WO2015186988A1 - Method for decreasing immunogenicity of protein and peptide - Google Patents

Method for decreasing immunogenicity of protein and peptide Download PDF

Info

Publication number
WO2015186988A1
WO2015186988A1 PCT/KR2015/005651 KR2015005651W WO2015186988A1 WO 2015186988 A1 WO2015186988 A1 WO 2015186988A1 KR 2015005651 W KR2015005651 W KR 2015005651W WO 2015186988 A1 WO2015186988 A1 WO 2015186988A1
Authority
WO
WIPO (PCT)
Prior art keywords
peptide
exendin
protein
physiologically active
factor
Prior art date
Application number
PCT/KR2015/005651
Other languages
French (fr)
Inventor
Sung Hee Park
Seung Su Kim
Hyung Kyu Lim
Jae Hyuk Choi
In Young Choi
Se Chang Kwon
Original Assignee
Hanmi Pharm. Co., Ltd.
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to EA201692279A priority Critical patent/EA035964B1/en
Priority to UAA201611826A priority patent/UA124183C2/en
Priority to AU2015269039A priority patent/AU2015269039B2/en
Priority to JP2016570961A priority patent/JP7125249B2/en
Priority to EP15802343.2A priority patent/EP3152236A4/en
Priority to MYPI2016002124A priority patent/MY193519A/en
Priority to BR112016028227A priority patent/BR112016028227A2/en
Application filed by Hanmi Pharm. Co., Ltd. filed Critical Hanmi Pharm. Co., Ltd.
Priority to SG11201610098YA priority patent/SG11201610098YA/en
Priority to EP23161874.5A priority patent/EP4219565A1/en
Priority to HU1700024A priority patent/HUP1700024A2/en
Priority to US15/315,992 priority patent/US20170100488A1/en
Priority to CA2950576A priority patent/CA2950576A1/en
Priority to MX2016015668A priority patent/MX2016015668A/en
Priority to CN201580030057.9A priority patent/CN106661118A/en
Publication of WO2015186988A1 publication Critical patent/WO2015186988A1/en
Priority to IL249131A priority patent/IL249131A0/en
Priority to PH12016502430A priority patent/PH12016502430A1/en
Priority to NO20161980A priority patent/NO20161980A1/en
Priority to US17/566,368 priority patent/US20220118103A1/en

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/46Hybrid immunoglobulins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/22Hormones
    • A61K38/26Glucagons
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/22Hormones
    • A61K38/28Insulins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/39Medicinal preparations containing antigens or antibodies characterised by the immunostimulating additives, e.g. chemical adjuvants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39591Stabilisation, fragmentation
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/56Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule
    • A61K47/59Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes
    • A61K47/60Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes the organic macromolecular compound being a polyoxyalkylene oligomer, polymer or dendrimer, e.g. PEG, PPG, PEO or polyglycerol
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/06Immunosuppressants, e.g. drugs for graft rejection
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K19/00Hybrid peptides, i.e. peptides covalently bound to nucleic acids, or non-covalently bound protein-protein complexes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/30Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto

Definitions

  • the present invention relates to a method for increasing serum half-life of a protein or peptide and decreasing immunogenicity thereof by site-specifically binding a carrier to a protein or peptide, and to the use thereof.
  • Immune responses to biological therapeutic agents can be widely induced for both non-human and human-derived proteins. These responses may weaken clinical effects, limit the efficacy, and sometimes lead to pathological diseases or even cause the death of the patient.
  • the production of neutralizing antibodies that target the recombinant self-protein may induce a cross-reaction with the protein inherent in the body of the patient and thus lead to serious consequences (see, Lim LC. Hematology 2005 10(3):255-9). Problems of biopharmaceuticals such as monoclonal antibodies were greatly reduced with the development of molecular biology.
  • Factors for immunogenicity include dosage, frequency and route of administration, immunomodulatory ability of protein drugs, their preparation and the like. The most important factor to induce the immune response is whether there is an antigen recognition site (epitope) that can effectively stimulate a CD4 + T cell response (reviewed Baker MP and Jones TD. Curr . Opin. Drug Disc Dev 2007 10(2):219-227).
  • exendin-4 is a natural peptide discovered in the salivary gland of the Gila monster lizard and has a 52% sequence similarity with human GLP-1 (glucagon-like peptide-1). Exendin-4 and GLP-1 have a similar insulin secretion function. However, GLP-1 is rapidly deactivated by dipeptidyl peptidase-IV (DPP-IV), thus having a very short half-life, whereas exendin-4 keeps the resistance to DPP-IV by glycine being present instead of alanine in the second amino acid sequence and thus can be more effective as a therapeutic agent of type II diabetes.
  • DPP-IV dipeptidyl peptidase-IV
  • insulin or analogs thereof, and dual agonists of GLP-1/glucagon are also used as therapeutic agents for diabetes and obesity.
  • the presence of these non-human amino acid sequences can act as an antigen recognition site of T cells.
  • Exenatide (Byetta) which was approved as therapeutic agents of type II diabetes as synthetic exendin-4 has produced an antibody to exenatide for more than 30% of patients who received administration of exenatide for one year in clinical trials.
  • Lixisenatide approved recently, has produced an antibody for about 60-71% of patients (see, Zinman, B. et al., Annals of Internal Medicines .
  • physiologically active protein or peptide which has been administered within the body for the purpose of treatment or prevention for a long period of time, it is important to control the immunogenicity.
  • adult disease-related physiologically active proteins or peptides such as insulin or insulinotropic peptide and anti-obesity protein have often been developed as as long-acting formulations capable of lasting in the body after administration.
  • insulin or insulinotropic peptide and anti-obesity protein have often been developed as as long-acting formulations capable of lasting in the body after administration.
  • insulin or insulinotropic peptide and anti-obesity protein have often been developed as as long-acting formulations capable of lasting in the body after administration.
  • insulin or insulinotropic peptide and anti-obesity protein have often been developed as as long-acting formulations capable of lasting in the body after administration.
  • insulin or insulinotropic peptide and anti-obesity protein have often been developed as as long-acting formulations capable of lasting in the body after administration.
  • the present inventors have conducted numerous studies and experiments to develop pharmaceutical formulations of a protein or peptide which do not induce an immune response. As a result, the inventors have discovered that, when a carrier site-specifically binds to a protein or peptide, the immunogenicity can be decreased as compared to that of a protein or peptide to which the carrier has not been bound, thus completing the present invention.
  • One object of the present inveniton is to provide a method for decreasing immunogenicity of physiologically active proteins or peptides.
  • Another object of the present invention is to provide a composition, comprising a conjugate of a physiologically active protein or peptide in which a carrier is bound to the non-terminal, internal residue of a physiologically active protein or peptide, via a non-peptidyl linker.
  • Another object of the present invention is to provide a method for preparing the conjugate of the physiologically active protein or peptide, in which the carrier is bound to the non-terminal, internal residue of the physiologically active protein or peptide.
  • the present invention provides a method for decreasing immunogenicity of a physiologically active protein or peptide as compared to that of a physiologically active protein or peptide to which a carrier is not bound, which comprises binding a carrier to the non-terminal, internal residue of the physiologically active protein or peptide.
  • the above carrier is characterized in that it is selected from the group consisting of a polyethylene glycol, a fatty acid, a cholesterol, an albumin or a fragment thereof, an albumin-binding substance, a polymer having repeating units of a particular amino acid sequence, an antibody, an antibody fragment, an FcRn binding substance, an in- vivo connective tissue or a derivative thereof, a nucleotide, a fibronectin, a transferrin, an elastin-like polypeptide(ELP), an XTEN polypeptide, a carboxy-terminal peptide (CTP), a structure inducing probe (SIP), a saccharide and a high molecular weight polymer.
  • a polyethylene glycol a fatty acid, a cholesterol, an albumin or a fragment thereof, an albumin-binding substance, a polymer having repeating units of a particular amino acid sequence, an antibody, an antibody fragment, an FcRn binding substance, an in- vivo connect
  • the FcRn binding substance is characterized in that it includes an immunoglobulin Fc region.
  • physiologically active protein or peptide and the carrier are characterized by being bound via a linker interposed therebetween.
  • the linker is characterized in that it is a non-peptidyl linker.
  • the non-peptidyl linker is characterized in that it is selected from the group consisting of a polyethylene glycol, a polypropylene glycol, an ethylene glycol-propylene glycol copolymer, a polyoxyethylated polyol, a polyvinyl alcohol, a polysaccharide, a dextran, a polyvinyl ethyl ether, a biodegradable polymer, a lipid polymer, a chitin, a hyaluronic acid and a combination thereof.
  • the physiologically active protein or peptide is bound to an immunoglobulin Fc region via a non-peptidyl polymer which is selected from the group consisting of a polyethylene glycol, a polypropylene glycol, an ethylene glycol-propylene glycol copolymer, a polyoxyethylated polyol, a polyvinyl alcohol, a polysaccharide, a dextran, a polyvinyl ethyl ether, a biodegradable polymer, a lipid polymer, a chitin, a hyaluronic acid and a combination thereof.
  • a non-peptidyl polymer which is selected from the group consisting of a polyethylene glycol, a polypropylene glycol, an ethylene glycol-propylene glycol copolymer, a polyoxyethylated polyol, a polyvinyl alcohol, a polysaccharide, a dextran, a polyvinyl eth
  • the physiologically active protein or peptide is characterized in that it is selected from the group consisting of an anti-obesity peptide, an insulinotropic peptide or an analog thereof, a leptin, an insulin, an insulin analog, a glucagon, a human growth hormone, a growth hormone releasing hormone, a growth hormone releasing peptide, an interferon, an interferon receptor, a colony stimulating factor, a glucagon-like peptide such as GLP-1, a GLP-1/glucagon dual agonist, a gastric inhibitory polypeptide (GIP), a G-protein-coupled receptor, an interleukin, an interleukin receptor, an enzyme, an interleukin binding protein, a cytokine binding protein, a macrophage activating factor, a macrophage peptide, a B cell factor, a T cell factor, a protein A, an allergy inhibitory factor, a cell necrosis glycoprotein, an immuno
  • the physiologically active protein or peptide is characterized in that it is selected from the group consisting of an exendin-4, an exendin-4 derivative, a GLP-1 agonist, an insulin and a GLP-1/glucagon dual agonist.
  • the exendin-4 derivative is characterized in that it is an exendin-4 derivative in which the charge on the N-terminal of exendin-4 is modified, which is selected from the group consisting of an exendin-4 derivative in which N-terminal amine group of exendin-4 is deleted, an exendin-4 derivative in which N-terminal amine group of exendin-4 is substituted with hydroxl group, an exendin-4 derivative in which N-terminal amine group of exendin-4 is substituted with carboxly group, an exendin-4 derivative in which N-terminal amine group of exendin-4 is modified with dimethyl group, and an exendin-4 derivative in which alpha carbon of N-terminal histidine residue of exendin-4 is deleted.
  • the above-described internal residue is characterized in that it is a lysine residue at position 12 or 27 of the exendin-4 derivative in which N-terminal charge of exendin-4 is modified.
  • the above-described internal residue is characterized in that it is a lysine residue at position 27 of the exendin-4 derivative in which N-terminal charge of exendin-4 is modified.
  • the exendin-4 derivative in which the charge on the N-terminal of the exendin-4 is changed is characterized in that it is an exendin-4 derivative in which alpha carbon of N-terminal histidine residue of exendin-4 is deleted.
  • the preset the present invention provides a composition, comprising a conjugate of a physiologically active protein or peptide in which a carrier is bound to the non-terminal, internal residue of a physiologically active protein or peptide, via a non-peptidyl linker, wherein the conjugate exhibits decreased immunogenicity as compared to that of the physiologically active protein or peptide to which the carrier is not bound.
  • the above-described conjugate is characterized in that it has decreased immunogenicity, which is a side effect of a long-acting preparation.
  • the non-peptidyl linker is characterized in that it is a polyethylene glycol.
  • the present invention provides a method for preparing the conjugate of the physiologically active protein or peptide, in which the carrier is bound to the non-terminal, internal residue of the physiologically active protein or peptide.
  • the physiologically active protein or peptide conjugate of the present invention can significantly decrease immunogenicity in the human body and thus reduce antibody production rate against proteins or peptides. Therefore, the present conjugate has advantages in that the phenomenon of reduced clinical effects of the physiologically active protein or peptide is low, and it can be effectively used in the development of long-acting formulations having a high safety against the immune response.
  • Figure 1 is a diagram showing a comparison of HLA-DR genotype frequency of a donor in the ex vivo T cell activity test with that of the population in the world, Europe and North America.
  • the present invention relates to a method for decreasing the immunogenicity of a physiologically active protein or peptide compared to that of the protein or peptide to which a carrier has not been bound, which comprises a step of binding a carrier to the non-terminal, internal residue of the physiologically active protein or peptide.
  • the inventors have discovered a method for decreasing the immunogenicity of a physiologically active protein or peptide in which a non-peptide linker and Fc fragment are bound to the internal residue rather than the terminal of a physiologically active protein or peptide, thus inhibiting the mechanism in which the desired protein or peptide acts as an antigen.
  • the inventors have identified that, in the case of using the method as described above, the activation of T cells and the antibody production reaction in animals is significantly inhibited compared with the method for preparing a conjugate by the modification at other sites such as N-terminal of the peptide.
  • the physiologically active protein or peptide conjugate used as a conventional protein pharmaceutical preparation has a novel use as the composition and method for deacreasing the immunogenicity of a physiologically active protein or peptide.
  • the decrease of immunogenicity in the body can be measured without limitation by a known method.
  • the difference in immunogenicity can be confirmed by the ex- vivo activity measurement method of T cells which comprises coupling each of the carriers to the N-terminal or the sites other than the N-terminal including the C-terminal.
  • Aldehyde reactive group selectively reacts with the N-terminal at a low pH, and also it can form a covalent bond with a lysine residue at the condition of high pH, for example pH 9.0.
  • the pegylation reaction is conducted while changing the reaction pH, and then positional isomers can be separated from the reaction mixture using an ion exchange column.
  • a reactive thiol group can be introduced to an amino acid residue position to be modified, thus forming a covalent bond between the protein or peptide and a maleimide group of the non-peptidyl polymer.
  • an amine group is introduced to an amino acid residue position to be modified, thus forming a covalent bond between the protein or peptide and an aldehyde group of the non-peptidyl polymer.
  • the method of protection of the N-terminal end includes methylation, deamination or acetylation in addition to dimethylation, but is not limited thereto.
  • physiologically active protein or peptide refers to a protein or peptide that can control the genetic expression or physiological function.
  • the physiologically active protein or peptide can be included, without limitation, in the scope of the present invention, as long as a carrier is bound to the non-terminal, internal residue of the physiologically active protein or peptide according to the present invention, thus exhibiting descresed immunogenicity compared to that of the protein or peptide to which a carrier is not bound.
  • the carrier can be bound via a linker, specifically a non-peptidyl linker, to a physiologically active protein or peptide.
  • physiologically active protein or peptide includes, in addition to native biologically active protein or peptide, derivatives, variants, or fragments thereof.
  • physiologically active protein or peptide examples include an anti-obesity peptide, an insulinotropic peptide or an analog thereof, a leptin, an insulin, an insulin analog, a glucagon, a human growth hormone, a growth hormone releasing hormone, a growth hormone releasing peptide, an interferon, an interferon receptor, a colony stimulating factor, a glucagon-like peptide (GLP-1, etc.), a GLP-1/glucagon dual agonist, a gastric inhibitory polypeptide (GIP), a G-protein-coupled receptor, an interleukin, an interleukin receptor, an enzyme, an interleukin binding protein, a cytokine binding protein, a macrophage activating factor, a macrophage peptide, a B cell factor, a T cell factor, a protein A, an allergy inhibitory factor, a cell necrosis glycoprotein, an immunotoxin, a lymphotoxin, a tumor necros
  • physiologically active protein or peptide may include an insulin, an insulinotropic peptide, or a GLP-1/glucagon dual agonist, but is not limited thereto.
  • the term "insulin" includes all peptides or modified peptides which have a stimulating effect on insulin receptors.
  • the insulin may be, for example, a native insulin, a rapid-acting insulin, a basal insulin, an insulin analog in which any amino acids of the native insulin is changed by any one method selected from substitution, addition, deletion, and modification, or a combination of these methods, or may be a fragment thereof.
  • the insulin used in the present invention may be a long-acting insulin to which long-acting techniques applied to overcome the short half-life.
  • the insulin may be a long-acting insulin or a long-acting insulin analog which can be administered once a week, but is not limited thereto.
  • Some specific examples of the insulin according to the present invention include an insulin or an insulin analog and its long-acting type as disclosed in Korean Patent No. 10-1058290 (or International Publication WO 2008-082274) or Korean Patent Application Publication No. 2014-0106452 (or International Publication WO 2014-133324), the entire contents of which are incorporated herein by reference, but are not limited thereto.
  • insulin analog refers to a substance which retains the same function of controlling the blood glucose level in vivo as a native insulin.
  • the insulin analogs include those in which one or more amino acids in the native insulin sequence have been modified.
  • the insulin analog may be an insulin analog in which A-chain or B-chain amino acid of native insulin is changed.
  • the native insulin amino acid sequence is as follows.
  • At least one amino acid in the native insulin may have a modififation selected from the group consisting of substitution, addition, deletion, modification and a combination thereof, but are not limited thereto.
  • amino acids that are normally observed in a human protein as well as atyhpical or non-naturally occurring amino acids can be used.
  • the commercial sources of the atypical amino acids may include Sigma-Aldrich, ChemPep and Genzyme pharmaceuticals.
  • the peptides including such amino acids and a typical peptide sequence can be synthesized or purchased from commercial peptide synthesis companies, for example, American peptide company Inc., and Bachem (USA), or Anygen (Korea).
  • the above-described insulin analogs include an inverted insulin, an insulin variant, an insulin fragment, an insulin agonist, an insulin derivative and the like, and the preparation method thereof includes a genetic recombination as well as a solid phase method, but is not limited thereto.
  • insulin derivative shows an amino acid sequence homolgy with A-chain and B-chain of native insulin, while retaining the function to control the blood glucose level in the body, and includes a peptide form which may have some groups on the amino acid redidues chemically substituted (e.g., alpha-methylation, alpha-hydroxylation), deleted (e.g., deamination), or modified (e.g., N-methylation).
  • the insulin derivative includes a peptide mimic, and a low molecular or high molecular compound, which can bind with an insulin receptor to control blood glucose levels in the body, even without homology with a native insulin and an amino acid sequence.
  • insulin fragment refers to a fragment having one or more amino acids added or deleted in insulin.
  • the added amino acid may be an amino acid that is not present in the native state (e.g., D-type amino acid).
  • Such insulin fragment retains a function to control blood glucose levels in the body.
  • insulin variant is a peptide having one or more amino acid sequences different from those of insulin, and retaining a function to control blood glucose levels in the body.
  • the present invention includes a peptide which has one or more amino acid sequence different from those of native insulin, has deamination at the terminal amino acid residue, and retains a function to control blood glucose levels in the body, can be included.
  • agonists, derivatives, fragments and variants may be applied evewn to other types of proteins or peptides.
  • the insulin analogs may be those in which one or more amino acids selected from the group consisting of amino acids at position 1, amino acids at position 2, amino acids at position 3, amino acids at position 5, amino acids at position 8, amino acids at position 10, amino acids at position 12, amino acids at position 16, amino acids at position 23, amino acids at position 24, amino acids at position 25, amino acids at position 26, amino acids at position 27, amino acids at position 28, amino acids at position 29, amino acids at position 30 of the chain B; amino acids at position 1, amino acids at position 2, amino acids at position 5, amino acids at position 8, amino acids at position 10, amino acids at position 12, amino acids at position 14, amino acids at position 16, amino acids at position 17, amino acids at position 18, amino acids at position 19 and amino acids at position 21 of the chain A have been substituted with other amino acids, and more specifically those in which one or more amino acids selected from the group consisting of amino acids at position 8, amino acids at position 23, amino acids at position 24, amino acids at position 25 of the chain B; amino acids at position 1, amino acids at position 2, amino acids at position 14 and amino acids at position 19 of the chain A have been substituted with other
  • amino acids those in which one or more, two or more, three or more, four or more, five or more, six or more, seven or more, eight or more, nine or more, ten or more, 11 or more, 12 or more, 13 or more, 14 or more, more than 15, 16 or more, 17 or more, 18 or more, 19 or more, 20 or more, 21 or more, 22 or more, 23 or more, 24 or more, 25 or more, 26 or more, or 27 or more amino acids have been substituted with other amino acids may be used, but are not limited thereto.
  • amino acid residues at the above-described positions may be substituted with alanine, glutamic acid, asparagine, isoleucine, valine, glutamine, glycine, lysine, histidine, cysteine, phenylalanine, tryptophan, proline, serine, threonine, and/or aspartic acids.
  • insulinotropic peptide refers to a peptide that retains the function of secreting insulin.
  • the insulinotropic peptide may stimulate synthesis or expression of insulin in the beta cells of the pancreas.
  • the insulinotropic peptide is GLP (Glucagon like peptide)-1, exendin-3, or exendin-4, but is not limited thereto.
  • the insulinotropic peptide includes native insulinotropic peptides, precursors thereof, agonists thereof, derivatives thereof, fragments thereof, and variants thereof. Further, a combination thereof as previously described can be included.
  • GLP-1 is a hormone secreted by the small intestine, and generally promotes biosynthesis and secretion of insulin, inhibits glucagon secretion, and promotes glucose uptake by cells.
  • a glucagon precursor is decomposed into three peptides, that is, glucagon, GLP-1, and GLP-2.
  • the GLP-1 means GLP-1 (1-37), which is originally in the form having no insulinotropic function, but is then processed and converted into the activated GLP-1 (7-37) forms.
  • Exendin-4 refers to peptides having 39 amino acids, which show a 53% amino acid sequence homology with GLP-1.
  • the exendin-4 may have the following sequence, but is not limited thereto:
  • exendin-3 is a polypeptide having different amino acids at positions 2 and 3 from those of exendin-4.
  • Exendin-3 is that in which amino acids at positions 2 and 3 of exendin 4 are substituted with serine and aspartic acid, respectively, and it can be represented as Ser 2 Asp 3 -exendin-4(1-39).
  • the exendin-3 may have the following sequence, but is not limited thereto:
  • the above-described insulinotropic peptide derivative may be that in which N-terminus of the insulinotropic peptide has been modified. More specifically, the insulinotropic peptide derivative can cause a rapid dissociation of the receptor by changing the charge on the N-terminal, and it may be a derivative in which the positive charge on the N-terminal is changed to neutral or net negative charges.
  • the insulinotropic peptide derivative of the present invention may include a desamino-histidyl derivative where the N-terminal amino (or amine) group of insulinotropic peptide is deleted, beta-hydroxy imidazopropionyl-derivative where the amino group is substituted with a hydroxyl group, dimethyl-histidyl derivative where the amino group is modified with two methyl groups, beta-carboxyimidazopropionyl-derivative where the N-terminal amino group is substituted with a carboxyl group, or an imidazoacetyl-derivative where the alpha carbon of the N-terminal histidine residue is deleted to retain only the imidazoacetyl group and thus the positive charge of the amino group is removed, and other N-terminal amino group-modified derivatives are included within the scope of the present invention.
  • the insulinotropic peptide derivative may be a derivative in which N-terminal amino (or amine) group or amino acid residue of exendin-4 is chemically modified. Specifically, it is an exendin-4 derivative which is prepared by substituting or removing the alpha amino group present in the alpha carbon of the N-terminal histidine residue (the first amino acid) of exendin-4.
  • DA-Exendin-4 desamino-histidyl-exendin-4
  • HY-exendin-4 beta-hydroxy imidazopropyl-exendin-4
  • CX-exendin-4 beta-carboxy imidazopropyl-exendin-4
  • CA-exendin-4 imidazoacetyl-exendin-4 with removal of alpha carbon of N-terminal histidine residue, and the like.
  • the "GLP-1/glucagon dual agonist” includes peptides or fragments, precursors, variants or derivatives thereof which have GLP-1/glucagon dual activity, like oxyntomodulin, a native GLP-1/glucagon dual agonist.
  • the GLP-1/glucagon dual agonist may be a GLP-1/glucagon dual agonist to which the long-acting techniques applied to overcome the short half-life, and preferably a long-acting GLP-1/glucagon dual agonist which can be administered once a week, but is not limited thereto.
  • the GLP-1/glucagon dual agonist includes oxyntomodulin.
  • oxyntomodulin refers to a peptide produced from a pre-glucagon, a percursor of glucagon.
  • oxyntomodulin includes a native oxyntomodulin, a precursor thereof, a derivative thereof, a fragment thereof, a variant thereof and the like as previously described.
  • the oxyntomodulin may have specifically the amino acid sequence of HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA (SEQ ID NO: 5), but is not limited thereto.
  • the oxyntomodulin derivative includes a peptide, a peptide derivative or a peptide mimic that is prepared by the addition, deletion or substitution of any amino acid of sequences of oxyntomodulin and can activate both GLP-1 receptor and glucagon receptor, and particularly, can activate each receptor at a higher level compared to the level activated by native oxyntomodulin.
  • GLP-1/glucagon dual agonist examples include a GLP-1/glucagon dual agonist and its derivative or its long-acting type as disclosed in Korean Patent Application Publication Nos. 10-20125-01372771 (or International Publication WO 2012-169798) and 10-2012-01639579 (or International Publication WO 2012-173422), the entire contents of which are incorporated herein by reference.
  • the carrier that is bound to the physiological active protein or peptide may be a material which can increase the in vivo half-life of the physiological active protein or peptide.
  • physiologically active protein or peptide examples include various substances capable of reducing the renal clearance of the physiologically active protein or peptide, for example, a polyethylene glycol, a fatty acid, a cholesterol, an albumin or a fragment thereof, an albumin-binding substance, a polymer of repeating units of a particular amino acid sequence, an antibody, an antibody fragment, a FcRn binding substance, an in- vivo connective tissue or a derivative thereof, a nucleotide, a fibronectin, a transferrin, an elastin-like polypeptide(ELP), a XTEN polypeptide, a carboxy-terminal peptide (CTP), a structure inducing probe (SIP), a saccharide, a high molecular polymer, a particular amino acid sequence, a polymer of repeating units of a particular amino acid sequence, and the like.
  • the linkage between the physiologically active protein or peptide and the carrier includes a genetic recombination
  • the carrier may be covalently or non-covalently linked to the physiologically active protein or peptide.
  • the above described FcRn binding substance may be an immunoglobulin Fc region, for example, IgG Fc.
  • a Recode technique by Ambrx Inc. which enables a site-specific binding to polyethylene glycol may be used.
  • a glycopegylation technique by Neose company which enables a specific binding to the glycosylated moiety may be used.
  • a releasable PEG technique in which polyethylene glycol is slowly deleted in the body may be used, but is not limited thereto.
  • the techniques which can be used in the present invention include techniques which increase bioavailability using PEG.
  • non-peptidyl polymers such as polyethylene glycol, polypropylene glycol, ethylene glycol-propylene glycol copolymer, polyoxyethylated polyol, polyvinyl alcohol, polysaccharides, dextran, polyvinyl ethyl ether, biodegradable polymer, lipid polymer, chitins, or hyaluronic acid can also be bound to the physiologically active protein or peptide using the above described techniques.
  • the technique which can be used in the present invention includes a technique in which albumins or albumin fragments can be directly covalently linked to the physiologically active protein or peptide to increase the in vivo stability. Even if albumin is not directly linked, a technique in which the albumin binding materials, for example, albumin-specific binding antibody or antibody fragment are bound to the physiologically active protein or peptide to thereby bind to albumin can be used, and a technique in which a certain peptide/protein having a binding affinity to albumin is bound to the physiologically active protein or peptide can be used.
  • a technique in which a fatty acid having a binding affinity to albumin is bound to the physiologically active protein or peptide can be used, but is not limited thereto. Any technique or binding method which can increase the in vivo stability using albumin can be included here.
  • the technique for binding to the physiologically active protein or peptide by using the antibody or antibody fragment as a carrier in order to increase the in vivo half-life may also be included in the present invention.
  • the antibody or antibody fragment having a FcRn binding site can be used, and any antibody fragment containing no FcRn binding site such as Fab can be used.
  • CovX-body technique of CovX company using a catalytic antibody can be included herein, and the technique which increases the in vivo half-life using the immunoglobulin Fc region may be included in the present invention.
  • the linker binding to the Fc region and the physiologically active protein or peptide and its binding method may include a peptide bond or a polyethylene glycol or the like, but is not limited thereto and any chemical binding method may be available.
  • the binding ratio of the Fc region and the insulin analog may be 1:1 or 1:2, but is not limited thereto.
  • An immunoglobulin constant region including Fc region is a biodegradable polypeptide which can be metabolized in vivo , so that it can safely be used as a drug carrier.
  • an immunoglobulin Fc region is more advantageous in terms of production, purification and production yield of a complex than an entire immunoglobulin molecule owing to its relatively lower molecular weight.
  • the immunoglobulin Fc alone provides the complex with significantly enhanced homogeneity, and reduces the possibility of inducing blood antigenicity.
  • the aforementioned PEG is non-specifically bound to a specific site or various sites of the target peptide and thus increases the molecular weight of the peptide. Therefore, the PEG is effective in inhibiting the renal clearance and preventing hydrolysis and further it does not cause special side effects.
  • PEG when PEG is bound to an exogenous peptide, it can inhibit the recognition of antigenic sites being present in the exogenous peptide by the immune cells. Specifically, the PEG can inhibit the peptide to be phagocytosed by antigen presenting cell and proteolysed. Therefore, it is able to lower the potential for the peptide to act as an antigen.
  • the carrier and the physiologically active protein or peptide is connected via a linker, in particular, a non-peptidyl linker.
  • the non-peptidyl linker refers to a biocompatible polymer including two or more repeating units, the repeating units being bound with each other by any covalent bond excluding a peptide linkage.
  • the non-peptidyl linker may be interchangeably used with the non-peptidyl polymer.
  • the non-peptidyl linker useful in the present invention may be selected from the group consisting of a biodegradable polymer, a lipid polymer, a chitin, a hyaluronic acid, and a combination thereof.
  • the biodegradable polymer used herein may be polyethylene glycol, polypropylene glycol, ethylene glycol-propylene glycol copolymer, polyoxyethylatedpolyol, polyvinyl alcohol, polysaccharide, dextran, polyvinyl ethyl ether, polylactic acid (PLA) or polylactic-glycolic acid (PLGA).
  • the non-peptidyl polymer is polyethylene glycol.
  • derivatives thereof known in the art and derivatives easily prepared by a method known in the art may be included in the scope of the present invention.
  • the peptide linker which is used in the fused protein obtained by a conventional inframe fusion method has drawbacks in that it is easily cleaved in vivo by a proteolytic enzyme, and thus a sufficient effect of increasing the serum half-life of the active drug by a carrier cannot be obtained as expected.
  • the non-peptydyl polymer of the present invention is a substance that has no peptide linkage, it can have basically a resistance to the proteolytic enzyme, thus increasing the serum half-life of the peptide.
  • the molecular weight of the non-peptidyl polymer which can be used in the present invention ranges specifically from 1 to 100 kDa, and more specifically from 1 to 20 kDa.
  • the non-peptidyl polymer of the present invention, linked to the immunoglobulin Fc region may be one type of polymer or a combination of different types of polymers.
  • the carrier is characterized in that it is bound to a non-terminal internal residue of the physiologically active protein or peptide.
  • the carrier may be bound to the non-terminal internal residue of the physiologically active protein or peptide via a linker.
  • the non-terminal internal residue of the physiologically active protein or peptide may include, without limitation, any residue if it can, when a carrier is bound to the physiologically active protein or peptide, decrease the immunogenicity thereof, compared to that of a protein or peptide to which a carrier is not bound or a protein or peptide in which a carrier is bound to terminal site of the protein or peptide.
  • the non-terminal, internal amino acid of the physiologically active protein or peptide may be lysine, cysteine, or the like.
  • physiologically active protein or peptide is an insulinotropic peptide, particularly exendin-4 or a derivative of exendin-4
  • its internal residue may be lysine residues at positions 12 or 27, but is not limited thereto.
  • the N-terminal is reacted with an amine group in the lysine residue, and a modified form of insulinotropic peptide can be used to improve the reaction yield.
  • a reactive amine group can be maintained at a desired position using a method of blocking the N-terminal, a method of substitutig the lysine residue, a method of introducing an amine group, and further the pegylation and coupling yield can be improved.
  • an insulinotropic peptide conjugate in which a carrier is bound to the non-terminal internal resiue of the insulinotropic peptide of the invention refers to an insulinotropic peptide conjugate in which an immunoglobulin Fc region is specifically bound with an amine group other than the N-terminal of the insulinotropic peptide.
  • the present inventors have conducted a series of experiments; that is, in a method for selectively binding PEG to a lysine residue of the insulinotropic peptide, when binding PEG to a native exendin-4, the reaction was conducted at pH 9.0, thus inducing a pegylation to lysine residue; whereas in the other method, when binding PEG to a N-terminus-removed or protected form of exendin-4 derivative, the reaction was conducted at pH 7.5, thus inducing a pegylation to lysine residue.
  • immunoglobulin Fc region refers to the heavy-chain constant region 2 (CH2) and the heavy-chain constant region 3 (CH3) of an immunoglobulin, excluding the variable regions of the heavy and light chains, heavy-chain constant region 1 (CH1) and the light-chain constant region 1 (CL1) of the immunoglobulin. It may further include a hinge region at the heavy-chain constant region.
  • the immunoglobulin Fc region of the present invention may contain a part or all of the Fc region including the heavy-chain constant region 1 (CH1) and/or the light-chain constant region 1 (CL1), except for the variable regions of the heavy and light chains of the immunoglobulin, as long as it has a physiological effect substantially similar to or better than that of the native protein.
  • the immunoglobulin Fc region may be a fragment having a deletion in a relatively long portion of the amino acid sequence of CH2 and/or CH3.
  • the immunoglobulin Fc region of the present invention may comprise 1) a CH1 domain, a CH2 domain, a CH3 domain and a CH4 domain, 2) a CH1 domain and a CH2 domain, 3) a CH1 domain and a CH3 domain, 4) a CH2 domain and a CH3 domain, 5) a combination of one or more domains and an immunoglobulin hinge region (or a portion of the hinge region), and 6) a dimer of each domain of the heavy-chain constant regions and the light-chain constant region.
  • the immunoglobulin Fc region of the present invention includes a native amino acid sequence as well as a sequence derivative (mutant) thereof.
  • An amino acid sequence derivative has a different sequence due to a deletion, an insertion, a non-conservative or conservative substitution or combinations thereof of one or more amino acid residues of the native amino acid sequences.
  • amino acid residues at positions 214 to 238, 297 to 299, 318 to 322, or 327 to 331, known to be important in the binding may be used as a suitable target for modification.
  • various kinds of derivatives are possible, including one in which a region capable of forming a disulfide bond is deleted, or certain amino acid residues are removed at the N-terminal end of a native Fc form or a methionine residue is added thereto. Further, to remove effector functions, a deletion may occur in a complement-binding site, such as a Clq-binding site and an antibody dependent cell mediated cytotoxicity (ADCC) site.
  • ADCC antibody dependent cell mediated cytotoxicity
  • the Fc region may be modified by phosphorylation, sulfation, acrylation, glycosylation, methylation, farnesylation, acetylation, amidation, and the like.
  • Fc derivatives may be derivatives that exhibit the same biological activity as the Fc region of the present invention or improve a structural stability against heat, pH or the like of the Fc region.
  • these Fc regions may be obtained from native forms isolated from humans and other animals including cows, goats, pigs, mice, rabbits, hamsters, rats or guinea pigs, or may be recombinants or derivatives thereof, obtained from transformed animal cells or microorganisms.
  • the method for obtaining from a native immunoglobulin includes isolating whole immunoglobulins from human or animal organisms and then treating them with a proteolytic enzyme. Papain treatment results in the digestion of the native immunoglobulin into Fab and Fc, and pepsin treatment results in the production of pFc' and F(ab)2 fragments. These fragments may be subjected to size exclusion chromatography and the like to isolate Fc or pFc' fragments.
  • a human-derived Fc region is a recombinant immunoglobulin Fc region that is obtained from a microorganism.
  • the immunoglobulin Fc region be in the form of having native sugar chains, increased sugar chains compared to a native form or decreased sugar chains compared to the native form, or may be in a deglycosylated form.
  • the increase, decrease or removal of the immunoglobulin Fc sugar chains may be achieved by methods common in the art, such as a chemical method, an enzymatic method and a genetic engineering method using a microorganism.
  • the removal of sugar chains from an immunoglobulin Fc region results in a sharp decrease in binding affinity to the C1q part of the complement component and a decrease or removal in antibody-dependent cell-mediated cytotoxicity or complement-dependent cytotoxicity, thereby not inducing unnecessary immune responses in vivo .
  • an immunoglobulin Fc region in a deglycosylated or aglycosylated form may be more suitable to the object of the present invention as a drug carrier.
  • deglycosylation refers to enzymatically removing sugar moieties from an Fc region
  • amino acid sequence means that an Fc region is produced in an unglycosylated form by a prokaryote, specifically E. coli .
  • the immunoglobulin Fc region may be derived from humans or other animals including cows, goats, pigs, mice, rabbits, hamsters, rats and guinea pigs, and preferably from humans.
  • the immunoglobulin Fc region may be an Fc region that is derived from IgG, IgA, IgD, IgE and IgM, or that is made by combinations thereof or hybrids thereof. Specifically, it is derived from IgG or IgM, which are among the most abundant proteins in human blood, and most specifically from IgG, which is known to enhance the half-lives of ligand-binding proteins, but is not limited thereto.
  • a dimer or multimer may be formed from two or more fragments selected from the group consisting of IgG Fc, IgA Fc, IgM Fc, IgD Fc, and IgE Fc fragments.
  • hybrid means that a sequence corresponding to at least two Fc fragments of a different origin is present in a single-chain immunoglobulin Fc region.
  • various types of hybrid are available. That is, the hybrid consisting of 1 to 4 domains selected from the group consisting of CH1, CH2, CH3 and CH4 of IgG Fc, IgM Fc, IgA Fc, IgE Fc and IgD Fc is available, and may include a hinge.
  • IgG can also be divided into sub-classes of IgG1, IgG2, IgG3 and IgG4, and in the present invention, a combination or hybridization thereof is possible. It is specifically sub-classes of IgG2 and IgG4, and most specifically Fc region of IgG4 rarely having effector function, such as a complement dependent cytotoxicity (CDC).
  • the immunoglobulin Fc region for the carrier of the drug of the present invention may be, for example, human IgG4-derived aglycosylated Fc region, but is not limited thereto.
  • the human-derived Fc region is preferable as compared with nonhuman-derived Fc region which can cause undesirable immune responses, for example, which can act as an antigen in the human body to produce a new antibody.
  • the non-peptidyl polymer used in one specific embodiment of the present invention has a reactive group capable of binding to the immunoglobulin Fc region and the physiologically active protein or peptide. In a further specific embodiment, this reactive group is located at both terminal ends.
  • the both terminal reactive group of the non-peptidyl polymer is preferably selected from the group consisting of a reactive aldehyde group, a propionaldehyde group, a butyraldehyde group, a maleimide group and a succinimide derivative.
  • the succinimide derivative may be succinimidyl propionate, hydroxy succinimidyl, succinimidyl carboxymethyl, or succinimidyl carbonate.
  • the non-peptidyl polymer when the non-peptidyl polymer has a reactive group of the reactive aldehyde group at both terminal ends thereof, it is effective in linking at both terminal ends with a physiologically active polypeptide and an immunoglobulin with minimal non-specific reactions.
  • a final product produced by reductive alkylation by an aldehyde linkate is much more stable than that bound by an amide linkage.
  • the aldehyde reactive group selectively reacts at an N-terminus at a low pH, and forms a covalent bond with a lysine residue at a high pH, such as pH 9.0.
  • the both terminal reactive groups of the non-peptidyl polymer may be the same as or different from each other.
  • the non-peptidyl polymer may possess a maleimide group at one terminal end, and an aldehyde group, a propionaldehyde group or a butyraldehyde group at the other terminal end.
  • a polyethylene glycol having a reactive hydroxy group at both terminal ends thereof is used as the non-peptidyl polymer, the hydroxy group may be activated to various reactive groups by known chemical reactions, or a polyethylene glycol having a commercially available modified reactive group may be used to thereby prepare a physiologically active protein or peptide conjugate, specifically an insulinotropic peptide conjugatge, according to the present invention.
  • the insulinotropic peptide conjugate of the present invention can not only maintain in vivo activities of a conventional insulinotropic peptide, such as a promotion of insulin synthesis and secretion, an appetite suppression, a weight loss, an increase in blood glucose sensitivity of beta cells, a promotion of beta cell proliferation, or a gastric emptying delay, but also it can dramatically increase the serum half-life of the insulinotropic peptide and hence in vivo lasting effects of the peptide.
  • this insulinotropic peptide conjugate is useful in the treatment of diabetes, obesity, acute coronary syndrome or polycystic ovary syndrome.
  • the present invention provides a composition, comprising a conjugate of a physiologically active protein or peptide in which a carrier is bound to the non-terminal, internal residue of a physiologically active protein or peptide, via a non-peptidyl linker, wherein the conjugate exhibits decreased immunogenicity as compared to that of the physiologically active protein or peptide to which the carrier is not bound.
  • the above-described conjugate is characterized in that it decreases immunogenicity, which is a side effect of a long-acting preparation.
  • non-peptidyl linker may be polyethylene glycol.
  • physiologically active protein or peptide The physiologically active protein or peptide, the linker and the conjucate are as described above.
  • the present invention provides a method for preparing the conjugate of the physiologically active protein or peptide.
  • the present invention provides a method for preparing the conjugate of the physiologically active protein or peptide which comprises the follwing steps:
  • the present invention provides a method for preparing a protein conjugate which comprises the follwing steps:
  • the non-peptidyl polymer of step (1) and the lysine residue of the insulinotropic peptide, which is a physiologically active protein or peptide, are bound at pH 7.5 or higher.
  • the Lys12-pegylated conjugate was eluted first, and then the Lys27-pegylated conjugate was eluted in the last portion. A perfect peak separation between N-terminal positional isomer and the Lys12 positional isomer was possible.
  • CA exendin-4 is a N-terminal-modified exendin-4 in which the alpha carbon is deleted from the N-terminal histidine residue of a native exendin and the ⁇ -carbon of the side chain is directly bound to a carboxyl carbon.
  • the reaction was conducted in a 100mM Na-phosphate buffer (pH 9.0), and a reducing agent, 20mM SCB was added thereto.
  • the mono-peglated peptide was primarily purified from the reaction solution through a SOURCE Q (XK 16ml, Amersham Biosciences), and the isomer was separated through a SOURCES (XK 16ml, Amersham Biosciences).
  • the Lys12-pegylated conjugate was eluted first, and then the Lys27-pegylated conjugate was eluted in the last portion.
  • a perfect peak separation between N-terminal positional isomer N-terminal positional isomer and the Lys12 positional isomer allowed was possible
  • 3.4K PropionALD(2) PEG was reacted with the Lys of CA exendin-4 using imidazo-acetyl exendin-4 (CA exendin-4, AP, USA) in the same manner as in Example 2.
  • the coupling reaction was then conducted using the last isomer peak (positional isomer of Lys 27), which shows a lot of reactivity and is easily distinguished from the N-terminal isomer, among the two Lys isomer peaks.
  • the peptide and the immunoglobulin Fc were reacted at a molar ratio of 1:8, and a total protein concentration of 60 mg/mL at 4°C for 20 hours.
  • Example 4 Separation of human peripheral blood mononuclear cells (PBMC) for the ex vivo test and selection of the donors
  • PBMC Human peripheral blood mononuclear cells
  • HLA-DR haploid genotype of the cells of the donor were analyzed using HLA SSP-PCR based tissue-typing kit (Biotest, Solihull, UK). The reactivity of the T cells was tested using KLH (Keyhole Limpet Haemocyanin, Pierce (Perbio), Northumberland, UK), which is an antigen peptide derived from influenza A and Epstein Barr virus.
  • KLH Keyhole Limpet Haemocyanin, Pierce (Perbio), Northumberland, UK
  • HLA-DR type of the world's population 50 donors representing the frequency of HLA-DR type of the world's population were selected and composed of a single cohort. MHC class II haploid genotypes and the reactivity of T cells for each donor constituting the cohort is shown in Table 1 below. The frequency of the genotype of the donor was compared with the frequency of the world's population and the results are shown in Figure 1. Table 1 below shows the HLA-DR genotypes and the reactivity of T-cells on the antigenic peptides KLH for each donor.
  • Example 5 EpiScreen TM ex vivo T cell proliferation test
  • the T cell proliferative capacities of unbound native exendin-4 and unbound CA exendin-4, CA exendin-4 (CA Exendin-4-PEG(inter)) pegylated at the lysine residue, and the native exendin-4 (Exendin-4-PEG(N-term)) pegylated at the N-terminus were campared.
  • CA exendin-4 does not have N-terminal residue that can be pegylated
  • the N-terminal pegylated CA-exendin-4 was not prepared for the CA exendin-4.
  • PBMC peripheral blood mononuclear cells
  • the antigen peptide KLH treated group was placed to indentify the reproducility of each donor cell. All the test groups and the control groups were cultured at 37°C and 5% CO 2 incubator condition for 8 days. A part of the cells was taken on the 5th, 6th, 7th and 8th day and transferred to the 96-well culture plates to measure the cell proliferation rate.
  • Table 3 shows the strength and frequency of T-cell proliferation resonse (including SI ⁇ 1.9 boundary value).
  • Example 6 EpiScreen TM ex vivo interleukin-2 (IL-2) secretion test
  • the IL-2 secretory capacities of the unbound exendin-4 and the peglyated exendin-4 of Example 5 was compared and measured using donor cells and the samples, which are the same as in EpiScreenTM T cell proliferation assays.
  • the anti-interleukin-2 antibody (R & D Systems, Abingdon, UK) was bound to ELISpot plates (Millipore, Herts, UK). The plate was washed three times with PBS (phosphate-buffered saline), and then PBS, supplemented with 1% bovine serum albumin, was added and reacted.
  • the donor cells diluted with AIM-V medium were dispensed per 100 ⁇ l/well.
  • biotinylated IL-2 detection antibody and streptavidin-AP R & D Systems, Abingdon, UK
  • BCIP/NBT R&D Systems, Abingdon, UK
  • Table 4 shows the strength and fequency of interleukin-2 (IL-2) secretion response of T cells (including SI ⁇ 1.9 boundary value).
  • IL-2 interleukin-2
  • the blood was collected before and during administration, at the 13rd, 19th and 26th week, and at the end of the recovery period, the serum was separated from this. It was determined on whether to produce the antibodies against the insulinotropic peptide.
  • the blood was taken before and during administration, at the 12th, 19th and 26th week, and at the end of the recovery period, the serum was separated from this. It was determined whether to produce the antibodies against the insulinotropic peptide.
  • Table 6 shows production of antibodies at the 26-week administration in Cynomolgus monkey.
  • Example 9 Detection of the anti-drug antibody in the blood and evaluation of the neutralizing capacity
  • Example 3 In order to detect whether the conjugate of Example 3 has produced an anti-drug antibody (ADA) in the body of rat or Cynomolgus monkey, the conjugate was examined by the bridging ELISA method.
  • the biotinylated conjugate of Example 3 was bound to the 96-well microplate in which streptavidin was coupled to the bottom thereof, and washed with water.
  • Digoxigenin(DIG)-labeled conjugate of Example 3 hereinafter, HM11260C
  • the horseradish peroxidase-coupled anti-DIG antibody (anti-DIG-POD antibody) was added and developed by TMB substrate (3,3',5,5'-tetramethylbenzidine substrate).
  • Measurement sensitivity in the rat serum was 3.1 ng/ml, and the measurement sensitivity in monkey serum was 12.5 ng/ml.
  • serum samples and HM11260C were added to the human GLP-1 overexpressed cell line (GLP-1R/CHO) and then the inhibiton rate of cAMP-induction was measured.
  • the antibodies produced by only two of the 160 animals were confirmed to have no neutralizing ability.
  • results suggest that the immunogenicity of the physiologically active protein or peptide was decreased by binding a non-peptide linker and Fc fragment to the internal residue other than the terminal of the physiologically active protein or peptide, thus inhibiting the mechanism in which the desired peptide acts as an antigen.
  • the results also support that, in the case of using the producing method as described above, the activation of T cells and the antibody production reaction in animals were significantly inhibited.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Immunology (AREA)
  • General Health & Medical Sciences (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Veterinary Medicine (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Epidemiology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Organic Chemistry (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Zoology (AREA)
  • Endocrinology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Biochemistry (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Diabetes (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Transplantation (AREA)
  • Toxicology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Medicinal Preparation (AREA)
  • Vascular Medicine (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)

Abstract

The present invention relates to a method for increasing serum half-life of a protein or peptide and decreasing immunogenicity thereof by site-specifically binding a carrier to a protein or peptide, and to the use thereof. The conjugate of the physiologically active protein or peptide of the present invention can significantly decrease immunogenicity in the human body and thus reduce antibody production rate against the protein or peptide. Therefore, the present conjugate has advantages in that a phenomenon of reduced clinical effects of the physiologically active protein or peptide is low, and it can be effectively used in the development of long-acting formulations having a high safety against the immune response.

Description

METHOD FOR DECREASING IMMUNOGENICITY OF PROTEIN AND PEPTIDE
The present invention relates to a method for increasing serum half-life of a protein or peptide and decreasing immunogenicity thereof by site-specifically binding a carrier to a protein or peptide, and to the use thereof.
Immune responses to biological therapeutic agents can be widely induced for both non-human and human-derived proteins. These responses may weaken clinical effects, limit the efficacy, and sometimes lead to pathological diseases or even cause the death of the patient. In particular, the production of neutralizing antibodies that target the recombinant self-protein may induce a cross-reaction with the protein inherent in the body of the patient and thus lead to serious consequences (see, Lim LC. Hematology 2005 10(3):255-9). Problems of biopharmaceuticals such as monoclonal antibodies were greatly reduced with the development of molecular biology. However, many recombinant protein pharmaceuticals are identical with the protein sequences which are expressed in the body and thus, there still remain a possibility of causing a neutralizing immune response (see, Namaka M et al, Curr Med Res Opin 2006 22(2):223-39). Although the mechanism by which it is possible to induce immunogenicity is not wholly clear, it is known that the resistance to self-proteins can be broken by products administered to the patient and by various factors of the patient (reviewed in Chester, K, Baker, MP and Mayer A. Expert Rev Clin Immunol 2005 1(4): 549-559, Baker MP and Jones TD. Curr . Opin . Drug Disc Dev 2007 10(2):219-227). Factors for immunogenicity include dosage, frequency and route of administration, immunomodulatory ability of protein drugs, their preparation and the like. The most important factor to induce the immune response is whether there is an antigen recognition site (epitope) that can effectively stimulate a CD4 + T cell response (reviewed Baker MP and Jones TD. Curr . Opin. Drug Disc Dev 2007 10(2):219-227).
On the other hand, exendin-4 is a natural peptide discovered in the salivary gland of the Gila monster lizard and has a 52% sequence similarity with human GLP-1 (glucagon-like peptide-1). Exendin-4 and GLP-1 have a similar insulin secretion function. However, GLP-1 is rapidly deactivated by dipeptidyl peptidase-IV (DPP-IV), thus having a very short half-life, whereas exendin-4 keeps the resistance to DPP-IV by glycine being present instead of alanine in the second amino acid sequence and thus can be more effective as a therapeutic agent of type II diabetes. In addition, insulin or analogs thereof, and dual agonists of GLP-1/glucagon are also used as therapeutic agents for diabetes and obesity. However, the presence of these non-human amino acid sequences can act as an antigen recognition site of T cells. Exenatide (Byetta) which was approved as therapeutic agents of type II diabetes as synthetic exendin-4 has produced an antibody to exenatide for more than 30% of patients who received administration of exenatide for one year in clinical trials. Lixisenatide, approved recently, has produced an antibody for about 60-71% of patients (see, Zinman, B. et al., Annals of Internal Medicines. 2007 146(7): 477-486; Schnabel CA et al, Peptides 2006 27:1902-1910; DeFronzo, R.A. et al, Diabetes Care 2005 28:1092-1100; Buse, J.B. et al, Diabetes Care 2004 27:2628-2635). That is, exentide was recognized as an in vivo extraneous substance to be treated and the antibody was produced. For this reason, the problem that is difficult to reliably expect a therapeutic effect is increasing prevalent.
Therefore, in the case of a physiologically active protein or peptide which has been administered within the body for the purpose of treatment or prevention for a long period of time, it is important to control the immunogenicity. In particular, adult disease-related physiologically active proteins or peptides such as insulin or insulinotropic peptide and anti-obesity protein have often been developed as as long-acting formulations capable of lasting in the body after administration. In addition, even if they are not long-acting formulations, there are many cases in which they must be administered several times for a long period of time. Therefore, not inducing an immune response is an important issue.
Under these circumstances, the present inventors have conducted numerous studies and experiments to develop pharmaceutical formulations of a protein or peptide which do not induce an immune response. As a result, the inventors have discovered that, when a carrier site-specifically binds to a protein or peptide, the immunogenicity can be decreased as compared to that of a protein or peptide to which the carrier has not been bound, thus completing the present invention.
One object of the present inveniton is to provide a method for decreasing immunogenicity of physiologically active proteins or peptides.
Another object of the present invention is to provide a composition, comprising a conjugate of a physiologically active protein or peptide in which a carrier is bound to the non-terminal, internal residue of a physiologically active protein or peptide, via a non-peptidyl linker.
Another object of the present invention is to provide a method for preparing the conjugate of the physiologically active protein or peptide, in which the carrier is bound to the non-terminal, internal residue of the physiologically active protein or peptide.
In one aspect, the present invention provides a method for decreasing immunogenicity of a physiologically active protein or peptide as compared to that of a physiologically active protein or peptide to which a carrier is not bound, which comprises binding a carrier to the non-terminal, internal residue of the physiologically active protein or peptide.
In one specific embodiment of the invention, the above carrier is characterized in that it is selected from the group consisting of a polyethylene glycol, a fatty acid, a cholesterol, an albumin or a fragment thereof, an albumin-binding substance, a polymer having repeating units of a particular amino acid sequence, an antibody, an antibody fragment, an FcRn binding substance, an in- vivo connective tissue or a derivative thereof, a nucleotide, a fibronectin, a transferrin, an elastin-like polypeptide(ELP), an XTEN polypeptide, a carboxy-terminal peptide (CTP), a structure inducing probe (SIP), a saccharide and a high molecular weight polymer.
In another specific embodiment of the invention, the FcRn binding substance is characterized in that it includes an immunoglobulin Fc region.
In another specific embodiment of the invention, the physiologically active protein or peptide and the carrier are characterized by being bound via a linker interposed therebetween.
In another specific embodiment of the invention, the linker is characterized in that it is a non-peptidyl linker.
In another specific embodiment of the invention, the non-peptidyl linker is characterized in that it is selected from the group consisting of a polyethylene glycol, a polypropylene glycol, an ethylene glycol-propylene glycol copolymer, a polyoxyethylated polyol, a polyvinyl alcohol, a polysaccharide, a dextran, a polyvinyl ethyl ether, a biodegradable polymer, a lipid polymer, a chitin, a hyaluronic acid and a combination thereof.
In another specific embodiment of the invention, it is characterized in that the physiologically active protein or peptide is bound to an immunoglobulin Fc region via a non-peptidyl polymer which is selected from the group consisting of a polyethylene glycol, a polypropylene glycol, an ethylene glycol-propylene glycol copolymer, a polyoxyethylated polyol, a polyvinyl alcohol, a polysaccharide, a dextran, a polyvinyl ethyl ether, a biodegradable polymer, a lipid polymer, a chitin, a hyaluronic acid and a combination thereof.
In another specific embodiment of the invention, the physiologically active protein or peptide is characterized in that it is selected from the group consisting of an anti-obesity peptide, an insulinotropic peptide or an analog thereof, a leptin, an insulin, an insulin analog, a glucagon, a human growth hormone, a growth hormone releasing hormone, a growth hormone releasing peptide, an interferon, an interferon receptor, a colony stimulating factor, a glucagon-like peptide such as GLP-1, a GLP-1/glucagon dual agonist, a gastric inhibitory polypeptide (GIP), a G-protein-coupled receptor, an interleukin, an interleukin receptor, an enzyme, an interleukin binding protein, a cytokine binding protein, a macrophage activating factor, a macrophage peptide, a B cell factor, a T cell factor, a protein A, an allergy inhibitory factor, a cell necrosis glycoprotein, an immunotoxin, a lymphotoxin, a tumor necrosis factor, a tumor inhibitory factor, a metastasis growth factor, an alpha-1 antitrypsin, an albumin, an α-lactalbumin, an apolipoprotein-E, an erythropoiesis factor, a highly glycosylated erythropoiesis factor, an angiopoietin, a hemoglobin, a thrombin, a thrombin receptor activating peptide, a thrombomodulin, blood factors VII, VIIa, VIII, IX and XIII, a plasminogen activating factor, a fibrin-binding peptide, an urokinase, a streptokinase, a hirudine, a protein C,C-reactive protein, a renin inhibitor, a collagenase inhibitor, a superoxide dismutase, a platelet-derived growth factor, an epithelial cell growth factor, an epidermal growth factor, an angiostatin, an angiotensin, a bone growth factor, a bone stimulating protein, a calcitonin, an atriopeptin, a cartilage inducing factor, an elcatonin, a connective tissue activating factor, a tissue factor pathway inhibitor, a follicle stimulating hormone, a luteinizing hormone, a luteinizing hormone releasing hormone, a nerve growth factor, a parathyroid hormone, a relaxin, a secretin, a somatomedin, an insulin-like growth factor, an adrenocortical hormone, a glucagon, a cholecystokinin, a pancreatic polypeptide, a gastrin-releasing peptide, a cortincotropin releasing factor, a thyroid stimulating hormone, an autotaxin, a lactoferrin, a myostatin, a receptor, a receptor antagonist, a cell surface antigen, a virus-derived vaccine antigen, a monoclonal antibody, a polyclonal antibody, and an antibody fragment.
In another specific embodiment of the invention, the physiologically active protein or peptide is characterized in that it is selected from the group consisting of an exendin-4, an exendin-4 derivative, a GLP-1 agonist, an insulin and a GLP-1/glucagon dual agonist.
In another specific embodiment of the invention, the exendin-4 derivative is characterized in that it is an exendin-4 derivative in which the charge on the N-terminal of exendin-4 is modified, which is selected from the group consisting of an exendin-4 derivative in which N-terminal amine group of exendin-4 is deleted, an exendin-4 derivative in which N-terminal amine group of exendin-4 is substituted with hydroxl group, an exendin-4 derivative in which N-terminal amine group of exendin-4 is substituted with carboxly group, an exendin-4 derivative in which N-terminal amine group of exendin-4 is modified with dimethyl group, and an exendin-4 derivative in which alpha carbon of N-terminal histidine residue of exendin-4 is deleted.
In another specific embodiment of the invention, the above-described internal residue is characterized in that it is a lysine residue at position 12 or 27 of the exendin-4 derivative in which N-terminal charge of exendin-4 is modified.
In another specific embodiment of the invention, the above-described internal residue is characterized in that it is a lysine residue at position 27 of the exendin-4 derivative in which N-terminal charge of exendin-4 is modified.
In another specific embodiment of the invention, the exendin-4 derivative in which the charge on the N-terminal of the exendin-4 is changed is characterized in that it is an exendin-4 derivative in which alpha carbon of N-terminal histidine residue of exendin-4 is deleted.
Another aspect, the preset the present invention provides a composition, comprising a conjugate of a physiologically active protein or peptide in which a carrier is bound to the non-terminal, internal residue of a physiologically active protein or peptide, via a non-peptidyl linker, wherein the conjugate exhibits decreased immunogenicity as compared to that of the physiologically active protein or peptide to which the carrier is not bound.
In one specific embodiment of the invention, the above-described conjugate is characterized in that it has decreased immunogenicity, which is a side effect of a long-acting preparation.
In another specific embodiment of the invention, the non-peptidyl linker is characterized in that it is a polyethylene glycol.
Another aspect, the present invention provides a method for preparing the conjugate of the physiologically active protein or peptide, in which the carrier is bound to the non-terminal, internal residue of the physiologically active protein or peptide.
The physiologically active protein or peptide conjugate of the present invention can significantly decrease immunogenicity in the human body and thus reduce antibody production rate against proteins or peptides. Therefore, the present conjugate has advantages in that the phenomenon of reduced clinical effects of the physiologically active protein or peptide is low, and it can be effectively used in the development of long-acting formulations having a high safety against the immune response.
Figure 1 is a diagram showing a comparison of HLA-DR genotype frequency of a donor in the ex vivo T cell activity test with that of the population in the world, Europe and North America.
The present invention relates to a method for decreasing the immunogenicity of a physiologically active protein or peptide compared to that of the protein or peptide to which a carrier has not been bound, which comprises a step of binding a carrier to the non-terminal, internal residue of the physiologically active protein or peptide.
In the present invention, the inventors have discovered a method for decreasing the immunogenicity of a physiologically active protein or peptide in which a non-peptide linker and Fc fragment are bound to the internal residue rather than the terminal of a physiologically active protein or peptide, thus inhibiting the mechanism in which the desired protein or peptide acts as an antigen. The inventors have identified that, in the case of using the method as described above, the activation of T cells and the antibody production reaction in animals is significantly inhibited compared with the method for preparing a conjugate by the modification at other sites such as N-terminal of the peptide. As a result, the present inventors have found that the physiologically active protein or peptide conjugate used as a conventional protein pharmaceutical preparation has a novel use as the composition and method for deacreasing the immunogenicity of a physiologically active protein or peptide.
The decrease of immunogenicity in the body can be measured without limitation by a known method. For example, the difference in immunogenicity can be confirmed by the ex- vivo activity measurement method of T cells which comprises coupling each of the carriers to the N-terminal or the sites other than the N-terminal including the C-terminal. Aldehyde reactive group selectively reacts with the N-terminal at a low pH, and also it can form a covalent bond with a lysine residue at the condition of high pH, for example pH 9.0. The pegylation reaction is conducted while changing the reaction pH, and then positional isomers can be separated from the reaction mixture using an ion exchange column.
When the coupling is made at a position other than N-terminal end which is an important site in the activity of the protein or peptide in vivo, a reactive thiol group can be introduced to an amino acid residue position to be modified, thus forming a covalent bond between the protein or peptide and a maleimide group of the non-peptidyl polymer.
When the coupling is made at a position other than N-terminal end which is an important site in the activity of the protein or peptide in vivo, an amine group is introduced to an amino acid residue position to be modified, thus forming a covalent bond between the protein or peptide and an aldehyde group of the non-peptidyl polymer.
The method of protection of the N-terminal end includes methylation, deamination or acetylation in addition to dimethylation, but is not limited thereto.
In the present invention, "physiologically active protein or peptide" refers to a protein or peptide that can control the genetic expression or physiological function. The physiologically active protein or peptide can be included, without limitation, in the scope of the present invention, as long as a carrier is bound to the non-terminal, internal residue of the physiologically active protein or peptide according to the present invention, thus exhibiting descresed immunogenicity compared to that of the protein or peptide to which a carrier is not bound. As described below, the carrier can be bound via a linker, specifically a non-peptidyl linker, to a physiologically active protein or peptide.
In addition, the physiologically active protein or peptide includes, in addition to native biologically active protein or peptide, derivatives, variants, or fragments thereof.
Examples of the physiologically active protein or peptide include an anti-obesity peptide, an insulinotropic peptide or an analog thereof, a leptin, an insulin, an insulin analog, a glucagon, a human growth hormone, a growth hormone releasing hormone, a growth hormone releasing peptide, an interferon, an interferon receptor, a colony stimulating factor, a glucagon-like peptide (GLP-1, etc.), a GLP-1/glucagon dual agonist, a gastric inhibitory polypeptide (GIP), a G-protein-coupled receptor, an interleukin, an interleukin receptor, an enzyme, an interleukin binding protein, a cytokine binding protein, a macrophage activating factor, a macrophage peptide, a B cell factor, a T cell factor, a protein A, an allergy inhibitory factor, a cell necrosis glycoprotein, an immunotoxin, a lymphotoxin, a tumor necrosis factor, a tumor inhibitory factor, a metastasis growth factor, an alpha-1 antitrypsin, an albumin, an α-lactalbumin, an apolipoprotein-E, an erythropoiesis factor, a highly glycosylated erythropoiesis factor, an angiopoietin, a hemoglobin, a thrombin, a thrombin receptor activating peptide, a thrombomodulin, blood factors VII, VIIa, VIII, IX and XIII, a plasminogen activating factor, a fibrin-binding peptide, an urokinase, a streptokinase, a hirudine, a protein C, C-reactive protein, a renin inhibitor, a collagenase inhibitor, a superoxide dismutase, a platelet-derived growth factor, an epithelial cell growth factor, an epidermal cell growth factor, an angiostatin, an angiotensin, a bone growth factor, a bone stimulating protein, a calcitonin, an atripeptin, a cartilage inducing factor, an elcatonin, a connective tissue activating factor, a tissue factor pathway inhibitor, a follicle stimulating hormone, a luteinizing hormone, a luteinizing hormone releasing hormone, a nerve growth factor, a parathyroid hormone, a relaxin, a secretin, a somatomedin, an insulin-like growth factor, an adrenocortical hormone, a glucagon, a cholecystokinin, a pancreatic polypeptide, a gastrin-releasing peptide, a cortincotropin releasing factor, a thyroid stimulating hormone, an autotaxin, a lactoferrin, a myostatin, a receptor, a receptor antagonist, a cell surface antigen, a virus-derived vaccine antigen, a monoclonal antibody, a polyclonal antibody, and an antibody fragment, without limitation.
More specifically, the physiologically active protein or peptide may include an insulin, an insulinotropic peptide, or a GLP-1/glucagon dual agonist, but is not limited thereto.
In the present invention, the term "insulin" includes all peptides or modified peptides which have a stimulating effect on insulin receptors. The insulin may be, for example, a native insulin, a rapid-acting insulin, a basal insulin, an insulin analog in which any amino acids of the native insulin is changed by any one method selected from substitution, addition, deletion, and modification, or a combination of these methods, or may be a fragment thereof. Also, the insulin used in the present invention may be a long-acting insulin to which long-acting techniques applied to overcome the short half-life. In particular, the insulin may be a long-acting insulin or a long-acting insulin analog which can be administered once a week, but is not limited thereto.
Some specific examples of the insulin according to the present invention include an insulin or an insulin analog and its long-acting type as disclosed in Korean Patent No. 10-1058290 (or International Publication WO 2008-082274) or Korean Patent Application Publication No. 2014-0106452 (or International Publication WO 2014-133324), the entire contents of which are incorporated herein by reference, but are not limited thereto.
As used herein, the term "insulin analog" refers to a substance which retains the same function of controlling the blood glucose level in vivo as a native insulin. Specifically, the insulin analogs include those in which one or more amino acids in the native insulin sequence have been modified. The insulin analog may be an insulin analog in which A-chain or B-chain amino acid of native insulin is changed. The native insulin amino acid sequence is as follows.
A chain:
Gly-Ile-Val-Glu-Gln-Cys-Cys-Thr-Ser-Ile-Cys-Ser-Leu-Tyr-Gln-Leu-Glu-Asn-Tyr-Cys-Asn (SEQ ID NO: 1)
B chain:
Phe-Val-Asn-Gln-His-Leu-Cys-Gly-Ser-His-Leu-Val-Glu-Ala-Leu-Tyr-Leu-Val-Cys-Gly-Glu-Arg-Gly-Phe-Phe-Tyr-Thr-Pro-Lys-Thr (SEQ ID NO: 2)
Specifically, at least one amino acid in the native insulin may have a modififation selected from the group consisting of substitution, addition, deletion, modification and a combination thereof, but are not limited thereto.
In the substitution or addition of the amino acids, 20 amino acids that are normally observed in a human protein as well as atyhpical or non-naturally occurring amino acids can be used. The commercial sources of the atypical amino acids may include Sigma-Aldrich, ChemPep and Genzyme pharmaceuticals. The peptides including such amino acids and a typical peptide sequence can be synthesized or purchased from commercial peptide synthesis companies, for example, American peptide company Inc., and Bachem (USA), or Anygen (Korea).
Specifically, the above-described insulin analogs include an inverted insulin, an insulin variant, an insulin fragment, an insulin agonist, an insulin derivative and the like, and the preparation method thereof includes a genetic recombination as well as a solid phase method, but is not limited thereto.
The term "insulin derivative" shows an amino acid sequence homolgy with A-chain and B-chain of native insulin, while retaining the function to control the blood glucose level in the body, and includes a peptide form which may have some groups on the amino acid redidues chemically substituted (e.g., alpha-methylation, alpha-hydroxylation), deleted (e.g., deamination), or modified (e.g., N-methylation). In addition, the insulin derivative includes a peptide mimic, and a low molecular or high molecular compound, which can bind with an insulin receptor to control blood glucose levels in the body, even without homology with a native insulin and an amino acid sequence.
As used herein, the term "insulin fragment" refers to a fragment having one or more amino acids added or deleted in insulin. The added amino acid may be an amino acid that is not present in the native state (e.g., D-type amino acid). Such insulin fragment retains a function to control blood glucose levels in the body.
As used herein, the term "insulin variant" is a peptide having one or more amino acid sequences different from those of insulin, and retaining a function to control blood glucose levels in the body.
Methods for preparing the insulin agonist, derivative, fragment and variant of the present invention, respectively, can be used alone and in combination thereof. For example, the present invention includes a peptide which has one or more amino acid sequence different from those of native insulin, has deamination at the terminal amino acid residue, and retains a function to control blood glucose levels in the body, can be included.
The description of the agonists, derivatives, fragments and variants may be applied evewn to other types of proteins or peptides.
Specifically, the insulin analogs may be those in which one or more amino acids selected from the group consisting of amino acids at position 1, amino acids at position 2, amino acids at position 3, amino acids at position 5, amino acids at position 8, amino acids at position 10, amino acids at position 12, amino acids at position 16, amino acids at position 23, amino acids at position 24, amino acids at position 25, amino acids at position 26, amino acids at position 27, amino acids at position 28, amino acids at position 29, amino acids at position 30 of the chain B; amino acids at position 1, amino acids at position 2, amino acids at position 5, amino acids at position 8, amino acids at position 10, amino acids at position 12, amino acids at position 14, amino acids at position 16, amino acids at position 17, amino acids at position 18, amino acids at position 19 and amino acids at position 21 of the chain A have been substituted with other amino acids, and more specifically those in which one or more amino acids selected from the group consisting of amino acids at position 8, amino acids at position 23, amino acids at position 24, amino acids at position 25 of the chain B; amino acids at position 1, amino acids at position 2, amino acids at position 14 and amino acids at position 19 of the chain A have been substituted with other amino acids.
Specifically, among the foregoing amino acids, those in which one or more, two or more, three or more, four or more, five or more, six or more, seven or more, eight or more, nine or more, ten or more, 11 or more, 12 or more, 13 or more, 14 or more, more than 15, 16 or more, 17 or more, 18 or more, 19 or more, 20 or more, 21 or more, 22 or more, 23 or more, 24 or more, 25 or more, 26 or more, or 27 or more amino acids have been substituted with other amino acids may be used, but are not limited thereto.
The amino acid residues at the above-described positions may be substituted with alanine, glutamic acid, asparagine, isoleucine, valine, glutamine, glycine, lysine, histidine, cysteine, phenylalanine, tryptophan, proline, serine, threonine, and/or aspartic acids.
In the present invention, "insulinotropic peptide" refers to a peptide that retains the function of secreting insulin. The insulinotropic peptide may stimulate synthesis or expression of insulin in the beta cells of the pancreas. Specifically, the insulinotropic peptide is GLP (Glucagon like peptide)-1, exendin-3, or exendin-4, but is not limited thereto. The insulinotropic peptide includes native insulinotropic peptides, precursors thereof, agonists thereof, derivatives thereof, fragments thereof, and variants thereof. Further, a combination thereof as previously described can be included.
GLP-1 is a hormone secreted by the small intestine, and generally promotes biosynthesis and secretion of insulin, inhibits glucagon secretion, and promotes glucose uptake by cells. In the small intestine, a glucagon precursor is decomposed into three peptides, that is, glucagon, GLP-1, and GLP-2. Here, the GLP-1 means GLP-1 (1-37), which is originally in the form having no insulinotropic function, but is then processed and converted into the activated GLP-1 (7-37) forms.
Exendin-4 refers to peptides having 39 amino acids, which show a 53% amino acid sequence homology with GLP-1. The exendin-4 may have the following sequence, but is not limited thereto:
Exendin-4:
His Gly Glu Gly Thr Phe Thr Ser Asp Leu Ser Lys Gln Met Glu Glu Glu Ala Val Arg Leu Phe Ile Glu Trp Leu Lys Asn Gly Gly Pro Ser Ser Gly Ala Pro Pro Pro Ser (SEQ ID NO: 3)
Meanwhile, exendin-3 is a polypeptide having different amino acids at positions 2 and 3 from those of exendin-4. Exendin-3 is that in which amino acids at positions 2 and 3 of exendin 4 are substituted with serine and aspartic acid, respectively, and it can be represented as Ser2Asp3-exendin-4(1-39). Specifically, the exendin-3 may have the following sequence, but is not limited thereto:
Exendin-3:
His Ser Asp Gly Thr Phe Thr Ser Asp Leu Ser Lys Gln Met Glu Glu Glu Ala Val Arg Leu Phe Ile Glu Trp Leu Lys Asn Gly Gly Pro Ser Ser Gly Ala Pro Pro Pro Ser (SEQ ID NO: 4)
The above-described insulinotropic peptide derivative may be that in which N-terminus of the insulinotropic peptide has been modified. More specifically, the insulinotropic peptide derivative can cause a rapid dissociation of the receptor by changing the charge on the N-terminal, and it may be a derivative in which the positive charge on the N-terminal is changed to neutral or net negative charges.
The insulinotropic peptide derivative of the present invention may include a desamino-histidyl derivative where the N-terminal amino (or amine) group of insulinotropic peptide is deleted, beta-hydroxy imidazopropionyl-derivative where the amino group is substituted with a hydroxyl group, dimethyl-histidyl derivative where the amino group is modified with two methyl groups, beta-carboxyimidazopropionyl-derivative where the N-terminal amino group is substituted with a carboxyl group, or an imidazoacetyl-derivative where the alpha carbon of the N-terminal histidine residue is deleted to retain only the imidazoacetyl group and thus the positive charge of the amino group is removed, and other N-terminal amino group-modified derivatives are included within the scope of the present invention.
By way of example, the insulinotropic peptide derivative may be a derivative in which N-terminal amino (or amine) group or amino acid residue of exendin-4 is chemically modified. Specifically, it is an exendin-4 derivative which is prepared by substituting or removing the alpha amino group present in the alpha carbon of the N-terminal histidine residue (the first amino acid) of exendin-4. More specifically, it can include desamino-histidyl-exendin-4 (DA-Exendin-4) with removal of the N-terminal amino group, beta-hydroxy imidazopropyl-exendin-4 (HY-exendin-4) prepared by substitution of the N-terminal amino group with a hydroxyl group, beta-carboxy imidazopropyl-exendin-4 (CX-exendin-4) prepared by substitution of the N-terminal amino group with a carboxyl group, dimethyl-histidyl-exendin-4 (DM-exendin-4) prepared by modification of the N-terminal amino group with two methyl residues, or imidazoacetyl-exendin-4 (CA-exendin-4) with removal of alpha carbon of N-terminal histidine residue, and the like.
It is obvious that the insulinotropic peptide as disclosed in Korean Patent Application Publication No. 10-2012-0135123 (or international publication WO 2012/165915) or international publication WO 2014/107035 is also included in the scope of the present invention. The entire contents of these publications are incorporated herein by reference.
In the present invention, the "GLP-1/glucagon dual agonist" includes peptides or fragments, precursors, variants or derivatives thereof which have GLP-1/glucagon dual activity, like oxyntomodulin, a native GLP-1/glucagon dual agonist. In the present invention, the GLP-1/glucagon dual agonist may be a GLP-1/glucagon dual agonist to which the long-acting techniques applied to overcome the short half-life, and preferably a long-acting GLP-1/glucagon dual agonist which can be administered once a week, but is not limited thereto.
The GLP-1/glucagon dual agonist includes oxyntomodulin.
The "oxyntomodulin" refers to a peptide produced from a pre-glucagon, a percursor of glucagon. In the present invention, oxyntomodulin includes a native oxyntomodulin, a precursor thereof, a derivative thereof, a fragment thereof, a variant thereof and the like as previously described.
The oxyntomodulin may have specifically the amino acid sequence of HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA (SEQ ID NO: 5), but is not limited thereto.
The oxyntomodulin derivative includes a peptide, a peptide derivative or a peptide mimic that is prepared by the addition, deletion or substitution of any amino acid of sequences of oxyntomodulin and can activate both GLP-1 receptor and glucagon receptor, and particularly, can activate each receptor at a higher level compared to the level activated by native oxyntomodulin.
Some specific examples of the GLP-1/glucagon dual agonist according to the present invention include a GLP-1/glucagon dual agonist and its derivative or its long-acting type as disclosed in Korean Patent Application Publication Nos. 10-20125-01372771 (or International Publication WO 2012-169798) and 10-2012-01639579 (or International Publication WO 2012-173422), the entire contents of which are incorporated herein by reference.
In the present invention, the carrier that is bound to the physiological active protein or peptide may be a material which can increase the in vivo half-life of the physiological active protein or peptide.
Examples of the physiologically active protein or peptide include various substances capable of reducing the renal clearance of the physiologically active protein or peptide, for example, a polyethylene glycol, a fatty acid, a cholesterol, an albumin or a fragment thereof, an albumin-binding substance, a polymer of repeating units of a particular amino acid sequence, an antibody, an antibody fragment, a FcRn binding substance, an in- vivo connective tissue or a derivative thereof, a nucleotide, a fibronectin, a transferrin, an elastin-like polypeptide(ELP), a XTEN polypeptide, a carboxy-terminal peptide (CTP), a structure inducing probe (SIP), a saccharide, a high molecular polymer, a particular amino acid sequence, a polymer of repeating units of a particular amino acid sequence, and the like. In addition, the linkage between the physiologically active protein or peptide and the carrier includes a genetic recombination and an in vitro linkage, but is not limited thereto.
The carrier may be covalently or non-covalently linked to the physiologically active protein or peptide. The above described FcRn binding substance may be an immunoglobulin Fc region, for example, IgG Fc.
When polyethylene glycol is used as the carrier, a Recode technique by Ambrx Inc. which enables a site-specific binding to polyethylene glycol may be used. Also, a glycopegylation technique by Neose company which enables a specific binding to the glycosylated moiety may be used. Furthermore, a releasable PEG technique in which polyethylene glycol is slowly deleted in the body may be used, but is not limited thereto. Also, the techniques which can be used in the present invention include techniques which increase bioavailability using PEG. In addition, the non-peptidyl polymers such as polyethylene glycol, polypropylene glycol, ethylene glycol-propylene glycol copolymer, polyoxyethylated polyol, polyvinyl alcohol, polysaccharides, dextran, polyvinyl ethyl ether, biodegradable polymer, lipid polymer, chitins, or hyaluronic acid can also be bound to the physiologically active protein or peptide using the above described techniques.
When albumin is used as a carrier, the technique which can be used in the present invention includes a technique in which albumins or albumin fragments can be directly covalently linked to the physiologically active protein or peptide to increase the in vivo stability. Even if albumin is not directly linked, a technique in which the albumin binding materials, for example, albumin-specific binding antibody or antibody fragment are bound to the physiologically active protein or peptide to thereby bind to albumin can be used, and a technique in which a certain peptide/protein having a binding affinity to albumin is bound to the physiologically active protein or peptide can be used. In addition, a technique in which a fatty acid having a binding affinity to albumin is bound to the physiologically active protein or peptide can be used, but is not limited thereto. Any technique or binding method which can increase the in vivo stability using albumin can be included here.
The technique for binding to the physiologically active protein or peptide by using the antibody or antibody fragment as a carrier in order to increase the in vivo half-life may also be included in the present invention. The antibody or antibody fragment having a FcRn binding site can be used, and any antibody fragment containing no FcRn binding site such as Fab can be used. CovX-body technique of CovX company using a catalytic antibody can be included herein, and the technique which increases the in vivo half-life using the immunoglobulin Fc region may be included in the present invention.
When the immunoglobulin Fc region is used, the linker binding to the Fc region and the physiologically active protein or peptide and its binding method may include a peptide bond or a polyethylene glycol or the like, but is not limited thereto and any chemical binding method may be available. In addition, the binding ratio of the Fc region and the insulin analog may be 1:1 or 1:2, but is not limited thereto.
An immunoglobulin constant region including Fc region is a biodegradable polypeptide which can be metabolized in vivo, so that it can safely be used as a drug carrier. In addition, an immunoglobulin Fc region is more advantageous in terms of production, purification and production yield of a complex than an entire immunoglobulin molecule owing to its relatively lower molecular weight. Further, since it is devoid of Fab, which exhibits high non-homogeneity due to the difference in amino acid sequence from one antibody to another, the immunoglobulin Fc alone provides the complex with significantly enhanced homogeneity, and reduces the possibility of inducing blood antigenicity.
Also, the aforementioned PEG is non-specifically bound to a specific site or various sites of the target peptide and thus increases the molecular weight of the peptide. Therefore, the PEG is effective in inhibiting the renal clearance and preventing hydrolysis and further it does not cause special side effects. In addition, when PEG is bound to an exogenous peptide, it can inhibit the recognition of antigenic sites being present in the exogenous peptide by the immune cells. Specifically, the PEG can inhibit the peptide to be phagocytosed by antigen presenting cell and proteolysed. Therefore, it is able to lower the potential for the peptide to act as an antigen. Especially for the exogenous protein to stimulate the activation of CD4+T cells as an antigen, about 14-24 short peptides in the form of being bound to MHC class II must be presented on the antigen-presenting cells. This can be inhibited in the course of being degraded as an appropriate size depending on the binding site of PEG.
In one embodiment of the present invention, the carrier and the physiologically active protein or peptide is connected via a linker, in particular, a non-peptidyl linker.
In the present invention, the non-peptidyl linker refers to a biocompatible polymer including two or more repeating units, the repeating units being bound with each other by any covalent bond excluding a peptide linkage. The non-peptidyl linker may be interchangeably used with the non-peptidyl polymer.
The non-peptidyl linker useful in the present invention may be selected from the group consisting of a biodegradable polymer, a lipid polymer, a chitin, a hyaluronic acid, and a combination thereof. The biodegradable polymer used herein may be polyethylene glycol, polypropylene glycol, ethylene glycol-propylene glycol copolymer, polyoxyethylatedpolyol, polyvinyl alcohol, polysaccharide, dextran, polyvinyl ethyl ether, polylactic acid (PLA) or polylactic-glycolic acid (PLGA). In one specific embodiment of the present invention, the non-peptidyl polymer is polyethylene glycol. In addition, derivatives thereof known in the art and derivatives easily prepared by a method known in the art may be included in the scope of the present invention.
The peptide linker which is used in the fused protein obtained by a conventional inframe fusion method has drawbacks in that it is easily cleaved in vivo by a proteolytic enzyme, and thus a sufficient effect of increasing the serum half-life of the active drug by a carrier cannot be obtained as expected. However, since the non-peptydyl polymer of the present invention is a substance that has no peptide linkage, it can have basically a resistance to the proteolytic enzyme, thus increasing the serum half-life of the peptide. The molecular weight of the non-peptidyl polymer which can be used in the present invention ranges specifically from 1 to 100 kDa, and more specifically from 1 to 20 kDa. The non-peptidyl polymer of the present invention, linked to the immunoglobulin Fc region, may be one type of polymer or a combination of different types of polymers.
In the present invention, the carrier is characterized in that it is bound to a non-terminal internal residue of the physiologically active protein or peptide. In this case, as described above, the carrier may be bound to the non-terminal internal residue of the physiologically active protein or peptide via a linker.
The non-terminal internal residue of the physiologically active protein or peptide may include, without limitation, any residue if it can, when a carrier is bound to the physiologically active protein or peptide, decrease the immunogenicity thereof, compared to that of a protein or peptide to which a carrier is not bound or a protein or peptide in which a carrier is bound to terminal site of the protein or peptide.
The non-terminal, internal amino acid of the physiologically active protein or peptide may be lysine, cysteine, or the like.
More specifically, when the physiologically active protein or peptide is an insulinotropic peptide, particularly exendin-4 or a derivative of exendin-4, its internal residue may be lysine residues at positions 12 or 27, but is not limited thereto.
In addition, when using an aldehyde linker as the non-peptidyl polymer, the N-terminal is reacted with an amine group in the lysine residue, and a modified form of insulinotropic peptide can be used to improve the reaction yield. For example, a reactive amine group can be maintained at a desired position using a method of blocking the N-terminal, a method of substitutig the lysine residue, a method of introducing an amine group, and further the pegylation and coupling yield can be improved.
In a preferred embodiment of the present invention, an insulinotropic peptide conjugate in which a carrier is bound to the non-terminal internal resiue of the insulinotropic peptide of the invention, refers to an insulinotropic peptide conjugate in which an immunoglobulin Fc region is specifically bound with an amine group other than the N-terminal of the insulinotropic peptide.
In one specific embodiment, the present inventors have conducted a series of experiments; that is, in a method for selectively binding PEG to a lysine residue of the insulinotropic peptide, when binding PEG to a native exendin-4, the reaction was conducted at pH 9.0, thus inducing a pegylation to lysine residue; whereas in the other method, when binding PEG to a N-terminus-removed or protected form of exendin-4 derivative, the reaction was conducted at pH 7.5, thus inducing a pegylation to lysine residue. As a result, it was comfimed that, contray to the N-terminal binding, when bound to the lysine residue, the ex vivo T-cell antivities were significantly inhibited (Tables 2 to 4).
Further, the term "immunoglobulin Fc region" as used herein refers to the heavy-chain constant region 2 (CH2) and the heavy-chain constant region 3 (CH3) of an immunoglobulin, excluding the variable regions of the heavy and light chains, heavy-chain constant region 1 (CH1) and the light-chain constant region 1 (CL1) of the immunoglobulin. It may further include a hinge region at the heavy-chain constant region.
Also, the immunoglobulin Fc region of the present invention may contain a part or all of the Fc region including the heavy-chain constant region 1 (CH1) and/or the light-chain constant region 1 (CL1), except for the variable regions of the heavy and light chains of the immunoglobulin, as long as it has a physiological effect substantially similar to or better than that of the native protein. Furthermore, the immunoglobulin Fc region may be a fragment having a deletion in a relatively long portion of the amino acid sequence of CH2 and/or CH3. That is, the immunoglobulin Fc region of the present invention may comprise 1) a CH1 domain, a CH2 domain, a CH3 domain and a CH4 domain, 2) a CH1 domain and a CH2 domain, 3) a CH1 domain and a CH3 domain, 4) a CH2 domain and a CH3 domain, 5) a combination of one or more domains and an immunoglobulin hinge region (or a portion of the hinge region), and 6) a dimer of each domain of the heavy-chain constant regions and the light-chain constant region.
Further, the immunoglobulin Fc region of the present invention includes a native amino acid sequence as well as a sequence derivative (mutant) thereof. An amino acid sequence derivative has a different sequence due to a deletion, an insertion, a non-conservative or conservative substitution or combinations thereof of one or more amino acid residues of the native amino acid sequences. For example, in an IgG Fc, amino acid residues at positions 214 to 238, 297 to 299, 318 to 322, or 327 to 331, known to be important in the binding, may be used as a suitable target for modification. Further, various kinds of derivatives are possible, including one in which a region capable of forming a disulfide bond is deleted, or certain amino acid residues are removed at the N-terminal end of a native Fc form or a methionine residue is added thereto. Further, to remove effector functions, a deletion may occur in a complement-binding site, such as a Clq-binding site and an antibody dependent cell mediated cytotoxicity (ADCC) site. Techniques of preparing such sequence derivatives of the immunoglobulin Fc region are disclosed in International Publications, WO 97/34631, WO 96/32478 and the like.
Amino acid exchanges in proteins and peptides, which do not wholly alter the activity of the moleculars, are known in the art (H. Neurath, R. L. Hill, The Proteins, Academic Press, New York, 1979). The most commonly occurring exchanges are exchanges between amino acid residues Ala/Ser, Val/Ile, Asp/Glu, Thr/Ser, Ala/Gly, Ala/Thr, Ser/Asn, Ala/Val, Ser/Gly, Thy/Phe, Ala/Pro, Lys/Arg, Asp/Asn, Leu/Ile, Leu/Val, Ala/Glu and Asp/Gly.
In addition, the Fc region, if desired, may be modified by phosphorylation, sulfation, acrylation, glycosylation, methylation, farnesylation, acetylation, amidation, and the like.
The above-described Fc derivatives may be derivatives that exhibit the same biological activity as the Fc region of the present invention or improve a structural stability against heat, pH or the like of the Fc region.
Furthermore, these Fc regions may be obtained from native forms isolated from humans and other animals including cows, goats, pigs, mice, rabbits, hamsters, rats or guinea pigs, or may be recombinants or derivatives thereof, obtained from transformed animal cells or microorganisms. Herein, the method for obtaining from a native immunoglobulin includes isolating whole immunoglobulins from human or animal organisms and then treating them with a proteolytic enzyme. Papain treatment results in the digestion of the native immunoglobulin into Fab and Fc, and pepsin treatment results in the production of pFc' and F(ab)2 fragments. These fragments may be subjected to size exclusion chromatography and the like to isolate Fc or pFc' fragments.
Specifically, a human-derived Fc region is a recombinant immunoglobulin Fc region that is obtained from a microorganism.
In addition, the immunoglobulin Fc region be in the form of having native sugar chains, increased sugar chains compared to a native form or decreased sugar chains compared to the native form, or may be in a deglycosylated form. The increase, decrease or removal of the immunoglobulin Fc sugar chains may be achieved by methods common in the art, such as a chemical method, an enzymatic method and a genetic engineering method using a microorganism. The removal of sugar chains from an immunoglobulin Fc region results in a sharp decrease in binding affinity to the C1q part of the complement component and a decrease or removal in antibody-dependent cell-mediated cytotoxicity or complement-dependent cytotoxicity, thereby not inducing unnecessary immune responses in vivo. In this regard, an immunoglobulin Fc region in a deglycosylated or aglycosylated form may be more suitable to the object of the present invention as a drug carrier.
As used herein, the term "deglycosylation" refers to enzymatically removing sugar moieties from an Fc region, and the term "aglycosylation" means that an Fc region is produced in an unglycosylated form by a prokaryote, specifically E. coli.
Meanwhile, the immunoglobulin Fc region may be derived from humans or other animals including cows, goats, pigs, mice, rabbits, hamsters, rats and guinea pigs, and preferably from humans.
Also, the immunoglobulin Fc region may be an Fc region that is derived from IgG, IgA, IgD, IgE and IgM, or that is made by combinations thereof or hybrids thereof. Specifically, it is derived from IgG or IgM, which are among the most abundant proteins in human blood, and most specifically from IgG, which is known to enhance the half-lives of ligand-binding proteins, but is not limited thereto.
On the other hand, the term "combination", as used herein, means that polypeptides encoding single-chain immunoglobulin Fc regions of the same origin are bound to a single-chain polypeptide of a different origin to form a dimer or multimer. That is, a dimer or multimer may be formed from two or more fragments selected from the group consisting of IgG Fc, IgA Fc, IgM Fc, IgD Fc, and IgE Fc fragments.
In the present invention, the term "hybrid" means that a sequence corresponding to at least two Fc fragments of a different origin is present in a single-chain immunoglobulin Fc region. In the present invention, various types of hybrid are available. That is, the hybrid consisting of 1 to 4 domains selected from the group consisting of CH1, CH2, CH3 and CH4 of IgG Fc, IgM Fc, IgA Fc, IgE Fc and IgD Fc is available, and may include a hinge. On the other hand, IgG can also be divided into sub-classes of IgG1, IgG2, IgG3 and IgG4, and in the present invention, a combination or hybridization thereof is possible. It is specifically sub-classes of IgG2 and IgG4, and most specifically Fc region of IgG4 rarely having effector function, such as a complement dependent cytotoxicity (CDC).
That is, the immunoglobulin Fc region for the carrier of the drug of the present invention may be, for example, human IgG4-derived aglycosylated Fc region, but is not limited thereto. The human-derived Fc region is preferable as compared with nonhuman-derived Fc region which can cause undesirable immune responses, for example, which can act as an antigen in the human body to produce a new antibody.
The non-peptidyl polymer used in one specific embodiment of the present invention has a reactive group capable of binding to the immunoglobulin Fc region and the physiologically active protein or peptide. In a further specific embodiment, this reactive group is located at both terminal ends. The both terminal reactive group of the non-peptidyl polymer is preferably selected from the group consisting of a reactive aldehyde group, a propionaldehyde group, a butyraldehyde group, a maleimide group and a succinimide derivative. The succinimide derivative may be succinimidyl propionate, hydroxy succinimidyl, succinimidyl carboxymethyl, or succinimidyl carbonate. In particular, when the non-peptidyl polymer has a reactive group of the reactive aldehyde group at both terminal ends thereof, it is effective in linking at both terminal ends with a physiologically active polypeptide and an immunoglobulin with minimal non-specific reactions. A final product produced by reductive alkylation by an aldehyde linkate is much more stable than that bound by an amide linkage. The aldehyde reactive group selectively reacts at an N-terminus at a low pH, and forms a covalent bond with a lysine residue at a high pH, such as pH 9.0.
The both terminal reactive groups of the non-peptidyl polymer may be the same as or different from each other.
For example, the non-peptidyl polymer may possess a maleimide group at one terminal end, and an aldehyde group, a propionaldehyde group or a butyraldehyde group at the other terminal end. When a polyethylene glycol having a reactive hydroxy group at both terminal ends thereof is used as the non-peptidyl polymer, the hydroxy group may be activated to various reactive groups by known chemical reactions, or a polyethylene glycol having a commercially available modified reactive group may be used to thereby prepare a physiologically active protein or peptide conjugate, specifically an insulinotropic peptide conjugatge, according to the present invention.
The insulinotropic peptide conjugate of the present invention can not only maintain in vivo activities of a conventional insulinotropic peptide, such as a promotion of insulin synthesis and secretion, an appetite suppression, a weight loss, an increase in blood glucose sensitivity of beta cells, a promotion of beta cell proliferation, or a gastric emptying delay, but also it can dramatically increase the serum half-life of the insulinotropic peptide and hence in vivo lasting effects of the peptide. Accordinlgy, this insulinotropic peptide conjugate is useful in the treatment of diabetes, obesity, acute coronary syndrome or polycystic ovary syndrome.
In another embodiment, the present invention provides a composition, comprising a conjugate of a physiologically active protein or peptide in which a carrier is bound to the non-terminal, internal residue of a physiologically active protein or peptide, via a non-peptidyl linker, wherein the conjugate exhibits decreased immunogenicity as compared to that of the physiologically active protein or peptide to which the carrier is not bound.
Specifically, the above-described conjugate is characterized in that it decreases immunogenicity, which is a side effect of a long-acting preparation.
Moreover, the non-peptidyl linker may be polyethylene glycol.
The physiologically active protein or peptide, the linker and the conjucate are as described above.
In another aspect, the present invention provides a method for preparing the conjugate of the physiologically active protein or peptide.
In detail, the present invention provides a method for preparing the conjugate of the physiologically active protein or peptide which comprises the follwing steps:
(1) covalently binding a non-peptidyl polymer having aldehyde, maleimide or succinimid reactive groups at the both terminal ends to an amine or thiol group of the physiologically active protein or peptide;
(2) separating the physiologically active protein or peptide which is covalently bound to the non-peptidyl polymer through a site other than the N-terminal end of the physiologically protein or peptide from the reaction mixture of step (1); and
(3) covalently binding an immunoglobulin Fc region to the other terminal end of the non-peptidyl polymer covalently bound to the physiologically active protein or peptide to produce a conjugate of the physiologically active protein or peptide in which both terminal ends of the non-peptidyl polymer are bound with the immunoglobulin Fc region and the physiologically active protein or peptide, respectively.
In a preferred aspect, the present invention provides a method for preparing a protein conjugate which comprises the follwing steps:
(1) covalently binding a non-peptidyl polymer haivng aldehyde reactive groups at the both terminal ends to a lysine residue of the physiologically active protein or peptide;
(2) separating the physiologically active protein or peptide covalently bound to the non-peptidyl polymer through the lysine residue of the physiologically active protein or peptide from the reaction mixture of step (1); and
(3) covalently linking an immunoglobulin Fc region to the other terminal end of the non-peptidyl polymer covalently bound to the physiologically active protein or peptide to produce a conjugate in which both terminal ends of the non-peptidyl polymer are bound with the immunoglobulin Fc region and the physiologically active protein or peptide, respectively.
More specifically, the non-peptidyl polymer of step (1) and the lysine residue of the insulinotropic peptide, which is a physiologically active protein or peptide, are bound at pH 7.5 or higher.
Hereinafter, the present invention will be described in more detail by the following examples. However, the following examples are intended to illustrate the invention and not to limit the scope of the invention thereto.
Example 1: Pegylation of exendin-4 and separation of positional isomer of pegylated exendin-4
For PEGylation of the N-terminus of native exendin-4 (American Peptides) with 3.4K PropionALD (2) PEG (PEG with two propionaldehyde groups of molecular weight of 3.4 kDa, IDB Inc., Korea), the peptide and PEG were reacted at a molar ratio of 1:15 with a peptide concentration of 3mg/ml at 4℃ for 90 minutes. At this time, the reaction was conducted in a 100mM NaOAc buffer (pH 4.0), and a reducing agent, 20mM SCB (NaCNBH3) was added thereto.
Also, for PEGylation of the lysine (Lys) of exendin-4 with 3.4K PropionALD (2) PEG, the peptide and PEG were reacted at a molar ratio of 1:30 with a peptide concentration of 3mg /ml at 4℃ for 3 hours. At this time, the reaction was conducted in a 100mM Na-phosphate buffer (pH 9.0), and a reducing agent, 20mM SCB was added thereto. The mono-pegylated peptide was primarily purified from the reaction solution through a SOURCE Q (XK 16ml, Amersham Biosciences), and the isomer was separated through a SOURCES (XK 16ml, Amersham Biosciences). It could be seen that the N-terminus-pegylated peak appeared earlier, and then two lysine (Lys)-pegylated peaks appeared in order. The pegylated sites were confirmed from the eluted peak by a peptide mapping method.
The Lys12-pegylated conjugate was eluted first, and then the Lys27-pegylated conjugate was eluted in the last portion. A perfect peak separation between N-terminal positional isomer and the Lys12 positional isomer was possible.
Column : SOURCE Q (XK 16ml, Amersham Biosciences) 58-27
Flow rate : 2.0ml/min
Gradient : A 0 → 40% 80min B (A: 20mM tris pH8.5, B: A + 0.5M NaCl)
Column : SOURCE S (XK 16ml, Amersham Biosciences)
Flow rate : 2.0ml/min
Gradient : A 0 → 100% 50 min B (A : 20mM citric acid pH 3.0, B : A + 0.5M KCl)
Example 2: Pegylation of CA exendin-4 lysine residue and separation of positional isomer
For PEGylation of the lysine (Lys) residue of CA exendin-4 (American American Peptides) with 3.4K PropionALD (2) PEG, the CA exendin-4 and PEG were reacted at a molar ratio of 1:30 with a CA exendin-4 concentration of 3mg/ml at 4℃ for 3 hours. CA exendin-4 is a N-terminal-modified exendin-4 in which the alpha carbon is deleted from the N-terminal histidine residue of a native exendin and the β-carbon of the side chain is directly bound to a carboxyl carbon. At this time, the reaction was conducted in a 100mM Na-phosphate buffer (pH 9.0), and a reducing agent, 20mM SCB was added thereto. The mono-peglated peptide was primarily purified from the reaction solution through a SOURCE Q (XK 16ml, Amersham Biosciences), and the isomer was separated through a SOURCES (XK 16ml, Amersham Biosciences).
It could be seen that two lysine(Lys)-pegylated peaks appeared. The pegylated sites were confirmed from the eluted peaks by a peptide mapping method.
The Lys12-pegylated conjugate was eluted first, and then the Lys27-pegylated conjugate was eluted in the last portion. A perfect peak separation between N-terminal positional isomer N-terminal positional isomer and the Lys12 positional isomer allowed was possible
Column : SOURCE Q (XK 16ml, Amersham Biosciences)
Flow rate : 2.0ml/min
Gradient : A 0 → 40% 80min B (A: 20mM tris pH8.5, B: A + 0.5M NaCl)
Column : SOURCE S (XK 16ml, Amersham Biosciences)
Flow rate : 2.0ml/min
Gradient : A 0 → 100% 50 min B (A : 20mM citric acid pH 3.0, B : A + 0.5M KCl)
Example 3: Preparation of imidazo-acetyl exendin-4 (Lys27)-immunoglobulin Fc conjugate
3.4K PropionALD(2) PEG was reacted with the Lys of CA exendin-4 using imidazo-acetyl exendin-4 (CA exendin-4, AP, USA) in the same manner as in Example 2. The coupling reaction was then conducted using the last isomer peak (positional isomer of Lys 27), which shows a lot of reactivity and is easily distinguished from the N-terminal isomer, among the two Lys isomer peaks. The peptide and the immunoglobulin Fc were reacted at a molar ratio of 1:8, and a total protein concentration of 60 mg/mL at 4℃ for 20 hours. The reaction wsa performed in a solution of 100mM K-P (pH 6.0) and a reducing agent, 20mM SCB, was added thereto. After the coupling reaction, the two step purification using 16ml of SOURCE Q and 16ml of SOURCE ISO was the same as in Example 2. The result of the reverse phase HPLC analysis showed a purity of 95.8%.
Example 4: Separation of human peripheral blood mononuclear cells (PBMC) for the ex vivo test and selection of the donors
Human peripheral blood mononuclear cells (PBMC) were separated within 24 hours from blood collected from healthy donors. Donating blood has been supplied by UK National Blood Transfusion Service (Addenbrooke Hospital, Cambridge, UK). The peripheral blood mononuclear cells were separated from a buffy coat obtained by a density gradient centrifugation method using LymphoprepTM (Axis-shield, Dundee, Scotland). Among them, CD8+T cells were removed using CD8+ RosetteSepTM (StemCell Technologies Inc, London, UK). The peripheral blood mononuclear cells of each donor were stored in liquid nitrogen until before use. HLA-DR haploid genotype of the cells of the donor were analyzed using HLA SSP-PCR based tissue-typing kit (Biotest, Solihull, UK). The reactivity of the T cells was tested using KLH (Keyhole Limpet Haemocyanin, Pierce (Perbio), Northumberland, UK), which is an antigen peptide derived from influenza A and Epstein Barr virus.
50 donors representing the frequency of HLA-DR type of the world's population were selected and composed of a single cohort. MHC class II haploid genotypes and the reactivity of T cells for each donor constituting the cohort is shown in Table 1 below. The frequency of the genotype of the donor was compared with the frequency of the world's population and the results are shown in Figure 1. Table 1 below shows the HLA-DR genotypes and the reactivity of T-cells on the antigenic peptides KLH for each donor.
Donor No. Haplotype KLH
Test 1 HAN03
1 DRB1*01,DRB1*13;DRB3* 2.25 18.69
2 DRB1*07,DRB1*12;DRB3*;DRB4* 1.11 1.60
3 DRB1*03,DRB1*15;DRB3*;DRB5* 2.66 2.87
4 DRB1*01,DRB1*07;DRB3*;DRB4* 5.54 7.54
5 DRB1*03,DRB1*16;DRB3*;DRB5* 7.02 3.46
6 DRB1*01,DRB1*13;DRB3* 4.36 14.17
7 DRB1*03,DRB1*04;DRB3*;DRB4* 4.45 9.98
8 DRB1*03,DRB1*13;DRB3* 8.85 4.37
9 DRB1*01,DRB1*12;DRB3* 4.79 8.45
10 DRB1*01,DRB1*13;DRB3* 2.53 3.14
11 DRB1*07,DRB1*15;DRB4*;DRB5* 3.00 10.29
12 DRB1*04,DRB1*13;DRB3*;DRB4* 2.70 9.31
13 DRB1*01,DRB1*12;DRB3* 2.55 15.07
14 DRB1*11,DRB1*15;DRB3*;DRB5* 0.27 1.55
15 DRB1*07,DRB1*15;DRB3*;DRB5* 3.03 8.78
16 DRB1*10,DRB1*13;DRB3* 4.08 4.65
17 DRB1*07,DRB1*11;DRB3*;DRB4* 1.13 5.80
18 DRB1*03,DRB1*04;DRB3*;DRB4* 0.61 5.34
19 DRB1*03,DRB1*13;DRB3* 2.42 12.17
20 DRB1*04,DRB1*12;DRB3*;DRB4* 2.76 6.51
21 DRB1*15;DRB5* 3.38 3.27
22 DRB1*04,DRB1*15;DRB4*;DRB5* 2.11 3.55
23 DRB1*04,DRB1*11;DRB3*;DRB4* 1.93 3.28
24 DRB1*13,DRB1*15;DRB3*;DRB5* 8.93 6.66
25 DRB1*11,DRB1*13;DRB3* 2.02 2.99
26 DRB1*04,DRB1*07;DRB4* 2.42 1.97
27 DRB1*11,DRB1*13;DRB3* 5.55 1.20
28 DRB1*04,DRB1*11;DRB3*;DRB4* 3.97 3.93
29 DRB1*03,DRB1*04;DRB3*;DRB4* 2.00 6.76
30 DRB1*03,DRB1*15;DRB3*;DRB5* 1.22 13.32
31 DRB1*15,DRB1*16;DRB5* 3.95 5.75
32 DRB1*03,DRB1*11;DRB3* 2.82 3.74
33 DRB1*13,DRB1*15;DRB3*;DRB5* 2.43 1.97
34 DRB1*04,DRB1*15;DRB4*;DRB5* 3.79 4.70
35 DRB1*01,DRB1*04;DRB4* 9.24 8.67
36 DRB1*03,DRB1*04;DRB3*;DRB4* 2.21 3.06
37 DRB1*10,DRB1*15;DRB5* 12.11 4.03
38 DRB1*08,DRB1*13;DRB3* 4.85 3.22
39 DRB1*04,DRB1*11;DRB3*;DRB4* 5.37 6.43
40 DRB1*01,DRB1*16;DRB5* 3.22 4.15
41 DRB1*08,DRB1*15;DRB5* 2.24 2.92
42 DRB1*14;DRB1*15;DRB3*;DRB5* 20.58 13.67
43 DRB1*15,DRB1*16;DRB5* 3.50 4.88
44 DRB1*15;DRB5* 2.01 7.01
45 DRB1*07,DRB1*11;DRB3*;DRB4* 1.93 13.71
46 DRB1*01,DRB1*04;DRB4* 29.18 19.33
47 DRB1*03,DRB1*07;DRB3*;DRB4* 2.31 3.49
48 DRB1*07,DRB1*15;DRB4*;DRB5* 2.20 29.21
49 DRB1*03,DRB1*07;DRB3*;DRB4* 0.94 1.72
50 DRB1*03,DRB1*15;DRB3*;DRB5* 0.73 3.27
In Table 1 above, the bolded section (donors 17, 18, 27, 30, and 50) shows cases in which the reactivity with KLH before and after thawing of the donor cells was significently different.
Example 5: EpiScreenTM ex vivo T cell proliferation test
In order to identify the immunogenicity suppression mechanism according to the pegylated sites of insulinotropic peptides that are representative physiologically active protein or peptide, the T cell proliferative capacities of unbound native exendin-4 and unbound CA exendin-4, CA exendin-4 (CA Exendin-4-PEG(inter)) pegylated at the lysine residue, and the native exendin-4 (Exendin-4-PEG(N-term)) pegylated at the N-terminus were campared. At this time, since the CA exendin-4 does not have N-terminal residue that can be pegylated, the N-terminal pegylated CA-exendin-4 was not prepared for the CA exendin-4.
For T cell proliferation test, the peripheral blood mononuclear cells (PBMC) of the donor were thawed to measure the cell number and viability. Cells were diluted to 4-6x106 cells/ml in AIM-V culture medium. After dispensing the cells of each donor in 24-well culture plates, the test samples were added to a final concentration of 50㎍/ml (n=3). The antigen peptide KLH treated group was placed to indentify the reproducility of each donor cell. All the test groups and the control groups were cultured at 37℃ and 5% CO2 incubator condition for 8 days. A part of the cells was taken on the 5th, 6th, 7th and 8th day and transferred to the 96-well culture plates to measure the cell proliferation rate. For the measurement of the cell proliferation rate, 0.75μi [3H]-Thymidine (Perkin Elmer Buckinghamshire, UK) was added per well and cultured for 18 hours, and the cells were then collected with the 96-well filter plates using TomTec Mach III cell collecting device.
The radioactivity of each well (count per minute, cpm) was measured using 1450 Microbeta Wallac Trilux Liquid Scintillation Counter (Perkin Elmer Buckinghamshire, UK). The results have been determined based on the experimental thresholds of simulation index (SI) that two or more SI (SI≥2, p <0.05) was positive. In the case of including the boundary values corresponding to SI≥1.9, it was separately indicated as (P*). As a result, the CA exendin-4 and exendin-4 exhibited positive in 12% and 10% of donors, respectively. However, the CA exendin-4 pegylated to the internal residue of the peptide exhibited negative in all donors. On the other hand, the exendin-4 pegylated to the N-terminus exhibited positive in 6% of donors. Accordingly, if the pegylation was made to the internal lysine residue of the peptide rather than the N-terminus, the immunogenicity of the peptide was significantly inhibited (Table 2). Table 2 shows T-cell proliferation and interleukin-2 (IL-2) secretion.
CA Exendin-4 Exendin -4 CA Exendin-4-PEG (inter) Exendin -4-PEG (N-term) Humanised A33 KLH
Donor 1 PE E PE
Donor 2 E
Donor 3 E PE
Donor 4 P E* PE
Donor 5 PE
Donor 6 PE
Donor 7 E* P*E PE
Donor 8 P
Donor 9 PE* PE E* PE
Donor 10 P
Donor 11 PE
Donor 12 PE
Donor 13 PE PE
Donor 14 E
Donor 15 P
Donor 16 PE PE* PE
Donor 17 P PE PE PE
Donor 18 PE* PE
Donor 19 PE
Donor 20 PE
Donor 21 E E PE PE
Donor 22 PE PE
Donor 23 E PE
Donor 24 PE
Donor 25 PE
Donor 26 P*E
Donor 27 PE P*E E
Donor 28 PE
Donor 29 PE* PE
Donor 30 P
Donor 31 PE
Donor 32 PE*
Donor 33 P*E P*E
Donor 34 PE
Donor 35 PE
Donor 36 PE PE
Donor 37 PE
Donor 38 P
Donor 39 PE
Donor 40 E* PE
Donor 41 P*E PE
Donor 42 P
Donor 43 PE PE PE
Donor 44 PE PE
Donor 45 PE
Donor 46 P*E PE
Donor 47 PE
Donor 48 PE PE
Donor 49
Donor 50 E PE
% Proliferation 12 10 0 6 22 92
ELISpot % 12 16 2 6 30 86
Proliferation and ELISpot % 10 10 0 4 22 80
Correlation % 83 100 N/A 67 100 87
Table 3 shows the strength and frequency of T-cell proliferation resonse (including SI≥1.9 boundary value).
Mean SI Standard Deviation Frequency of Response ( % )
CA Exendin -4 2.09 0.2 12
Exendin -4 2.68 1.46 10
CA Exendin -4-PEG(inter) N/A N/A 0
Exendin-4-PEG(N-term) 2.33 0.17 6
Humanised A33 2.17 0.28 22
KLH 5.16 3.94 92
The above-described results suggest that the immunogenicity of the physiologically active protein or peptide bound to the non-peptidyl polymer, particularly PEG, through internal residue other than the terminal of the physiologically protein or peptide is inhibited.
Example 6: EpiScreenTM ex vivo interleukin-2 (IL-2) secretion test
In order to identify the immunogenicity suppression mechanism according to the pegylated sites of insulinotropic peptides that are representative protein or peptide, the IL-2 secretory capacities of the unbound exendin-4 and the peglyated exendin-4 of Example 5 was compared and measured using donor cells and the samples, which are the same as in EpiScreenTM T cell proliferation assays. The anti-interleukin-2 antibody (R & D Systems, Abingdon, UK) was bound to ELISpot plates (Millipore, Herts, UK). The plate was washed three times with PBS (phosphate-buffered saline), and then PBS, supplemented with 1% bovine serum albumin, was added and reacted. After washing with AIM-V culture medium, the donor cells diluted with AIM-V medium (4-6x106 cells/ml) were dispensed per 100 ㎕/well. The test sample was added each 50㎕ (n=6) so that the final concentration is 50 ㎍/ml(n = 6). After culturing for 8 days, biotinylated IL-2 detection antibody and streptavidin-AP (R & D Systems, Abingdon, UK) were bound sequentially to ELISpot plates and then BCIP/NBT (R&D Systems, Abingdon, UK) was added to the plates to express a spot. The reaction was completed by washing with distilled water and then the plate was dried. Spots per well (spw) were scanned and analyzed using Immunoscan Analyser. The results of the activity measurement test of ex vivo T cells were determined based on the experimental threshold of stimulation index (SI) that two or more SI (SI≥2, p <0.05) was positive. In the case of including the boundary values corresponding to SI≥1.9, it was separately indicated as (P*). As a result, the CA exendin-4 and exendin-4 exhibited positive in 12% and 16% of donors, respectively. However, the CA exendin-4 pegylated to the internal residue of the peptide exhibited positive only in 2% of donors.. On the other hand, the exendin-4 pegylated to the N-terminus exhibited positive in 6% of donors. Accordingly, if the pegylation was made to the internal lysine of the peptide rather than the N-terminus, the immunogenicity of the peptide was significantly inhibited (Tables 2 to 4). Table 4 shows the strength and fequency of interleukin-2 (IL-2) secretion response of T cells (including SI≥1.9 boundary value).
Mean SI Standard Deviation Frequency of Response ( % )
CA Exendin -4 2.18 0.23 12
Exendin -4 2.22 0.19 16
PEG-CA Exendin -4 2.35 N/A 2
3.4K PEG(N-term) Exendin-4 2.09 0.17 6
Humanised A33 2.24 0.43 30
KLH 3.79 1.84 86
The above-described results suggest that the immunogenicity of the physiologically active protein or peptide bound to the non-peptidyl polymer, particularly PEG, through internal residue other than the terminal of the physiologically protein or peptide is inhibited.
Example 7: Production of antibodies against long-acting insulinotropic peptides in normal rats
The conjugates in which the CA exendin-4 was linked to immunoglobulin Fc fragment via PEG prepared in Example 3 were administrated subcutaneously to a normal Sprague Dawley rat once a week for 26 weeks (low, mild or high dosage), and then placed during the recovery period of 4 weeks (n = 40~60/group). The blood was collected before and during administration, at the 13rd, 19th and 26th week, and at the end of the recovery period, the serum was separated from this. It was determined on whether to produce the antibodies against the insulinotropic peptide.
As a result, among 160 subjects administered with a drug, the antibodies were detected in only two objects after the recovery period of 13 weeks. However, these antibodies were confirmed to be not neutralizing antibodies for the drug (Table 5). Table 5 shows the production of the antibody at 26-week administration in rats (SD Rat).
Group Dose n/group Positive Time point % positive Neutralizing Ab
1 vehicle 60 0 - 0 0
2 low dose 40 1 Week 13 2.5 0
3 mid dose 40 0 - 0 0
4 high dose 60 1 recovery 1.6 0
Total 200 2 1.0 0
Example 8: Production test of antibodies against persistent insulin secretion peptide in Cynomolgus monkey
The conjugates in which the CA exendin-4 was bound to immunoglobulin Fc fragment via PEG prepared in Example 3 were subcutaneously administered to Cynomolgus monkey once a week for 26 weeks, and then placed during the recovery period of 4 weeks (n=8~12/group). The blood was taken before and during administration, at the 12th, 19th and 26th week, and at the end of the recovery period, the serum was separated from this. It was determined whether to produce the antibodies against the insulinotropic peptide.
As a result, no production of the antibodies in all subjects was detected (Table 6). Table 6 shows production of antibodies at the 26-week administration in Cynomolgus monkey.
Group Dose n/group Positive/ total % positive
1 vehicle 12 0 0
2 low dose 8 0 0
3 mid dose 8 0 0
4 high dose 12 0 0
Total 40 0 0
Example 9: Detection of the anti-drug antibody in the blood and evaluation of the neutralizing capacity
In order to detect whether the conjugate of Example 3 has produced an anti-drug antibody (ADA) in the body of rat or Cynomolgus monkey, the conjugate was examined by the bridging ELISA method. The biotinylated conjugate of Example 3 was bound to the 96-well microplate in which streptavidin was coupled to the bottom thereof, and washed with water. Digoxigenin(DIG)-labeled conjugate of Example 3 (hereinafter, HM11260C) was added along with the serum samples of rat or monkey to react and then washed with water. Then, the horseradish peroxidase-coupled anti-DIG antibody (anti-DIG-POD antibody) was added and developed by TMB substrate (3,3',5,5'-tetramethylbenzidine substrate).
Measurement sensitivity in the rat serum was 3.1 ng/ml, and the measurement sensitivity in monkey serum was 12.5 ng/ml. To evaluate the neutralizing capacity against HM11260C of detected anti HM11260C antibody, serum samples and HM11260C were added to the human GLP-1 overexpressed cell line (GLP-1R/CHO) and then the inhibiton rate of cAMP-induction was measured. The antibodies produced by only two of the 160 animals were confirmed to have no neutralizing ability.
The above-described results suggest that the immunogenicity of the physiologically active protein or peptide was decreased by binding a non-peptide linker and Fc fragment to the internal residue other than the terminal of the physiologically active protein or peptide, thus inhibiting the mechanism in which the desired peptide acts as an antigen. The results also support that, in the case of using the producing method as described above, the activation of T cells and the antibody production reaction in animals were significantly inhibited.
From the foregoing description, it will be understood by those skilled in the art that the present invention may be embodied in other specific forms without changing the technical spirit or essential characteristics of the invention. In this regard, the above-described embodiments are for illustrative purposes and should be understood to be not limited thereto. It should be interpreted as encompassing all changes or modified forms derived from the meaning and range and equivalents thereof of the appended claims rather than the foregoing detailed description.

Claims (16)

  1. A method for decreasing immunogenicity of a physiologically active protein or peptide as compared to that of a physiologically active protein or peptide to which a carrier is not bound, which comprises binding a carrier to the non-terminal, internal residue of the physiologically active protein or peptide.
  2. The method according to claim 1, wherein the carrier is selected from the group consisting of a polyethylene glycol, a fatty acid, a cholesterol, an albumin or a fragment thereof, an albumin-binding substance, a polymer having repeating units of a particular amino acid sequence, an antibody, an antibody fragment, a FcRn binding substance, an in- vivo connective tissue or a derivative thereof, a nucleotide, a fibronectin, a transferrin, an elastin-like polypeptide(ELP), a XTEN polypeptide, a carboxy-terminal peptide (CTP), a structure inducing probe (SIP), a saccharide and a high molecular weight polymer.
  3. The method according to claim 2, wherein the FcRn binding substance includes an immunoglobulin Fc region.
  4. The method according to claim 1, wherein the physiologically active protein or peptide and the carrier are bound via a linker interposed therebetween.
  5. The method according to claim 3, wherein the linker is a non-peptidyl linker.
  6. The method according to claim 4, wherein the non-peptidyl linker is selected from the group consisting of a polyethylene glycol, a polypropylene glycol, an ethylene glycol-propylene glycol copolymer, a polyoxyethylated polyol, a polyvinyl alcohol, a polysaccharide, a dextran, a polyvinyl ethyl ether, a biodegradable polymer, a lipid polymer, a chitin, a hyaluronic acid and a combination thereof.
  7. The method according to claim 4, wherein the physiologically active protein or peptide is bound to an immunoglobulin Fc region via a non-peptidyl polymer which is selected from the group consisting of a polyethylene glycol, a polypropylene glycol, an ethylene glycol-propylene glycol copolymer, a polyoxyethylated polyol, a polyvinyl alcohol, a polysaccharide, a dextran, a polyvinyl ethyl ether, a biodegradable polymer, a lipid polymer, a chitin, a hyaluronic acid and a combination thereof.
  8. The method according to claim 1, wherein the physiologically active protein or peptide is selected from the group consisting of an anti-obesity peptide, an insulinotropic peptide or an analog thereof, a leptin, an insulin, an insulin analog, a glucagon, a human growth hormone, a growth hormone releasing hormone, a growth hormone releasing peptide, an interferon, an interferon receptor, a colony stimulating factor, a glucagon-like peptide such as GLP-1, a GLP-1/glucagon dual agonist, a gastric inhibitory polypeptide (GIP), a G-protein-coupled receptor, an interleukin, an interleukin receptor, an enzyme, an interleukin binding protein, a cytokine binding protein, a macrophage activating factor, a macrophage peptide, a B cell factor, a T cell factor, a protein A, an allergy inhibitory factor, a cell necrosis glycoprotein, an immunotoxin, a lymphotoxin, a tumor necrosis factor, a tumor inhibitory factor, a metastasis growth factor, an alpha-1 antitrypsin, an albumin, an α-lactalbumin, a apolipoprotein-E, an erythropoiesis factor, a highly glycosylated erythropoiesis factor, an angiopoietin, a hemoglobin, a thrombin, a thrombin receptor activating peptide, a thrombomodulin, blood factors VII, VIIa, VIII, IX and XIII, a plasminogen activating factor, a fibrin-binding peptide, an urokinase, a streptokinase, a hirudine, a protein C, C-reactive protein, a renin inhibitor, a collagenase inhibitor, a superoxide dismutase, a platelet-derived growth factor, an epithelial cell growth factor, an epidermal growth factor, an angiostatin, an angiotensin, a bone growth factor, a bone stimulating protein, a calcitonin, an atriopeptin, a cartilage inducing factor, an elcatonin, a connective tissue activating factor, a tissue factor pathway inhibitor, a follicle stimulating hormone, a luteinizing hormone, a luteinizing hormone releasing hormone, a nerve growth factor, a parathyroid hormone, a relaxin, a secretin, a somatomedin, an insulin-like growth factor, an adrenocortical hormone, a glucagon, a cholecystokinin, a pancreatic polypeptide, a gastrin-releasing peptide, a cortincotropin releasing factor, a thyroid stimulating hormone, an autotaxin, a lactoferrin, a myostatin, a receptor, a receptor antagonist, a cell surface antigen, a virus-derived vaccine antigen, a monoclonal antibody, a polyclonal antibody, and an antibody fragment.
  9. The method according to claim 8, wherein the physiologically active protein or peptide is selected from the group consisting of an exendin-4, an exendin-4 derivative, a GLP-1 agonist, an insulin and a GLP-1/glucagon dual agonist.
  10. The method according to claim 9, wherein the exendin-4 derivative is an exendin-4 derivative in which the charge on the N-terminal of exendin-4 is modified, which is selected from the group consisting of an exendin-4 derivative in which N-terminal amine group of exendin-4 is deleted; an exendin-4 derivative in which N-terminal amine group of exendin-4 is substituted with hydroxl group; an exendin-4 derivative in which N-terminal amine group of exendin-4 is substituted with carboxyl group; an exendin-4 derivative in which N-terminal amine group of exendin-4 is modified with dimethyl group; and an exendin-4 derivative in which alpha carbon of N-terminal histidine residue of exendin-4 is deleted.
  11. The method according to claim 9 or 10, wherein the internal residue is a lysine residue at position 12 or 27 of the exendin-4 derivative in which N-terminal charge of exendin-4 is modified.
  12. The method according to claim 11, wherein the internal residue is a lysine residue at position 27 of the exendin-4 derivative in which N-terminal charge of exendin-4 is modified.
  13. The method according to claim 11, wherein the exendin-4 derivative in which the charge on the N-terminal of the exendin-4 is modified is an exendin-4 derivative in which alpha carbon of N-terminal histidine residue of exendin-4 is deleted.
  14. A composition, comprising a conjugate of a physiologically active protein or peptide in which a carrier is bound to the non-terminal, internal residue of a physiologically active protein or peptide, via a non-peptidyl linker, wherein the conjugate exhibits decreased immunogenicity as compared to that of the physiologically active protein or peptide to which the carrier is not bound.
  15. The composition according to claim 14, wherein the conjugate has decreased immunogenicity, which is a side effect of a long-acting preparation.
  16. The composition according to claim 14, wherein the non-peptidyl linker is a polyethylene glycol.
PCT/KR2015/005651 2014-06-05 2015-06-05 Method for decreasing immunogenicity of protein and peptide WO2015186988A1 (en)

Priority Applications (18)

Application Number Priority Date Filing Date Title
MX2016015668A MX2016015668A (en) 2014-06-05 2015-06-05 Method for decreasing immunogenicity of protein and peptide.
AU2015269039A AU2015269039B2 (en) 2014-06-05 2015-06-05 Method for decreasing immunogenicity of protein and peptide
JP2016570961A JP7125249B2 (en) 2014-06-05 2015-06-05 Methods of reducing immunogenicity of proteins and peptides
EP15802343.2A EP3152236A4 (en) 2014-06-05 2015-06-05 Method for decreasing immunogenicity of protein and peptide
MYPI2016002124A MY193519A (en) 2014-06-05 2015-06-05 Method for decreasing immunogenicity of protein and peptide
BR112016028227A BR112016028227A2 (en) 2014-06-05 2015-06-05 method for reducing protein and peptide immunogenicity
HU1700024A HUP1700024A2 (en) 2014-06-05 2015-06-05 Method for decreasing immunogenicity of protein and peptide
SG11201610098YA SG11201610098YA (en) 2014-06-05 2015-06-05 Method for decreasing immunogenicity of protein and peptide
EP23161874.5A EP4219565A1 (en) 2014-06-05 2015-06-05 Method for decreasing immunogenicity of protein and peptide
EA201692279A EA035964B1 (en) 2014-06-05 2015-06-05 Method for decreasing immunogenicity of protein and peptide
US15/315,992 US20170100488A1 (en) 2014-06-05 2015-06-05 Method for decreasing immunogenicity of protein and peptide
CA2950576A CA2950576A1 (en) 2014-06-05 2015-06-05 Method for decreasing immunogenicity of protein and peptide
UAA201611826A UA124183C2 (en) 2014-06-05 2015-06-05 Method for decreasing immunogenicity of protein and peptide
CN201580030057.9A CN106661118A (en) 2014-06-05 2015-06-05 Method for decreasing immunogenicity of protein and peptide
IL249131A IL249131A0 (en) 2014-06-05 2016-11-22 Method for decreasing immunogenicity of protein and peptide
PH12016502430A PH12016502430A1 (en) 2014-06-05 2016-12-05 Method for decreasing immunogenicity of protein and peptide
NO20161980A NO20161980A1 (en) 2014-06-05 2016-12-14 Method for decreasing immunogenicity of protein and peptide
US17/566,368 US20220118103A1 (en) 2014-06-05 2021-12-30 Method for decreasing immunogenicity of protein and peptide

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR10-2014-0068660 2014-06-05
KR1020140068660A KR20150140177A (en) 2014-06-05 2014-06-05 Method of decreasing immunogenicity of protein and pepteide

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US15/315,992 A-371-Of-International US20170100488A1 (en) 2014-06-05 2015-06-05 Method for decreasing immunogenicity of protein and peptide
US17/566,368 Continuation US20220118103A1 (en) 2014-06-05 2021-12-30 Method for decreasing immunogenicity of protein and peptide

Publications (1)

Publication Number Publication Date
WO2015186988A1 true WO2015186988A1 (en) 2015-12-10

Family

ID=54767003

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2015/005651 WO2015186988A1 (en) 2014-06-05 2015-06-05 Method for decreasing immunogenicity of protein and peptide

Country Status (20)

Country Link
US (2) US20170100488A1 (en)
EP (2) EP4219565A1 (en)
JP (2) JP7125249B2 (en)
KR (3) KR20150140177A (en)
CN (1) CN106661118A (en)
AR (1) AR100768A1 (en)
AU (1) AU2015269039B2 (en)
BR (1) BR112016028227A2 (en)
CA (1) CA2950576A1 (en)
EA (1) EA035964B1 (en)
HU (1) HUP1700024A2 (en)
IL (1) IL249131A0 (en)
MX (2) MX2016015668A (en)
MY (1) MY193519A (en)
NO (1) NO20161980A1 (en)
PH (1) PH12016502430A1 (en)
SG (2) SG11201610098YA (en)
TW (1) TW201625314A (en)
UA (1) UA124183C2 (en)
WO (1) WO2015186988A1 (en)

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN110291103A (en) * 2016-12-05 2019-09-27 韩美药品株式会社 The conjugate of immune response with reduction
JP2019532019A (en) * 2016-07-22 2019-11-07 ネクター セラピューティクス Conjugates of factor VIII moieties with oxime-containing linkages
EP3578204A4 (en) * 2017-02-03 2021-01-06 Hanmi Pharm. Co., Ltd. Conjugate of bioactive material having enhanced sustainability and use thereof

Families Citing this family (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20130049671A (en) 2011-11-04 2013-05-14 한미사이언스 주식회사 Method for preparation of biological active polypeptide conjugate
AR090281A1 (en) 2012-03-08 2014-10-29 Hanmi Science Co Ltd IMPROVED PROCESS FOR THE PREPARATION OF A PHYSIOLOGICALLY ACTIVE POLYPEPTIDE COMPLEX
KR102385120B1 (en) * 2014-03-31 2022-04-12 한미약품 주식회사 Method of increasing solubility of peptide and protein by immunoglobulin Fc fragment conjugation
KR20150140177A (en) * 2014-06-05 2015-12-15 한미약품 주식회사 Method of decreasing immunogenicity of protein and pepteide
JP7379323B2 (en) * 2017-08-18 2023-11-14 ザ・ジョンズ・ホプキンス・ユニバーシティ Supramolecular filament assembly for protein purification
CN111315767A (en) 2017-08-22 2020-06-19 萨纳生物有限责任公司 Soluble interferon receptors and uses thereof
WO2019066603A1 (en) * 2017-09-29 2019-04-04 한미약품 주식회사 Persistent protein conjugate with improved efficiency

Citations (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1996032478A1 (en) 1995-04-14 1996-10-17 Genentech, Inc. Altered polypeptides with increased half-life
WO1997034631A1 (en) 1996-03-18 1997-09-25 Board Of Regents, The University Of Texas System Immunoglobin-like domains with increased half lives
WO2002066514A2 (en) * 2001-02-19 2002-08-29 Merck Patent Gmbh Artificial fusion proteins with reduced immunogenicity
WO2008082274A1 (en) 2007-01-05 2008-07-10 Hanmi Pharmaceutical Co., Ltd. An insulinotropic complex using an immunoglobulin fragment
KR20100105494A (en) * 2009-03-20 2010-09-29 한미홀딩스 주식회사 Method for preparing a site-specific physiologically active polypeptide conjugate
WO2012169798A2 (en) 2011-06-10 2012-12-13 Hanmi Science Co., Ltd. Novel oxyntomodulin derivatives and pharmaceutical composition for treating obesity comprising the same
WO2012173422A1 (en) 2011-06-17 2012-12-20 Hanmi Science Co., Ltd. A conjugate comprising oxyntomodulin and an immunoglobulin fragment, and use thereof
KR20120137277A (en) 2011-06-10 2012-12-20 니폰 제온 가부시키가이샤 Liquid crystal composition for patterned retardation film, patterned retardation film, and stereoscopic display device
US20130122023A1 (en) 2010-07-21 2013-05-16 Hanmi Science Co., Ltd. Novel long-acting glucagon conjugate and pharmaceutical composition comprising the same for the prevention and treatment of obesity
KR20140106452A (en) 2013-02-26 2014-09-03 한미약품 주식회사 Novel insulin analog and use thereof

Family Cites Families (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP1438966B1 (en) * 1999-12-08 2007-02-14 Cyclacel Pharmaceuticals, Inc. Use of depsipeptide and congeners thereof as immunosuppressants for treating an infectious disease, an autoimmune disease, allergic reactions or a hyperproliferative skin disease.
US6706289B2 (en) * 2000-10-31 2004-03-16 Pr Pharmaceuticals, Inc. Methods and compositions for enhanced delivery of bioactive molecules
US8263084B2 (en) 2003-11-13 2012-09-11 Hanmi Science Co., Ltd Pharmaceutical composition for treating obesity-related disease comprising insulinotropic peptide conjugate
US8420598B2 (en) * 2007-04-20 2013-04-16 B & L Delipharm Corp. Mono modified exendin with polyethylene glycol or its derivatives and uses thereof
UA113626C2 (en) 2011-06-02 2017-02-27 A COMPOSITION FOR THE TREATMENT OF DIABETES CONTAINING THE DURABLE INSULIN CON conjugate AND THE DUAL ACTION INSULINOTROPIC PIPIDE
KR20140088837A (en) 2013-01-03 2014-07-11 한미약품 주식회사 Insulinotropic peptide derivative wherein its N-terminal charge is modified
KR20150140177A (en) * 2014-06-05 2015-12-15 한미약품 주식회사 Method of decreasing immunogenicity of protein and pepteide

Patent Citations (12)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1996032478A1 (en) 1995-04-14 1996-10-17 Genentech, Inc. Altered polypeptides with increased half-life
WO1997034631A1 (en) 1996-03-18 1997-09-25 Board Of Regents, The University Of Texas System Immunoglobin-like domains with increased half lives
WO2002066514A2 (en) * 2001-02-19 2002-08-29 Merck Patent Gmbh Artificial fusion proteins with reduced immunogenicity
WO2008082274A1 (en) 2007-01-05 2008-07-10 Hanmi Pharmaceutical Co., Ltd. An insulinotropic complex using an immunoglobulin fragment
KR101058290B1 (en) 2007-01-05 2011-08-22 한미홀딩스 주식회사 Insulin Secreting Peptide Drug Conjugates Using Immunoglobulin Fragments
KR20100105494A (en) * 2009-03-20 2010-09-29 한미홀딩스 주식회사 Method for preparing a site-specific physiologically active polypeptide conjugate
US20130122023A1 (en) 2010-07-21 2013-05-16 Hanmi Science Co., Ltd. Novel long-acting glucagon conjugate and pharmaceutical composition comprising the same for the prevention and treatment of obesity
WO2012169798A2 (en) 2011-06-10 2012-12-13 Hanmi Science Co., Ltd. Novel oxyntomodulin derivatives and pharmaceutical composition for treating obesity comprising the same
KR20120137277A (en) 2011-06-10 2012-12-20 니폰 제온 가부시키가이샤 Liquid crystal composition for patterned retardation film, patterned retardation film, and stereoscopic display device
WO2012173422A1 (en) 2011-06-17 2012-12-20 Hanmi Science Co., Ltd. A conjugate comprising oxyntomodulin and an immunoglobulin fragment, and use thereof
KR20140106452A (en) 2013-02-26 2014-09-03 한미약품 주식회사 Novel insulin analog and use thereof
WO2014133324A1 (en) 2013-02-26 2014-09-04 한미약품 주식회사 Novel insulin analog and use thereof

Non-Patent Citations (15)

* Cited by examiner, † Cited by third party
Title
ANONYMOUS, PEPTIDE THERAPEUTIC SYMPOSIUM, 24 October 2008 (2008-10-24)
BAKER MPJONES TD, CURR. OPIN. DRUG DISC DEV, vol. 10, no. 2, 2007, pages 219 - 227
BUSE, J.B. ET AL., DIABETES CARE, vol. 27, 2004, pages 2628 - 2635
CHESTER, KBAKER, MPMAYER A, EXPERT REV CLIN IMMUNOL, vol. 1, no. 4, 2005, pages 549 - 559
CHOI ET AL.: "A Long-acting exendin-4 analog conjugate to the human Fc fragment reveals low immunogenic potential", AMERICAN DIABETES ASSOCIATION'S 74TH ANNUAL SCIENTIFIC SESSIONS, 14 June 2014 (2014-06-14), XP002767699 *
CZAJKOWSKY ET AL.: "Fc-fusion proteins: new developments and future perspectives", EMBO MOLECULAR MEDICINE, vol. 4, no. Issue 10, 2012, pages 1015 - 1028, XP055160259, ISSN: 1757-4676 *
DEFRONZO, R.A. ET AL., DIABETES CARE, vol. 28, 2005, pages 1092 - 1100
GLAESNER ET AL.: "Engineering and characterization of the long-acting glucagon-like peptide-1 analogue LY2189265, an Fc fusion protein", DIABETES/METABOLISM RESEARCH AND REVIEWS, vol. 26, no. 4, 2010, pages 287 - 296, XP055181624, ISSN: 1520-7552 *
H. NEURATHR. L. HILL: "The Proteins", 1979, ACADEMIC PRESS
LIANG ET AL.: "Immunity against a therapeutic xenoprotein/Fc construct delivered by gene transfer is reduced through binding to the inhibitory receptor FcgammaRIIb", THE JOURNAL OF GENE MEDICINE, vol. 13, no. 9, 2011, pages 470 - 477, XP055239698, ISSN: 1099-498x *
LIM LC., HEMATOLOGY, vol. 10, no. 3, 2005, pages 255 - 9
NAMAKA M ET AL., CURR MED RES OPIN, vol. 22, no. 2, 2006, pages 223 - 39
SCHNABEL CA ET AL., PEPTIDES, vol. 27, 2006, pages 1902 - 1910
See also references of EP3152236A4
ZINMAN, B. ET AL., ANNALS OF INTERNAL MEDICINES, vol. 146, no. 7, 2007, pages 477 - 486

Cited By (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP2019532019A (en) * 2016-07-22 2019-11-07 ネクター セラピューティクス Conjugates of factor VIII moieties with oxime-containing linkages
US11628205B2 (en) 2016-07-22 2023-04-18 Nektar Therapeutics Conjugates of a factor VIII moiety having an oxime-containing linkage
CN110291103A (en) * 2016-12-05 2019-09-27 韩美药品株式会社 The conjugate of immune response with reduction
JP2019536823A (en) * 2016-12-05 2019-12-19 ハンミ ファーマシューティカル カンパニー リミテッド Conjugate with reduced immune response
EP3549950A4 (en) * 2016-12-05 2020-08-19 Hanmi Pharm. Co., Ltd. Conjugate having attenuated immune response
EP3578204A4 (en) * 2017-02-03 2021-01-06 Hanmi Pharm. Co., Ltd. Conjugate of bioactive material having enhanced sustainability and use thereof

Also Published As

Publication number Publication date
KR20150140177A (en) 2015-12-15
US20170100488A1 (en) 2017-04-13
AU2015269039B2 (en) 2020-12-10
EP4219565A1 (en) 2023-08-02
AR100768A1 (en) 2016-11-02
NO20161980A1 (en) 2016-12-14
SG10202104313PA (en) 2021-06-29
PH12016502430A1 (en) 2017-03-06
AU2015269039A1 (en) 2016-12-08
IL249131A0 (en) 2017-01-31
SG11201610098YA (en) 2016-12-29
JP2021028329A (en) 2021-02-25
UA124183C2 (en) 2021-08-04
HUP1700024A2 (en) 2017-05-29
EA201692279A1 (en) 2017-05-31
MX2016015668A (en) 2017-02-27
JP7125249B2 (en) 2022-08-24
CN106661118A (en) 2017-05-10
EP3152236A4 (en) 2018-07-04
US20220118103A1 (en) 2022-04-21
MY193519A (en) 2022-10-17
TW201625314A (en) 2016-07-16
CA2950576A1 (en) 2015-12-10
MX2021006021A (en) 2021-07-06
KR20230023691A (en) 2023-02-17
BR112016028227A2 (en) 2017-10-24
EP3152236A1 (en) 2017-04-12
KR20210111190A (en) 2021-09-10
EA035964B1 (en) 2020-09-07
JP2017521381A (en) 2017-08-03

Similar Documents

Publication Publication Date Title
AU2015269039B2 (en) Method for decreasing immunogenicity of protein and peptide
WO2010011096A2 (en) A polypeptide complex comprising non-peptidyl polymer having three functional ends
WO2014017843A1 (en) Composition for treating hyperlipidemia comprising oxyntomodulin derivative
WO2017052321A1 (en) Protein conjugate comprising multiple bioactive polypeptides and immunoglobulin fc regions
WO2017052329A1 (en) Protein complex by use of a specific site of an immunoglobulin fragment for linkage
WO2015152618A1 (en) Method for improving solubility of protein and peptide by using immunoglobulin fc fragment linkage
WO2014073845A1 (en) A composition for treating diabetes or diabesity comprising oxyntomodulin analog
WO2015183038A1 (en) Composition for treating diabetes, containing long-acting insulin analog conjugate and long-acting insulin secretion peptide conjugate
WO2014133324A1 (en) Novel insulin analog and use thereof
WO2012011752A2 (en) Novel long-acting glucagon conjugate and pharmaceutical composition comprising the same for the prevention and treatment of obesity
WO2015005747A1 (en) Immunoglobulin fc conjugate maintaining fcrn binding strength
WO2018143729A1 (en) Conjugate of bioactive material having enhanced sustainability and use thereof
WO2011122922A2 (en) Long-acting human follicle-stimulating hormone formulation using immunoglobulin fragment
WO2019066603A1 (en) Persistent protein conjugate with improved efficiency
WO2016056812A1 (en) Human igg4 fc polypeptide variant
WO2021154046A1 (en) Ph-sensitive fc variant
WO2017018742A1 (en) Method of preparing physiologically active polypeptide conjugate
WO2020050626A1 (en) Fusion polypeptide comprising polypeptide region that can be o-glycosylated
WO2018105988A1 (en) Conjugate having attenuated immune response
WO2022245179A1 (en) Composition for combination therapy comprising growth differentiation factor-15 variant and glucagon-like peptide-1 receptor agonist
WO2021182928A1 (en) Novel bispecific protein and use thereof
WO2022080985A1 (en) Pharmaceutical composition for preventing or treating lupus-related diseases comprising gip derivative or long-acting conjugate thereof
WO2021235915A1 (en) Liquid formulation
AU2019308089A1 (en) Pharmaceutical composition comprising polypeptide

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 15802343

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 249131

Country of ref document: IL

REEP Request for entry into the european phase

Ref document number: 2015802343

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2015802343

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2950576

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: MX/A/2016/015668

Country of ref document: MX

ENP Entry into the national phase

Ref document number: 2016570961

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 15315992

Country of ref document: US

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 12016502430

Country of ref document: PH

ENP Entry into the national phase

Ref document number: 2015269039

Country of ref document: AU

Date of ref document: 20150605

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 201692279

Country of ref document: EA

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112016028227

Country of ref document: BR

WWE Wipo information: entry into national phase

Ref document number: A201611826

Country of ref document: UA

ENP Entry into the national phase

Ref document number: 112016028227

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20161130