assessed by KD, k on or k cff .
- the pegylated binding polypeptide protein shows an increase in binding to CXCR5 relative to unpegylated binding polypeptide.
- the serum clearance rate of PEG-modified polypeptide may be decreased by about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or even 90%, relative to the clearance rate of the unmodified binding polypeptide.
- the PEG-modified polypeptide may have a half-life (ti /2 ) which is enhanced relative to the half-life of the unmodified protein.
- the half-life of PEG- binding polypeptide may be enhanced by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, 125%, 150%, 175%, 200%, 250%, 300%, 400% or 500%, or even by 1000% relative to the half-life of the unmodified binding polypeptide.
- the protein half-life is determined in vitro, such as in a buffered saline solution or in serum.
- the protein half-life is an in vivo half life, such as the half-life of the protein in the serum or other bodily fluid of an animal.
- the present disclosure features methods for treating conditions or preventing preconditions which respond to an inhibition of CXCR5 biological activity.
- Preferred examples are conditions that are characterized by inflammation or cellular hyperproliferation.
- therapeutic formulations will generally be distinguished from other formulations in that they are substantially pyrogen free, or at least contain no more than acceptable levels of pyrogen as determined by the appropriate regulatory agency ⁇ e.g., FDA).
- compositions of the present disclosure may be administered with a pharmaceutically acceptable diluent, carrier, or excipient, in unit dosage form.
- Administration may be parenteral ⁇ e.g., intravenous, subcutaneous), oral, or topical, as non-limiting examples.
- any gene therapy technique using nucleic acids encoding the polypeptides of the invention, may be employed, such as naked DNA delivery, recombinant genes and vectors, cell-based delivery, including ex vivo manipulation of patients' cells, and the like.
- the composition can be in the form of a pill, tablet, capsule, liquid, or sustained release tablet for oral administration; or a liquid for intravenous, subcutaneous or parenteral administration; gel, lotion, ointment, cream, or a polymer or other sustained release vehicle for local administration.
- Formulations for parenteral administration may, for example, contain excipients, sterile water, saline, polyalkylene glycols such as polyethylene glycol, oils of vegetable origin, or hydrogenated napthalenes.
- sterile water ed., ed. A. R. Gennaro A R., 2000, Lippincott Williams & Wilkins, Philadelphia, Pa.
- Formulations for parenteral administration may, for example, contain excipients, sterile water, saline, polyalkylene glycols such as polyethylene glycol, oils of vegetable origin, or hydrogenated napthalenes.
- Biocompatible, biodegradable lactide polymer, lactide/glycolide copolymer, or polyoxyethylene- polyoxypropylene copolymers may be used to control the release of the compounds.
- Nanoparticulate formulations may be used to control the biodistribution of the compounds.
- Other potentially useful parenteral delivery systems include ethylene- vinyl acetate copolymer particles, osmotic pumps, implantable infusion systems, and liposomes.
- concentration of the compound in the formulation varies depending upon a number of factors, including the dosage of the drug to be administered, and the route of administration.
- the polypeptide may be optionally administered as a pharmaceutically acceptable salt, such as non-toxic acid addition salts or metal complexes that are commonly used in the pharmaceutical industry.
- acid addition salts include organic acids such as acetic, lactic, pamoic, maleic, citric, malic, ascorbic, succinic, benzoic, palmitic, suberic, salicylic, tartaric, methanesulfonic, toluenesulfonic, or trifluoroacetic acids or the like; polymeric acids such as tannic acid, carboxymethyl cellulose, or the like; and inorganic acid such as hydrochloric acid, hydrobromic acid, sulfuric acid phosphoric acid, or the like.
- Metal complexes include zinc, iron, and the like.
- the polypeptide is formulated in the presence of sodium acetate to increase thermal stability.
- Formulations for oral use include tablets containing the active ingredient(s) in a mixture with non-toxic pharmaceutically acceptable excipients.
- excipients may be, for example, inert diluents or fillers (e.g., sucrose and sorbitol), lubricating agents, glidants, and anti- adhesives (e.g., magnesium stearate, zinc stearate, stearic acid, silicas, hydrogenated vegetable oils, or talc).
- Formulations for oral use may also be provided as chewable tablets, or as hard gelatin capsules wherein the active ingredient is mixed with an inert solid diluent, or as soft gelatin capsules wherein the active ingredient is mixed with water or an oil medium.
- a therapeutically effective dose refers to a dose that produces the therapeutic effects for which it is administered.
- the exact dose will depend on the disorder to be treated, and may be ascertained by one skilled in the art using known techniques.
- the polypeptide is administered at about 0.01 g/kg to about 50 mg/kg per day, preferably 0.01 mg/kg to about 30 mg/kg per day, most preferably 0.1 mg/kg to about 20 mg/kg per day.
- the polypeptide may be given daily (e.g., once, twice, three times, or four times daily) or preferably less frequently (e.g., weekly, every two weeks, every three weeks, monthly, or quarterly).
- adjustments for age as well as the body weight, general health, sex, diet, time of administration, drug interaction, and the severity of the disease may be necessary, and will be ascertainable with routine experimentation by those skilled in the art.
- the CXCR5 binding proteins described herein and their related variants are useful in a number of therapeutic and diagnostic applications. These include the inhibition of the biological activity of CXCR5 by competing for or blocking the binding to a CXCR5 as well as the delivery of cytotoxic or imaging moieties to cells, preferably cells expressing CXCR5.
- the small size and stable structure of these molecules can be particularly valuable with respect to manufacturing of the drug, rapid clearance from the body for certain applications where rapid clearance is desired or formulation into novel delivery systems that are suitable or improved using a molecule with such characteristics.
- the polypeptides of this disclosure are effective against a number of cancer conditions as well as complications arising from cancer, such as pleural effusion and ascites, colorectal cancers, head and neck cancers, small cell lung cancer, non-small cell lung cancer (NSCLC) and pancreatic cancer.
- cancer such as pleural effusion and ascites, colorectal cancers, head and neck cancers, small cell lung cancer, non-small cell lung cancer (NSCLC) and pancreatic cancer.
- Non-limiting examples of cancers include bladder, blood, bone, brain, breast, cartilage, colon kidney, liver, lung, lymph node, nervous tissue, ovary, pancreatic, prostate, skeletal muscle, skin, spinal cord, spleen, stomach, testes, thymus, thyroid, trachea, urogenital tract, ureter, urethra, uterus, or vaginal cancer.
- the subject anti-CXCR5 antibodies agents of the invention can be used alone.
- the subject agents may be used in combination with other conventional anti-cancer therapeutic approaches directed to treatment or prevention of proliferative disorders (e.g., tumor).
- proliferative disorders e.g., tumor
- methods can be used in prophylactic cancer prevention, prevention of cancer recurrence and metastases after surgery, and as an adjuvant of other conventional cancer therapy.
- conventional cancer therapies e.g., chemotherapy, radiation therapy, phototherapy, immunotherapy, and surgery
- a wide array of conventional compounds have been shown to have anti-neoplastic activities. These compounds have been used as pharmaceutical agents in chemotherapy to shrink solid tumors, prevent metastases and further growth, or decrease the number of malignant cells in leukemic or bone marrow malignancies.
- chemotherapy has been effective in treating various types of malignancies, many anti-neoplastic compounds induce undesirable side effects. It has been shown that when two or more different treatments are combined, the treatments may work synergistically and allow reduction of dosage of each of the treatments, thereby reducing the detrimental side effects exerted by each compound at higher dosages. In other instances, malignancies that are refractory to a treatment may respond to a combination therapy of two or more different treatments.
- a polypeptide therapeutic agent of the present invention When a polypeptide therapeutic agent of the present invention is administered in combination with another conventional anti-neoplastic agent, either concomitantly or sequentially, such therapeutic agent may be found to enhance the therapeutic effect of the antineoplastic agent or overcome cellular resistance to such anti-neoplastic agent. This allows decrease of dosage of an anti-neoplastic agent, thereby reducing the undesirable side effects, or restores the effectiveness of an anti-neoplastic agent in resistant cells.
- Pharmaceutical compounds that may be used for combinatory anti-tumor therapy include, merely to illustrate: aminoglutethimide, amsacrine, anastrozole, asparaginase, beg, bicalutamide, bleomycin, buserelin, busulfan, campothecin, capecitabine, carboplatin, carmustine, chlorambucil, cisplatin, cladribine, clodronate, colchicine, cyclophosphamide, cyproterone, cytarabine, dacarbazine, dactinomycin, daunorubicin, dienestrol,
- diethylstilbestrol docetaxel, doxorubicin, epirubicin, estradiol, estramustine, etoposide, exemestane, filgrastim, fludarabine, fludrocortisone, fluorouracil, fluoxymesterone, flutamide, gemcitabine, genistein, goserelin, hydroxyurea, idarubicin, ifosfamide, imatinib, interferon, irinotecan, ironotecan, letrozole, leucovorin, leuprolide, levamisole, lomustine,
- chemotherapeutic anti-tumor compounds may be categorized by their mechanism of action into, for example, following groups: anti-metabolites/anti-cancer agents, such as pyrimidine analogs (5 -fluorouracil, floxuridine, capecitabine, gemcitabine and cytarabine) and purine analogs, folate antagonists and related inhibitors (mercaptopurine, thioguanine, pentostatin and 2-chlorodeoxyadenosine (cladribine)); antiproliferative/antimitotic agents including natural products such as vinca alkaloids (vinblastine, vincristine, and vinorelbine), microtubule disrupters such as taxane (paclitaxel, docetaxel), vincristin, vinblastin, nocodazole, epothilones and navelbine, epidipodophyllotoxins (etoposide, teniposide), DNA damaging agents (actinomycin, amsacrine, anthra
- doxorubicin (adriamycin), amsacrine, camptothecin, daunorubicin, dactinomycin, eniposide, epirubicin, etoposide, idarubicin and mitoxantrone, topotecan, irinotecan), corticosteroids (cortisone, dexamethasone, hydrocortisone, methylpednisolone, prednisone, and prenisolone); growth factor signal transduction kinase inhibitors; mitochondrial dysfunction inducers and caspase activators; and chromatin disrupters.
- administration of the polypeptide therapeutic agents may be continued while the other therapy is being administered and/or thereafter.
- Administration of the polypeptide therapeutic agents may be made in a single dose, or in multiple doses.
- administration of the polypeptide therapeutic agents is commenced at least several days prior to the conventional therapy, while in other instances, administration is begun either immediately before or at the time of the administration of the conventional therapy.
- a biological sample such as serum or a tissue biopsy, from a patient suspected of having a condition characterized by inappropriate angiogenesis is contacted with a detectably labeled polypeptide of the disclosure to detect levels of CXCR5.
- the levels of CXCR5 detected are then compared to levels of CXCR5 detected in a normal sample also contacted with the labeled polypeptide.
- An increase of at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90% in the levels of the CXCR5 may be considered a diagnostic indicator.
- the CXCR5 binding polypeptides are further attached to a label that is able to be detected (e.g., the label can be a radioisotope, fluorescent compound, enzyme or enzyme co-factor).
- the label can be a radioisotope, fluorescent compound, enzyme or enzyme co-factor.
- the active moiety may be a radioactive agent, such as:
- radioactive heavy metals such as iron chelates, radioactive chelates of gadolinium or
- a binding agent affixed to such a moiety may be used as an imaging agent and is administered in an amount effective for diagnostic use in a mammal such as a human and the localization and accumulation of the imaging agent is then detected.
- the localization and accumulation of the imaging agent may be detected by radioscintigraphy, nuclear magnetic resonance imaging, computed tomography or positron emission tomography.
- Immunoscintigraphy using CXCR5 binding polypeptides directed at CXCR5 may be used to detect and/or diagnose cancers and vasculature.
- Iodine may be effectively used for such imaging.
- the amount of radioisotope to be administered is dependent upon the radioisotope.
- Those having ordinary skill in the art can readily formulate the amount of the imaging agent to be administered based upon the specific activity and energy of a given radionuclide used as the active moiety.
- 0.1 -100 millicuries per dose of imaging agent preferably 1 -10 millicuries, most often 2-5 millicuries are administered.
- compositions according to the present invention useful as imaging agents comprising a targeting moiety conjugated to a radioactive moiety comprise 0.1 -100 millicuries, in some embodiments preferably 1 -10 millicuries, in some embodiments preferably 2-5 millicuries, in some embodiments more preferably 1 -5 millicuries.
- the CXCR5 binding polypeptides can also be used to deliver additional therapeutic agents (including but not limited to drug compounds, chemotherapeutic compounds, and radiotherapeutic compounds) to a cell or tissue expressing CXCR5.
- the CXCR5 binding polypeptide is fused to a chemotherapeutic agent for targeted delivery of the chemotherapeutic agent to a tumor cell or tissue expressing CXCR5.
- the CXCR5 binding polypeptides are useful in a variety of applications, including research, diagnostic and therapeutic applications. For instance, they can be used to isolate and/or purify receptor or portions thereof, and to study receptor structure (e.g., conformation) and function.
- the binding polypeptides of fragments thereof can be labeled or unlabeled for diagnostic purposes.
- diagnostic assays entail detecting the formation of a complex resulting from the binding of a binding polypeptide to CXCR5.
- the binding polypeptides or fragments can be directly labeled, similar to antibodies.
- labels can be employed, including, but not limited to, radionuclides, fluorescers, enzymes, enzyme substrates, enzyme cofactors, enzyme inhibitors and ligands (e.g., biotin, haptens). Numerous appropriate immunoassays are known to the skilled artisan (see, for example, U.S. Patents.
- the binding polypeptides can be used in assays, such as agglutination assays. Unlabeled binding polypeptides can also be used in combination with another (one or more) suitable reagent which can be used to detect the binding polypeptide, such as a labeled antibody reactive with the binding polypeptide or other suitable reagent (e.g., labeled protein A).
- a suitable reagent which can be used to detect the binding polypeptide, such as a labeled antibody reactive with the binding polypeptide or other suitable reagent (e.g., labeled protein A).
- the binding polypeptides of the present invention can be utilized in enzyme immunoassays, wherein the subject polypeptides are conjugated to an enzyme.
- a biological sample comprising a CXCR5 protein is combined with the subject binding polypeptides, binding occurs between the binding polypeptides and the CXCR5 protein.
- a sample containing cells expressing a CXCR5 protein e.g., endothelial cells
- binding occurs between the binding polypeptides and cells bearing a CXCR5 protein recognized by the binding polypeptide.
- binding polypeptide-enzyme conjugate specifically bound to the cells can be determined, for example, by contacting the sample with a substrate of the enzyme which produces a color or other detectable change when acted on by the enzyme.
- the subject binding polypeptides can be unlabeled, and a second, labeled polypeptide (e.g., an antibody) can be added which recognizes the subject binding polypeptide.
- kits for use in detecting the presence of a CXCR5 protein in a biological sample can also be prepared.
- kits will include a CXCR5 binding polypeptide which binds to a CXCR5 protein or portion of said receptor, as well as one or more ancillary reagents suitable for detecting the presence of a complex between the binding polypeptide and the receptor protein or portions thereof.
- the polypeptide compositions of the present invention can be provided in lyophilized form, either alone or in combination with additional antibodies specific for other epitopes.
- the binding polypeptides and/or antibodies, which can be labeled or unlabeled can be included in the kits with adjunct ingredients (e.g., buffers, such as Tris, phosphate and carbonate, stabilizers, excipients, biocides and/or inert proteins, e.g., bovine serum albumin).
- the binding polypeptides and/or antibodies can be provided as a lyophilized mixture with the adjunct ingredients, or the adjunct ingredients can be separately provided for combination by the user.
- these adjunct materials will be present in less than about 5% weight based on the amount of active binding polypeptide or antibody, and usually will be present in a total amount of at least about 0.001 % weight based on polypeptide or antibody concentration.
- a second antibody capable of binding to the binding polypeptide is employed, such antibody can be provided in the kit, for instance in a separate vial or container.
- the second antibody if present, is typically labeled, and can be formulated in an analogous manner with the antibody formulations described above.
- the present disclosure also provides a method of detecting and/or quantitating expression of CXCR5, wherein a composition comprising a cell or fraction thereof (e.g., membrane fraction) is contacted with a binding polypeptide which binds to a CXCR5 or portion of the receptor under conditions appropriate for binding thereto, and the binding is monitored. Detection of the binding polypeptide, indicative of the formation of a complex between binding polypeptide and CXCR5 or a portion thereof, indicates the presence of the receptor. Binding of a polypeptide to the cell can be determined by standard methods, such as those described in the working examples. The method can be used to detect expression of CXCR5 on cells from an individual. Optionally, a quantitative expression of CXCR5 on the surface of endothelial cells can be evaluated, for instance, by flow cytometry, and the staining intensity can be correlated with disease susceptibility, progression or risk.
- a composition comprising a cell or fraction thereof (e.g., membrane fraction) is contacted
- the present disclosure also provides a method of detecting the susceptibility of a mammal to certain diseases.
- the method can be used to detect the susceptibility of a mammal to diseases which progress based on the amount of CXCR5 present on cells and/or the number of CXCR5 -positive cells in a mammal.
- Polypeptide sequences are indicated using standard one- or three-letter abbreviations. Unless otherwise indicated, each polypeptide sequence has amino termini at the left and a carboxy termini at the right; each single-stranded nucleic acid sequence, and the top strand of each double-stranded nucleic acid sequence, has a 5' termini at the left and a 3' termini at the right.
- a particular polypeptide sequence also can be described by explaining how it differs from a reference sequence.
- Antigen binding proteins are polypeptides that bind to EGFR, (preferably, human CXCR5).
- Antigen binding proteins include antigen binding proteins that inhibit a biological activity of CXCR5.
- Oligomers that contain one or more antigen binding proteins may be employed as CXCR5 antagonists. Oligomers may be in the form of covalently-linked or non-covalently- linked dimers, trimers, or higher oligomers. Oligomers comprising two or more antigen binding protein are contemplated for use, with one example being a homodimer. Other oligomers include heterodimers, homotrimers, heterotrimers, homotetramers, heterotetramers, etc.
- One embodiment is directed to oligomers comprising multiple antigen binding proteins joined via covalent or non-covalent interactions between peptide moieties fused to the antigen binding proteins.
- Such peptides may be peptide linkers (spacers), or peptides that have the property of promoting oligomerization.
- Leucine zippers and certain polypeptides derived from antibodies are among the peptides that can promote oligomerization of antigen binding proteins attached thereto, as described in more detail below.
- the oligomers comprise from two to four antigen binding proteins.
- the antigen binding proteins of the oligomer may be in any form, such as any of the forms described above, e.g., variants or fragments.
- the oligomers comprise antigen binding proteins that have CXCR5 binding activity.
- an oligomer is prepared using polypeptides derived from immunoglobulins. Preparation of Fusion Proteins Comprising Certain Heterologous
- Polypeptides Fused to Various Portions of antibody-derived polypeptides has been described, e.g., by Ashkenazi et al., 1991, Proc. Natl. Acad. Sci. USA 88: 10535; Byrn et al., 1990, Nature 344:677; and Hollenbaugh et al., 1992 "Construction of Immunoglobulin Fusion Proteins", in Current Protocols in Immunology, Suppl. 4, pages 10.19.1-10.19.11.
- One embodiment is directed to a dimer comprising two fusion proteins created by fusing a CXCR5 binding fragment of an anti-CXCR5 antibody to the Fc region of an antibody.
- the dimer can be made by, for example, inserting a gene fusion encoding the fusion protein into an appropriate expression vector, expressing the gene fusion in host cells transformed with the recombinant expression vector, and allowing the expressed fusion protein to assemble much like antibody molecules, whereupon interchain disulfide bonds form between the Fc moieties to yield the dimer.
- Fc polypeptide includes native and mutein forms of polypeptides derived from the Fc region of an antibody. Truncated forms of such polypeptides containing the hinge region that promotes dimerization also are included. Fusion proteins comprising Fc moieties (and oligomers formed therefrom) offer the advantage of facile purification by affinity chromatography over Protein A or Protein G columns.
- Leucine zipper domains are peptides that promote oligomerization of the proteins in which they are found.
- Leucine zippers were originally identified in several DNA- binding proteins (Landschulz et al., 1988, Science 240: 1759), and have since been found in a variety of different proteins.
- leucine zippers are naturally occurring peptides and derivatives thereof that dimerize or trimerize.
- leucine zipper domains suitable for producing soluble oligomeric proteins are described in WO 94/10308, and the leucine zipper derived from lung surfactant protein D (SPD) described in Hoppe et al., 1994, FEBS Letters 344: 191.
- SPD lung surfactant protein D
- the use of a modified leucine zipper that allows for stable trimerization of a heterologous protein fused thereto is described in Fanslow et al., 1994, Semin. Immunol. 6:267- 78.
- recombinant fusion proteins comprising an anti-CXCR5 antibody fragment or derivative fused to a leucine zipper peptide are expressed in suitable host cells, and the soluble oligomeric anti-CXCR5 antibody fragments or derivatives that form are recovered from the culture supernatant.
- Antigen-binding fragments of antigen binding proteins of the invention may be produced by conventional techniques. Examples of such fragments include, but are not limited to, Fab and F(ab') 2 fragments.
- the present disclosure provides monoclonal antibodies that bind to CXCR5.
- Monoclonal antibodies may be produced using any technique known in the art, e.g., by immortalizing spleen cells harvested from the transgenic animal after completion of the immunization schedule.
- the spleen cells can be immortalized using any technique known in the art, e.g., by fusing them with myeloma cells to produce hybridomas.
- Myeloma cells for use in hybridoma-producing fusion procedures preferably are non-antibody-producing, have high fusion efficiency, and enzyme deficiencies that render them incapable of growing in certain selective media which support the growth of only the desired fused cells (hybridomas).
- Suitable cell lines for use in mouse fusions include Sp-20, P3-X63/Ag8, P3-X63- Ag8.653, NSl/l .Ag 4 1, Sp210-Agl4, FO, NSO/U, MPC-11, MPC 11 -X45-GTG 1.7 and
- examples of cell lines used in rat fusions include R210.RCY3, Y3-Ag 1.2.3, IR983F and 48210.
- Other cell lines useful for cell fusions are U-266, GM1500-GRG2, LICR- LON-HMy2 and UC729-6.
- Antigen binding proteins directed against CXCR5 can be used, for example, in assays to detect the presence of CXCR5 polypeptides, either in vitro or in vivo.
- the antigen binding proteins also may be employed in purifying CXCR5 proteins by immunoaffinity
- Blocking antigen binding proteins can be used in the methods disclosed herein. Such antigen binding proteins that function as CXCR5 antagonists may be employed in treating any CXCR5-induced condition, including but not limited to various cancers.
- Antigen binding proteins may be employed in an in vitro procedure, or administered in vivo to inhibit CXCR5-induced biological activity. Disorders caused or exacerbated (directly or indirectly) by the proteolytic activation of CXCR5, examples of which are provided herein, thus may be treated.
- the present invention provides a therapeutic method comprising in vivo administration of a CXCR5 blocking antigen binding protein to a mammal in need thereof in an amount effective for reducing a CXCR5-induced biological activity.
- Antigen binding proteins include fully human monoclonal antibodies that inhibit a biological activity of CXCR5.
- Antigen binding proteins may be prepared by any of a number of conventional techniques. For example, they may be purified from cells that naturally express them (e.g., an antibody can be purified from a hybridoma that produces it), or produced in recombinant expression systems, using any technique known in the art. See, for example, Monoclonal Antibodies, Hybridomas: A New Dimension in Biological Analyses, Kennet et al. (eds.), Plenum Press, New York (1980); and Antibodies: A Laboratory Manual, Harlow and Land (eds.), Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., (1988).
- any expression system known in the art can be used to make the recombinant polypeptides of the invention.
- host cells are transformed with a recombinant expression vector that comprises DNA encoding a desired polypeptide.
- the host cells that may be employed are prokaryotes, yeast or higher eukaryotic cells.
- Prokaryotes include gram negative or gram positive organisms, for example E. coli or bacilli.
- Higher eukaryotic cells include insect cells and established cell lines of mammalian origin.
- suitable mammalian host cell lines include the COS-7 line of monkey kidney cells (ATCC CRL 1651) (Gluzman et al., 1981, Cell 23: 175), L cells, 293 cells, C127 cells, 3T3 cells (ATCC CCL 163), Chinese hamster ovary (CHO) cells, HeLa cells, BHK (ATCC CRL 10) cell lines, and the CVl/EBNA cell line derived from the African green monkey kidney cell line CVl (ATCC CCL 70) as described by McMahan et al., 1991, EMBO J. 10: 2821.
- Appropriate cloning and expression vectors for use with bacterial, fungal, yeast, and mammalian cellular hosts are described by Pouwels et al. (Cloning Vectors: A Laboratory Manual, Elsevier, N.Y., 1985).
- the transformed cells can be cultured under conditions that promote expression of the polypeptide, and the polypeptide recovered by conventional protein purification procedures.
- One such purification procedure includes the use of affinity chromatography, e.g., over a matrix having all or a portion (e.g., the extracellular domain) of CXCR5 bound thereto.
- Polypeptides contemplated for use herein include substantially homogeneous recombinant mammalian anti-CXCR5 antibody polypeptides substantially free of contaminating
- Antigen binding proteins may be prepared, and screened for desired properties, by any of a number of known techniques. Certain of the techniques involve isolating a nucleic acid encoding a polypeptide chain (or portion thereof) of an antigen binding protein of interest (e.g., an anti-CXCR5 antibody), and manipulating the nucleic acid through recombinant DNA technology.
- the nucleic acid may be fused to another nucleic acid of interest, or altered (e.g., by mutagenesis or other conventional techniques) to add, delete, or substitute one or more amino acid residues, for example.
- Single chain antibodies may be formed by linking heavy and light chain variable domain (Fv region) fragments via an amino acid bridge (short peptide linker), resulting in a single polypeptide chain.
- Fv region heavy and light chain variable domain
- short peptide linker short peptide linker
- Such single-chain Fvs have been prepared by fusing DNA encoding a peptide linker between DNAs encoding the two variable domain polypeptides (VL and VH).
- the resulting polypeptides can fold back on themselves to form antigen-binding monomers, or they can form multimers (e.g., dimers, trimers, or tetramers), depending on the length of a flexible linker between the two variable domains (Kortt et al., 1997, Prot. Eng.
- IgG antibodies may be derived from an IgM antibody, for example, and vice versa.
- Such techniques allow the preparation of new antibodies that possess the antigen-binding properties of a given antibody (the parent antibody), but also exhibit biological properties associated with an antibody isotype or subclass different from that of the parent antibody.
- Recombinant DNA techniques may be employed. Cloned DNA encoding particular antibody polypeptides may be employed in such procedures, e.g., DNA encoding the constant domain of an antibody of the desired isotype (Lantto et al., 2002, Methods Mol. Biol. 178:303-16).
- an IgG4 it may also be desired to introduce a point mutation (CPSCP->CPPCP) in the hinge region (Bloom et al., 1997, Protein Science 6:407) to alleviate a tendency to form intra-H chain disulfide bonds that can lead to heterogeneity in the IgG4 antibodies.
- CPSCP->CPPCP point mutation
- antigen binding proteins of the present invention have a binding affinity (K a ) for CXCR5 of at least 10 6 . In other embodiments, the antigen binding
- the proteins exhibit a K a of at least 10 , at least 10 , at least 10 , or at least 10 .
- the antigen binding protein exhibits a K a substantially the same as that of an antibody described herein in the Examples.
- the present disclosure provides an antigen binding protein that has a low dissociation rate from CXCR5.
- the antigen binding protein has a K 0ff of 1 X 10 "4 to 1 or lower.
- the K cff is 5 X 10 "5 to 1 or lower.
- the K cff is substantially the same as an antibody described herein.
- the antigen binding protein binds to CXCR5 with substantially the same K 0ff as an antibody described herein.
- the present disclosure provides an antigen binding protein that inhibits an activity of CXCR5.
- the antigen binding protein has an IC 50 of 1000 nM or lower. In another embodiment, the IC 50 is 100 nM or lower; in another embodiment, the IC 50 is 10 nM or lower. In another embodiment, the IC 50 is substantially the same as that of an antibody described herein in the Examples. In another embodiment, the antigen binding protein inhibits an activity of CXCR5 with substantially the same IC5 0 as an antibody described herein.
- the present disclosure provides an antigen binding protein that binds to human CXCR5 expressed on the surface of a cell and, when so bound, inhibits CXCR5 signaling activity in the cell without causing a significant reduction in the amount of CXCR5 on the surface of the cell. Any method for determining or estimating the amount of CXCR5 on the surface and/or in the interior of the cell can be used. In other embodiments, binding of the antigen binding protein to the CXCR5 -expressing cell causes less than about 75%, 50%, 40%, 30%, 20%, 15%, 10%, 5%, 1%, or 0.1 % of the cell-surface CXCR5 to be internalized.
- the present disclosure provides an antigen binding protein having a half-life of at least one day in vitro or in vivo ⁇ e.g., when administered to a human subject).
- the antigen binding protein has a half-life of at least three days.
- the antigen binding protein has a half-life of four days or longer.
- the antigen binding protein has a half-life of eight days or longer.
- the antigen binding protein is derivatized or modified such that it has a longer half-life as compared to the underivatized or unmodified antigen binding protein.
- the antigen binding protein contains one or more point mutations to increase serum half life, such as described in WO00/09560, incorporated by reference herein.
- bispecific antigen binding protein e.g., antigen binding protein that bind to two different epitopes of CXCR5, or to an epitope of CXCR5 and an epitope of another molecule, via two different antigen binding sites or regions.
- bispecific antigen binding protein as disclosed herein can comprise an CXCR5 binding site from one of the herein-described antibodies and a second CXCR5 binding region from another of the herein-described antibodies, including those described herein by reference to other publications.
- a bispecific antigen binding protein may comprise an antigen binding site from one of the herein described antibodies and a second antigen binding site from another CXCR5 antibody that is known in the art, or from an antibody that is prepared by known methods or the methods described herein.
- bispecific antibodies Numerous methods of preparing bispecific antibodies are known in the art. Such methods include the use of hybrid-hybridomas as described by Milstein et al., 1983, Nature 305:537, and chemical coupling of antibody fragments (Brennan et al., 1985, Science 229:81 ; Glennie et al., 1987, /. Immunol. 139:2367; U.S. Patent 6,010,902). Moreover, bispecific antibodies can be produced via recombinant means, for example by using leucine zipper moieties ⁇ i.e., from the Fos and Jun proteins, which preferentially form heterodimers; Kostelny et al., 1992, /. Immunol.
- the antigen binding protein comprises a derivative of an antibody.
- the derivatized antibody can comprise any molecule or substance that imparts a desired property to the antibody, such as increased half-life in a particular use.
- the derivatized antibody can comprise, for example, a detectable (or labeling) moiety (e.g., a radioactive, colorimetric, antigenic or enzymatic molecule, a detectable bead (such as a magnetic or electrodense (e.g., gold bead), or a molecule that binds to another molecule (e.g., biotin or streptavidin), a therapeutic or diagnostic moiety (e.g., a radioactive, cytotoxic, or
- an antibody e.g., a pharmaceutically active moiety
- a molecule that increases the suitability of the antibody for a particular use e.g., administration to a subject, such as a human subject, or other in vivo or in vitro uses.
- molecules that can be used to derivatize an antibody include albumin (e.g., human serum albumin) and polyethylene glycol (PEG).
- Albumin-linked and PEGylated derivatives of antibodies can be prepared using techniques well known in the art.
- the antibody is conjugated or otherwise linked to transthyretin (TTR) or a TTR variant.
- TTR transthyretin
- the TTR or TTR variant can be chemically modified with, for example, a chemical selected from the group consisting of dextran, poly(n- vinyl pyurrolidone), polyethylene glycols, propropylene glycol homopolymers, polypropylene oxide/ethylene oxide co-polymers, polyoxyethylated polyols and polyvinyl alcohols.
- Certain methods provided herein comprise administering a CXCR5 binding antigen binding protein to a subject, thereby reducing a CXCR5-induced biological response that plays a role in a particular condition.
- methods of the invention involve contacting endogenous CXCR5 with an CXCR5 binding antigen binding protein, e.g., via administration to a subject or in an ex vivo procedure.
- treatment encompasses alleviation or prevention of at least one symptom or other aspect of a disorder, or reduction of disease severity, and the like.
- An antigen binding protein need not effect a complete cure, or eradicate every symptom or manifestation of a disease, to constitute a viable therapeutic agent.
- drugs employed as therapeutic agents may reduce the severity of a given disease state, but need not abolish every manifestation of the disease to be regarded as useful therapeutic agents.
- a prophylactically administered treatment need not be completely effective in preventing the onset of a condition in order to constitute a viable prophylactic agent.
- Simply reducing the impact of a disease for example, by reducing the number or severity of its symptoms, or by increasing the effectiveness of another treatment, or by producing another beneficial effect), or reducing the likelihood that the disease will occur or worsen in a subject, is sufficient.
- One embodiment of the invention is directed to a method comprising
- a CXCR5 antagonist in an amount and for a time sufficient to induce a sustained improvement over baseline of an indicator that reflects the severity of the particular disorder.
- antigen binding proteins in ex vivo procedures also is contemplated.
- a patient's blood or other bodily fluid may be contacted with an antigen binding protein that binds CXCR5 ex vivo.
- the antigen binding protein may be bound to a suitable insoluble matrix or solid support material.
- antigen binding proteins are administered in the form of a
- composition comprising one or more additional components such as a physiologically acceptable carrier, excipient or diluent.
- the composition additionally comprises one or more physiologically active agents, for example, a second inflammation- or immune- inhibiting substance, an anti-angiogenic substance, an analgesic substance, etc., non-exclusive examples of which are provided herein.
- the composition comprises one, two, three, four, five, or six physiologically active agents in addition to an EGFR binding antigen binding protein
- the present disclosure provides a method of treating a subject with an CXCR5 inhibiting antigen binding protein and one or more other treatments.
- a combination therapy achieves synergy or an additive effect by, for example, attacking multiple sites or molecular targets in a tumor.
- Types of combination therapies that can be used in connection with the present invention include inhibiting or activating (as appropriate) multiple nodes in a single disease-related pathway, multiple pathways in a target cell, and multiple cell types within a target tissue.
- a combination therapy method comprises administering to the subject two, three, four, five, six, or more of the CXCR5 agonists or antagonists described herein.
- the method comprises administering to the subject two or more treatments that together inhibit or activate (directly or indirectly) CXCR5 -mediated signal transduction. Examples of such methods include using combinations of two or more CXCR5 inhibiting antigen binding proteins, of an CXCR5 inhibiting antigen binding protein and one or more other therapeutic moiety having anti-cancer properties (for example, cytotoxic agents, and/or immunomodulators), or of an CXCR5 inhibiting antigen binding protein and one or more other treatments (e.g., surgery, or radiation).
- one or more anti-CXCR5 antibodies or antibody derivatives can be used in combination with one or more molecules or other treatments, wherein the other molecule(s) and/or treatment(s) do not directly bind to or affect CXCR5, but which combination is effective for treating or preventing the condition being treated.
- one or more of the molecule(s) and/or treatment(s) treats or prevents a condition that is caused by one or more of the other molecule(s) or treatment(s) in the course of therapy, e.g., nausea, fatigue, alopecia, cachexia, insomnia, etc.
- the individual molecule(s) and/or treatment(s) can be administered in any order, over any length of time, which is effective, e.g., simultaneously, consecutively, or alternately.
- the method of treatment comprises completing a first course of treatment with one molecule or other treatment before beginning a second course of treatment.
- the length of time between the end of the first course of treatment and beginning of the second course of treatment can be any length of time that allows the total course of therapy to be effective, e.g., seconds, minutes, hours, days, weeks, months, or even years.
- the method comprises administering one or more of the CXCR5 antagonists described herein and one or more other treatments (e.g., a therapeutic or palliative treatment).
- a method comprises administering more than one treatment to a subject
- the order, timing, number, concentration, and volume of the administrations is limited only by the medical requirements and limitations of the treatment, i.e., two treatments can be administered to the subject, e.g., simultaneously, consecutively, alternately, or according to any other regimen.
- This example describes a cellular binding assay to determine the EC 50 for anti-CXCR5 antibodies binding to human CXCR5. This example shows the binding characteristics for these antibodies in terms of the maximal cell binding and the concentration at which 50% binding saturation (EC 50) is reached.
- CHO-CXCR5 cells were lifted from culture flasks using non-enzymatic Cell Dissociation Buffer - PBS based (Life Technologies #13151- 014). Cells were resuspended in FACS Buffer (2% Fetal Bovine Serum in PBS) at 1 x 10 6 cells/ml and 50 ⁇ (0.5 x 10 5 cells) were aliquoted into the wells of a 96-well plate. Plated cells were spun down and the supernatant discarded. Cells were resuspended in 30 ⁇ FACS Buffer serially diluted concentrations of CXCR5 IgG in triplicate. Plates were incubated for 1 hr at 4
- IgG ⁇ -chain specific
- PE conjugated secondary antibody Southern Biotech # 2040-09
- This example shows a cellular binding assay to determine the EC5 0 for anti-CXCR5 antibodies binding to murine CXCR5.
- This example shows the binding characteristics for these antibodies in terms of the maximal cell binding and the concentration at which 50% binding saturation (EC 50) is reached.
- mouse spleen cells were harvested from either C57B1/6 or athymic nu/nu mice. Cells were cultured at 2xl0 6 per ml with LPS at 10 micrograms per ml in RPMI+10%FCS for up to 4 days at 37 °C in 5% C02.
- FACS Buffer 2% Fetal Bovine Serum in PBS
- 50 ⁇ 0.5 x 10 5 cells
- FACS Buffer 2% Fetal Bovine Serum in PBS
- CH0-CXCR5 cells were lifted from culture flasks using non- enzymatic Cell Dissociation Buffer - PBS based (Life Technologies #13151-014).
- Cells were resuspended in FACS Buffer (2% Fetal Bovine Serum in PBS) with sodium azide at 1 x 10 6 cells/ml and 800 ⁇ were aliquoted into a tube for each antibody.
- Antibody was added to a final concentration of 5 ⁇ g/ml and incubated at room temperature for lh. The samples were then placed on ice and a 105 ⁇ aliquot at various time points was removed and added to 190 ⁇ FACS buffer in a 96-well plate and centrifuged for 3 min.
- This example shows a Calcium assay with CHO-CXCR5 cells.
- CHO-CXCR5 cells CHO cells transfected with human CXCR5 gene
- Cells (O.lxlO 5 ) were seeded in 20 ⁇ of growth medium per well of a 384 well plate (#781091, Greiner) and incubated for 20 hours.
- the growth medium is F-12K (#21127, Life
- This example shows a chemotaxis assay with Sultan cells.
- Human B lymphocyte SH- Sultan cell line (CRL-1484, ATCC) was used for the chemotaxis assays.
- the chemotaxis assays were set up using 96-well chemotaxis chamber (ChemoTX; NeuroProbe, Gaithersburg, MD) with the 2 compartments separated by a 5- ⁇ polycarbonate membrane.
- Assay buffer used for chemotaxis was RPMI plus 0.5% FBS, 0.5 mM sodium pyruvate and 0.5% BSA.
- Serial diluted concentrations of mAbs were pre-incubated with the activated T cells (O.lxlO 6 cells in 25 ⁇ of the assay buffer) at room temperature for 20 min.
- the SARI 13244 antibody used as a control in the assay is a Sanofi antibody expressed as an IgGl.
- A12 EGTTVTVSS SEQ ID NO. 33 34 QVQLVESGGGLVKPGGSLRLSCAASGFTFSDYYMV LPVLTQSPSASGTPGQRVTISCSGSSSNIGSN WVRRSPGKGLEWISYISSSGGTIIYADSVKGRFTISRH YVYWYQQLPGTAPKLLIYRNNQRPSGVPDR NSENTLYLQMNSLRAEDTAVYYCATRSKGHALDVW FSGSKSGTSASLAISGLQPEDEAYYYCASWD
- E7 DVWGQGTMVTVSS SEQ ID NO. 58
- SYRSRSTLVFGGGTQLTVL SEQ ID NO. 59
- A4 GQGTTVTVSS SEQ ID NO. 82 DSS LSAG VFGG GTKVTVL SEQ ID NO. 83
- E4 PDYWGQGTLVTVSS SEQ ID NO. 114 SYTSSSTLVFGGGTKLTVL SEQ ID NO. 140
- G9 GQGTTVTVSS SEQ ID NO. 147 S I N TVVFG G GTQLTVL SEQ ID NO. 148
- E5 WGQGTLVTVSS SEQ ID NO. 149 TSRAVVFGGGTKLTVL SEQ ID NO. 150
- QVQLVESG G G VVQP G M S LRLS CAAS GFTFSSHAM DIVMTQTPLSLPVTPGEPASISCRSSQSLLHK HWVRQAPGKGLEWVAQIWSDGSNRYYSDSVKGR NGNNYLDWYLQRPGQSPQLLIYLASN RASG FTISRDQSKNTVSLQMNSLRAEDTAVYFCARDGQS VPDRFSGSGSGTDFTLEIS RVQP E DVG VYYC MAPYAMDVWGQGTMVTVSS SEQ ID NO. 151 MQGLQTPTFGPGTKVEIK SEQ ID NO. 152
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Veterinary Medicine (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Immunology (AREA)
- Virology (AREA)
- Biomedical Technology (AREA)
- Neurology (AREA)
- Neurosurgery (AREA)
- Molecular Biology (AREA)
- Oncology (AREA)
- Diabetes (AREA)
- Communicable Diseases (AREA)
- Pulmonology (AREA)
- Tropical Medicine & Parasitology (AREA)
- Hematology (AREA)
- Dermatology (AREA)
- Biochemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Endocrinology (AREA)
- Pain & Pain Management (AREA)
- Heart & Thoracic Surgery (AREA)
- Rheumatology (AREA)
- Psychiatry (AREA)
- Psychology (AREA)
- Cardiology (AREA)
- Urology & Nephrology (AREA)
Abstract
Description
Claims
Priority Applications (13)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
AU2015305850A AU2015305850A1 (en) | 2014-08-22 | 2015-08-12 | Antigen binding proteins that bind CXCR5 |
KR1020177007944A KR20170068450A (en) | 2014-08-22 | 2015-08-12 | Antigen binding proteins that bind cxcr5 |
EP15833683.4A EP3183001A4 (en) | 2014-08-22 | 2015-08-12 | Antigen binding proteins that bind cxcr5 |
MX2017002381A MX2017002381A (en) | 2014-08-22 | 2015-08-12 | Antigen binding proteins that bind cxcr5. |
SG11201701375TA SG11201701375TA (en) | 2014-08-22 | 2015-08-12 | Antigen binding proteins that bind cxcr5 |
EA201790438A EA201790438A1 (en) | 2014-08-22 | 2015-08-12 | ANTIGEN-BINDING PROTEINS THAT CONNECT WITH CXCR5 |
JP2017510481A JP2017525710A (en) | 2014-08-22 | 2015-08-12 | Antigen binding protein that binds to CXCR5 |
BR112017003472A BR112017003472A2 (en) | 2014-08-22 | 2015-08-12 | antibodies, antibody fab fragment and method for treating an inflammatory disease |
CN201580056533.4A CN107148281A (en) | 2014-08-22 | 2015-08-12 | With reference to CXCR5 antigen-binding proteins |
CA2958674A CA2958674A1 (en) | 2014-08-22 | 2015-08-12 | Antigen binding proteins that bind cxcr5 |
IL250631A IL250631A0 (en) | 2014-08-22 | 2017-02-15 | Antigen binding proteins that bind cxcr5 |
PH12017500331A PH12017500331A1 (en) | 2014-08-22 | 2017-02-22 | Antigen binding proteins that bind cxcr5 |
ZA2017/01912A ZA201701912B (en) | 2014-08-22 | 2017-03-17 | Antigen binding proteins that bind cxcr5 |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201462041017P | 2014-08-22 | 2014-08-22 | |
US62/041,017 | 2014-08-22 |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2016028573A1 true WO2016028573A1 (en) | 2016-02-25 |
Family
ID=55347734
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2015/044926 WO2016028573A1 (en) | 2014-08-22 | 2015-08-12 | Antigen binding proteins that bind cxcr5 |
Country Status (16)
Country | Link |
---|---|
US (2) | US9765146B2 (en) |
EP (1) | EP3183001A4 (en) |
JP (1) | JP2017525710A (en) |
KR (1) | KR20170068450A (en) |
CN (1) | CN107148281A (en) |
AU (1) | AU2015305850A1 (en) |
BR (1) | BR112017003472A2 (en) |
CA (1) | CA2958674A1 (en) |
EA (1) | EA201790438A1 (en) |
IL (1) | IL250631A0 (en) |
MA (1) | MA40527A (en) |
MX (1) | MX2017002381A (en) |
PH (1) | PH12017500331A1 (en) |
SG (1) | SG11201701375TA (en) |
WO (1) | WO2016028573A1 (en) |
ZA (1) | ZA201701912B (en) |
Cited By (8)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2018114804A1 (en) * | 2016-12-21 | 2018-06-28 | Bayer Pharma Aktiengesellschaft | Specific antibody drug conjugates (adcs) having ksp inhibitors |
WO2018172465A1 (en) * | 2017-03-22 | 2018-09-27 | Sanofi | Treatment of lupus using humanized anti-cxcr5 antibodies |
US20190169283A1 (en) * | 2017-12-01 | 2019-06-06 | Pfizer Inc. | Anti-cxcr5 antibodies and compositions and uses thereof |
JP2020514386A (en) * | 2017-03-22 | 2020-05-21 | サノフイSanofi | Treatment of lupus using humanized anti-CXCR5 antibody |
US11001636B2 (en) | 2016-06-15 | 2021-05-11 | Bayer Pharma Aktiengesellschaft | Specific antibody-drug-conjugates (ADCs) with KSP inhibitors and anti-CD123-antibodies |
US11478554B2 (en) | 2016-12-21 | 2022-10-25 | Bayer Pharma Aktiengesellschaft | Antibody drug conjugates (ADCS) having enzymatically cleavable groups |
WO2023014210A1 (en) * | 2021-08-02 | 2023-02-09 | Latvijas Universitate | A device for detection of gastric cancer |
RU2798422C2 (en) * | 2017-12-01 | 2023-06-22 | Пфайзер Инк. | Antibodies against cxcr5, their compositions and use |
Families Citing this family (6)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP3183001A4 (en) | 2014-08-22 | 2018-01-17 | Sorrento Therapeutics, Inc. | Antigen binding proteins that bind cxcr5 |
CN109503712B (en) * | 2018-12-12 | 2021-06-01 | 广州市第八人民医院 | Monoclonal antibody ZKns2E11 and application thereof |
CA3136840A1 (en) * | 2019-04-15 | 2020-10-22 | Targinta Ab | Integrin alpha10 and aggressive cancer forms |
WO2023010483A1 (en) * | 2021-08-05 | 2023-02-09 | Hifibio (Hk) Limited | Anti-human cxcr5 antibody and uses thereof |
WO2022169825A1 (en) | 2021-02-03 | 2022-08-11 | Mozart Therapeutics, Inc. | Binding agents and methods of using the same |
WO2023076876A1 (en) | 2021-10-26 | 2023-05-04 | Mozart Therapeutics, Inc. | Modulation of immune responses to viral vectors |
Citations (7)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20050180977A1 (en) * | 2003-08-14 | 2005-08-18 | Dendreon Corp. | Endotheliase-2 ligands |
US20070004910A1 (en) * | 2004-08-03 | 2007-01-04 | Sexton Daniel J | HK1-binding proteins |
US20080267974A1 (en) * | 2007-04-10 | 2008-10-30 | Vaccinex, Inc. | Selection of Human TNFAlpha Specific Antibodies |
US20100196265A1 (en) * | 2006-11-21 | 2010-08-05 | Adams Gregory P | Anti-egfr family antibodies, bispecific anti-egfr family antibodies and methods of use thereof |
WO2012010582A1 (en) * | 2010-07-21 | 2012-01-26 | Roche Glycart Ag | Anti-cxcr5 antibodies and methods of use |
US8263073B2 (en) * | 2008-02-04 | 2012-09-11 | Medarex, Inc. | Anti-CTLA-4 antibodies with reduced blocking of binding of CTLA-4 to B7 and uses thereof |
US20130209481A1 (en) * | 2010-07-22 | 2013-08-15 | The Regents Of The University Of California | Anti-Tumor Antigen Antibodies and Methods of Use |
Family Cites Families (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US8512701B2 (en) * | 2002-11-15 | 2013-08-20 | Morehouse School Of Medicine | Anti-CXCL13 and anti-CXCR5 antibodies for the prevention and treatment of cancer and cancer cell migration |
TW200813086A (en) * | 2006-05-11 | 2008-03-16 | Hoffmann La Roche | Immunereconstituted mouse |
EP3354662B1 (en) * | 2007-08-29 | 2020-08-19 | Sanofi | Humanized anti-cxcr5 antibodies, derivatives thereof and their uses |
EP3183001A4 (en) | 2014-08-22 | 2018-01-17 | Sorrento Therapeutics, Inc. | Antigen binding proteins that bind cxcr5 |
-
2015
- 2015-08-12 EP EP15833683.4A patent/EP3183001A4/en not_active Withdrawn
- 2015-08-12 EA EA201790438A patent/EA201790438A1/en unknown
- 2015-08-12 WO PCT/US2015/044926 patent/WO2016028573A1/en active Application Filing
- 2015-08-12 CN CN201580056533.4A patent/CN107148281A/en not_active Withdrawn
- 2015-08-12 SG SG11201701375TA patent/SG11201701375TA/en unknown
- 2015-08-12 MA MA040527A patent/MA40527A/en unknown
- 2015-08-12 BR BR112017003472A patent/BR112017003472A2/en not_active Application Discontinuation
- 2015-08-12 MX MX2017002381A patent/MX2017002381A/en unknown
- 2015-08-12 AU AU2015305850A patent/AU2015305850A1/en not_active Abandoned
- 2015-08-12 JP JP2017510481A patent/JP2017525710A/en not_active Withdrawn
- 2015-08-12 KR KR1020177007944A patent/KR20170068450A/en unknown
- 2015-08-12 US US14/825,144 patent/US9765146B2/en active Active
- 2015-08-12 CA CA2958674A patent/CA2958674A1/en not_active Abandoned
-
2017
- 2017-02-15 IL IL250631A patent/IL250631A0/en unknown
- 2017-02-22 PH PH12017500331A patent/PH12017500331A1/en unknown
- 2017-03-17 ZA ZA2017/01912A patent/ZA201701912B/en unknown
- 2017-08-10 US US15/674,401 patent/US10479837B2/en active Active
Patent Citations (7)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20050180977A1 (en) * | 2003-08-14 | 2005-08-18 | Dendreon Corp. | Endotheliase-2 ligands |
US20070004910A1 (en) * | 2004-08-03 | 2007-01-04 | Sexton Daniel J | HK1-binding proteins |
US20100196265A1 (en) * | 2006-11-21 | 2010-08-05 | Adams Gregory P | Anti-egfr family antibodies, bispecific anti-egfr family antibodies and methods of use thereof |
US20080267974A1 (en) * | 2007-04-10 | 2008-10-30 | Vaccinex, Inc. | Selection of Human TNFAlpha Specific Antibodies |
US8263073B2 (en) * | 2008-02-04 | 2012-09-11 | Medarex, Inc. | Anti-CTLA-4 antibodies with reduced blocking of binding of CTLA-4 to B7 and uses thereof |
WO2012010582A1 (en) * | 2010-07-21 | 2012-01-26 | Roche Glycart Ag | Anti-cxcr5 antibodies and methods of use |
US20130209481A1 (en) * | 2010-07-22 | 2013-08-15 | The Regents Of The University Of California | Anti-Tumor Antigen Antibodies and Methods of Use |
Non-Patent Citations (1)
Title |
---|
See also references of EP3183001A4 * |
Cited By (16)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US11643469B2 (en) | 2016-06-15 | 2023-05-09 | Bayer Pharma Aktiengesellschaft | Specific antibody-drug-conjugates (ADCs) with KSP inhibitors and anti-CD123-antibodies |
US11001636B2 (en) | 2016-06-15 | 2021-05-11 | Bayer Pharma Aktiengesellschaft | Specific antibody-drug-conjugates (ADCs) with KSP inhibitors and anti-CD123-antibodies |
US11478554B2 (en) | 2016-12-21 | 2022-10-25 | Bayer Pharma Aktiengesellschaft | Antibody drug conjugates (ADCS) having enzymatically cleavable groups |
WO2018114804A1 (en) * | 2016-12-21 | 2018-06-28 | Bayer Pharma Aktiengesellschaft | Specific antibody drug conjugates (adcs) having ksp inhibitors |
US11660351B2 (en) | 2016-12-21 | 2023-05-30 | Bayer Aktiengesellschaft | Antibody drug conjugates (ADCs) having enzymatically cleavable groups |
US11433140B2 (en) | 2016-12-21 | 2022-09-06 | Bayer Pharma Aktiengesellschaft | Specific antibody drug conjugates (ADCs) having KSP inhibitors |
WO2018172465A1 (en) * | 2017-03-22 | 2018-09-27 | Sanofi | Treatment of lupus using humanized anti-cxcr5 antibodies |
US10842869B2 (en) | 2017-03-22 | 2020-11-24 | Sanofi | Method of treating lupus by administering humanized anti-CXCR5 (C-X-C motif chemokine receptor 5) antibodies |
JP2020514386A (en) * | 2017-03-22 | 2020-05-21 | サノフイSanofi | Treatment of lupus using humanized anti-CXCR5 antibody |
CN111615520A (en) * | 2017-12-01 | 2020-09-01 | 辉瑞大药厂 | anti-CXCR 5 antibodies and compositions and uses thereof |
US10875915B2 (en) | 2017-12-01 | 2020-12-29 | Pfizer Inc. | Anti-CXCR5 antibodies and compositions and uses thereof |
WO2019108639A1 (en) | 2017-12-01 | 2019-06-06 | Pfizer Inc. | Anti-cxcr5 antibodies and compositions and uses thereof |
US20190169283A1 (en) * | 2017-12-01 | 2019-06-06 | Pfizer Inc. | Anti-cxcr5 antibodies and compositions and uses thereof |
RU2798422C2 (en) * | 2017-12-01 | 2023-06-22 | Пфайзер Инк. | Antibodies against cxcr5, their compositions and use |
US11958901B2 (en) | 2017-12-01 | 2024-04-16 | Pfizer Inc. | Anti-CXCR5 antibodies and compositions and uses thereof |
WO2023014210A1 (en) * | 2021-08-02 | 2023-02-09 | Latvijas Universitate | A device for detection of gastric cancer |
Also Published As
Publication number | Publication date |
---|---|
MA40527A (en) | 2017-06-28 |
AU2015305850A1 (en) | 2017-04-06 |
EA201790438A1 (en) | 2017-08-31 |
US9765146B2 (en) | 2017-09-19 |
BR112017003472A2 (en) | 2018-01-30 |
CA2958674A1 (en) | 2016-02-25 |
IL250631A0 (en) | 2017-04-30 |
US20160053014A1 (en) | 2016-02-25 |
CN107148281A (en) | 2017-09-08 |
KR20170068450A (en) | 2017-06-19 |
JP2017525710A (en) | 2017-09-07 |
US10479837B2 (en) | 2019-11-19 |
PH12017500331A1 (en) | 2017-07-17 |
MX2017002381A (en) | 2017-09-15 |
US20170342156A1 (en) | 2017-11-30 |
SG11201701375TA (en) | 2017-03-30 |
EP3183001A4 (en) | 2018-01-17 |
ZA201701912B (en) | 2018-05-30 |
EP3183001A1 (en) | 2017-06-28 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US10479837B2 (en) | Methods for treating subjects having a CXC chemokine receptor 5 (CXCR5)-responsive cancer by administering fully human anti-CXCR5 antibodies | |
US20240190959A1 (en) | Antigen Binding Proteins that Bind PD-L1 | |
US10696746B2 (en) | Antigen binding proteins that bind CCR2 | |
US10668148B2 (en) | Fully human anti-C-X-C chemokine receptor 3 (CXCR3) antibodies and methods of use thereof | |
US10301386B2 (en) | Antibody therapeutics that bind CD147 | |
US10100126B2 (en) | Antibody therapeutics that bind PSMA | |
EP2850105A2 (en) | Antigen binding proteins that bind egfr |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 15833683 Country of ref document: EP Kind code of ref document: A1 |
|
WWE | Wipo information: entry into national phase |
Ref document number: 250631 Country of ref document: IL |
|
ENP | Entry into the national phase |
Ref document number: 2958674 Country of ref document: CA |
|
ENP | Entry into the national phase |
Ref document number: 2017510481 Country of ref document: JP Kind code of ref document: A |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2017/002381 Country of ref document: MX Ref document number: 12017500331 Country of ref document: PH |
|
REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112017003472 Country of ref document: BR |
|
REEP | Request for entry into the european phase |
Ref document number: 2015833683 Country of ref document: EP |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2015833683 Country of ref document: EP |
|
WWE | Wipo information: entry into national phase |
Ref document number: 201790438 Country of ref document: EA |
|
ENP | Entry into the national phase |
Ref document number: 20177007944 Country of ref document: KR Kind code of ref document: A |
|
ENP | Entry into the national phase |
Ref document number: 2015305850 Country of ref document: AU Date of ref document: 20150812 Kind code of ref document: A |
|
ENP | Entry into the national phase |
Ref document number: 112017003472 Country of ref document: BR Kind code of ref document: A2 Effective date: 20170221 |