WO2015155199A1 - A new biomarker of antibody-mediated rejection - Google Patents

A new biomarker of antibody-mediated rejection Download PDF

Info

Publication number
WO2015155199A1
WO2015155199A1 PCT/EP2015/057551 EP2015057551W WO2015155199A1 WO 2015155199 A1 WO2015155199 A1 WO 2015155199A1 EP 2015057551 W EP2015057551 W EP 2015057551W WO 2015155199 A1 WO2015155199 A1 WO 2015155199A1
Authority
WO
WIPO (PCT)
Prior art keywords
abmr
patient
notch3
transplanted
risk
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2015/057551
Other languages
French (fr)
Inventor
Christos CHATZIANTONIOU
Eric RONDEAU
Jean-Claude DUSSAULE
Yi-Chun DUBOIS
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Universite Pierre et Marie Curie
Assistance Publique Hopitaux de Paris APHP
Institut National de la Sante et de la Recherche Medicale INSERM
Original Assignee
Universite Pierre et Marie Curie
Assistance Publique Hopitaux de Paris APHP
Institut National de la Sante et de la Recherche Medicale INSERM
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Universite Pierre et Marie Curie, Assistance Publique Hopitaux de Paris APHP, Institut National de la Sante et de la Recherche Medicale INSERM filed Critical Universite Pierre et Marie Curie
Publication of WO2015155199A1 publication Critical patent/WO2015155199A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G01N33/6893Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids related to diseases not provided for elsewhere
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/5005Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells
    • G01N33/5008Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics
    • G01N33/5082Supracellular entities, e.g. tissue, organisms
    • G01N33/5088Supracellular entities, e.g. tissue, organisms of vertebrates
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2800/00Detection or diagnosis of diseases
    • G01N2800/24Immunology or allergic disorders
    • G01N2800/245Transplantation related diseases, e.g. graft versus host disease
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2800/00Detection or diagnosis of diseases
    • G01N2800/34Genitourinary disorders
    • G01N2800/347Renal failures; Glomerular diseases; Tubulointerstitial diseases, e.g. nephritic syndrome, glomerulonephritis; Renovascular diseases, e.g. renal artery occlusion, nephropathy
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2800/00Detection or diagnosis of diseases
    • G01N2800/50Determining the risk of developing a disease
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2800/00Detection or diagnosis of diseases
    • G01N2800/52Predicting or monitoring the response to treatment, e.g. for selection of therapy based on assay results in personalised medicine; Prognosis

Definitions

  • the invention relates to the field of medicine, and more particularly to the diagnosis or the prediction of transplant antibody-mediated rejection (ABMR).
  • ABMR transplant antibody-mediated rejection
  • ABMR antibody-mediated rejection
  • DSA donor-specific antibodies
  • desensitization protocols before transplantation avoids efficiently the hyperacute form of ABMR
  • the early/acute ABMR developed in the cross-match positive, but desensitized patients still occurs
  • the late/chronic ABMR because of the presence of de novo DSA or the increased activity of low preexisting title of DSA now emerges as a leading cause of late graft loss.
  • This form of ABMR is usually at beginning indolent, but it destroys progressively the graft structure.
  • the pharmaceutical intervention often has no efficiency because the chronic ABMR associated graft fibrosis is too extensive and is no longer reversible.
  • diagnosis of the ABMR remains still difficult and mainly based on a triad of criteria: 1) the presence in the recipient's plasma of donor specific antibodies (DSA) for HLA antigens; 2) inflammation in the micro-circulation of the allograft such as peri-tubular capillaritis (ptc) and glomerulitis; and 3) deposits of C4d (a fragment of complement) on the endothelial cells of peritubular capillaries.
  • DSA donor specific antibodies
  • ptc peri-tubular capillaritis
  • C4d a fragment of complement
  • the invention relates to a method for determining whether a transplanted patient has or is at risk of antibody-mediated rejection (ABMR), comprising a step of determining the expression level of the Notch3 gene in pericytes present on a transplant biopsy obtained from said patient.
  • ABMR antibody-mediated rejection
  • the invention also relates to a method for adjusting the immunosuppressive treatment administered to a transplanted patient following its transplantation, comprising the following steps of: (i) performing the method for determining whether a transplanted patient has or is at risk of ABMR of the invention, and (ii) adjusting the immunosuppressive treatment.
  • the invention also relates to a compound selected from the group consisting of monoclonal anti-CD20 antibodies, anti-thymocyte globulin (ATG), proteasome inhibitors, anti-C5 antibodies, for use in preventing ABMR or progression of ABMR in a transplanted patient, determined as having or being at risk of ABMR by an increase in the expression level of the Notch3 gene in pericytes present on a transplant biopsy obtained from said patient.
  • AGT anti-thymocyte globulin
  • proteasome inhibitors for use in preventing ABMR or progression of ABMR in a transplanted patient, determined as having or being at risk of ABMR by an increase in the expression level of the Notch3 gene in pericytes present on a transplant biopsy obtained from said patient.
  • the invention addresses these needs, as it relates to methods and treatment approaches useful in the prediction, diagnosis and prevention of development and progression of antibody-mediated transplant rejection (e.g., in kidney transplantation).
  • antibody-mediated transplant rejection e.g., in kidney transplantation
  • the invention relates to a method for determining whether a transplanted patient has or is at risk of antibody-mediated rejection (ABMR), comprising a step of determining the expression level of the Notch3 gene in pericytes present on a transplant biopsy obtained from said patient.
  • ABMR antibody-mediated rejection
  • risk refers to the probability that an event will occur over a specific time period, such as the onset of transplant rejection, and can mean a patient's “absolute” risk or “relative” risk.
  • Absolute risk can be measured with reference to either actual observation post- measurement for the relevant time cohort, or with reference to index values developed from statistically valid historical cohorts that have been followed for the relevant time period.
  • Relative risk refers to the ratio of absolute risks of a patient compared either to the absolute risks of low risk cohorts or an average population risk, which can vary by how clinical risk factors are assessed. Odds ratios, the proportion of positive events to negative events for a given test result, are also commonly used (odds are according to the formula p/(l-p) where p is the probability of event and (1- p) is the probability of no event) to no- conversion.
  • risk determination encompasses making a prediction of the probability, odds, or likelihood that an event may occur. Risk determination can also comprise prediction of future clinical parameters, traditional laboratory risk factor values, such age, sex mismatch, HLA-testing, etc ...; either in absolute or relative terms in reference to a previously measured population.
  • the methods of the invention may be used to make categorical measurements of the risk of transplant rejection, thus defining the risk spectrum of a category of transplanted patient defined as being at risk of transplant rejection.
  • transplant rejection or "graft rejection” or encompasses both acute and chronic transplant rejection.
  • Acute rejection is the rejection by the immune system of a tissue transplant recipient when the transplanted tissue is immunologically foreign. Acute rejection is characterized by infiltration of the transplant tissue by immune cells of the recipient, which carry out their effector function and destroy the transplant tissue. The onset of acute rejection is rapid and generally occurs in humans within a few weeks after transplant surgery. Generally, acute rejection can be inhibited or suppressed with immunosuppressive drugs such as rapamycin, cyclosporin, anti-CD40L monoclonal antibody and the like. "Chronic transplant rejection” generally occurs in humans within several months to years after engraftment, even in the presence of successful immunosuppression of acute rejection. Fibrosis is a common factor in chronic rejection of all types of organ transplants.
  • transplantation refers to the insertion of a transplant (also called graft) into a recipient, whether the transplantation is syngeneic (where the donor and recipient are genetically identical), allogeneic (where the donor and recipient are of different genetic origins but of the same species), or xenogeneic (where the donor and recipient are from different species).
  • the host is human and the graft is an isograft, derived from a human of the same or different genetic origins.
  • the graft is derived from a species different from that into which it is transplanted, including animals from phylogenically widely separated species.
  • Notch3 gene belongs to the family of highly conserved Notch/LIN-12 receptors, which includes 4 members in vertebrates. It encodes a protein of 2321 amino acids that includes all canonical Notch motifs, i.e., an extracellular domain containing 34 tandem EGF-like repeats, 3 cysteine-rich Notch/LIN-12 repeats, a single transmembrane domain, and an intracellular domain containing 6 tandem ankyrin repeats. Mutations in the NOTCH3 gene have been found to cause cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy, commonly known as CADASIL.
  • the naturally occurring human Notch3 receptor protein has an aminoacid sequence of 2321 amino acids provided in the UniProt database under accession number Q9UM47 and is shown as follows (SEQ ID NO: 1):
  • genes which are not structural genes, may be transcribed from DNA to RNA, but are not translated into an amino acid sequence.
  • Other genes may function as regulators of structural genes or as regulators of DNA transcription.
  • the term gene may be intended for the genomic sequence encoding a protein, i.e. a sequence comprising regulator, promoter, intron and exon sequences.
  • a "coding sequence” or a sequence “encoding” an expression product, such as a RNA, polypeptide, protein, or enzyme is a nucleotide sequence that, when expressed, results in the production of that RNA, polypeptide, protein, or enzyme, i.e., the nucleotide sequence encodes an amino acid sequence for that polypeptide, protein or enzyme.
  • a coding sequence for a protein may include a start codon (usually ATG) and a stop codon.
  • the term “determining” includes qualitative and/or quantitative determination (i.e. detecting and/or measuring the expression level) with or without reference to a control or a predetermined value.
  • detecting means determining if Notch3 is present or not in a biological sample and “measuring” means determining the amount of Notch3 in a biological sample.
  • the expression level may be determined for example by immunohistochemistry performed on a transplant biopsy obtained from the recipient (e.g., a transplant renal biopsy).
  • transplant biopsy has its general meaning in the art and refers to any biopsy sample which may be obtained from a transplanted patient.
  • a preferred biological sample is a renal biopsy that can be used for immunohistochemistry (IHC).
  • pericyte or "microvascular perivascular cell” are well known in the art and refer to small ovoid shaped cell with many finger-like projections that parallel the capillary axis and partially surround an endothelial cell in a microvessel.
  • Pericytes are associated with capillaries and post-capillary vessels. In fact, there are pericytes in all tissues containing capillaries. Pericytes are elongated cells with the power of contraction that have been observed to have a variety of functional characteristics. In one embodiment, the pericytes are pericytes of peritubular capillaries.
  • the invention also encompasses various types of transplants including, but not limited to, a renal allograft a heart transplant, a lung allograft, a liver allograft or a pancreas allograft.
  • the transplanted patient is a transplanted renal patient.
  • said method comprises a step of (i) determining the expression level of the Notch3 gene in a transplant biopsy obtained from said patient, and (ii) comparing said expression level with a predetermined reference value, wherein an increase in the expression level of the Notch3 gene is indicative of having or being at risk of ABMR.
  • the term "predetermined reference value” refers to the amount of Notch3 in biological samples obtained from the general population or from a selected population of subjects.
  • the predetermined reference value can be a threshold value or a range.
  • the selected population may be comprised of apparently healthy transplanted patient, such as individuals who have not previously had any sign or symptoms indicating the outcome of a graft rejection, more particularly ABMR.
  • Determination of the expression level of Notch3 gene may be performed by a variety of techniques.
  • the expression level as determined is a relative expression level.
  • the determination comprises contacting the biological sample with selective reagents such as probes or ligands, and thereby detecting the presence, or measuring the amount, of nucleic acids or polypeptides of interest originally in said biological sample. Contacting may be performed in any suitable device, such as a plate, micro titer dish, test tube, well, glass, column, and so forth. In specific embodiments, the contacting is performed on a substrate coated with the reagent, such as a nucleic acid array or a specific ligand array.
  • the substrate may be a solid or semi-solid substrate such as any suitable support comprising glass, plastic, nylon, paper, metal, polymers and the like.
  • the substrate may be of various forms and sizes, such as a slide, a membrane, a bead, a column, a gel, etc.
  • the contacting may be made under any condition suitable for a detectable complex, such as a nucleic acid hybrid or an antibody-antigen complex, to be formed between the reagent and the nucleic acids or polypeptides of the biological sample.
  • the expression level of the Notch3 gene may be determined by determining the quantity of mRNA.
  • nucleic acid contained in the biological samples e.g., biopsy prepared from the patient
  • the extracted mRNA is then detected by hybridization (e.g., Northern blot analysis) and/or amplification (e.g., RT-PCR).
  • hybridization e.g., Northern blot analysis
  • amplification e.g., RT-PCR
  • Quantitative or semi-quantitative RT-PCR is preferred. Real-time quantitative or semi-quantitative RT-PCR is particularly advantageous.
  • the methods of the invention comprise a step of carrying out an in situ hybridization (ISH).
  • ISH in situ hybridization
  • hybridization relates to the fact of obtaining a close interaction of the nucleotide probe and the target region that is expected to be revealed by the detection of the nucleotide probe. Such an interaction can be achieved by the formation of hydrogen bonds between the nucleotide probe and the target sequence, which is typical of the interactions between complementary nucleotide molecules capable of base pairing. Hydrogen bonds can be found, for example, in the annealing of two complementary strands of DNA.
  • ISH In situ hybridization
  • RNA ISH RNA in situ hybridization
  • RNA in situ hybridization is used to measure and localize RNAs (e.g., mRNAs) within tissue sections.
  • RNAs e.g., mRNAs
  • the integrity of the structure and/or content of the biological material is maintained. Therefore, in order to achieve the invention, the biological material is preferably fixed. Nucleic acids having at least 10 nucleotides and exhibiting sequence complementarity or homology to the mR A of interest herein find utility as hybridization probes.
  • probes typically comprise single-stranded nucleic acids of between 10 to 1000 nucleotides in length, for instance of between 10 and 800, more preferably of between 15 and 700, typically of between 20 and 500.
  • the probes and primers are "specific" to the nucleic acids they hybridize to, i.e. they preferably hybridize under high stringency hybridization conditions (corresponding to the highest melting temperature Tm, e.g., 50 % formamide, 5x or 6x SCC.
  • Tm melting temperature
  • SCC is a 0.15 M NaCl, 0.015 M Na-citrate
  • the expression level of the Notch3 gene may be determined by determining of the quantity of protein encoded by the Notch3 gene.
  • Such methods comprise contacting the biological sample with a binding partner capable of selectively interacting with the protein present in said sample.
  • the binding partner is generally an antibody that may be polyclonal or monoclonal, preferably monoclonal.
  • Antibodies directed against Notch3 are well known from the skilled man in the art such as the antibodies commercialized by Abeam (ab23426, rabbit polyclonal). Antibodies that bind specifically to human Notch3 and which are useful in the detection and/or diagnosis of Notch3 related diseases are disclosed in the US patent application N° US2012142899
  • the term "monoclonal antibody” refers to a population of antibody molecules that contains only one species of antibody combining site capable of immunoreacting with a particular epitope.
  • a monoclonal antibody thus typically displays a single binding affinity for any epitope with which it immunoreacts.
  • a monoclonal antibody may therefore contain an antibody molecule having a plurality of antibody combining sites, each immunospecific for a different epitope, e.g. a bispecific monoclonal antibody.
  • a monoclonal antibody was produced by immortalization of a clonally pure immunoglobulin secreting cell line, a monoclonally pure population of antibody molecules can also be prepared by the methods of the invention.
  • Monoclonal antibodies may be prepared by immunizing purified Notch3 into a mammal, e.g. a mouse, rat, human and the like mammals.
  • the antibody-producing cells in the immunized mammal are isolated and fused with myeloma or heteromyeloma cells to produce hybrid cells (hybridoma).
  • the hybridoma cells producing the monoclonal antibodies are utilized as a source of the desired monoclonal antibody. This standard method of hybridoma culture is described in Kohler and Milstein (1975).
  • mAbs can be produced by hybridoma culture the invention is not to be so limited. Also contemplated is the use of mAbs produced by an expressing nucleic acid cloned from a hybridoma of this invention. That is, the nucleic acid expressing the molecules secreted by a hybridoma of this invention can be transferred into another cell line to produce a transformant.
  • the transformant is genotypically distinct from the original hybridoma but is also capable of producing antibody molecules of this invention, including immunologically active fragments of whole antibody molecules, corresponding to those secreted by the hybridoma. See, for example, U.S. Pat. No. 4,642,334 to Reading; European Patent Publications No. 0239400 to Winter et al. and No. 0125023 to Cabilly et al.
  • Antibody generation techniques not involving immunisation are also contemplated such as for example using phage display technology to examine naive libraries (from non- immunised animals); see Barbas et al. (1992), and Waterhouse et al. (1993).
  • binding agents other than antibodies may be used for the purpose of the invention.
  • binding agents may be for instance aptamers, which are a class of molecule that represents an alternative to antibodies in term of molecular recognition.
  • Aptamers are oligonucleotide or oligopeptide sequences with the capacity to recognize virtually any class of target molecules with high affinity and specificity.
  • ligands may be isolated through Systematic Evolution of Ligands by Exponential enrichment (SELEX) of a random sequence library, as described in Tuerk C. and Gold L., 1990.
  • the random sequence library is obtainable by combinatorial chemical synthesis of DNA. In this library, each member is a linear oligomer, eventually chemically modified, of a unique sequence.
  • Peptide aptamers consists of a conformationally constrained antibody variable region displayed by a platform protein, such as E. coli Thioredoxin A that are selected from combinatorial libraries by two hybrid methods (Colas et al, 1996).
  • a platform protein such as E. coli Thioredoxin A
  • the term "labelled" with regard to the antibody or aptamer is intended to encompass direct labelling of the antibody or aptamer by coupling (i.e., physically linking) a detectable substance, such as a radioactive agent or a fluorophore (e.g.
  • radioactive molecules include but are not limited radioactive atom for scintigraphic studies such as I 123 , I 124 , In 111 , Re 186 and Re 188 .
  • an immunohistochemistry (IHC) method may be used.
  • IHC specifically provides a method of detecting a target protein in a biological sample or tissue specimen in situ.
  • the overall cellular integrity of the sample is maintained in IHC, thus allowing detection of both the presence and location of the protein of interest.
  • a biological sample is fixed with formalin, embedded in paraffin and cut into sections for staining and subsequent inspection by light microscopy.
  • Current methods of IHC use either direct labelling or secondary antibody-based or hapten-based labelling. Examples of known IHC systems include, for example, EnVision TM (DakoCytomation), Powervision® (Immunovision, Springdale, AZ), the NBATM kit (Zymed Laboratories Inc., South San Francisco, CA), HistoFine ® (Nichirei Corp, Tokyo, Japan).
  • the invention also relates to a kit for performing a method above- mentioned, wherein said kit comprises means for determining the expression level of the Notch3 gene in a biopsy sample obtained from said transplanted patient.
  • the invention relates to the use of Notch3 as a biomarker of ABMR.
  • biomarker refers generally to a molecule, i.e., a gene (or nucleic acid encoding said gene), protein, the expression of which in a biological sample from a patient can be detected by standard methods in the art (as well as those disclosed herein), and is predictive or denotes a condition of the patient from which it was obtained.
  • the invention relates to the use of Notch3 as a biomarker of ABMR in a transplanted renal patient.
  • Methods for adjusting an immunosuppressive treatment :
  • the invention further provides methods for developing personalized treatment plans. Information gained by way of the methods described above can be used to develop a personalized treatment plan for a transplant recipient.
  • the invention relates to a method for adjusting the immunosuppressive treatment administered to a transplanted patient following its transplantation, comprising the following steps of: (i) performing the method for determining whether a transplanted patient has or is at risk of ABMR of the invention, and (ii) adjusting the immunosuppressive treatment.
  • the methods can be carried out by, for example, using any of the methods for determining risk described above and, in consideration of the results obtained, designing a treatment plan for the transplant recipient.
  • Notch3 is present in pericytes on a kidney biopsy obtained from a patient of interest, this indicates that said patient is at risk for an undesirable clinical outcome (e.g., ABMR). Therefore, said patient is a candidate for treatment with an effective amount of an immunosuppressive treatment (e.g. by an anti-rejection agent).
  • an immunosuppressive treatment e.g. by an anti-rejection agent
  • the absence of Nocth3 is indicative of a reduced risk of transplant rejection.
  • the expression level Notch3 i.e.
  • the patient may require a treatment regime that is more or less aggressive than a standard regimen, or it may be determined that the patient is best suited for a standard regimen. For instance, a patient without Notch3 expressed in pericytes may avoid an immunosuppressive treatment (or require a less aggressive regimen) and their associated side effects.
  • Reducing the level and the production of the DSA and/or protecting the allograft may be achieved using any suitable medical means known to those skilled in the art.
  • such reduction and protection comprise a therapeutic intervention with the patient such as administration of anti-thymocyte globulin (ATG), monoclonal anti- CD20 antibodies (rituximab), proteasome inhibitor (bortezomib), anti-C5 antibodies (eculizumab), intravenous administration of immunoglobulins and plasmapheresis.
  • ATG anti-thymocyte globulin
  • rituximab monoclonal anti- CD20 antibodies
  • proteasome inhibitor bortezomib
  • anti-C5 antibodies eculizumab
  • the invention relates to a method for preventing ABMR or progression of ABMR in a transplanted patient, comprising the following steps of: (i) performing the method for determining whether a renal transplanted patient has or is at risk of ABMR of the invention, and (ii) administering to said patient a therapeutically effective amount of a compound selected from the group consisting of anti-thymocyte globulin (ATG), monoclonal anti-CD20 antibodies (rituximab), proteasome inhibitor (bortezomib), anti-C5 antibodies (eculizumab).
  • AGT anti-thymocyte globulin
  • rituximab monoclonal anti-CD20 antibodies
  • proteasome inhibitor bortezomib
  • anti-C5 antibodies eculizumab
  • terapéuticaally effective amount is meant an amount sufficient to achieve a concentration of compound which is capable of preventing or slowing down the disease to be treated. Such concentrations can be routinely determined by those of skilled in the art.
  • the amount of the polypeptide actually administered will typically be determined by a physician or a veterinarian, in the light of the relevant circumstances, including the condition to be treated, the chosen route of administration, the actual compound administered, the age, weight, and response of the patient, the severity of the subject's symptoms, and the like. It will also be appreciated by those of skilled in the art that the dosage may be dependent on the stability of the administered compound.
  • said compound is selected from the group consisting of anti- thymocyte globulin (ATG), monoclonal anti-CD20 antibodies (rituximab), proteasome inhibitor (bortezomib), anti-C5 antibodies (eculizumab).
  • ATG anti- thymocyte globulin
  • rituximab monoclonal anti-CD20 antibodies
  • bortezomib proteasome inhibitor
  • anti-C5 antibodies eculizumab
  • the transplanted patient is a transplanted renal patient.
  • the compounds of the invention may be administered by any means that achieve the intended purpose.
  • administration may be achieved by a number of different routes including, but not limited to subcutaneous, intravenous, intradermal, intramuscular, intraperitoneal, intracerebral, intrathecal, intranasal, oral, rectal, transdermal, buccal, topical, local, inhalant or subcutaneous use. Parenteral and topical routes are particularly preferred. Dosages to be administered depend on individual needs, on the desired effect and the chosen route of administration.
  • the dosage administered will be dependent upon the age, sex, health, and weight of the recipient, concurrent treatment, if any, frequency of treatment, and the nature of the effect desired.
  • the total dose required for each treatment may be administered by multiple doses or in a single dose.
  • the doses used for the administration can be adapted as a function of various parameters, and in particular as a function of the mode of administration used, of the relevant pathology, or alternatively of the desired duration of treatment.
  • the daily dosage of the polypeptides may be varied over a wide range from 0.01 to 1,000 mg per adult per day.
  • the compositions contain 0.01, 0.05, 0.1, 0.5, 1.0, 2.5, 5.0, 10.0, 15.0, 25.0, 50.0, 100, 250 and 500 mg of the active ingredient for the symptomatic adjustment of the dosage to the subject to be treated.
  • a medicament typically contains from about 0.01 mg to about 500 mg of the active ingredient, preferably from 1 mg to about 100 mg of the active ingredient.
  • An effective amount of the drug is ordinarily supplied at a dosage level from 0.0002 mg/kg to about 20 mg/kg of body weight per day, especially from about 0.001 mg/kg to 10 mg/kg of body weight per day.
  • FIGURES are a diagrammatic representation of FIGURES.
  • FIG. 1 Notch3 expression in peritubular capillary pericytes is strongly increased in the renal transplanted patients with ABMR compared to other types of graft rejection.
  • Notch3 expression was also studied in 2 "healthy" kidneys in the vicinity of renal carcinomas and in 3 renal grafts de-transplanted due to repeated antibody-mediated rejection ABMR and graft function loss.
  • Notch3 was evaluated in the pericytes of peritubular capillaries in 14 biopsies diagnosed with ABMR, and compared with those in 41 non-ABMR biopsies including 6 biopsies with T cell mediated rejection (TCMR) or borderline lesions, 19 with diagnoses other than rejection (6 biopsies with acute tubular necrosis, 9 with graft fibrosis, 4 for no classified graft diseases such as minimum graft inflammation) and 16 biopsies with no lesions.
  • TCMR diagnosed by medical staff was based on the biopsies showing peribubular capillaritis with or without c4d staining and anti class I or II antibodies determined by Luminex. All patients had given their oral informed consent to participate in the study.
  • Renal histopatho logical analysis was scored according to the recently (201 1) updated Banff working classification for renal graft pathology [11-13]. Mean i score was 0.32, t score was 0.23, g score was 0.39 and ptc score was 0.53. Seven biopsies displayed acute tubular necrosis lesions. Chronic Banff score for ci was 0.79; and ct was 0.66; cv was 0.7; ah was 0.72.
  • Notch3 expression was detected in paraffin tissue by immunohistochemistry. Target retrieval was carried out by heating the tissue in citrate buffer. The sections were incubated overnight at 4°C with phosphate-buffered saline containing anti-Notch3 antibodies (gift kindly offered by Dr. Anne Joutel as described in Joutel et al, JCI 2000. The immunoreactive Notch3 expression was visualized using Envision + HRP system (AEC). For the negative controls, the primary antibodies were replaced by an equal concentration of mouse IgG.
  • Notch3 expression in each biopsy was semi-quantified 3 times in a blind fashion in the pericytes of peritubular capillaries according to the following scale score: 0: no staining; 1 : ⁇ 10%; 2: 10-24%; 3: 25-50%; 4: >50%.
  • Notch3 expression in normal kidneys is mainly observed in vascular smooth cells and in glomerular mesengial cells, but not in the peritubular capillary pericytes.
  • Notch3 expression is highly induced in the peritubular capillary pericytes in the renal transplanted patients with ABMR.
  • Notch3 expression in peritubular capillary pericytes was significantly correlated with microcirculation infiltration scores g, ptc and v (found in ABMR), but not with interstitial or tubular inflammation score (for TCMR). Notch3 expression level was significantly correlated with graft function (up to 2 years post biopsy) and proteinuria (two important clinical manifestations during ABMR).

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Biomedical Technology (AREA)
  • Immunology (AREA)
  • Molecular Biology (AREA)
  • Chemical & Material Sciences (AREA)
  • Urology & Nephrology (AREA)
  • Hematology (AREA)
  • Cell Biology (AREA)
  • General Health & Medical Sciences (AREA)
  • General Physics & Mathematics (AREA)
  • Pathology (AREA)
  • Food Science & Technology (AREA)
  • Medicinal Chemistry (AREA)
  • Physics & Mathematics (AREA)
  • Biotechnology (AREA)
  • Analytical Chemistry (AREA)
  • Microbiology (AREA)
  • Biochemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Toxicology (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Peptides Or Proteins (AREA)
  • Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)

Abstract

The invention relates to a method for determining whether a transplanted patient has or is at risk of antibody-mediated rejection (ABMR), comprising a step of determining the expression level of the Notch3 gene in pericytes present on a transplant biopsy obtained from said patient. The invention also relates to a method for adjusting the immunosuppressive treatment administered to a transplanted recipient following its transplantation, comprising the following steps of: (i) performing the method for determining whether a transplanted patient is at risk of ABMR according to the invention, and (ii) adjusting the immunosuppressive treatment.

Description

A NEW BIOMARKER OF ANTIBODY-MEDIATED REJECTION
FIELD OF THE INVENTION:
The invention relates to the field of medicine, and more particularly to the diagnosis or the prediction of transplant antibody-mediated rejection (ABMR).
BACKGROUND OF THE INVENTION:
In transplantation, the antibody-mediated rejection (ABMR) is currently a major thread for the long term graft survival. Although important advances have been made in the detection of preexistent donor-specific antibodies (DSA) and the use of desensitization protocols before transplantation avoids efficiently the hyperacute form of ABMR, the early/acute ABMR developed in the cross-match positive, but desensitized patients still occurs; and the late/chronic ABMR because of the presence of de novo DSA or the increased activity of low preexisting title of DSA now emerges as a leading cause of late graft loss. This form of ABMR is usually at beginning indolent, but it destroys progressively the graft structure. When the graft function starts to be altered, the pharmaceutical intervention often has no efficiency because the chronic ABMR associated graft fibrosis is too extensive and is no longer reversible. However the diagnosis of the ABMR remains still difficult and mainly based on a triad of criteria: 1) the presence in the recipient's plasma of donor specific antibodies (DSA) for HLA antigens; 2) inflammation in the micro-circulation of the allograft such as peri-tubular capillaritis (ptc) and glomerulitis; and 3) deposits of C4d (a fragment of complement) on the endothelial cells of peritubular capillaries. The medical community stresses the necessity of developing new biomarkers in predicting and diagnosing ABMR because the current criteria are neither necessary nor sufficient: the presence of DSA in the plasma of patients is a pre-requisite for the diagnosis of ABMR, but it is not always associated with ABMR. In addition, some antibodies may be present in the context of accommodation that is without significant harmful effect even if C4d is detected. In contrast, some anti-donor antibodies directed against MICA or MICB antigens or other anti-endothelial cell antibodies are not included in the panel of DSA detection. The presence of C4d on the peritubular capillaries is a good witness of complement activation thus strongly suggestive of ABMR. Yet, recent studies pointed out its poor sensitivity as a diagnostic tool, since it can detect only 50-60% of ABMR patients. It results that it is likely that many patients with ABMR are underdiagnosed and not appropriately treated. Yet, early and accurate diagnosis of ABMR is thus important because a specific treatment, different from that of T cell-mediated rejection (TCMR), can be proposed for these patients including anti-CD20 antibodies (rituximab). Otherwise, in the absence of appropriate treatment, the patients can lose their graft rapidly. In addition, when the diagnostic can be made with certainty, undue over-immunosuppression will be prevented.
SUMMARY OF THE INVENTION:
In a first aspect, the invention relates to a method for determining whether a transplanted patient has or is at risk of antibody-mediated rejection (ABMR), comprising a step of determining the expression level of the Notch3 gene in pericytes present on a transplant biopsy obtained from said patient.
In a second aspect, the invention also relates to a method for adjusting the immunosuppressive treatment administered to a transplanted patient following its transplantation, comprising the following steps of: (i) performing the method for determining whether a transplanted patient has or is at risk of ABMR of the invention, and (ii) adjusting the immunosuppressive treatment.
In a third aspect, the invention also relates to a compound selected from the group consisting of monoclonal anti-CD20 antibodies, anti-thymocyte globulin (ATG), proteasome inhibitors, anti-C5 antibodies, for use in preventing ABMR or progression of ABMR in a transplanted patient, determined as having or being at risk of ABMR by an increase in the expression level of the Notch3 gene in pericytes present on a transplant biopsy obtained from said patient.
DETAILED DESCRIPTION OF THE INVENTION:
The invention addresses these needs, as it relates to methods and treatment approaches useful in the prediction, diagnosis and prevention of development and progression of antibody-mediated transplant rejection (e.g., in kidney transplantation).
The inventors have demonstrated that the expression level of Notch3 in pericytes present on a transplant biopsy is useful to specifically predict ABMR, until two years before said ABMR and even if said biopsy displays no classical sign of rejection. The inventors have thus shown that Notch3 expression is highly induced in the peritubular capillary pericytes in the renal transplanted patients with ABMR. Prognostic methods of the invention:
In a first aspect, the invention relates to a method for determining whether a transplanted patient has or is at risk of antibody-mediated rejection (ABMR), comprising a step of determining the expression level of the Notch3 gene in pericytes present on a transplant biopsy obtained from said patient.
As used herein, the term "risk" refers to the probability that an event will occur over a specific time period, such as the onset of transplant rejection, and can mean a patient's "absolute" risk or "relative" risk.
Absolute risk can be measured with reference to either actual observation post- measurement for the relevant time cohort, or with reference to index values developed from statistically valid historical cohorts that have been followed for the relevant time period. Relative risk refers to the ratio of absolute risks of a patient compared either to the absolute risks of low risk cohorts or an average population risk, which can vary by how clinical risk factors are assessed. Odds ratios, the proportion of positive events to negative events for a given test result, are also commonly used (odds are according to the formula p/(l-p) where p is the probability of event and (1- p) is the probability of no event) to no- conversion.
As used herein, the term "risk determination" encompasses making a prediction of the probability, odds, or likelihood that an event may occur. Risk determination can also comprise prediction of future clinical parameters, traditional laboratory risk factor values, such age, sex mismatch, HLA-testing, etc ...; either in absolute or relative terms in reference to a previously measured population. The methods of the invention may be used to make categorical measurements of the risk of transplant rejection, thus defining the risk spectrum of a category of transplanted patient defined as being at risk of transplant rejection.
As used herein, the term "transplant rejection" or "graft rejection" or encompasses both acute and chronic transplant rejection. "Acute rejection" is the rejection by the immune system of a tissue transplant recipient when the transplanted tissue is immunologically foreign. Acute rejection is characterized by infiltration of the transplant tissue by immune cells of the recipient, which carry out their effector function and destroy the transplant tissue. The onset of acute rejection is rapid and generally occurs in humans within a few weeks after transplant surgery. Generally, acute rejection can be inhibited or suppressed with immunosuppressive drugs such as rapamycin, cyclosporin, anti-CD40L monoclonal antibody and the like. "Chronic transplant rejection" generally occurs in humans within several months to years after engraftment, even in the presence of successful immunosuppression of acute rejection. Fibrosis is a common factor in chronic rejection of all types of organ transplants.
The term "transplantation" and variations thereof refers to the insertion of a transplant (also called graft) into a recipient, whether the transplantation is syngeneic (where the donor and recipient are genetically identical), allogeneic (where the donor and recipient are of different genetic origins but of the same species), or xenogeneic (where the donor and recipient are from different species). Thus, in a typical scenario, the host is human and the graft is an isograft, derived from a human of the same or different genetic origins. In another scenario, the graft is derived from a species different from that into which it is transplanted, including animals from phylogenically widely separated species.
As used herein, the term "Notch3 gene" belongs to the family of highly conserved Notch/LIN-12 receptors, which includes 4 members in vertebrates. It encodes a protein of 2321 amino acids that includes all canonical Notch motifs, i.e., an extracellular domain containing 34 tandem EGF-like repeats, 3 cysteine-rich Notch/LIN-12 repeats, a single transmembrane domain, and an intracellular domain containing 6 tandem ankyrin repeats. Mutations in the NOTCH3 gene have been found to cause cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy, commonly known as CADASIL. The naturally occurring human Notch3 receptor protein has an aminoacid sequence of 2321 amino acids provided in the UniProt database under accession number Q9UM47 and is shown as follows (SEQ ID NO: 1):
MGPGARGRR RR PMSPPPPPPPVRALPLLLLLAGPGAAAPPCLDGSPCANGGRCTQ LPSREAACLCPPGWVGERCQLEDPCHSGPCAGRGVCQSSVVAGTARFSCRCPRGFRG PDCSLPDPCLSSPCAHGARCSVGPDGRFLCSCPPGYQGRSCRSDVDECRVGEPCRHG GTCLNTPGSFRCQCPAGYTGPLCENPAVPCAPSPCRNGGTCRQSGDLTYDCACLPGF EGQNCEVNVDDCPGHRCLNGGTCVDGVNTYNCQCPPEWTGQFCTEDVDECQLQPN ACHNGGTCFNTLGGHSCVCVNGWTGESCSQNIDDCATAVCFHGATCHDRVASFYCA CPMGKTGLLCHLDDACVSNPCHEDAICDTNPVNGRAICTCPPGFTGGACDQDVDECS IGANPCEHLGRCVNTQGSFLCQCGRGYTGPRCETDVNECLSGPCRNQATCLDRIGQF TCICMAGFTGTYCEVDIDECQSSPCVNGGVCKDRVNGFSCTCPSGFSGSTCQLDVDE CASTPCRNGAKCVDQPDGYECRCAEGFEGTLCDRNVDDCSPDPCHHGRCVDGIASFS CACAPGYTGTRCESQVDECRSQPCRHGGKCLDLVDKYLCRCPSGTTGVNCEVNIDD CASNPCTFGVCRDGINRYDCVCQPGFTGPLCNVEINECASSPCGEGGSCVDGENGFRC LCPPGSLPPLCLPPSHPCAHEPCSHGICYDAPGGFRCVCEPGWSGPRCSQSLARDACES QPCRAGGTCSSDGMGFHCTCPPGVQGRQCELLSPCTPNPCEHGGRCESAPGQLPVCS CPQGWQGPRCQQDVDECAGPAPCGPHGICTNLAGSFSCTCHGGYTGPSCDQDINDC DPNPCLNGGSCQDGVGSFSCSCLPGFAGPRCARDVDECLSNPCGPGTCTDHVASFTC TCPPGYGGFHCEQDLPDCSPSSCFNGGTCVDGVNSFSCLCRPGYTGAHCQHEADPCL SRPCLHGGVCSAAHPGFRCTCLESFTGPQCQTLVDWCSRQPCQNGGRCVQTGAYCL CPPGWSGRLCDIRSLPCREAAAQIGVRLEQLCQAGGQCVDEDSSHYCVCPEGRTGSH CEQEVDPCLAQPCQHGGTCRGYMGGYMCECLPGYNGDNCEDDVDECASQPCQHGG SCIDLVARYLCSCPPGTLGVLCEINEDDCGPGPPLDSGPRCLHNGTCVDLVGGFRCTC PPGYTGLRCEADINECRSGACHAAHTRDCLQDPGGGFRCLCHAGFSGPRCQTVLSPC ESQPCQHGGQCRPSPGPGGGLTFTCHCAQPFWGPRCERVARSCRELQCPVGVPCQQT PRGPRCACPPGLSGPSCRSFPGSPPGASNASCAAAPCLHGGSCRPAPLAPFFRCACAQ GWTGPRCEAPAAAPEVSEEPRCPRAACQAKRGDQRCDRECNSPGCGWDGGDCSLSV GDPWRQCEALQCWRLFNNSRCDPACSSPACLYDNFDCHAGGRERTCNPVYEKYCA DHFADGRCDQGCNTEECGWDGLDCASEVPALLARGVLVLTVLLPPEELLRSSADFLQ RLSAILRTSLRFRLDAHGQAMVFPYHRPSPGSEPRARRELAPEVIGSVVMLEIDNRLCL Q SPENDHCFPD AQ S AAD YLG AL S AVERLDFP YPLRD VRGEPLEPPEP S VPLLPLL V AG AVLLLVILVLGVMVARRKREHSTLWFPEGFSLHKDVASGHKGRREPVGQDALGMK NMAKGESLMGEVATDWMDTECPEAKRLKVEEPGMGAEEAVDCRQWTQHHLVAA DIRVAPAMALTPPQGDADADGMDVNVRGPDGFTPLMLASFCGGALEPMPTEEDEAD DTSASIISDLICQGAQLGARTDRTGETALHLAARYARADAAKRLLDAGADTNAQDHS GRTPLHTAVTADAQGVFQILIRNRSTDLDARMADGSTALILAARLAVEGMVEELIAS HADVNAVDELGKSALHWAAAV NVEATLALLK GANKDMQDSKEETPLFLAARE GSYEAAKLLLDHFANREITDHLDRLPRDVAQERLHQDIVRLLDQPSGPRSPPGPHGLG PLLCPPGAFLPGLKAAQSGSK SRRPPGKAGLGPQGPRGRGKKLTLACPGPLADSSVT LSPVDSLDSPRPFGGPPASPGGFPLEGPYAAATATAVSLAQLGGPGRAGLGRQPPGGC VLSLGLLNPVAVPLDWARLPPPAPPGPSFLLPLAPGPQLLNPGTPVSPQERPPPYLAVP GHGEEYPAAGAHSSPPKARFLRVPSEHPYLTPSPESPEHWASPSPPSLSDWSESTPSPA TATGAMATTTGALPAQPLPLSVPSSLAQAQTQLGPQPEVTPKRQVLA As used herein, the term "gene" refers to a DNA sequence that codes for or corresponds to a particular sequence of amino acids which comprise all or part of one or more proteins or enzymes, and may or may not include regulatory DNA sequences, such as promoter sequences, which determine for example the conditions under which the gene is expressed. Some genes, which are not structural genes, may be transcribed from DNA to RNA, but are not translated into an amino acid sequence. Other genes may function as regulators of structural genes or as regulators of DNA transcription. In particular, the term gene may be intended for the genomic sequence encoding a protein, i.e. a sequence comprising regulator, promoter, intron and exon sequences.
A "coding sequence" or a sequence "encoding" an expression product, such as a RNA, polypeptide, protein, or enzyme, is a nucleotide sequence that, when expressed, results in the production of that RNA, polypeptide, protein, or enzyme, i.e., the nucleotide sequence encodes an amino acid sequence for that polypeptide, protein or enzyme. A coding sequence for a protein may include a start codon (usually ATG) and a stop codon.
As used herein, the term "determining" includes qualitative and/or quantitative determination (i.e. detecting and/or measuring the expression level) with or without reference to a control or a predetermined value. As used herein, "detecting" means determining if Notch3 is present or not in a biological sample and "measuring" means determining the amount of Notch3 in a biological sample. Typically the expression level may be determined for example by immunohistochemistry performed on a transplant biopsy obtained from the recipient (e.g., a transplant renal biopsy). As used herein, the term "transplant biopsy" has its general meaning in the art and refers to any biopsy sample which may be obtained from a transplanted patient. A preferred biological sample is a renal biopsy that can be used for immunohistochemistry (IHC).
As used herein, the terms "pericyte" or "microvascular perivascular cell" are well known in the art and refer to small ovoid shaped cell with many finger-like projections that parallel the capillary axis and partially surround an endothelial cell in a microvessel. Pericytes are associated with capillaries and post-capillary vessels. In fact, there are pericytes in all tissues containing capillaries. Pericytes are elongated cells with the power of contraction that have been observed to have a variety of functional characteristics. In one embodiment, the pericytes are pericytes of peritubular capillaries.
In the setting of transplantation, it is envisioned that that ABMR of non-renal transplants would as well be diagnosed using the invention because the microvascular damage induced by anti-donor HLA antibodies is broad and not organ-specific. Accordingly, the invention also encompasses various types of transplants including, but not limited to, a renal allograft a heart transplant, a lung allograft, a liver allograft or a pancreas allograft. In one embodiment, the transplanted patient is a transplanted renal patient.
In one embodiment, said method comprises a step of (i) determining the expression level of the Notch3 gene in a transplant biopsy obtained from said patient, and (ii) comparing said expression level with a predetermined reference value, wherein an increase in the expression level of the Notch3 gene is indicative of having or being at risk of ABMR.
As used herein, the term "predetermined reference value" refers to the amount of Notch3 in biological samples obtained from the general population or from a selected population of subjects. The predetermined reference value can be a threshold value or a range. For example, the selected population may be comprised of apparently healthy transplanted patient, such as individuals who have not previously had any sign or symptoms indicating the outcome of a graft rejection, more particularly ABMR.
Methods for determining the expression level of the biomarker of the invention:
Determination of the expression level of Notch3 gene may be performed by a variety of techniques. Generally, the expression level as determined is a relative expression level. For example, the determination comprises contacting the biological sample with selective reagents such as probes or ligands, and thereby detecting the presence, or measuring the amount, of nucleic acids or polypeptides of interest originally in said biological sample. Contacting may be performed in any suitable device, such as a plate, micro titer dish, test tube, well, glass, column, and so forth. In specific embodiments, the contacting is performed on a substrate coated with the reagent, such as a nucleic acid array or a specific ligand array. The substrate may be a solid or semi-solid substrate such as any suitable support comprising glass, plastic, nylon, paper, metal, polymers and the like. The substrate may be of various forms and sizes, such as a slide, a membrane, a bead, a column, a gel, etc. The contacting may be made under any condition suitable for a detectable complex, such as a nucleic acid hybrid or an antibody-antigen complex, to be formed between the reagent and the nucleic acids or polypeptides of the biological sample.
In a particular embodiment, the expression level of the Notch3 gene may be determined by determining the quantity of mRNA.
Methods for determining the quantity of mRNA are well known in the art. For example the nucleic acid contained in the biological samples (e.g., biopsy prepared from the patient) is first extracted according to standard methods, for example using lytic enzymes or chemical solutions or extracted by nucleic-acid-binding resins following the manufacturer's instructions. The extracted mRNA is then detected by hybridization (e.g., Northern blot analysis) and/or amplification (e.g., RT-PCR). Quantitative or semi-quantitative RT-PCR is preferred. Real-time quantitative or semi-quantitative RT-PCR is particularly advantageous.
In a particular embodiment, the methods of the invention comprise a step of carrying out an in situ hybridization (ISH). In the context of the invention, "hybridization" relates to the fact of obtaining a close interaction of the nucleotide probe and the target region that is expected to be revealed by the detection of the nucleotide probe. Such an interaction can be achieved by the formation of hydrogen bonds between the nucleotide probe and the target sequence, which is typical of the interactions between complementary nucleotide molecules capable of base pairing. Hydrogen bonds can be found, for example, in the annealing of two complementary strands of DNA.
"In situ hybridization" (ISH) thus refers to a type of hybridization that uses a labelled complementary DNA or RNA strand (i.e., probe) to localize a specific DNA or RNA sequence in a portion or section of tissue (in situ). RNA ISH (RNA in situ hybridization) is used to measure and localize RNAs (e.g., mRNAs) within tissue sections. Preferably, the integrity of the structure and/or content of the biological material is maintained. Therefore, in order to achieve the invention, the biological material is preferably fixed. Nucleic acids having at least 10 nucleotides and exhibiting sequence complementarity or homology to the mR A of interest herein find utility as hybridization probes. It is understood that such nucleic acids need not be identical, but are typically at least about 80% identical to the homologous region of comparable size, more preferably 85% identical and even more preferably 90-95% identical. Probes typically comprise single-stranded nucleic acids of between 10 to 1000 nucleotides in length, for instance of between 10 and 800, more preferably of between 15 and 700, typically of between 20 and 500. The probes and primers are "specific" to the nucleic acids they hybridize to, i.e. they preferably hybridize under high stringency hybridization conditions (corresponding to the highest melting temperature Tm, e.g., 50 % formamide, 5x or 6x SCC. SCC is a 0.15 M NaCl, 0.015 M Na-citrate).
In a particular embodiment, the expression level of the Notch3 gene may be determined by determining of the quantity of protein encoded by the Notch3 gene. Such methods comprise contacting the biological sample with a binding partner capable of selectively interacting with the protein present in said sample. The binding partner is generally an antibody that may be polyclonal or monoclonal, preferably monoclonal. Antibodies directed against Notch3 are well known from the skilled man in the art such as the antibodies commercialized by Abeam (ab23426, rabbit polyclonal). Antibodies that bind specifically to human Notch3 and which are useful in the detection and/or diagnosis of Notch3 related diseases are disclosed in the US patent application N° US2012142899
As used herein, the term "monoclonal antibody" refers to a population of antibody molecules that contains only one species of antibody combining site capable of immunoreacting with a particular epitope. A monoclonal antibody thus typically displays a single binding affinity for any epitope with which it immunoreacts. A monoclonal antibody may therefore contain an antibody molecule having a plurality of antibody combining sites, each immunospecific for a different epitope, e.g. a bispecific monoclonal antibody. Although historically a monoclonal antibody was produced by immortalization of a clonally pure immunoglobulin secreting cell line, a monoclonally pure population of antibody molecules can also be prepared by the methods of the invention.
Laboratory methods for preparing monoclonal antibodies are well known in the art (see, for example, Harlow et al, 1988). Monoclonal antibodies (mAbs) may be prepared by immunizing purified Notch3 into a mammal, e.g. a mouse, rat, human and the like mammals. The antibody-producing cells in the immunized mammal are isolated and fused with myeloma or heteromyeloma cells to produce hybrid cells (hybridoma). The hybridoma cells producing the monoclonal antibodies are utilized as a source of the desired monoclonal antibody. This standard method of hybridoma culture is described in Kohler and Milstein (1975).
While mAbs can be produced by hybridoma culture the invention is not to be so limited. Also contemplated is the use of mAbs produced by an expressing nucleic acid cloned from a hybridoma of this invention. That is, the nucleic acid expressing the molecules secreted by a hybridoma of this invention can be transferred into another cell line to produce a transformant. The transformant is genotypically distinct from the original hybridoma but is also capable of producing antibody molecules of this invention, including immunologically active fragments of whole antibody molecules, corresponding to those secreted by the hybridoma. See, for example, U.S. Pat. No. 4,642,334 to Reading; European Patent Publications No. 0239400 to Winter et al. and No. 0125023 to Cabilly et al.
Antibody generation techniques not involving immunisation are also contemplated such as for example using phage display technology to examine naive libraries (from non- immunised animals); see Barbas et al. (1992), and Waterhouse et al. (1993).
Alternatively, binding agents other than antibodies may be used for the purpose of the invention. These may be for instance aptamers, which are a class of molecule that represents an alternative to antibodies in term of molecular recognition. Aptamers are oligonucleotide or oligopeptide sequences with the capacity to recognize virtually any class of target molecules with high affinity and specificity. Such ligands may be isolated through Systematic Evolution of Ligands by Exponential enrichment (SELEX) of a random sequence library, as described in Tuerk C. and Gold L., 1990. The random sequence library is obtainable by combinatorial chemical synthesis of DNA. In this library, each member is a linear oligomer, eventually chemically modified, of a unique sequence. Possible modifications, uses and advantages of this class of molecules have been reviewed in Jayasena S.D., 1999. Peptide aptamers consists of a conformationally constrained antibody variable region displayed by a platform protein, such as E. coli Thioredoxin A that are selected from combinatorial libraries by two hybrid methods (Colas et al, 1996). As used herein, the term "labelled" with regard to the antibody or aptamer, is intended to encompass direct labelling of the antibody or aptamer by coupling (i.e., physically linking) a detectable substance, such as a radioactive agent or a fluorophore (e.g. fluorescein isothiocyanate (FITC) or phycoerythrin (PE) or indocyanine (Cy5), to the antibody or aptamer, as well as indirect labelling of the probe or antibody (e.g., horseradish peroxidise, HRP) by reactivity with a detectable substance. An antibody or aptamer may be also labelled with a radioactive molecule by any method known in the art. For example, radioactive molecules include but are not limited radioactive atom for scintigraphic studies such as I123, I124, In111, Re186 and Re188.
More particularly, an immunohistochemistry (IHC) method may be used.
IHC specifically provides a method of detecting a target protein in a biological sample or tissue specimen in situ. The overall cellular integrity of the sample is maintained in IHC, thus allowing detection of both the presence and location of the protein of interest. Typically a biological sample is fixed with formalin, embedded in paraffin and cut into sections for staining and subsequent inspection by light microscopy. Current methods of IHC use either direct labelling or secondary antibody-based or hapten-based labelling. Examples of known IHC systems include, for example, EnVision (DakoCytomation), Powervision® (Immunovision, Springdale, AZ), the NBA™ kit (Zymed Laboratories Inc., South San Francisco, CA), HistoFine® (Nichirei Corp, Tokyo, Japan).
Accordingly, the invention also relates to a kit for performing a method above- mentioned, wherein said kit comprises means for determining the expression level of the Notch3 gene in a biopsy sample obtained from said transplanted patient.
In another aspect, the invention relates to the use of Notch3 as a biomarker of ABMR.
The term "biomarker", as used herein, refers generally to a molecule, i.e., a gene (or nucleic acid encoding said gene), protein, the expression of which in a biological sample from a patient can be detected by standard methods in the art (as well as those disclosed herein), and is predictive or denotes a condition of the patient from which it was obtained.
In one embodiment, the invention relates to the use of Notch3 as a biomarker of ABMR in a transplanted renal patient. Methods for adjusting an immunosuppressive treatment:
The invention further provides methods for developing personalized treatment plans. Information gained by way of the methods described above can be used to develop a personalized treatment plan for a transplant recipient.
Accordingly, in a further aspect, the invention relates to a method for adjusting the immunosuppressive treatment administered to a transplanted patient following its transplantation, comprising the following steps of: (i) performing the method for determining whether a transplanted patient has or is at risk of ABMR of the invention, and (ii) adjusting the immunosuppressive treatment.
The methods can be carried out by, for example, using any of the methods for determining risk described above and, in consideration of the results obtained, designing a treatment plan for the transplant recipient. If Notch3 is present in pericytes on a kidney biopsy obtained from a patient of interest, this indicates that said patient is at risk for an undesirable clinical outcome (e.g., ABMR). Therefore, said patient is a candidate for treatment with an effective amount of an immunosuppressive treatment (e.g. by an anti-rejection agent). On the contrary, the absence of Nocth3 is indicative of a reduced risk of transplant rejection. Moreover, depending on the expression level Notch3 (i.e. low level or high level of Nocth3 in the analyzed biological sample), the patient may require a treatment regime that is more or less aggressive than a standard regimen, or it may be determined that the patient is best suited for a standard regimen. For instance, a patient without Notch3 expressed in pericytes may avoid an immunosuppressive treatment (or require a less aggressive regimen) and their associated side effects.
Reducing the level and the production of the DSA and/or protecting the allograft may be achieved using any suitable medical means known to those skilled in the art.
In one embodiment, such reduction and protection comprise a therapeutic intervention with the patient such as administration of anti-thymocyte globulin (ATG), monoclonal anti- CD20 antibodies (rituximab), proteasome inhibitor (bortezomib), anti-C5 antibodies (eculizumab), intravenous administration of immunoglobulins and plasmapheresis. In one embodiment, the transplanted patient is a transplanted renal patient.
Therapeutic methods and uses:
In a further aspect, the invention relates to a method for preventing ABMR or progression of ABMR in a transplanted patient, comprising the following steps of: (i) performing the method for determining whether a renal transplanted patient has or is at risk of ABMR of the invention, and (ii) administering to said patient a therapeutically effective amount of a compound selected from the group consisting of anti-thymocyte globulin (ATG), monoclonal anti-CD20 antibodies (rituximab), proteasome inhibitor (bortezomib), anti-C5 antibodies (eculizumab).
By "therapeutically effective amount" is meant an amount sufficient to achieve a concentration of compound which is capable of preventing or slowing down the disease to be treated. Such concentrations can be routinely determined by those of skilled in the art. The amount of the polypeptide actually administered will typically be determined by a physician or a veterinarian, in the light of the relevant circumstances, including the condition to be treated, the chosen route of administration, the actual compound administered, the age, weight, and response of the patient, the severity of the subject's symptoms, and the like. It will also be appreciated by those of skilled in the art that the dosage may be dependent on the stability of the administered compound.
In one embodiment, said compound is selected from the group consisting of anti- thymocyte globulin (ATG), monoclonal anti-CD20 antibodies (rituximab), proteasome inhibitor (bortezomib), anti-C5 antibodies (eculizumab).
In one embodiment, the transplanted patient is a transplanted renal patient. The compounds of the invention may be administered by any means that achieve the intended purpose. For example, administration may be achieved by a number of different routes including, but not limited to subcutaneous, intravenous, intradermal, intramuscular, intraperitoneal, intracerebral, intrathecal, intranasal, oral, rectal, transdermal, buccal, topical, local, inhalant or subcutaneous use. Parenteral and topical routes are particularly preferred. Dosages to be administered depend on individual needs, on the desired effect and the chosen route of administration. It is understood that the dosage administered will be dependent upon the age, sex, health, and weight of the recipient, concurrent treatment, if any, frequency of treatment, and the nature of the effect desired. The total dose required for each treatment may be administered by multiple doses or in a single dose.
The doses used for the administration can be adapted as a function of various parameters, and in particular as a function of the mode of administration used, of the relevant pathology, or alternatively of the desired duration of treatment. For example, it is well within the skill of the art to start doses of the compounds at levels lower than those required to achieve the desired therapeutic effect and to gradually increase the dosage until the desired effect is achieved. However, the daily dosage of the polypeptides may be varied over a wide range from 0.01 to 1,000 mg per adult per day. Preferably, the compositions contain 0.01, 0.05, 0.1, 0.5, 1.0, 2.5, 5.0, 10.0, 15.0, 25.0, 50.0, 100, 250 and 500 mg of the active ingredient for the symptomatic adjustment of the dosage to the subject to be treated. A medicament typically contains from about 0.01 mg to about 500 mg of the active ingredient, preferably from 1 mg to about 100 mg of the active ingredient. An effective amount of the drug is ordinarily supplied at a dosage level from 0.0002 mg/kg to about 20 mg/kg of body weight per day, especially from about 0.001 mg/kg to 10 mg/kg of body weight per day.
The invention will be further illustrated by the following figures and examples. However, these examples and figures should not be interpreted in any way as limiting the scope of the present invention.
FIGURES:
Figure 1: Notch3 expression in peritubular capillary pericytes is strongly increased in the renal transplanted patients with ABMR compared to other types of graft rejection.
Figure 2: Notch3 expression in peritubular capillary pericytes in the different groups of transplanted patients. The level of Notch3 expression was significantly higher in the patients with ABMR than that in other groups EXAMPLE:
Material & Methods
PATIENTS AND SAMPLES COLLECTION:
We analyzed retrospectively the expression of Notch3 in 55 biopsies taken from 50 renal transplanted patients during 2010 to 2012 in Tenon hospital. As negative and positive controls, Notch3 expression was also studied in 2 "healthy" kidneys in the vicinity of renal carcinomas and in 3 renal grafts de-transplanted due to repeated antibody-mediated rejection ABMR and graft function loss.
The expression of Notch3 was evaluated in the pericytes of peritubular capillaries in 14 biopsies diagnosed with ABMR, and compared with those in 41 non-ABMR biopsies including 6 biopsies with T cell mediated rejection (TCMR) or borderline lesions, 19 with diagnoses other than rejection (6 biopsies with acute tubular necrosis, 9 with graft fibrosis, 4 for no classified graft diseases such as minimum graft inflammation) and 16 biopsies with no lesions. ABMR diagnosed by medical staff was based on the biopsies showing peribubular capillaritis with or without c4d staining and anti class I or II antibodies determined by Luminex. All patients had given their oral informed consent to participate in the study. Forty of these patients had received a graft from a deceased donor and the other 10 from living relatives. 60% of biopsies were taken for clinical evaluation due to delayed or declining graft function, suspicion of rejection, occurring 6 days to 10 years after transplantation. 40%> were taken for graft surveillance. The mean recipient age was 50 years at the time of biopsy, and 57.41 % of them were male. The mean donor age was 52.4 years. The mean cold ischemia time was 15.5 hours. 28% of patients had delayed graft function. 63% of patients had received basiliximab as induction therapy. All patients received triple-therapy including a calcineurin inhibitor (CNI). Renal histopatho logical analysis was scored according to the recently (201 1) updated Banff working classification for renal graft pathology [11-13]. Mean i score was 0.32, t score was 0.23, g score was 0.39 and ptc score was 0.53. Seven biopsies displayed acute tubular necrosis lesions. Chronic Banff score for ci was 0.79; and ct was 0.66; cv was 0.7; ah was 0.72.
IMMUNOHISTOCHEMISTRY FOR NOTCH3 DETECTION: Notch3 expression was detected in paraffin tissue by immunohistochemistry. Target retrieval was carried out by heating the tissue in citrate buffer. The sections were incubated overnight at 4°C with phosphate-buffered saline containing anti-Notch3 antibodies (gift kindly offered by Dr. Anne Joutel as described in Joutel et al, JCI 2000. The immunoreactive Notch3 expression was visualized using Envision + HRP system (AEC). For the negative controls, the primary antibodies were replaced by an equal concentration of mouse IgG. Notch3 expression in each biopsy was semi-quantified 3 times in a blind fashion in the pericytes of peritubular capillaries according to the following scale score: 0: no staining; 1 : <10%; 2: 10-24%; 3: 25-50%; 4: >50%.
STATISTICAL ANALYSIS:
The score of Notch3 staining in the pericytes in the patients with ABMR was compared with that in different control groups by t test. Statistical significance was confirmed and p was presented by Mann- Whitney non parametric test by two sides. The association of Notch3 expression in pericytes with Banff histological scores, graft function and proteinuria was evaluated by linear correlation analysis. The level of significance was set up p<0.05. Data analysis was performed using the Stata 8 software.
Results
Notch3 expression in normal kidneys is mainly observed in vascular smooth cells and in glomerular mesengial cells, but not in the peritubular capillary pericytes.
Notch3 expression is highly induced in the peritubular capillary pericytes in the renal transplanted patients with ABMR.
Table 1: Correlation of Notch3 expression in peritubular capillary pericytes with Banff scores. The Notch3 expression level in the pericytes of peritubular capillaries was significantly correlated with microcirculation infiltration scores g, ptc and v (found in ABMR), but not with interstitial or tubular inflammation score (for TCMR). Notch3 expression level was significantly correlated with graft function (up to 2 years post biopsy) and proteinuria (two important clinical manifestations during ABMR).
Figure imgf000018_0001
REFERENCES: Throughout this application, various references describe the state of the art to which this invention pertains. The disclosures of these references are hereby incorporated by reference into the present disclosure.
Joutel A, Andreux F, Gaulis S, Domenga V, Cecillon M, Battail N, Piga N, Chapon F, Godfrain C, Tournier-Lasserve E; The ectodomain of the Notch3 receptor accumulates within the cerebrovasculature of CADASIL patients; J Clin Invest. 2000 Mar;105(5):597-605.

Claims

CLAIMS:
1. A method for determining whether a transplanted patient has or is at risk of antibody- mediated rejection (ABMR), comprising a step of determining the expression level of the Notch3 gene in pericytes present on a transplant biopsy obtained from said patient.
2. The method according to claim 1, further comprising a step of comparing said expression level with a predetermined reference value, wherein an increase in the expression level of the Notch3 gene is indicative of having or being at risk of ABMR.
3. The method according to claim 1 or 2, wherein the transplanted patient is a renal transplanted patient.
4. The method according to any one claims 1 to 3, wherein the expression level of the Notch3 gene is determined by measuring the amount of Notch3 by immunohistochemistry (IHC).
5. The method according to any one claims 1 to 4, wherein the pericytes are pericytes of peritubular capillaries.
6. The method according to any one claims 1 to 5, wherein the ABMR is acute ABMR.
7. A method for adjusting the immunosuppressive treatment administered to a transplanted recipient following its transplantation, comprising the following steps of :
(i) performing the method for determining whether a transplanted patient has or is at risk of ABMR according to any one claims 1 to 6, and
(ii) adjusting the immunosuppressive treatment.
8. A compound selected from the group consisting of monoclonal anti-CD20 antibodies, anti-thymocyte globulin (ATG), anti-C5 antibodies, for use in preventing ABMR or progression of ABMR in a transplanted patient, determined as having or being at risk of ABMR by an increase in the expression level of the Notch3 gene in pericytes present on a transplant biopsy obtained from said patient.
PCT/EP2015/057551 2014-04-08 2015-04-08 A new biomarker of antibody-mediated rejection Ceased WO2015155199A1 (en)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
EP14305511.9 2014-04-08
EP14305511 2014-04-08

Publications (1)

Publication Number Publication Date
WO2015155199A1 true WO2015155199A1 (en) 2015-10-15

Family

ID=50513193

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2015/057551 Ceased WO2015155199A1 (en) 2014-04-08 2015-04-08 A new biomarker of antibody-mediated rejection

Country Status (1)

Country Link
WO (1) WO2015155199A1 (en)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP2021524906A (en) * 2017-12-27 2021-09-16 フィート エンフェー Biomarkers for classifying allogeneic graft recipients

Non-Patent Citations (8)

* Cited by examiner, † Cited by third party
Title
A. NICHOLAS R. BARNETT ET AL: "Rituximab in renal transplantation", TRANSPLANT INTERNATIONAL, vol. 26, no. 6, 18 June 2013 (2013-06-18), pages 563 - 575, XP055135916, ISSN: 0934-0874, DOI: 10.1111/tri.12072 *
BÉATRICE CHARREAU ET AL: "Crosstalk between inflammation, ADAM10 proteolytic activity and Notch signaling in antibody-mediated rejection and endothelial dysfunction", 7 November 2013 (2013-11-07), XP055135906, Retrieved from the Internet <URL:https://tech4pco.com/bsm2013/user_agendas/open_view/143> [retrieved on 20140821] *
CORNELL LYNN D: "Renal allograft pathology in the sensitized patient", CURRENT OPINION IN ORGAN TRANSPLANTATION,, vol. 18, no. 3, 1 June 2013 (2013-06-01), pages 327 - 336, XP009179733, ISSN: 1531-7013 *
JOUDEH AMANI ET AL: "Pathologic basis of antibody-mediated organ transplant rejection: from pathogenesis to diagnosis", CURRENT OPINION IN ORGAN TRANSPLANTATION,, vol. 18, no. 4, 1 August 2013 (2013-08-01), pages 478 - 485, XP009179732, ISSN: 1531-7013 *
ROSANA ROSA MIRANDA CORRÊA ET AL: "The Importance of C4d in Biopsies of Kidney Transplant Recipients", CLINICAL AND DEVELOPMENTAL IMMUNOLOGY, vol. 12, no. 3, 1 January 2013 (2013-01-01), pages 574 - 8, XP055135935, ISSN: 1740-2522, DOI: 10.1111/j.1600-6143.2011.03757.x *
SADAKA BASMA ET AL: "Management of antibody-mediated rejection in transplantation", THE SURGICAL CLINICS OF NORTH AMERICA,, vol. 93, no. 6, 1 December 2013 (2013-12-01), pages 1451 - 1466, XP009179730 *
SONJA DJUDJAJ ET AL: "Notch-3 receptor activation drives inflammation and fibrosis following tubulointerstitial kidney injury", THE JOURNAL OF PATHOLOGY, vol. 228, no. 3, 7 November 2012 (2012-11-07), pages 286 - 299, XP055135932, ISSN: 0022-3417, DOI: 10.1002/path.4076 *
T. QUILLARD ET AL: "Impaired Notch4 Activity Elicits Endothelial Cell Activation and Apoptosis: Implication for Transplant Arteriosclerosis", ARTERIOSCLEROSIS, THROMBOSIS, AND VASCULAR BIOLOGY, vol. 28, no. 12, 1 December 2008 (2008-12-01), pages 2258 - 2265, XP055135895, ISSN: 1079-5642, DOI: 10.1161/ATVBAHA.108.174995 *

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP2021524906A (en) * 2017-12-27 2021-09-16 フィート エンフェー Biomarkers for classifying allogeneic graft recipients
JP7073528B2 (en) 2017-12-27 2022-05-23 フィート エンフェー Biomarkers for classifying allogeneic transplant recipients

Similar Documents

Publication Publication Date Title
JP6636067B2 (en) Method for diagnosis, prognosis and treatment of prostate cancer metastasis using c-MAF
KR20100131003A (en) Compositions and Methods for Treating and Diagnosing Asthma
JP2011509071A (en) Gene expression markers for inflammatory bowel disease
KR20110036610A (en) New Oncogin NRF2
CN112626207A (en) Gene combination for distinguishing non-invasive and invasive non-functional pituitary adenomas
EP3283889B1 (en) Method and assay for diagnosing rapidly progressive glomerulonephritis in a subject
JP2022544108A (en) Single nucleotide polymorphism and its use
WO2015155199A1 (en) A new biomarker of antibody-mediated rejection
US20150218242A1 (en) TIF1-Gamma for Treating and Diagnosing Inflammatory Diseases
US9056919B2 (en) USP2a peptides and antibodies
ES2786322T3 (en) Methods for predicting graft alterations
JP6721571B2 (en) Use of 15 male reproductive proteins or combinations thereof
KR102415818B1 (en) A composition for diagnosing subarachnoid hemorrhage comprising a formulation capable of measuring the expression level of TCRB CDR3 repertoire
KR102479643B1 (en) A method for diagnosing severe subarachnoid hemorrhage comprising analyzing the TCRB CDR3 repertoire
KR102415817B1 (en) A composition for diagnosing subarachnoid hemorrhage comprising a formulation capable of measuring the expression level of TCRBV 19-01 and TCRBJ02-04
WO2019208542A1 (en) Biomarker for differentiating between still&#39;s disease and septicemia
CN107385099A (en) Biomarker for diagnosis and treatment gastric gland metastasis of cancer
CN107385100A (en) Purposes of the MCM8 as sdenocarcinoma of stomach Metastatic Marker
CN107354230B (en) Molecular marker related to gastric adenocarcinoma metastasis
CN107385096B (en) LRRTM1 gene and application of expression product thereof in preparation of gastric adenocarcinoma metastasis diagnosis and treatment tool
JP2025520370A (en) Prognostic markers and therapeutic targets for diffuse gastric cancer
KR20220086913A (en) A method for diagnosing severe subarachnoid hemorrhage including measuring the expression level of TCRBV30-01 and TCRBJ02-04
CN107385098A (en) Gastric gland metastasis of cancer diagnosis and treatment instrument
WO2016005432A1 (en) A new biomarker of chronic allograft nephropathy and of renal transplant rejection
HK1174067A (en) Gene expression markers for crohn&#39;s disease

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 15715233

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 15715233

Country of ref document: EP

Kind code of ref document: A1