WO2015154783A1 - Glycosylated polypeptides originating from enterotoxigenic escherichia coli (etec) - Google Patents

Glycosylated polypeptides originating from enterotoxigenic escherichia coli (etec) Download PDF

Info

Publication number
WO2015154783A1
WO2015154783A1 PCT/DK2015/050089 DK2015050089W WO2015154783A1 WO 2015154783 A1 WO2015154783 A1 WO 2015154783A1 DK 2015050089 W DK2015050089 W DK 2015050089W WO 2015154783 A1 WO2015154783 A1 WO 2015154783A1
Authority
WO
WIPO (PCT)
Prior art keywords
polypeptide
etec
seq
glycosylated
immunogenic
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/DK2015/050089
Other languages
French (fr)
Inventor
Anders Boysen
Jakob MØLLER-JENSEN
Giuseppe Palmisano
Martin Røssel LARSEN
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Syddansk Universitet
Original Assignee
Syddansk Universitet
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Syddansk Universitet filed Critical Syddansk Universitet
Publication of WO2015154783A1 publication Critical patent/WO2015154783A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/195Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • C07K14/24Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Enterobacteriaceae (F), e.g. Citrobacter, Serratia, Proteus, Providencia, Morganella, Yersinia
    • C07K14/245Escherichia (G)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/02Bacterial antigens
    • A61K39/025Enterobacteriales, e.g. Enterobacter
    • A61K39/0258Escherichia
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/12Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from bacteria
    • C07K16/1203Gram-negative bacteria
    • C07K16/1228Enterobacterales (O), e.g. Citrobacter (G), Serratia (G), Proteus (G), Providencia (G), Morganella (G) or Yersinia (G)
    • C07K16/1232Escherichia (G)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • YGENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02ATECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
    • Y02A50/00TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
    • Y02A50/30Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change

Definitions

  • the present invention relates to glycosylated polypeptides that are
  • polypeptides originates from or are derived from
  • enterotoxigenic Escherichia coli ETEC
  • the applications include immunization, treatment, vaccination and diagnosis of ETEC. Background of the invention
  • ETEC Enterotoxigenic Escherichia coli
  • ETEC is a diverse group of pathogens defined by their ability to colonize the small intestine and secrete heat-labile and/or heat stable enterotoxins.
  • the complex pathogenicity is further attributed to the presence of additional bacterial virulence genes on mobile genetic elements such as plasmids and chromosomal pathogenicity islands.
  • glycoproteins Discovery and characterization of glycoproteins is further complicated by heterogeneous glycosylation, low abundance and poor ionization of peptides modified with carbohydrates compared to the non-modified counterpart.
  • An object of the present invention is to provide glycosylated polypeptides that are immunogenic.
  • polypeptide NmpC also known as ETEC_0806 or CBJ00316, SEQ ID NO: 1
  • TibA autotransporter also known as CBJ01643 or ETEC_2141, SEQ ID NO: 20
  • EtpA also known as CBJ04458, SEQ ID NO: 31
  • EatA also known as CBJ04449, SEQ ID NO: 39
  • CexE also known as CBJ04537, SEQ ID NO: 48
  • Ag43 also known as CBJ03971, SEQ ID NO: 51.
  • Another aspect of the present invention relates to one of these polypeptides comprising the full length sequence, a polypeptide fragment of SEQ ID NO: 1 that has at least 75 % sequence identity to the full length sequence, or a B- or T-cell epitope of the full length sequence, wherein the polypeptide is
  • polypeptide is glycosylated at least in two or three positions.
  • ETEC enterotoxigenic Escherichia coli
  • Fragments of the polypeptides include the glycosylated polypeptide selected from the group of glycosylated polypeptides consisting of SEQ ID NOs: 2- 19.
  • Yet another aspect of the present invention relates to the polypeptide, wherein the polypeptide is a fusion polypeptide.
  • a further aspect of the present invention relates to the polypeptides as described herein comprised in an immunogenic composition, a pharmaceutical composition, or a vaccine.
  • One other aspect of the present invention relates to a nucleic acid sequence encoding a polypeptide.
  • Another aspect of the present invention relates to a method for immunizing a mammal, the method comprising administering to the mammal the
  • a further aspect of the present invention relates to a method for treating a mammal, which is infected with ETEC comprising administering to the mammal the immunogenic composition, pharmaceutical composition or vaccine as described herein.
  • Another aspect of the present invention relates to the polypeptide
  • immunogenic composition for use in treating infection caused by ETEC.
  • Yet another aspect of the present invention relates to the polypeptide, immunogenic composition, pharmaceutical composition, or vaccine as described herein for use in the preparation of a medicament for treating infection caused by ETEC.
  • Another aspect of the present invention relates to the polypeptide
  • immunogenic composition for use in the diagnosis of an infection caused by ETEC.
  • Figure 1 shows ⁇ -Elimination of glycan moiety and replacement with 2-AEP through Michael addition chemistry.
  • (1C) The AEP modified peptide is selectively enriched with T1O2 as both the glycopeptide and the beta-eliminated peptide is absent in the MALDI MS spectrum.
  • BEMAP mass spectrometry-based technique
  • BEMAP combines a simple reaction scheme with a highly selective enrichment protocol to circumvent the challenges previously associated with bacterial glycoproteomics.
  • the BEMAP reaction efficiently substitutes O-linked
  • AEP 2-Aminoethyl phosphonic acid
  • BEMAP has been employed to map novel protein glycosylation sites in ETEC strain H10407 and the non-pathogenic E. coli K-12 MG1655.
  • Functional characterization of an ⁇ 10407 ⁇ 7/ ⁇ knockout strain revealed the importance of protein glycosylation for ETEC adhesion to human intestinal cells.
  • the ETEC glycosylated proteins are important in understanding the immunogenicity of ETEC.
  • the glycosylated polypeptides disclosed herein leads to an enhanced immunogenicity compared to the same polypeptides that are not glycosylated.
  • an object of the present invention is to provide glycosylated polypeptides that are immunogenic.
  • glycosylation refers to O-linked glycosylation. This is the attachment of a sugar molecule to a hydroxyl oxygen of either a Serine or Threonine side chain in a protein.
  • the proteins include NmpC (also known as ETEC_0806 or CBJ00316, SEQ ID NO: 1), TibA autotransporter (also known as CBJ01643 or ETEC_2141, SEQ ID NO: 20), EtpA (also known as CBJ04458, SEQ ID NO: 31), EatA (also known as CBJ04449, SEQ ID NO: 39), CexE (also known as CBJ04537, SEQ ID NO: 48), and Ag43 (also known as CBJ03971, SEQ ID NO: 51).
  • one aspect of the present invention relates to a polypeptide comprising SEQ ID NO: 1, a polypeptide fragment of SEQ ID NO: 1 that has at least 75 % sequence identity to SEQ ID NO: 1, or a B- or T-cell epitope of SEQ ID NO: 1, wherein the polypeptide is glycosylated at least in one position.
  • Another aspect of the present invention relates to a polypeptide comprising SEQ ID NO: 20, a polypeptide fragment of SEQ ID NO: 20 that has at least 75 % sequence identity to SEQ ID NO: 20, or a B- or T-cell epitope of SEQ ID NO: 20, wherein the polypeptide is glycosylated at least in one position.
  • Yet another aspect of the present invention relates to a polypeptide comprising SEQ ID NO: 31, a polypeptide fragment of SEQ ID NO: 31 that has at least 75 % sequence identity to SEQ ID NO: 31, or a B- or T-cell epitope of SEQ ID NO: 31, wherein the polypeptide is glycosylated at least in one position.
  • a further aspect of the present invention relates to a polypeptide comprising SEQ ID NO: 39, a polypeptide fragment of SEQ ID NO: 39 that has at least 75 % sequence identity to SEQ ID NO: 39, or a B- or T-cell epitope of SEQ ID NO: 39, wherein the polypeptide is glycosylated at least in one position.
  • Another aspect of the present invention relates to a polypeptide comprising SEQ ID NO: 48, a polypeptide fragment of SEQ ID NO: 48 that has at least 75 % sequence identity to SEQ ID NO: 48, or a B- or T-cell epitope of SEQ ID NO: 48, wherein the polypeptide is glycosylated at least in one position.
  • Yet another aspect of the present invention relates to a polypeptide comprising SEQ ID NO: 51, a polypeptide fragment of SEQ ID NO: 51 that has at least 75 % sequence identity to SEQ ID NO: 51, or a B- or T-cell epitope of SEQ ID NO: 51, wherein the polypeptide is glycosylated at least in one position.
  • polypeptides of the present invention may be glycosylated at least in two positions, such as at least in three positions, at least four positions, at least five positions, at least six positions, or at least seven positions.
  • polypeptides can also be glycosylated in exactly one, two three, four, five, sex or seven positions.
  • the polypeptides of the present invention originates from Enterotoxigenic Escherichia coli (ETEC) as shown in the examples of the present disclosure.
  • ETEC Enterotoxigenic Escherichia coli
  • the polypeptides can therefore be purified directly from ETEC but they can also be chemically synthesized.
  • the polypeptides can also be functional variants of the polypeptides disclosed herein. Such variance can be determined by sequence identity.
  • sequence identity indicates a quantitative measure of the degree of homology between two amino acid sequences of substantially equal length or between two nucleic acid sequences of substantially equal length. The two sequences to be compared must be aligned to best possible fit possible with the insertion of gaps or alternatively, truncation at the ends of the protein sequences.
  • sequence identity can be calculated as ( N ⁇ - ⁇ 100 r wherein Ndif is the total number of non-identical residues in the two sequences when aligned and wherein Nref is the number of residues in one of the sequences.
  • Sequence identity can alternatively be calculated by the BLAST program e.g. the BLASTP program (Pearson W. R and D.J. Lipman
  • a preferred minimum percentage of sequence identity is at least 75 %, such as at least 80%, such as at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, and at least 99.5%.
  • the numbers of substitutions, insertions, additions or deletions of one or more amino acid residues in the fusion polypeptide is limited, i.e. no more than 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 substitutions, no more than 1, 2, 3, 4, 5,
  • Polypeptides such as the ETEC proteins disclosed herein can contain
  • immunogenic parts such as B- or T-cell epitopes.
  • the immunogenic part of an immunogenic polypeptide is the part of the polypeptide, which elicits an immune response in an animal or a human being, and/or in a biological sample determined by any of the biological assays known to the skilled person working with immune responses.
  • the immunogenic part of a polypeptide may be a T-cell epitope or a B-cell epitope and can be related to one or a few relatively small parts of the polypeptide, they can be scattered throughout the polypeptide sequence or be situated in specific parts of the polypeptide.
  • T-cell epitopes which are recognised during an immune response
  • a "brute force” method Since T-cell epitopes are linear, deletion mutants of the polypeptide will, if constructed systematically, reveal what regions of the polypeptide are essential in immune recognition, e.g. by subjecting these deletion mutants e.g. to assays known to the skilled person working with immune responses.
  • Another method utilizes overlapping oligopeptides for the detection of MHC class II epitopes, preferably synthetic, having a length of e.g. 20 amino acid residues derived from the polypeptide. These peptides can be tested in biological assays and some of these will give a positive response (and thereby be immunogenic) as evidence for the presence of a T cell epitope in the peptide.
  • B-cell epitopes can be determined by analyzing the B-cell recognition to overlapping peptides covering the polypeptide of interest. B-cell epitopes differ from T-cell epitopes in that they are conformational epitopes that require a three dimensional structure in order to raise an immune response. Not intended to be bound by theory can variants of B-cell epitopes therefore be identified through key amino acids (for example glycosylated amino acids) and a certain length of the polypeptide while remaining
  • an embodiment of the present invention therefore relates to epitopes, such as B- or T-cell epitopes on the polypeptides mentioned herein.
  • polypeptides of the present invention are their capability to induce an immunological response as illustrated in the examples. It is understood that within the scope of the present invention are variants of the polypeptides of the invention produced by substitution, insertion, addition or deletion while remaining immunogenic.
  • epitopes examples include SEQ ID NOs: 2- 19 of NmpC, SEQ ID NOs: 21-30 of TibA, SEQ ID NOs: 32-38 of EtpA, SEQ ID NOs: 40-47 of EatA, SEQ ID NOs: 49-50 of CexE, and SEQ ID NOs: 52-68 of Ag43.
  • epitopes or fragments are that they comprise one or more glycosylations at central positions.
  • substantially pure polypeptide means a polypeptide preparation which contains at most 5% by weight of other polypeptide material with which it is associated natively or during recombinant or synthetic production (lower percentages of other polypeptide material are preferred, e.g. at most 4%, at most 3%, at most 2%, at most 1%, and at most/2%) .
  • the substantially pure polypeptide is at least 96% pure, i.e. that the polypeptide constitutes at least 96% by weight of total polypeptide material present in the preparation, and higher percentages are preferred, such as at least 97%, at least 98%, at least 99%, at least 99,25%, at least 99,5%, and at least 99,75%. It is especially preferred that the polypeptide is in
  • essentially pure form i.e. that the polypeptide is essentially free of any other antigen with which it is natively associated, i.e. free of any other antigen from bacteria.
  • This can be accomplished by preparing the polypeptide by means of recombinant methods in a host cell, or by synthesizing the polypeptide by the well-known methods of solid or liquid phase peptide synthesis, and by using appropriate purification procedures well known to the person of ordinary skill in the art.
  • polypeptides of the present invention substantially pure or in essentially pure form.
  • Two or more of the polypeptides disclosed herein may be fused to form fusion polypeptides.
  • polypeptides as defined herein wherein the polypeptide is comprised in a fusion polypeptide.
  • polypeptides to which fusion is made may originate from ETEC or alternatively be other polypeptides that are beneficial when an enhanced immune response against ETEC is required.
  • another embodiment of the present invention relates to a polypeptide as defined herein, wherein the polypeptide is fused to a polypeptide originating from ETEC.
  • An immunogenic polypeptide is defined as a polypeptide that induces an immune response.
  • the immune response may be monitored by one of the following methods: An in vitro cellular response is determined by release of a relevant cytokine such as IFN- ⁇ , from lymphocytes withdrawn from an animal or human currently or previously infected with ETEC, or by detection of proliferation of these T cells. The induction is performed by addition of the polypeptide or the
  • immunogenic part to a suspension comprising from lxlO 5 cells to 3xl0 5 cells per well.
  • the cells are isolated from either blood, the spleen, the liver or the lung and the addition of the polypeptide or the immunogenic part of the polypeptide result in a concentration of not more than 20 pg per ml suspension and the stimulation is performed from two to five days.
  • the cells are pulsed with radioactive labeled Thymidine and after 16-22 hours of incubation the proliferation is detected by liquid scintillation counting.
  • a positive response is a response more than background plus two standard deviations.
  • the release of IFN- y can be determined by the ELISA method, which is well known to a person skilled in the art.
  • a positive response is a response more than background plus two standard deviations.
  • Other cytokines than IFN- y could be relevant when monitoring an immunological response to the polypeptide, such as IL- 12, TNF-a, IL-4, IL-5, IL- 10, IL-6, TGF- ⁇ -
  • cytokine e.g. IFN-y
  • ELISPOT sandwich immunosorbent assay
  • the cells isolated from either the blood, the spleen, the liver or the lung are diluted to a concentration of preferable of 1 to 4 x 10 6 cells /ml and incubated for 18-22 hrs in the presence of the polypeptide or the immunogenic part of the polypeptide resulting in a concentration of not more than 20 pg per ml.
  • the cell suspensions are hereafter diluted to 1 to 2 x 10 6 / ml and transferred to Maxisorp plates coated with anti- IFN- ⁇ and incubated for preferably 4 to 16 hours.
  • the IFN-y producing cells are determined by the use of labelled secondary anti-IFN-antibody and a relevant substrate giving rise to spots, which can be enumerated using a dissection microscope. It is also a possibility to determine the presence of mRNA coding for the relevant cytokine by the use of the PCR technique. Usually one or more cytokines will be measured utilizing for example the PCR, ELISPOT or ELISA. It will be appreciated by a person skilled in the art that a significant increase or decrease in the amount of any of these cytokines induced by a specific polypeptide can be used in evaluation of the immunological activity of the polypeptide.
  • An in vitro cellular response may also be determined by the use of T cell lines derived from an immune individual or an ETEC infected person where the T cell lines have been driven with either live ETEC, extracts from the bacterial cell or culture filtrate for 10 to 20 days with the addition of IL-2.
  • the induction is performed by addition of not more than 20 pg polypeptide per ml suspension to the T cell lines containing from lxlO 5 cells to 3xl0 5 cells per well and incubation is performed from two to six days.
  • the induction of IFN- ⁇ or release of another relevant cytokine is detected by ELISA.
  • the stimulation of T cells can also be monitored by detecting cell proliferation using radioactively labeled Thymidine as described above. For both assays a positive response is a response more than background plus two standard deviations.
  • An in vivo cellular response may be determined as a positive DTH response after intradermal injection or local application patch of at most 100 pg of the polypeptide or the immunogenic part to an individual who is clinically or subclinically infected with ETEC, a positive response having a diameter of at least 5 mm 72-96 hours after the injection or application.
  • An in vitro humoral response is determined by a specific antibody response in an immune or infected individual.
  • the presence of antibodies may be
  • the polypeptide or the immunogenic part is absorbed to either a nitrocellulose membrane or a polystyrene surface.
  • the serum is preferably diluted in PBS from 1 : 10 to 1 : 100 and added to the absorbed polypeptide and the incubation being performed from 1 to 12 hours.
  • labeled secondary antibodies the presence of specific antibodies can be determined by measuring the presence or absence of a specific label e.g. by ELISA where a positive response is a response of more than background plus two standard deviations or alternatively a visual response in a Western blot.
  • Another relevant parameter is measurement of the protection in animal models induced after vaccination with the polypeptide in an adjuvant or after DNA vaccination.
  • Suitable animal models include primates, guinea pigs or mice, which are challenged with an infection of an ETEC. Readout for induced protection could be decrease of the bacterial load in target organs compared to non-vaccinated animals, prolonged survival times compared to non-vaccinated animals and diminished weight loss or pathology compared to non-vaccinated animals.
  • Readout for induced protection could be decrease of the bacterial load in target organs compared to non-vaccinated animals, prolonged survival times compared to non-vaccinated animals and diminished weight loss or pathology compared to non-vaccinated animals.
  • polypeptides described herein immunogenic are the polypeptides described herein immunogenic.
  • compositions comprising the polypeptides described herein.
  • Such composition will constitute an immunogenic composition.
  • glycosylated polypeptides disclosed herein can constitute epitopes.
  • An epitope also known as antigenic determinant, is the part of an antigen that is recognized by the immune system, specifically by antibodies, B cells, or T cells.
  • the epitopes of protein antigens are divided into two categories, conformational epitopes and linear epitopes, based on their structure and interaction with the paratope.
  • a conformational epitope is composed of discontinuous sections of the antigen's amino acid sequence. These epitopes interact with the paratope based on the 3-D surface features and shape or tertiary structure of the antigen.
  • linear epitopes interact with the paratope based on their primary structure.
  • a linear epitope is formed by a continuous sequence of amino acids from the antigen.
  • one aspect of the present invention relates to an antibody that binds to an epitope described herein.
  • Antibodies raised against the epitope may be either polyclonal or monoclonal.
  • the antibodies may be is suitable to generate chimeric and/ or human versions that could be appropriate for human in vivo use.
  • immunoglobulin heavy chain is the large polypeptide subunit of an antibody (immunoglobulin).
  • a typical antibody is composed of two
  • immunoglobulin (Ig) heavy chains and two Ig light chains.
  • Ig heavy chain immunoglobulin (Ig) heavy chains and two Ig light chains.
  • Ig heavy chain types vary between different animals.
  • the immunoglobulin light chain is the small polypeptide subunit of an antibody (immunoglobulin).
  • ⁇ chain encoded by the immunoglobulin kappa locus on chromosome 2
  • ⁇ chain encoded by the immunoglobulin lambda locus on chromosome 2
  • Antibodies are produced by B lymphocytes, each expressing only one class of light chain.
  • the total kappa to lambda ratio is roughly 2 : 1 in serum (measuring intact whole antibodies) or 1 : 1.5 if measuring free light chains, with a highly divergent ratio indicative of neoplasm.
  • the exact normal ratio of kappa to lambda ranges from 0.26 to 1.65.
  • compositions comprising the polypeptides described herein may be administered in a physiologically acceptable medium (e.g., deionized water, phosphate buffered saline (PBS), saline, aqueous ethanol or other alcohol, plasma, proteinaceous solutions, mannitol, aqueous glucose, vegetable oil, or the like).
  • a physiologically acceptable medium e.g., deionized water, phosphate buffered saline (PBS), saline, aqueous ethanol or other alcohol, plasma, proteinaceous solutions, mannitol, aqueous glucose, vegetable oil, or the like.
  • a further embodiment of the present invention relates to a composition comprising a polypeptides as described herein that constitutes a pharmaceutical composition.
  • Buffers may also be included, particularly where the media are generally buffered at a pH in the range of about 5 to 10, where the buffer will generally range in concentration from about 50 to 250 mM salt, where the concentration of salt will generally range from about 5 to 500 mM, physiologically acceptable stabilizers, and the like.
  • composition comprises one or more excipients, diluents and/or carriers.
  • Aqueous suspensions may contain the active materials in admixture with excipients suitable for the manufacture of aqueous suspensions.
  • excipients include suspending agents, for example sodium carboxymethylcellulose, methylcellulose, hydropropyl-methylcellulose, sodium alginate, polyvinylpyrrolidone, gum tragacanth and gum acacia ; dispersing or wetting agents can be a naturally-occurring phosphatide, for example, lecithin, or condensation products of an alkylene oxide with fatty acids, for example polyoxyethylene stearate, or condensation products of ethylene oxide with long chain aliphatic alcohols, for example heptadecaethyleneoxycetanol, or condensation products of ethylene oxide with partial esters derived from fatty acids and a hexitol such as polyoxyethylene sorbitol monooleate, or
  • condensation products of ethylene oxide with partial esters derived from fatty acids and hexitol anhydrides for example polyethylene sorbitan monooleate.
  • an aspect of the present invention relates to a pharmaceutical
  • composition comprising the polypeptide as described herein and at least one pharmaceutically acceptable carrier, excipient or diluent.
  • the polypeptides, immunogenic compositions, and pharmaceutical composition may constitute a vaccine against ETEC.
  • vaccines Key features of vaccines is that they are recognized by the recipient's immune response, generate a response, and ultimately decrease the bacterial load of ETEC.
  • the vaccines are administered in a manner compatible with the dosage formulation, and in such amount as will be prophylactic or therapeutically effective and immunogenic.
  • the quantity to be administered depends on the subject to be treated, including, e.g., the capacity of the individual's immune system to mount an immune response, and the degree of protection desired.
  • Suitable dosage ranges are of the order of several hundred micrograms of the fusion polypeptide of the invention per vaccination with a preferred range from about 0.1 pg to 1000 pg, such as in the range from about 1 pg to 300 pg, and especially in the range from about 10 pg to 100 pg.
  • Suitable regimens for initial administration and booster shots are also variable but are typified by an initial administration followed by subsequent inoculations or other administrations.
  • any of the conventional methods for administration of a vaccine are applicable. These include oral, nasal or mucosal application in either a solid form containing the active ingredients (such as a pill, suppository or capsule) or in a physiologically acceptable dispersion, such as a spray, powder or liquid, or parenterally, by injection, for example, subcutaneously, intradermally or intramuscularly or transdermal ⁇ applied.
  • the dosage of the vaccine will depend on the route of administration and will vary according to the age of the person to be vaccinated and, to a lesser degree, the size of the person to be vaccinated. Currently, most vaccines are administered intramuscularly by needle injection and this is likely to continue as the standard route.
  • the vaccines are conventionally administered parenterally, by injection, for example, either subcutaneously or intramuscularly.
  • Additional formulations which are suitable for other modes of administration include suppositories and, in some cases, oral formulations.
  • suppositories traditional binders and carriers may include, for example, polyalkalene glycols or triglycerides; such suppositories may be formed from mixtures containing the active ingredient in the range of 0.5% to 10%, preferably 1-2%.
  • Oral formulations include such normally employed excipients as, for example, pharmatical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharine, cellulose, magnesium carbonate, and the like.
  • compositions take the form of solutions, suspensions, tablets, pills, capsules, sustained release formulations or powders and advantageously contain 10-95% of active ingredient, preferably 25-70%.
  • active ingredient preferably 25-70%.
  • the adjuvant is preferably selected from the group consisting of
  • DDA dimethyloctadecylammonium bromide
  • DODAC dimethyloctadecenylammonium bromide
  • Quil A poly I :C, aluminium hydroxide, Freund's incomplete adjuvant, IFN- ⁇ , IL-2, IL- 12, monophosphoryl lipid A (MPL), Treholose
  • TDM Dimycolate
  • MDP muramyl dipeptide
  • the polypeptides may also be used for immunizing a mammal against ETEC or treating the mammal against ETEC.
  • Another aspect of the present invention relates to a method for treating a mammal, which is infected with ETEC comprising administering to the mammal the immunogenic composition, pharmaceutical composition or vaccine as described herein.
  • the mammal in one embodiment of the present invention is the mammal a human. In another embodiment of the present invention is the mammal an animal selected from the group consisting of a pig, a cow, a sheep, and a horse. A further aspect of the present invention relates to an immunogenic
  • compositions, pharmaceutical composition, or vaccine as described herein for use in treating infection caused by ETEC Yet another aspect of the present invention relates to an immunogenic composition, pharmaceutical, or vaccine as described herein for use in the preparation of a medicament for treating infection caused by ETEC.
  • nucleic acid fragment and “nucleic acid sequence” are understood any nucleic acid molecule including DNA, RNA, LNA (locked nucleic acids), PNA, RNA, dsRNA and RNA-DNA-hybrids. Also included are nucleic acid molecules comprising non-naturally occurring nucleosides. The term includes nucleic acid molecules of any length e.g . from 10 to 10000 nucleotides, depending on the use. When the nucleic acid molecule is for use as a
  • a molecule encoding at least one epitope is preferably used, having a length from about 18 to about 1000 nucleotides, the molecule being optionally inserted into a vector.
  • nucleic acid molecule When the nucleic acid molecule is used as a probe, as a primer or in antisense therapy, a molecule having a length of 10- 100 is preferably used.
  • molecule lengths can be used, for instance a molecule having at least 12, 15, 21, 24, 27, 30, 33, 36, 39, 42, 50, 60, 70, 80, 90, 100, 200, 300, 400, 500 or 1000 nucleotides (or nucleotide derivatives), or a molecule having at most 10000, 5000, 4000, 3000, 2000, 1000, 700, 500, 400, 300, 200, 100, 50, 40, 30 or 20 nucleotides (or nucleotide derivatives).
  • polypeptide as defined herein encoded nucleic acid sequence.
  • Immunodiagnostics are well-suited for the detection of even the smallest of amounts of biochemical substances such as antibodies.
  • Antibodies specific for a desired antigen can be conjugated with a radiolabel, fluorescent label, or color- forming enzyme and are used as a "probe" to detect it.
  • Well known applications include pregnancy tests, immunoblotting, ELISA and immunohistochemical staining of microscope slides. The speed, accuracy and simplicity of such tests has led to the development of rapid techniques for the diagnosis of disease.
  • one aspect of the present invention relates to a polypeptide
  • immunogenic composition or pharmaceutical composition as described herein for use in the diagnosis of an infection caused by ETEC.
  • polypeptide, immunogenic composition, or pharmaceutical composition as described herein may also be used to detect the present of ETEC in a sample or used as an indication whether a sample or subject may contain ETEC.
  • BEMAP relies on ⁇ -elimination of O-linked carbohydrate modifications, Michael addition of 2-Aminoethyl phosphonic acid (AEP) and T1O2 enrichment of phosphopeptides.
  • AEP 2-Aminoethyl phosphonic acid
  • T1O2 enrichment of phosphopeptides combines a firmly established in vitro chemical modification with a highly selective enrichment protocol (Thingholm et al., 2006) and the reactions take place in a single volume without the need for intermediate purification steps as described in the Experimental Procedures section.
  • the BEMAP method was first established using a synthetic mannosylated peptide as a model compound.
  • BEMAP converts other glycopeptides into a phosphopeptide, independent of the identity of the linked monosaccharide (data not shown). It should be noted that the T1O2 purification step of BEMAP also targets
  • the AEP molecule is constituted by a phosphonate functional group which is stable under CID and HCD fragmentation conditions compared to the phosphate one which is labile under these conditions. This allows unambiguous assignment of modified amino acid residues and avoids false positives in site localization assignment (data not shown).
  • BEMAP to a purified heptosylated protein : Ag43 from E. coli (Knudsen et al., 2008). As may be seen in Figure ID, in-gel digestion of the glycosylated protein yielded heptosylated and unmodified peptides.
  • BEMAP is a specific and sensitive method for detecting protein glycosylation.
  • the outer membrane protein fraction of H 10407 was isolated and subjected to BEMAP analysis for identification of glycoproteins. This approach identified the proteins NmpC, TibA, EtpA, EatA, CexE and Ag43.
  • BEMAP relies on nucleophile tagging using 2-Aminoethyl phosphonic acid (AEP) rather than e.g. DTT.
  • AEP 2-Aminoethyl phosphonic acid
  • BEMAP method selectivity is achieved with the glycan-for- phosphate molecule exchange combined with a highly specific enrichment protocol for downstream sample processing (Thingholm et al., 2006).
  • the BEMAP chemistry can be applied in principle to any organism on a large-scale proteomics level irrespective of the chemical properties of the O-linked monosaccharide.
  • BEMAP replaces the carbohydrate moiety of a synthetic glycosylated peptide with a phosphotag in a chemical reaction exceeding 95% efficiency.
  • HCD MS/MS HCD MS/MS
  • Lyophilized peptide sample is resuspended in 100 ⁇ BEMAP solution consisting of 0.4 M 2-AEP (Sigma; 268674), 0.75 M NaOH (Sigma; S8045), 20 mM Ba(OH)2 (Sigma; 433373) and incubate at 37°C in a heating block for 3.15 hours shaking at 1300 r. p. m .
  • the reaction is stopped by acidification (1% TFA final concentration).
  • Sample volume is increased to 1 ml and the peptides are purified on an Oasis HLB Plus short cartridge (Waters) as recommend by manufacturer and subsequently lyophilized.
  • T1O2 enrichment was performed as described by Tingholm et al., 2006.
  • NmpC Putative outer membrane porin protein NmpC, ETEC_0806, CBJ00316 Primary sequence of NmpC (SEQ ID NO: 1) :
  • ETEC H 10407 lead molecules 3
  • Two-partner secreted adhesin EtpA, CBJ04458, ETEC_p948_0110 Primary sequence of EtpA (SEQ ID NO: 31) :
  • VsNsGTIR S218 S220 Identified TibA glycopeptides listed as probable epitopes presented by Antigen Presenting Cells (glycosylations underlined, SEQ ID NOs: 35-38, respectively) :
  • GYSWKYSNDACNE 6 Putative antigen Ag43, CBJ03971, ETEC_4462
  • An immunogenic polypeptide is defined as a polypeptide that induces an immune response.
  • the immune response may be monitored by one of the following methods: An in vitro cellular response is determined by release of a relevant cytokine such as IFN- ⁇ , from lymphocytes withdrawn from an animal or human currently or previously infected with ETEC, or by detection of proliferation of these T cells.
  • the induction is performed by addition of the polypeptide or the immunogenic part to a suspension comprising from lxlO 5 cells to 3xl0 5 cells per well.
  • the cells are isolated from either blood, the spleen, the liver or the lung and the addition of the polypeptide or the immunogenic part of the polypeptide result in a concentration of not more than 20 pg per ml suspension and the stimulation is performed from two to five days.
  • cytokine For monitoring cell proliferation the cells are pulsed with radioactive labeled Thymidine and after 16-22 hours of incubation the proliferation is detected by liquid scintillation counting.
  • a positive response is a response more than background plus two standard deviations.
  • the release of IFN- ⁇ can be determined by the ELISA method, which is well known to a person skilled in the art.
  • a positive response is a response more than background plus two standard deviations.
  • Other cytokines than IFN- ⁇ could be relevant when monitoring an immunological response to the polypeptide, such as IL-12, TNF-a, IL-4, IL-5, IL-10, IL-6, TGF- ⁇ - Another and more sensitive method for determining the presence of a cytokine (e.g.
  • IFN- ⁇ is the ELISPOT method where the cells isolated from either the blood, the spleen, the liver or the lung are diluted to a concentration of preferable of 1 to 4 x 10 6 cells /ml and incubated for 18-22 hrs in the presence of the polypeptide or the immunogenic part of the polypeptide resulting in a concentration of not more than 20 pg per ml.
  • the cell suspensions are hereafter diluted to 1 to 2 x 10 6 / ml and transferred to Maxisorp plates coated with anti-IFN- ⁇ and incubated for preferably 4 to 16 hours.
  • the IFN- ⁇ producing cells are determined by the use of labelled secondary anti-IFN-antibody and a relevant substrate giving rise to spots, which can be enumerated using a dissection microscope. It is also a possibility to determine the presence of mRNA coding for the relevant cytokine by the use of the PCR technique. Usually one or more cytokines will be measured utilizing for example the PCR, ELISPOT or ELISA.
  • An in vitro cellular response may also be determined by the use of T cell lines derived from an immune individual or an ETEC infected person where the T cell lines have been driven with either live ETEC, extracts from the bacterial cell or culture filtrate for 10 to 20 days with the addition of IL-2.
  • the induction is performed by addition of not more than 20 pg polypeptide per ml suspension to the T cell lines containing from lxlO 5 cells to 3xl0 5 cells per well and incubation is performed from two to six days.
  • the induction of IFN- ⁇ or release of another relevant cytokine is detected by ELISA.
  • the stimulation of T cells can also be monitored by detecting cell proliferation using radioactively labeled Thymidine as described above. For both assays a positive response is a response more than background plus two standard deviations.
  • An in vivo cellular response may be determined as a positive DTH response after intradermal injection or local application patch of at most 100 pg of the polypeptide or the immunogenic part to an individual who is clinically or subclinically infected with ETEC, a positive response having a diameter of at least 5 mm 72-96 hours after the injection or application.
  • An in vitro humoral response is determined by a specific antibody response in an immune or infected individual.
  • the presence of antibodies may be
  • the presence of specific antibodies can be determined by measuring the presence or absence of a specific label e.g . by ELISA where a positive response is a response of more than background plus two standard deviations or alternatively a visual response in a Western blot.
  • Another relevant parameter is measurement of the protection in animal models induced after vaccination with the polypeptide in an adjuvant or after DNA vaccination.
  • Suitable animal models include primates, guinea pigs or mice, which are challenged with an infection of an ETEC. Readout for induced protection could be decrease of the bacterial load in target organs compared to non-vaccinated animals, prolonged survival times compared to non-vaccinated animals and diminished weight loss or pathology compared to non-vaccinated animals.
  • the glycosylated polypeptides described herein are immunogenic when one of the above described tests is positive.
  • NmpC and TibA have been tested for a wide variety of features using several different assays. An overview can be seen in the table above.
  • mice Five groups of CD-I mice were immunized with either adjuvant only (control), or appropriate amount of adjuvant + e.g. 25 pg of glycosylated NmpC, or adjuvant + e.g. 25 pg of non-glycosylated NmpC, or adjuvant + e.g. 25 pg of glycosylated TibA, or adjuvant + e.g. 25 pg of non-glycosylated TibA, on days 0, 14, 28.
  • mice were treated with streptomycin [e.g. 5 g per liter] in drinking water for 24 hours, followed by drinking water alone for 18 hours.
  • Fecal samples (6 pellets/mouse) were collected on day 42 before oral gavage, re-suspended in buffer (lOmM Tris, lOOmM NaCI, 0.05% Tween 20, 5mM Sodium Azide, pH 7.4) overnight at 4°C, centrifuged to pellet insoluble material, and recover supernatant for fecal antibody testing (below). Twenty- four hours after infection, mice were sacrificed, sera were collected, and
  • Example 5 Immunization with glycosylated antigen NmpC or TibA generates robust serum and mucosal antibody responses
  • Assay type Kinetic enzyme-linked immunosorbent assay probing relative levels of IgA, IgM and IgG
  • Murine immune responses to adjuvant, glycosylated and non-glycosylated versions of NmpC and TibA were determined using kinetic ELISA. Briefly, ELISA wells were incubated at 4°C overnight with proteins at a final concentration of 4 Mg/ml in 0.1 M NaHC03 buffer (pH 8.6), washed the following day with Tris- buffered saline containing 0.005% Tween 20 (TBS-T), and blocked with 1% bovine serum albumin (BSA) in TBS-T for 1 h at 37°C prior to the addition of the samples.
  • TBS-T Tris- buffered saline containing 0.005% Tween 20
  • BSA bovine serum albumin
  • Sera were diluted 1 : 500 in TBS-T with 1% BSA, and 100 ⁇ was added to each ELISA well, followed by incubation at 37°C for 1 h. After three washes with TBS-T, horseradish peroxidase-conjugated secondary antibody (either goat anti-mouse IgA, IgM, or IgG) was added at a final dilution of 1 : 5,000, followed by incubation for an additional hour before washing and development with TMB (3,3',5,5'-tetramethylbenzidine)-peroxidase substrate (KPL).
  • KPL 3,3',5,5'-tetramethylbenzidine
  • Caco-2 epithelial cell monolayers were infected with ETEC H 10407 at multiplicities of infection of approximately 100 (bacteria/cell) approximately 18 to 22 days after seeding into wells. Cultures of bacteria were grown overnight in Luria broth from frozen glycerol stocks, diluted 1 : 100, and grown for 1 h. One microliter of bacterial culture is added to confluent Caco-2 monolayers seeded into 96-well plates preincubated with or without antibodies. Two hours after inoculation, the monolayers were washed 3 times with tissue culture medium after which bacteria were isolated, serial diluted and plated to count CFU the following day.
  • Example 7 Monoclonal antibodies raised against glycosylated NmpC and TibA inhibits ETEC binding to intestinal epithelial cells to a higher extent compared to monoclonal antibodies raised against non-glycosylated NmpC and TibA protein version.
  • Caco-2 epithelial cell monolayers were infected with ETEC H 10407 at multiplicities of infection of approximately 100 (bacteria/cell). Cultures of bacteria were grown overnight in Luria broth from frozen glycerol stocks, diluted 1 : 100, and grown for 1 h. One microliter of bacterial culture is added to confluent Caco-2 monolayers seeded into 96-well plates preincubated with or without antibodies. Two hours after inoculation, the monolayers were washed 3 times with tissue culture medium, a nd the medium was replaced with 100 ⁇ of fresh medium/well and returned to the incubator (37°C, 5% C02) for 2.5 h . Subsequently, cyclic AMP (cAMP) enzyme imm unoassay (EIA) (Arbor Assays, Ann Arbor, MI) was used to exam ine the efficiency of toxin delivery.
  • cAMP cyclic AMP
  • NmpC and TibA were d igested ON at 25C using a n appropriate protease.
  • peptides covering whole protein length or sequences known to be glycosylated were isolated using HPLC. Sta ndard protocols were employed to create an array containing peptides (+/- glycosylated va ria nts) as well as controls; huma n IgG, human serum album in (HSA) and em pty spots. After interaction with the antibodies the a rray was regenerated (cleaned) using a n acid step to wash a nd elute the antibody and to prepare the sensor for the subsequent Ab sam ple.
  • Assay type MIC assay to test antibiotics susceptibility.
  • the MIC for a panel of antibiotics was determined by serial dilution in Mueller Hinton broth as recommended by the Clinical and Laboratory Standards Institute.
  • nmpC isogenic knock-out strain is less susceptible to antibiotics compared to wild type H10407.
  • antibodies which targets NmpC epitopes in the MIC assay the uptake of antibiotics is reduced resulting in antibiotics susceptibility levels comparable to the nmpC isogenic knock-out strain.

Landscapes

  • Chemical & Material Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Immunology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Mycology (AREA)
  • Microbiology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Epidemiology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Peptides Or Proteins (AREA)

Abstract

The present invention relates to glycosylated polypeptides that are immunogenic.These polypeptides originates from or are derived from Enterotoxigenic Escherichia coli (ETEC)and can be comprised in compositions or vaccines. The applications includes immunization, treatment, vaccination and diagnosis of ETEC.

Description

Glycosylated polypeptides originating from enterotoxigenic Escherichia coli (ETEC)
Field of the invention
The present invention relates to glycosylated polypeptides that are
immunogenic. These polypeptides originates from or are derived from
enterotoxigenic Escherichia coli (ETEC) and can be comprised in compositions or vaccines. The applications include immunization, treatment, vaccination and diagnosis of ETEC. Background of the invention
Enterotoxigenic Escherichia coli (ETEC) is the major source of E. coli mediated diarrhoea in humans and livestock. ETEC infections cause more than 280 million annual episodes of diarrhoea resulting in mortality numbers exceeding 300,000 deaths of children under the age of five years.
The significant negative health- and socio-economic impact of ETEC infection manifests itself mainly in the third world nations with poor sanitation and inadequate supplies of clean water. ETEC is a diverse group of pathogens defined by their ability to colonize the small intestine and secrete heat-labile and/or heat stable enterotoxins. The complex pathogenicity is further attributed to the presence of additional bacterial virulence genes on mobile genetic elements such as plasmids and chromosomal pathogenicity islands.
Much attention has been devoted to the understanding of how ETEC and other mucosa-associated pathogens interact with host tissue during infection. Recent work has revealed that bacterial protein glycosylation plays an important role in mediating adhesion, colonization and invasion of host tissue.
Up until now, the known protein glycosylation repertoire of E. coli was limited to just four proteins, all of which are surface-exposed adhesins with functions in bacterial pathogenesis. The prototypical ETEC strain H10407 encodes two known glycoproteins, TibA and EtpA. While the intimate coupling between protein glycosylation and bacterial pathophysiology has become apparent, the discovery of novel glycoproteins implicated in virulence is only advancing slowly. This gap of knowledge is linked to the inherent challenges associated with glycoproteomics. The analytical tools developed for enrichment of eukaryotic O- and N-linked glycopeptides rely on a limited set of defined physiochemical properties, e.g. glycan hydrophilicity or specific lectin recognition, which are relatively rare in bacteria.
Discovery and characterization of glycoproteins is further complicated by heterogeneous glycosylation, low abundance and poor ionization of peptides modified with carbohydrates compared to the non-modified counterpart.
Mapping of O-linked glycan moieties has proven to be a particularly challenging task owing to the diverse nature of carbohydrate structures available for protein modification in bacteria. Although methods such as periodic
acid/hydrazide glycan labelling and metabolic oligosaccharide engineering (MOE) have identified glycoproteins in a range of bacteria, these techniques present limitations in the form of low specificity for glycosylated proteins and dependence on sugar uptake and integration into bacterial glycoproteins, respectively.
Although they are poorly understood, bacterial glycoproteins potentially constitute an important reservoir of novel therapeutic targets, which could be used against bacterial pathogens.
Thus, there is a great need for understanding the glycosylation patterns of proteins originating from bacteria such as ETEC, and revealing the effect of the glycosylations on for example immunogenicity.
Summary of the invention
An object of the present invention is to provide glycosylated polypeptides that are immunogenic. In one aspect of the present invention is the polypeptide NmpC (also known as ETEC_0806 or CBJ00316, SEQ ID NO: 1), TibA autotransporter (also known as CBJ01643 or ETEC_2141, SEQ ID NO: 20), EtpA (also known as CBJ04458, SEQ ID NO: 31), EatA (also known as CBJ04449, SEQ ID NO: 39), CexE (also known as CBJ04537, SEQ ID NO: 48), or Ag43 (also known as CBJ03971, SEQ ID NO: 51).
Another aspect of the present invention relates to one of these polypeptides comprising the full length sequence, a polypeptide fragment of SEQ ID NO: 1 that has at least 75 % sequence identity to the full length sequence, or a B- or T-cell epitope of the full length sequence, wherein the polypeptide is
glycosylated at least in one position.
In one embodiment of the present invention is the polypeptide is glycosylated at least in two or three positions.
In a further embodiment of the present invention originates the polypeptides of the present invention from enterotoxigenic Escherichia coli (ETEC) or are synthetic.
Fragments of the polypeptides include the glycosylated polypeptide selected from the group of glycosylated polypeptides consisting of SEQ ID NOs: 2- 19.
Yet another aspect of the present invention relates to the polypeptide, wherein the polypeptide is a fusion polypeptide.
A further aspect of the present invention relates to the polypeptides as described herein comprised in an immunogenic composition, a pharmaceutical composition, or a vaccine.
These may be formulated for intradermal, transdermal, subcutaneous, intramuscular or mucosal application. One other aspect of the present invention relates to a nucleic acid sequence encoding a polypeptide.
Another aspect of the present invention relates to a method for immunizing a mammal, the method comprising administering to the mammal the
immunogenic composition, pharmaceutical composition or vaccine as described herein.
A further aspect of the present invention relates to a method for treating a mammal, which is infected with ETEC comprising administering to the mammal the immunogenic composition, pharmaceutical composition or vaccine as described herein.
Another aspect of the present invention relates to the polypeptide,
immunogenic composition, pharmaceutical composition, or vaccine as described herein for use in treating infection caused by ETEC.
Yet another aspect of the present invention relates to the polypeptide, immunogenic composition, pharmaceutical composition, or vaccine as described herein for use in the preparation of a medicament for treating infection caused by ETEC.
Another aspect of the present invention relates to the polypeptide,
immunogenic composition, pharmaceutical composition, or vaccine as described herein for use in the diagnosis of an infection caused by ETEC.
Brief description of the figures
Figure 1 shows β-Elimination of glycan moiety and replacement with 2-AEP through Michael addition chemistry. (1A) MALDI MS spectrum of TTVTSGGLQR (m/z = 1181.59 Da) synthetic O-linked glycopeptide. (IB) The BEMAP reaction efficiently replaces the carbohydrate moiety with the 2-AEP molecule and produces a phosphopeptide with the mass of 1126.64 Da. Minor traces of beta- eliminated as well as intact peptide can be observed (m/z = 1001.62 Da and 1181.59, respectively). (1C) The AEP modified peptide is selectively enriched with T1O2 as both the glycopeptide and the beta-eliminated peptide is absent in the MALDI MS spectrum. (ID) MALDI MS peptide mass fingerprint of Tryptic digest of heptosylated protein Ag43. Ag43 can be digested into a mixture of heptosylated as well as unmodified peptides. Peptides marked with an asterisk indicate heptosylation. (IE) BEMAP converts heptosylated peptides into phosphopeptides; modified peptides are indicated. (IF) Specific T1O2
enrichment of phosphopeptides.
Figure 2 shows gas-phase fragmentation properties of 2-AEP tagged peptide with either CID or HCD. Mapping of glycosylated residues by higher-energy collisional dissociation (HCD) fragmentation is superior to CID. Moreover, HCD fragmentation yields two characteristic ions (m/z= 126.03Da and
m/z= 138.03Da), useful for the identification of formerly glycosylated peptides in complex MS/MS spectra.
The present invention will now be described in more detail in the following. Detailed description of the invention
The present inventors have developed a novel mass spectrometry-based technique, termed BEMAP, that can be employed to map O-linked glycoproteins from theoretically any organism.
BEMAP combines a simple reaction scheme with a highly selective enrichment protocol to circumvent the challenges previously associated with bacterial glycoproteomics. The BEMAP reaction efficiently substitutes O-linked
carbohydrate moieties with a 2-Aminoethyl phosphonic acid (AEP) group, which can be selectively isolated based on its affinity for titanium dioxide.
BEMAP has been employed to map novel protein glycosylation sites in ETEC strain H10407 and the non-pathogenic E. coli K-12 MG1655. Functional characterization of an Η10407Δ 7/αΈ knockout strain revealed the importance of protein glycosylation for ETEC adhesion to human intestinal cells. These results, together with other recent studies of bacterial glycoproteomes, highlight protein glycosylation in bacteria as an abundant, yet largely unexplored, posttranslational protein modification which is central to bacterial physiology and pathophysiology.
The ETEC glycosylated proteins (polypeptides) are important in understanding the immunogenicity of ETEC. The glycosylated polypeptides disclosed herein leads to an enhanced immunogenicity compared to the same polypeptides that are not glycosylated.
The present inventors have therefore surprisingly found that certain proteins from ETEC causes an enhanced immunogenic response due to specific glycosylations of the proteins. Thus, an object of the present invention is to provide glycosylated polypeptides that are immunogenic.
The term glycosylation refers to O-linked glycosylation. This is the attachment of a sugar molecule to a hydroxyl oxygen of either a Serine or Threonine side chain in a protein.
The proteins include NmpC (also known as ETEC_0806 or CBJ00316, SEQ ID NO: 1), TibA autotransporter (also known as CBJ01643 or ETEC_2141, SEQ ID NO: 20), EtpA (also known as CBJ04458, SEQ ID NO: 31), EatA (also known as CBJ04449, SEQ ID NO: 39), CexE (also known as CBJ04537, SEQ ID NO: 48), and Ag43 (also known as CBJ03971, SEQ ID NO: 51).
Thus, one aspect of the present invention relates to a polypeptide comprising SEQ ID NO: 1, a polypeptide fragment of SEQ ID NO: 1 that has at least 75 % sequence identity to SEQ ID NO: 1, or a B- or T-cell epitope of SEQ ID NO: 1, wherein the polypeptide is glycosylated at least in one position.
Another aspect of the present invention relates to a polypeptide comprising SEQ ID NO: 20, a polypeptide fragment of SEQ ID NO: 20 that has at least 75 % sequence identity to SEQ ID NO: 20, or a B- or T-cell epitope of SEQ ID NO: 20, wherein the polypeptide is glycosylated at least in one position.
Yet another aspect of the present invention relates to a polypeptide comprising SEQ ID NO: 31, a polypeptide fragment of SEQ ID NO: 31 that has at least 75 % sequence identity to SEQ ID NO: 31, or a B- or T-cell epitope of SEQ ID NO: 31, wherein the polypeptide is glycosylated at least in one position.
A further aspect of the present invention relates to a polypeptide comprising SEQ ID NO: 39, a polypeptide fragment of SEQ ID NO: 39 that has at least 75 % sequence identity to SEQ ID NO: 39, or a B- or T-cell epitope of SEQ ID NO: 39, wherein the polypeptide is glycosylated at least in one position.
Another aspect of the present invention relates to a polypeptide comprising SEQ ID NO: 48, a polypeptide fragment of SEQ ID NO: 48 that has at least 75 % sequence identity to SEQ ID NO: 48, or a B- or T-cell epitope of SEQ ID NO: 48, wherein the polypeptide is glycosylated at least in one position.
Yet another aspect of the present invention relates to a polypeptide comprising SEQ ID NO: 51, a polypeptide fragment of SEQ ID NO: 51 that has at least 75 % sequence identity to SEQ ID NO: 51, or a B- or T-cell epitope of SEQ ID NO: 51, wherein the polypeptide is glycosylated at least in one position.
The polypeptides of the present invention may be glycosylated at least in two positions, such as at least in three positions, at least four positions, at least five positions, at least six positions, or at least seven positions.
The polypeptides can also be glycosylated in exactly one, two three, four, five, sex or seven positions.
The polypeptides of the present invention originates from Enterotoxigenic Escherichia coli (ETEC) as shown in the examples of the present disclosure. The polypeptides can therefore be purified directly from ETEC but they can also be chemically synthesized. The polypeptides can also be functional variants of the polypeptides disclosed herein. Such variance can be determined by sequence identity. The term "sequence identity" indicates a quantitative measure of the degree of homology between two amino acid sequences of substantially equal length or between two nucleic acid sequences of substantially equal length. The two sequences to be compared must be aligned to best possible fit possible with the insertion of gaps or alternatively, truncation at the ends of the protein sequences. The sequence identity can be calculated as (N^-^^100 r wherein Ndif is the total number of non-identical residues in the two sequences when aligned and wherein Nref is the number of residues in one of the sequences. Hence, the
DNA sequence AGTCAGTC will have a sequence identity of 75% with the sequence AATCAATC (Ndif=2 and Nref=8). A gap is counted as non-identity of the specific residue(s), i.e. the DNA sequence AGTGTC will have a sequence identity of 75% with the DNA sequence AGTCAGTC (Ndif=2 and Nref=8).
Sequence identity can alternatively be calculated by the BLAST program e.g. the BLASTP program (Pearson W. R and D.J. Lipman
(1988))(www. ncbi. nlm. nih.gov/cgi-bin/BLAST). In one embodiment of the invention, alignment is performed with the sequence alignment method
ClustalW with default parameters as described by Thompson J., et al 1994, available at http://www2.ebi.ac. uk/clustalw/.
A preferred minimum percentage of sequence identity is at least 75 %, such as at least 80%, such as at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, and at least 99.5%.
Preferably, the numbers of substitutions, insertions, additions or deletions of one or more amino acid residues in the fusion polypeptide is limited, i.e. no more than 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 substitutions, no more than 1, 2, 3, 4, 5,
6, 7, 8, 9, 10 insertions, no more than 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 additions, and no more than 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 deletions compared to the immunogenic polypeptide units based on polypeptides disclosed herein. Polypeptides such as the ETEC proteins disclosed herein can contain
immunogenic parts, such as B- or T-cell epitopes. The immunogenic part of an immunogenic polypeptide is the part of the polypeptide, which elicits an immune response in an animal or a human being, and/or in a biological sample determined by any of the biological assays known to the skilled person working with immune responses. The immunogenic part of a polypeptide may be a T-cell epitope or a B-cell epitope and can be related to one or a few relatively small parts of the polypeptide, they can be scattered throughout the polypeptide sequence or be situated in specific parts of the polypeptide. In order to identify relevant T-cell epitopes which are recognised during an immune response, it is possible to use a "brute force" method : Since T-cell epitopes are linear, deletion mutants of the polypeptide will, if constructed systematically, reveal what regions of the polypeptide are essential in immune recognition, e.g. by subjecting these deletion mutants e.g. to assays known to the skilled person working with immune responses.
Another method utilizes overlapping oligopeptides for the detection of MHC class II epitopes, preferably synthetic, having a length of e.g. 20 amino acid residues derived from the polypeptide. These peptides can be tested in biological assays and some of these will give a positive response (and thereby be immunogenic) as evidence for the presence of a T cell epitope in the peptide.
For the detection of MHC class I epitopes it is possible to predict peptides that will bind and hereafter produce these peptides synthetically and test them in relevant biological assays. The peptides preferably having a length of e.g. 8 to 11 amino acid residues derived from the polypeptide. B-cell epitopes can be determined by analyzing the B-cell recognition to overlapping peptides covering the polypeptide of interest. B-cell epitopes differ from T-cell epitopes in that they are conformational epitopes that require a three dimensional structure in order to raise an immune response. Not intended to be bound by theory can variants of B-cell epitopes therefore be identified through key amino acids (for example glycosylated amino acids) and a certain length of the polypeptide while remaining
immunogenic.
Thus, an embodiment of the present invention therefore relates to epitopes, such as B- or T-cell epitopes on the polypeptides mentioned herein.
A common feature of the polypeptides of the present invention is their capability to induce an immunological response as illustrated in the examples. It is understood that within the scope of the present invention are variants of the polypeptides of the invention produced by substitution, insertion, addition or deletion while remaining immunogenic.
Examples of such epitopes are listed in the examples of the present disclosure. They include SEQ ID NOs: 2- 19 of NmpC, SEQ ID NOs: 21-30 of TibA, SEQ ID NOs: 32-38 of EtpA, SEQ ID NOs: 40-47 of EatA, SEQ ID NOs: 49-50 of CexE, and SEQ ID NOs: 52-68 of Ag43.
Key features of these epitopes or fragments are that they comprise one or more glycosylations at central positions.
In the present context the term "substantially pure polypeptide" means a polypeptide preparation which contains at most 5% by weight of other polypeptide material with which it is associated natively or during recombinant or synthetic production (lower percentages of other polypeptide material are preferred, e.g. at most 4%, at most 3%, at most 2%, at most 1%, and at most/2%) .
It is preferred that the substantially pure polypeptide is at least 96% pure, i.e. that the polypeptide constitutes at least 96% by weight of total polypeptide material present in the preparation, and higher percentages are preferred, such as at least 97%, at least 98%, at least 99%, at least 99,25%, at least 99,5%, and at least 99,75%. It is especially preferred that the polypeptide is in
"essentially pure form", i.e. that the polypeptide is essentially free of any other antigen with which it is natively associated, i.e. free of any other antigen from bacteria. This can be accomplished by preparing the polypeptide by means of recombinant methods in a host cell, or by synthesizing the polypeptide by the well-known methods of solid or liquid phase peptide synthesis, and by using appropriate purification procedures well known to the person of ordinary skill in the art.
Thus in one embodiment of the present invention are the polypeptides of the present invention substantially pure or in essentially pure form. Fusion polypeptides
Two or more of the polypeptides disclosed herein may be fused to form fusion polypeptides.
Thus relates one embodiment of the present invention to the polypeptides as defined herein, wherein the polypeptide is comprised in a fusion polypeptide.
The polypeptides to which fusion is made may originate from ETEC or alternatively be other polypeptides that are beneficial when an enhanced immune response against ETEC is required.
Thus, another embodiment of the present invention relates to a polypeptide as defined herein, wherein the polypeptide is fused to a polypeptide originating from ETEC. Immunogenic
An immunogenic polypeptide is defined as a polypeptide that induces an immune response. The immune response may be monitored by one of the following methods: An in vitro cellular response is determined by release of a relevant cytokine such as IFN-γ, from lymphocytes withdrawn from an animal or human currently or previously infected with ETEC, or by detection of proliferation of these T cells. The induction is performed by addition of the polypeptide or the
immunogenic part to a suspension comprising from lxlO5 cells to 3xl05 cells per well. The cells are isolated from either blood, the spleen, the liver or the lung and the addition of the polypeptide or the immunogenic part of the polypeptide result in a concentration of not more than 20 pg per ml suspension and the stimulation is performed from two to five days. For monitoring cell proliferation the cells are pulsed with radioactive labeled Thymidine and after 16-22 hours of incubation the proliferation is detected by liquid scintillation counting. A positive response is a response more than background plus two standard deviations. The release of IFN- y can be determined by the ELISA method, which is well known to a person skilled in the art. A positive response is a response more than background plus two standard deviations. Other cytokines than IFN- y could be relevant when monitoring an immunological response to the polypeptide, such as IL- 12, TNF-a, IL-4, IL-5, IL- 10, IL-6, TGF- β-
Another and more sensitive method for determining the presence of a cytokine (e.g. IFN-y) is the ELISPOT method where the cells isolated from either the blood, the spleen, the liver or the lung are diluted to a concentration of preferable of 1 to 4 x 106 cells /ml and incubated for 18-22 hrs in the presence of the polypeptide or the immunogenic part of the polypeptide resulting in a concentration of not more than 20 pg per ml. The cell suspensions are hereafter diluted to 1 to 2 x 106/ ml and transferred to Maxisorp plates coated with anti- IFN-γ and incubated for preferably 4 to 16 hours. The IFN-y producing cells are determined by the use of labelled secondary anti-IFN-antibody and a relevant substrate giving rise to spots, which can be enumerated using a dissection microscope. It is also a possibility to determine the presence of mRNA coding for the relevant cytokine by the use of the PCR technique. Usually one or more cytokines will be measured utilizing for example the PCR, ELISPOT or ELISA. It will be appreciated by a person skilled in the art that a significant increase or decrease in the amount of any of these cytokines induced by a specific polypeptide can be used in evaluation of the immunological activity of the polypeptide. An in vitro cellular response may also be determined by the use of T cell lines derived from an immune individual or an ETEC infected person where the T cell lines have been driven with either live ETEC, extracts from the bacterial cell or culture filtrate for 10 to 20 days with the addition of IL-2. The induction is performed by addition of not more than 20 pg polypeptide per ml suspension to the T cell lines containing from lxlO5 cells to 3xl05 cells per well and incubation is performed from two to six days. The induction of IFN-γ or release of another relevant cytokine is detected by ELISA. The stimulation of T cells can also be monitored by detecting cell proliferation using radioactively labeled Thymidine as described above. For both assays a positive response is a response more than background plus two standard deviations.
An in vivo cellular response may be determined as a positive DTH response after intradermal injection or local application patch of at most 100 pg of the polypeptide or the immunogenic part to an individual who is clinically or subclinically infected with ETEC, a positive response having a diameter of at least 5 mm 72-96 hours after the injection or application.
An in vitro humoral response is determined by a specific antibody response in an immune or infected individual. The presence of antibodies may be
determined by an ELISA technique or a Western blot where the polypeptide or the immunogenic part is absorbed to either a nitrocellulose membrane or a polystyrene surface. The serum is preferably diluted in PBS from 1 : 10 to 1 : 100 and added to the absorbed polypeptide and the incubation being performed from 1 to 12 hours. By the use of labeled secondary antibodies the presence of specific antibodies can be determined by measuring the presence or absence of a specific label e.g. by ELISA where a positive response is a response of more than background plus two standard deviations or alternatively a visual response in a Western blot. Another relevant parameter is measurement of the protection in animal models induced after vaccination with the polypeptide in an adjuvant or after DNA vaccination. Suitable animal models include primates, guinea pigs or mice, which are challenged with an infection of an ETEC. Readout for induced protection could be decrease of the bacterial load in target organs compared to non-vaccinated animals, prolonged survival times compared to non-vaccinated animals and diminished weight loss or pathology compared to non-vaccinated animals. Thus are the glycosylated polypeptides described herein immunogenic when one of the above described tests is positive.
In one aspect of the present invention are the polypeptides described herein immunogenic.
In another aspect of the present invention relates to a composition comprising the polypeptides described herein. Such composition will constitute an immunogenic composition. Antibodies
The glycosylated polypeptides disclosed herein can constitute epitopes.
An epitope, also known as antigenic determinant, is the part of an antigen that is recognized by the immune system, specifically by antibodies, B cells, or T cells.
The epitopes of protein antigens are divided into two categories, conformational epitopes and linear epitopes, based on their structure and interaction with the paratope.
A conformational epitope is composed of discontinuous sections of the antigen's amino acid sequence. These epitopes interact with the paratope based on the 3-D surface features and shape or tertiary structure of the antigen.
By contrast, linear epitopes interact with the paratope based on their primary structure. A linear epitope is formed by a continuous sequence of amino acids from the antigen.
Thus, one aspect of the present invention relates to an antibody that binds to an epitope described herein.
Antibodies raised against the epitope may be either polyclonal or monoclonal.
The antibodies may be is suitable to generate chimeric and/ or human versions that could be appropriate for human in vivo use.
The immunoglobulin heavy chain (IgH) is the large polypeptide subunit of an antibody (immunoglobulin). A typical antibody is composed of two
immunoglobulin (Ig) heavy chains and two Ig light chains. Several different types of heavy chain exist that define the class or isotype of an antibody. These heavy chain types vary between different animals.
The immunoglobulin light chain is the small polypeptide subunit of an antibody (immunoglobulin).
There are two types of light chain in humans (as in other mammals), kappa (κ) chain, encoded by the immunoglobulin kappa locus on chromosome 2 and the lambda (λ) chain, encoded by the immunoglobulin lambda locus on
chromosome 22.
Antibodies are produced by B lymphocytes, each expressing only one class of light chain.
Once set, light chain class remains fixed for the life of the B lymphocyte. In a healthy individual, the total kappa to lambda ratio is roughly 2 : 1 in serum (measuring intact whole antibodies) or 1 : 1.5 if measuring free light chains, with a highly divergent ratio indicative of neoplasm.
The exact normal ratio of kappa to lambda ranges from 0.26 to 1.65.
Both the kappa and the lambda chains can increase proportionately,
maintaining a normal ratio.
Carriers, excipients and diluents
Pharmaceutical compositions comprising the polypeptides described herein may be administered in a physiologically acceptable medium (e.g., deionized water, phosphate buffered saline (PBS), saline, aqueous ethanol or other alcohol, plasma, proteinaceous solutions, mannitol, aqueous glucose, vegetable oil, or the like).
Thus, a further embodiment of the present invention relates to a composition comprising a polypeptides as described herein that constitutes a pharmaceutical composition.
Buffers may also be included, particularly where the media are generally buffered at a pH in the range of about 5 to 10, where the buffer will generally range in concentration from about 50 to 250 mM salt, where the concentration of salt will generally range from about 5 to 500 mM, physiologically acceptable stabilizers, and the like.
The compounds may be lyophilized for convenient storage and transport. Thus, in a further embodiment of the present invention the composition comprises one or more excipients, diluents and/or carriers.
Aqueous suspensions may contain the active materials in admixture with excipients suitable for the manufacture of aqueous suspensions. Such excipients include suspending agents, for example sodium carboxymethylcellulose, methylcellulose, hydropropyl-methylcellulose, sodium alginate, polyvinylpyrrolidone, gum tragacanth and gum acacia ; dispersing or wetting agents can be a naturally-occurring phosphatide, for example, lecithin, or condensation products of an alkylene oxide with fatty acids, for example polyoxyethylene stearate, or condensation products of ethylene oxide with long chain aliphatic alcohols, for example heptadecaethyleneoxycetanol, or condensation products of ethylene oxide with partial esters derived from fatty acids and a hexitol such as polyoxyethylene sorbitol monooleate, or
condensation products of ethylene oxide with partial esters derived from fatty acids and hexitol anhydrides, for example polyethylene sorbitan monooleate.
Thus, an aspect of the present invention relates to a pharmaceutical
composition comprising the polypeptide as described herein and at least one pharmaceutically acceptable carrier, excipient or diluent.
Vaccines, treatment and administration
The polypeptides, immunogenic compositions, and pharmaceutical composition may constitute a vaccine against ETEC.
Key features of vaccines is that they are recognized by the recipient's immune response, generate a response, and ultimately decrease the bacterial load of ETEC.
The vaccines are administered in a manner compatible with the dosage formulation, and in such amount as will be prophylactic or therapeutically effective and immunogenic. The quantity to be administered depends on the subject to be treated, including, e.g., the capacity of the individual's immune system to mount an immune response, and the degree of protection desired. Suitable dosage ranges are of the order of several hundred micrograms of the fusion polypeptide of the invention per vaccination with a preferred range from about 0.1 pg to 1000 pg, such as in the range from about 1 pg to 300 pg, and especially in the range from about 10 pg to 100 pg. Suitable regimens for initial administration and booster shots are also variable but are typified by an initial administration followed by subsequent inoculations or other administrations.
The manner of application may be varied widely. Any of the conventional methods for administration of a vaccine are applicable. These include oral, nasal or mucosal application in either a solid form containing the active ingredients (such as a pill, suppository or capsule) or in a physiologically acceptable dispersion, such as a spray, powder or liquid, or parenterally, by injection, for example, subcutaneously, intradermally or intramuscularly or transdermal^ applied. The dosage of the vaccine will depend on the route of administration and will vary according to the age of the person to be vaccinated and, to a lesser degree, the size of the person to be vaccinated. Currently, most vaccines are administered intramuscularly by needle injection and this is likely to continue as the standard route. However, vaccine formulations which induce mucosal immunity have been developed, typically by oral or nasal delivery. One of the most widely studies delivery systems for induction of mucosal immunity contains cholera toxin (CT) or its B subnit. This protein enhances mucosal immune responses and induces IgA production when administered in vaccine formulations. An advantage is the ease of delivery of oral or nasal vaccines. Modified toxins from other microbial species, which have reduced toxicity but retained immunostimulatory capacity, such as modified heat-labile toxin from Gram-negative bacteria or staphylococcal enterotoxins may also be used to generate a similar effect. These molecules are particularly suited to mucosal administration.
The vaccines are conventionally administered parenterally, by injection, for example, either subcutaneously or intramuscularly. Additional formulations which are suitable for other modes of administration include suppositories and, in some cases, oral formulations. For suppositories, traditional binders and carriers may include, for example, polyalkalene glycols or triglycerides; such suppositories may be formed from mixtures containing the active ingredient in the range of 0.5% to 10%, preferably 1-2%. Oral formulations include such normally employed excipients as, for example, pharmatical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharine, cellulose, magnesium carbonate, and the like. These compositions take the form of solutions, suspensions, tablets, pills, capsules, sustained release formulations or powders and advantageously contain 10-95% of active ingredient, preferably 25-70%. Thus, in one aspect of the present invention are the polypeptides, immunogenic compositions, and pharmaceutical compositions formulated for intradermal, transdermal, subcutaneous, intramuscular or mucosal application.
The adjuvant is preferably selected from the group consisting of
dimethyloctadecylammonium bromide (DDA), dimethyloctadecenylammonium bromide (DODAC), Quil A, poly I :C, aluminium hydroxide, Freund's incomplete adjuvant, IFN-γ, IL-2, IL- 12, monophosphoryl lipid A (MPL), Treholose
Dimycolate (TDM), Trehalose Dibehenate and muramyl dipeptide (MDP). The polypeptides may also be used for immunizing a mammal against ETEC or treating the mammal against ETEC.
Thus relates one aspect of the present invention to a method for immunizing a mammal, the method comprising administering to the mammal the
immunogenic composition, pharmaceutical composition or vaccine as described herein.
Another aspect of the present invention relates to a method for treating a mammal, which is infected with ETEC comprising administering to the mammal the immunogenic composition, pharmaceutical composition or vaccine as described herein.
In one embodiment of the present invention is the mammal a human. In another embodiment of the present invention is the mammal an animal selected from the group consisting of a pig, a cow, a sheep, and a horse. A further aspect of the present invention relates to an immunogenic
composition, pharmaceutical composition, or vaccine as described herein for use in treating infection caused by ETEC. Yet another aspect of the present invention relates to an immunogenic composition, pharmaceutical, or vaccine as described herein for use in the preparation of a medicament for treating infection caused by ETEC.
Nucleic acids
By the terms "nucleic acid fragment" and "nucleic acid sequence" are understood any nucleic acid molecule including DNA, RNA, LNA (locked nucleic acids), PNA, RNA, dsRNA and RNA-DNA-hybrids. Also included are nucleic acid molecules comprising non-naturally occurring nucleosides. The term includes nucleic acid molecules of any length e.g . from 10 to 10000 nucleotides, depending on the use. When the nucleic acid molecule is for use as a
pharmaceutical, e.g . in DNA therapy, or for use in a method for producing a polypeptide according to the invention, a molecule encoding at least one epitope is preferably used, having a length from about 18 to about 1000 nucleotides, the molecule being optionally inserted into a vector.
When the nucleic acid molecule is used as a probe, as a primer or in antisense therapy, a molecule having a length of 10- 100 is preferably used.
According to the invention, other molecule lengths can be used, for instance a molecule having at least 12, 15, 21, 24, 27, 30, 33, 36, 39, 42, 50, 60, 70, 80, 90, 100, 200, 300, 400, 500 or 1000 nucleotides (or nucleotide derivatives), or a molecule having at most 10000, 5000, 4000, 3000, 2000, 1000, 700, 500, 400, 300, 200, 100, 50, 40, 30 or 20 nucleotides (or nucleotide derivatives). Thus, in another aspect of the present invention is the polypeptide as defined herein encoded nucleic acid sequence.
Diagnosis Immunodiagnostics are well-suited for the detection of even the smallest of amounts of biochemical substances such as antibodies. Antibodies specific for a desired antigen can be conjugated with a radiolabel, fluorescent label, or color- forming enzyme and are used as a "probe" to detect it. Well known applications include pregnancy tests, immunoblotting, ELISA and immunohistochemical staining of microscope slides. The speed, accuracy and simplicity of such tests has led to the development of rapid techniques for the diagnosis of disease.
Thus, one aspect of the present invention relates to a polypeptide,
immunogenic composition, or pharmaceutical composition as described herein for use in the diagnosis of an infection caused by ETEC.
The polypeptide, immunogenic composition, or pharmaceutical composition as described herein may also be used to detect the present of ETEC in a sample or used as an indication whether a sample or subject may contain ETEC.
It should be noted that embodiments and features described in the context of one of the aspects of the present invention also apply to the other aspects of the invention.
All patent and non-patent references cited in the present application, are hereby incorporated by reference in their entirety.
Examples
BEMAP method results:
BEMAP relies on β-elimination of O-linked carbohydrate modifications, Michael addition of 2-Aminoethyl phosphonic acid (AEP) and T1O2 enrichment of phosphopeptides. Thus, BEMAP combines a firmly established in vitro chemical modification with a highly selective enrichment protocol (Thingholm et al., 2006) and the reactions take place in a single volume without the need for intermediate purification steps as described in the Experimental Procedures section. The BEMAP method was first established using a synthetic mannosylated peptide as a model compound. As shown in Figure 1A and IB, MALDI MS demonstrated that BEMAP efficiently replaces the carbohydrate moiety of the synthetic peptide (m/z = 1181.59 Da) with the AEP group and thus produces a phosphopeptide (m/z = 1126.64 Da).
The overall efficiency of substitution exceeds 95% (Figure IB) without the formation of degradation products. The AEP-modified peptide was then strongly enriched using affinity chromatography with T1O2; both the intact glycopeptide and the β-eliminated peptide (1001.62Da) were absent in the MALDI MS spectrum after enrichment (Figure 1C).
We found that BEMAP converts other glycopeptides into a phosphopeptide, independent of the identity of the linked monosaccharide (data not shown). It should be noted that the T1O2 purification step of BEMAP also targets
phosphopeptides. Therefore, as a precaution we use the enzyme Alkaline phosphatase to dephosphorylate any native phosphopeptides which otherwise may result in false positive identifications. We analysed the gas phase-induced fragmentation properties of the converted glycopeptide. As shown in Figure 2, the exchange of a carbohydrate moiety with AEP has several advantages. The AEP addition substitutes a labile glycoside bond with a stronger covalent C-N bond which greatly improves mapping of glycosylated residues by higher-energy collisional dissociation (HCD) fragmentation. Moreover, the AEP group yielded two characteristic ions during HCD fragmentation (m/z= 126.03Da and m/z= 138.03Da), which are very useful for the identification of formerly glycosylated peptides in complex MS/MS spectra. It should be noted that the AEP molecule is constituted by a phosphonate functional group which is stable under CID and HCD fragmentation conditions compared to the phosphate one which is labile under these conditions. This allows unambiguous assignment of modified amino acid residues and avoids false positives in site localization assignment (data not shown). Next, we applied BEMAP to a purified heptosylated protein : Ag43 from E. coli (Knudsen et al., 2008). As may be seen in Figure ID, in-gel digestion of the glycosylated protein yielded heptosylated and unmodified peptides.
Heptosylated peptides are marked by an asterisk. From the digested peptide mix, BEMAP enriched the three heptosylated peptides present in Figure ID as well as four additional glycopeptides initially undetectable by MALDI MS (Figure IE and IF). It is concluded that BEMAP is a specific and sensitive method for detecting protein glycosylation. Results
The outer membrane protein fraction of H 10407 was isolated and subjected to BEMAP analysis for identification of glycoproteins. This approach identified the proteins NmpC, TibA, EtpA, EatA, CexE and Ag43.
Discussion :
BEMAP relies on nucleophile tagging using 2-Aminoethyl phosphonic acid (AEP) rather than e.g. DTT. BEMAP method selectivity is achieved with the glycan-for- phosphate molecule exchange combined with a highly specific enrichment protocol for downstream sample processing (Thingholm et al., 2006).
Importantly, the BEMAP chemistry can be applied in principle to any organism on a large-scale proteomics level irrespective of the chemical properties of the O-linked monosaccharide. As demonstrated in Figure 1, BEMAP replaces the carbohydrate moiety of a synthetic glycosylated peptide with a phosphotag in a chemical reaction exceeding 95% efficiency. Moreover, HCD MS/MS
fragmentation of enriched BEMAP samples yields diagnostic ions instrumental for glycopeptide MS/MS spectrum identification as well as enabling
unambiguous assignment of the modified amino acid residue, see Figure 2.
To identify specific pathogenic E. coli associated glycoproteins of potential therapeutic value we compared the outer membrane protein complement to non-pathogenic reference strain MG1655 sampled under identical conditions. By applying our BEMAP workflow we identified five ETEC vaccine candidates. Based on our analyses, we propose that novel vaccines directed against ETEC should not only be selected amongst the glycoproteins expressed by the pathogen but can in principle also be targeting glycosylated domains of proteins which otherwise share 100% identity among E. coli strains.
Experimental procedures:
Lyophilized peptide sample is resuspended in 100 μΙ BEMAP solution consisting of 0.4 M 2-AEP (Sigma; 268674), 0.75 M NaOH (Sigma; S8045), 20 mM Ba(OH)2 (Sigma; 433373) and incubate at 37°C in a heating block for 3.15 hours shaking at 1300 r. p. m . The reaction is stopped by acidification (1% TFA final concentration). Sample volume is increased to 1 ml and the peptides are purified on an Oasis HLB Plus short cartridge (Waters) as recommend by manufacturer and subsequently lyophilized. T1O2 enrichment was performed as described by Tingholm et al., 2006.
ETEC H 10407 lead molecules:
1) Putative outer membrane porin protein NmpC, ETEC_0806, CBJ00316 Primary sequence of NmpC (SEQ ID NO: 1) :
MKKLTVAISAVAASVLMAMSAQAAEIYNKDSNKLDLYGKVNAKHYFSSNDADDGDTTYA RLGFKGETQINDQLTGFGQWEYEFKGNRAESQGSSKDKTRLAFAGLKFGDYGSIDYGRN YGVAYDIGAWTDVLPEFGGDTWTQTDVFMTQRATGVATYRNNDFFGLVDGLNFAAQYQ GKNDRSDFDNYTEGNGDGFGFSATYEYEGFGIGATYAKSDRTDTQVNAGKVLPEVFASG KNAEVWAAGLKYDANNIYLATTYSETQNMTVFADHFVANKAQNFEAVAQYQFDFGLRPS VAYLQSKGKDLGVWGDQDLVKYVDVGATYYFNKNMSTFVDYKINLLDKNDFTKALGVST DDIVAVGLVYQF
Unique to H 10407 compared to other E. coli
Identified Tryptic glycopeptides using BEMAP combined with ESI-MS/MS (SEQ ID NOs: 2-8, respectively) :
Start end Seq ModAA# l ModAA#2 ModAA#3
ModAA#4 44 60 HYFssNDADDGDttYAR S47 S48 T56
T57
107 117 FGDYGsIDYGR S112
151 158 AtGVAtYR T152 T156
215 226 sDRtDtQVNAGK S215 T218 T220
227 236 VLPEVFAsGK S234
328 336 NMsTFVDYK S330
337 347 INLLDKNDFtK T346 Identified NmpC glycopeptides listed as probable epitopes presented by Antigen Presenting Cells (glycosylations underlined, SEQ ID NOs: 9- 19, respectively)) :
NAKHYFSSNDADDG
DADDGDTTYARLGF KFG DYGSI DYG RN
FMTQRATGVATYR
RATG VATYRN N D F
GATYAKSDRTDTQ
YAKSDRTDTQVNA KSDRTDTQVNAGK
LP E V F AS G K N A E V
YFN KN M STFVDYK
LDKNDFTKALGVS
2) Adhesin/invasin TibA autotransporter, CBJ01643 or ETEC_2141 (SEQ ID NO: 20)
Primary sequence of TibA:
MNKVYNTVWNESTGTWVVTSELTRKGGLRPRQIKRTVLAGLIAGLLMPSMPALAAAYDN QTIGRGETSKSMHLSAGDTAKNTTINSGGKQYVSSGGSATSTTINIGGVQHVSSGGSAT SSTINSGGHQHVSSGGSATNTTVNNGGRQTVFSGGSAMGTIINSGGDQYVISGGSATS ASVTSGARQFVSSGGIVKATSVNSGGRQYVRDGGSATDTVLNNTGRQFVSSGGSAAKT TINSGGGMYLYGGSATGTSIYNGGRQYVSSGGSATNTTVYSGGRQHVYIDGNVTETTIT SGGMLQVEAGGSASKVIQNSGGAVITNTSAAVSGTNDNGSFSIAGGSAVNMLLENGGY LTVFDGHQASDTMVGSDGTLDVRSGGVLYGTTTLTDKGALVGDVVTNEGNLYYLNNSTA TFTGTLTGTGTLTQEGGNTRFSGLLSQDGGIFLQSGGAMTMDALQAKANVTTQSGTTLT LDNGTILTGNVAGDSTGAGDMAVKGASVWHLDGDSTVGALTLDNGTVDFRPSTTTRMT PAFQAVSLALGSLSGSGTFQMNTDIASHTGDMLNVAGNASGNFVLDIKNTGLEPVSAGA PLQVVQTGGGDAAFTLKGGKVDAGTWEYGLSKENTNWYLKADTPPPVTPPTNPDADNP DAGNPDAGNPDAGNPDAGNPDAGKPGTGKPDAGTSSSPVRRTTKSVDAVLGMATAPAY VFNSELDNLRFRHGDVMQNTRAPGGVWGRYTGSDNRISGGASSGYTLTQNGFETGAD MVFDLSDSSLAVGTFFSYSDNSIKHARGGKSNVDSSGGGLYATWFDNDGYYVDGVLKY NRFNNELRTWMSDGTAVKGDYSQNGFGGSLEAGRTFSLNENAWAQPYVRTTAFRADKK EIRLNNGMKASIGATKSLQAEAGLKLGMTLDVAGKEVKPYLSAAVSHEFSDNNKVRINDT YDFRNDISGTTGKYGLGVNAQLTPNAGVWAEARYENGKQTESPITGGVGFRINF
Identified Tryptic glycopeptides using BEMAP combined with ESI-MS/MS (SEQ ID NOs: 21-25, respectively) :
Start end Seq Mod AA # 1 Mod AA #2
70 80 SMHLsAGDTAK S74
81 89 NTTINsGGK S86
185 194 QFVssGGIVK S188 S189
195 203 ATSVNsGGR S200
223 233 QFVssGGSAAK S226 S227
Identified TibA glycopeptides listed as probable epitopes presented by Antigen Presenting Cells (glycosylations underlined, SEQ ID NOs: 26-30, respectively)
SKSMHLSAGDTAK KNTTINSGGKQYV GARQFVSSGGIVKA KATSVNSGGRQYV TGRQFVSSGGSAAK
ETEC H 10407 lead molecules: 3) Two-partner secreted adhesin EtpA, CBJ04458, ETEC_p948_0110 Primary sequence of EtpA (SEQ ID NO: 31) :
MNRIYKLKFDKRRNELVVVSEITTGVGNAKATGSVEGEKSPRRGVRAMALSLLSGMMIM AHPAMSANLPTGGQIVAGSGSIQTPSGNQMNIHQNSQNMVANWNSFDIGKGNTVQFD QPSSSAVALNRVVGGGESQIMGNLKANGQVFLVNPNGVLFGEGASVSTSGFVASTRDIK NDDFMNRRYTFSGGQKAGAAIVNQGELTTNAGGYIVLAADRVSNSGTIRTPGGKTVLAA SERITLQLDNGGLMSVQVTGDVVNALVENRGLVSARDGQVYLTALGRGMLMNTVLNVS GVVEASGMHRQDGNIVLDGGDSGVVHLSGTLQADNASGQGGKVVVQGKNILLDKGSN ITATGGQGGGEVYVGGGWQGKDSNIRNADKVVMQGGARIDVSATQQGNGGTAVLWS DSYTNFHGQISAKGGETGGNGGRVETSSHGNLQAFGTVSASAKKGKAGNWLLDSADIT IVNGSNVSKTETTQSPPHTQFAPTAAGSAVSNTSINNRLNNGTSVTILTHRTRTGTAQGG NITVNAAINKSNGSDVNLTLQAGGNITVNNSITSTEGKLNVNLSGARTSNGSITISNNAN ITTNGGDITVGTTNTSNRVNISINNTTLNASNGNIQLTGTGTDSGILFAGNNRLTASNIAL TGNSTSGNAINLTGTATLNATNNITLTGSSTSGNAINLKGNNTLTASNITLTGESTSGNAI N LT DTTGTTTLN ATN NITMQGTRVQIKHSNITAGNFALN AT V AG S E I S NTT LT AT N N I N LA AKTNSASSGVYLKDARITSTNGSITANGTATANGKATHLDGNVTLNASNGRIKLTGNGH GSASGILFAGNNRLTASNIALTGNSTSGNAINLTGTATLNATNDITLTGSSTSGNAINLTG TATLNATNNITLTGSSTSGNAINLKGNNTLTASNITLTGESTSGNAINLTDTTGTTTLNAT NNITMQGTRVQIKHSNITAGNFALNATVAGSEISNTTLTATNNINLAAKTNSASSGVYLK DARITSTNGSITANGTATANGKATHLDGNVTLNASNGRIKLTGNGHGSASGILFAGNNR LTASNIALTGNSTSGNAINLTGTATLNATNDITLTGSSTSGNAINLTGTATLNATNNITLTG SSTSGNAINLKGNNTLTASNITLTGESTSGNAINLTDTTGTTTLNATNNITMQGTRVQIKH SNITAGNFALNATVAGSEISNTTLTATNNINLAAKTNSASSGVYLKDARITSTNGSITANG TATANGKATHLDGNVTLNASNGRIKLTGNGHGSASGILFAGNNRLTASNIALTGNSTSG NAINLTGTATLNATNDITLTGSSTSGNAINLTGTATLNATNNITLTGSSTSGNAINLKGNN TLTASNITLTGESTSGNAINLTDTTGTTTLNATNNITMQGTRVQIKHSNITAGNFALNATV AGSEISNTTLTATNNINLAAKTNSASSGVYLKDARITSTNGSITANGTAPANDNATYLDG NVTLNASNGSIKLTGNGNGSTSGILFAGNNTLTASNITLTGNSEVYWQ
Identified Tryptic glycopeptides using BEMAP combined with ESI-MS/MS (SEQ ID NOs: 32-34), respectively) :
Seq Mod AA # 1 Mod AA #2 Mod AA #3 GNTVQFDQPsssAVALNR S119 S120 S121
LtGNGHGsAsGILFAGNNR T821 S827 S829
VsNsGTIR S218 S220 Identified TibA glycopeptides listed as probable epitopes presented by Antigen Presenting Cells (glycosylations underlined, SEQ ID NOs: 35-38, respectively) :
VOFDOPSSSAVALNR NGRIKLTGNGHGS TGNGHGSASGILF NGHGSASGILFAG
4) Secreted autotransporter protein EatA, CBJ04449, ETEC_p948_0020 Primary sequence of EatA (SEQ ID NO: 39) :
MNKVFSLKYSFLAKGFIAVSELARRVSVKGKLKSASSIIISPITIAIVSYAPPSLAATVNADI SYQTFRDFAENKGAFIVGASNINIYDKNGVLVGVLDKAPMPDFSSATMNTGTLPPGDHTL YSPQYVVTAKHVNGSDIMSFGHIQNNYTVVGENNHNSLDIKIRRLNKIVTEVAPAEISSV GAVNGAYQEGGRFKAFYRLGGGLQYIKDKNGNLTPVYTNGGFLTGGTISALSSYNNGQM ITAPTGDIFNPANGPLANYLNKGDSGSPLFAYDSLDKKWVLVGVLSSGSEHGNNWVVTT QDFLHQQPKHDFDKTISYDSEKGSLQWRYNKNSGVGTLSQESVVWDMHGKKGGDLNA GKNLQFTGNNGEIILHDSIDQGAGYLQFFDNYTVTSLTDQTWTGGGIITEKGVNVLWQV NGVNDDNLHKVGEGTLTVNGKGVNNGGLKVGDGTVILNQRPDDNGHKQAFSSINISSG RATVILSDANQVNPDKISWGYRGGTLDLNGNNVNFTRLQAADYGAIVSNNNKNKSELTL KLQTLNENDISVDVKTYEVFGGHGSPGDLYYVPASNTYFILKSKAYGPFFSDLDNTNVWQ NVGHDRDKAIQIVKQQKIGESSQPYMFHGQLNGYMDVNIHPLSGKDVLTLDGSVNLPEG VITKKSGTLIFQGHPVIHAGMTTSAGQSDWENRQFTMDKLRLDAATFHLSRNAHMQGDI SAANGSTVILGSSRVFTDKNDGTGNAVSSVEGSSIATTAGDQSYYSGNVLLENHSSLEV RENFTGGIEAYDSSVSVTSQNAIFDHVGSFVNSSLLLEKGAKLTAQSGIFTNNTMKIKEN ASLTLTGIPSVGKPGYYSPVTSTTEGIHLGERASLSVKNMGYLSSNITAENSAAIINLGDS NATIGKTDSPLFSTLMRGYNAVLQGNIMGPQSSVNMNNALWHSDRNSELKELKANDSQI ELGVRGHFAKLRVKELIASNSVFLVHANNSQADQLNVTDKLQGSNNTILVDFFNKAANG TNVTLITAPKGSDENTFKAGTQQIGFSNITPEIRTENTDTATQWVLTGYQSVADARASKIA TDFMDSGYKSFLTEVNNLNKRMGDLRDSQGDAGGWARIMNGTGSGESGYRDNYTHVQ IGADRKHELNGIDLFTGALLTYTDNNASSQAFSGKTKSLGGGVYASGLFESGAYFDLIGK YLHHDNRYTLNFASLGERSYTSHSLYAGAEIGYRYHMSENTWVEPQMELVYGSVSGKSF NWKDQGMQLSMKDKDYHPLIGRTGVDVGRAFSGDTWKVTVRAGLGYQFDLLANGETV LQDASGKKHFKGEKDSRMLMNVGTNVEVKDNMRFGLELEKSAFGRYNIDNSINANFRYY
(SEQ ID NOs: 40-43, respectively) Mod AA # 1 Mod AA #2 Mod AA #3
GGtLDLNGNNVNFTR T500
LQAADYGAIVsNNNK S523
VGEGTLtVNGK T434
AANGtNVTLITAPK T1011
Identified EatA glycopeptides listed as probable epitopes presented by Antigen Presenting Cells (glycosylations underlined, SEQ ID NOs: 44-47, respectively) :
WGYRGGTLDLNGN DYGAIVSNNNKNK VGEGTLTVNGKGV NKAANGTNVTLIT
5) CexE, CBJ04537
Primary sequence of CexE (SEQ ID NO: 48) :
MKKYILGVILAMGSLSAIAGGGNSERPPSVAAGECVTFNSKLGEIGGYSWKYSNDACNE TVAKGYAIGVAMHRTVNYEGGYSIQSSGIVKPGSDFIMKGGKTYKGHKKVSAGGDTPY WYK
Seq(SEQ ID NO: 49) Mod AA # 1
YsNDACNETVAK S53
Identified CexE glycopeptides listed as probable epitopes presented by Antigen Presenting Cells (glycosylation underlined, SEQ ID NO: 50) :
GYSWKYSNDACNE 6) Putative antigen Ag43, CBJ03971, ETEC_4462
Primary sequence of Ag43 (SEQ ID NO: 51) :
MKGESVYARDVSLCPITLFCTCRYPLLWVPAFLFTLCKEKLMKRHLNTSYRLVWNHITGTL VVASELARSRGKRTGVAVALSLATATSVPALAADSVVQAGETVSGGTLENHDNQIVFGTT NGITISTGLEYGPDNEANTGGQWVQDGGTASNTTISSGGLQFVGAGGKATDTIINEGGG QSLKGLALNTTLNGGEQWMHEGAIATGTVINDKGWQVVKPGAVATDTVVNTGAEGGPD AENADTGQFVRGDAVRTTINKNGRQIVVATGVANTTVVYAGGDQTVHGYALDTTLNGG NQYVHNGGTASDTVVNSDGWQIIKEGGLADFTTVNQKGKLQVNAGGTATNVTLKQGG ALVTSTAATVLGSNRLGNFTVENGKADGVVLESGGRLDVLEGHSAWKTLVDDGGILAVS AGGKATDVTMTSGGALIADSGATVEGTNASGKFSIDGISGQASGLLLENGGSFTVNAGG QAGNTTVGHRGTLTLAAGGSLSGRTQLSKGASMVLNGDVVSTGDIVNAGEIHFDNQTT QDAVLSRAVAKSNSPVTFHKLTTTNLTGQGGTINMRVSLDGSNASDQLVINGGQATGKT WLAFTNVGNSNLGVATSGQGIRVVDAQNGATTEEGAFALSRPLQAGAFNYTLNRDSDE DWYLRSENAYRAEVPLYTSMLTQAMDYDRILAGSRSHQTGVNGENNSVRLSIQGGHLG HDNNGGIARGATPESSGSYGFVRLEGDLLRTEVAGMSVTAGVYGAAGHSSVDVKDDDG SRAGTVRDDAGSLGGYLNLVHTSSGLWADIVAQGTRHSMKASTDNNDFRARGWGWLG SLETGLPFSITDNLMLEPQLQYTWQGLSLDDGKDNAGYVKFGHGSAQHVRAGFRLGSH NDMTFGEGTSSRAPLRDSAKHSMRELPVNWWVQPSVIRTFSSRGDMSMGTAAAGSNM TFSPSRNGTSLDLQAGLEARVRENITLGVQAGYAHSVIGSSAEGYNGQATLNVTF
Start End Sequence ID Nos 52-57, respectively Mod AA#
228 240 NGGVAGNTTVNQK T235
803 811 AstDNNDFR S804 T805
379 378 LGNFtVEnGK T373
682 695 sHQtGVnGENNsVR S682 T685 S693
566 587 VsLDGsNAsDQLVInGGQAtGK S567 S571
T585
611 642 VVDAQNGAttEEGAFALSRPLQAGAFnYTLNR T619 T620
Identified Ag43 glycopeptides listed as probable epitopes presented by Antigen Presenting Cells (glycosylations underlined, SEQ ID NOs: 58-68, respectively) : GGLADFTTVNQKG
RHSMKASTDNNDFR
NRLGNFTVENGKA
ILAGSRSHQTGVN
GSRSHQTGVNGEN
VNGENNSVRLSIQ
TINMRVSLDGSNA
RVSLDGSNASDQL
LDGSNASDQLVIN
INGGQATGKTWLA
DAQNGATTEEGAFA
Example 2 - Immunogenicity of ETEC glycosylated proteins
An immunogenic polypeptide is defined as a polypeptide that induces an immune response.
The immune response may be monitored by one of the following methods: An in vitro cellular response is determined by release of a relevant cytokine such as IFN-γ, from lymphocytes withdrawn from an animal or human currently or previously infected with ETEC, or by detection of proliferation of these T cells. The induction is performed by addition of the polypeptide or the immunogenic part to a suspension comprising from lxlO5 cells to 3xl05 cells per well. The cells are isolated from either blood, the spleen, the liver or the lung and the addition of the polypeptide or the immunogenic part of the polypeptide result in a concentration of not more than 20 pg per ml suspension and the stimulation is performed from two to five days. For monitoring cell proliferation the cells are pulsed with radioactive labeled Thymidine and after 16-22 hours of incubation the proliferation is detected by liquid scintillation counting. A positive response is a response more than background plus two standard deviations. The release of IFN- γ can be determined by the ELISA method, which is well known to a person skilled in the art. A positive response is a response more than background plus two standard deviations. Other cytokines than IFN- γ could be relevant when monitoring an immunological response to the polypeptide, such as IL-12, TNF-a, IL-4, IL-5, IL-10, IL-6, TGF- β- Another and more sensitive method for determining the presence of a cytokine (e.g. IFN-γ) is the ELISPOT method where the cells isolated from either the blood, the spleen, the liver or the lung are diluted to a concentration of preferable of 1 to 4 x 106 cells /ml and incubated for 18-22 hrs in the presence of the polypeptide or the immunogenic part of the polypeptide resulting in a concentration of not more than 20 pg per ml.
The cell suspensions are hereafter diluted to 1 to 2 x 106/ ml and transferred to Maxisorp plates coated with anti-IFN-γ and incubated for preferably 4 to 16 hours. The IFN-γ producing cells are determined by the use of labelled secondary anti-IFN-antibody and a relevant substrate giving rise to spots, which can be enumerated using a dissection microscope. It is also a possibility to determine the presence of mRNA coding for the relevant cytokine by the use of the PCR technique. Usually one or more cytokines will be measured utilizing for example the PCR, ELISPOT or ELISA. It will be appreciated by a person skilled in the art that a significant increase or decrease in the amount of any of these cytokines induced by a specific polypeptide can be used in evaluation of the immunological activity of the polypeptide. An in vitro cellular response may also be determined by the use of T cell lines derived from an immune individual or an ETEC infected person where the T cell lines have been driven with either live ETEC, extracts from the bacterial cell or culture filtrate for 10 to 20 days with the addition of IL-2. The induction is performed by addition of not more than 20 pg polypeptide per ml suspension to the T cell lines containing from lxlO5 cells to 3xl05 cells per well and incubation is performed from two to six days. The induction of IFN-γ or release of another relevant cytokine is detected by ELISA. The stimulation of T cells can also be monitored by detecting cell proliferation using radioactively labeled Thymidine as described above. For both assays a positive response is a response more than background plus two standard deviations.
An in vivo cellular response may be determined as a positive DTH response after intradermal injection or local application patch of at most 100 pg of the polypeptide or the immunogenic part to an individual who is clinically or subclinically infected with ETEC, a positive response having a diameter of at least 5 mm 72-96 hours after the injection or application.
An in vitro humoral response is determined by a specific antibody response in an immune or infected individual. The presence of antibodies may be
determined by an ELISA technique or a Western blot where the polypeptide or the immunogenic part is absorbed to either a nitrocellulose membrane or a polystyrene surface. The serum is preferably diluted in PBS from 1 : 10 to 1 : 100 and added to the absorbed polypeptide and the incubation being performed from 1 to 12 hours. By the use of labeled secondary antibodies the presence of specific antibodies can be determined by measuring the presence or absence of a specific label e.g . by ELISA where a positive response is a response of more than background plus two standard deviations or alternatively a visual response in a Western blot.
Another relevant parameter is measurement of the protection in animal models induced after vaccination with the polypeptide in an adjuvant or after DNA vaccination. Suitable animal models include primates, guinea pigs or mice, which are challenged with an infection of an ETEC. Readout for induced protection could be decrease of the bacterial load in target organs compared to non-vaccinated animals, prolonged survival times compared to non-vaccinated animals and diminished weight loss or pathology compared to non-vaccinated animals. The glycosylated polypeptides described herein are immunogenic when one of the above described tests is positive.
Example 3 - Schematic overview of assays and experiments used to
characterize glycosylated as well as non-glycosylated NmpC or TibA protein properties. An "X" indicate lead molecule specific assay. Candidate molecule
Experiment type NmpC TibA
Mouse challenge X X
Serum and mucosal antibody responses X X
Antibody mediated inhibition of ETEC binding to Caco-2 X X
Antibody mediated inhibition of ETEC binding to Caco-2; cAMP release measurement X X
Surface-plasmon-resonance-based (SPR) to determine k0ff and kon constants X X
M IC assay to test antibiotics susceptibility X
NmpC and TibA have been tested for a wide variety of features using several different assays. An overview can be seen in the table above. Example 4 - Vaccination with glycosylated NmpC or TibA affords better
protection against intestinal colonization of ETEC in mice compared to the non- glycosylated protein versions.
Assay type: Mouse challenge studies Materials and methods:
Five groups of CD-I mice were immunized with either adjuvant only (control), or appropriate amount of adjuvant + e.g. 25 pg of glycosylated NmpC, or adjuvant + e.g. 25 pg of non-glycosylated NmpC, or adjuvant + e.g. 25 pg of glycosylated TibA, or adjuvant + e.g. 25 pg of non-glycosylated TibA, on days 0, 14, 28. On day 40, mice were treated with streptomycin [e.g. 5 g per liter] in drinking water for 24 hours, followed by drinking water alone for 18 hours.
After administration of famotidine to reduce gastric acidity, mice were
challenged with 106 cfu of a chloramphenicol-resistant ETEC strain by oral gavage. Fecal samples (6 pellets/mouse) were collected on day 42 before oral gavage, re-suspended in buffer (lOmM Tris, lOOmM NaCI, 0.05% Tween 20, 5mM Sodium Azide, pH 7.4) overnight at 4°C, centrifuged to pellet insoluble material, and recover supernatant for fecal antibody testing (below). Twenty- four hours after infection, mice were sacrificed, sera were collected, and
dilutions of saponin small-intestinal lysates were plated onto Luria agar plates containing chloramphenicol (40 g/ml). Experimental outcome : As determined by CFU counting, fecal samples from mice immunized with glycosylated antigen NmpC and TibA contained fewer ETEC compared to fecal samples from mice immunized with non-glycosylated antigen versions.
Example 5 - Immunization with glycosylated antigen NmpC or TibA generates robust serum and mucosal antibody responses
Assay type: Kinetic enzyme-linked immunosorbent assay probing relative levels of IgA, IgM and IgG
Materials and methods:
Murine immune responses to adjuvant, glycosylated and non-glycosylated versions of NmpC and TibA were determined using kinetic ELISA. Briefly, ELISA wells were incubated at 4°C overnight with proteins at a final concentration of 4 Mg/ml in 0.1 M NaHC03 buffer (pH 8.6), washed the following day with Tris- buffered saline containing 0.005% Tween 20 (TBS-T), and blocked with 1% bovine serum albumin (BSA) in TBS-T for 1 h at 37°C prior to the addition of the samples. Sera were diluted 1 : 500 in TBS-T with 1% BSA, and 100 μΙ was added to each ELISA well, followed by incubation at 37°C for 1 h. After three washes with TBS-T, horseradish peroxidase-conjugated secondary antibody (either goat anti-mouse IgA, IgM, or IgG) was added at a final dilution of 1 : 5,000, followed by incubation for an additional hour before washing and development with TMB (3,3',5,5'-tetramethylbenzidine)-peroxidase substrate (KPL). Kinetic ELISA data are expressed as Vmax in milliunits/min.
Experimental outcome: Immunization with glycosylated antigen NmpC or TibA generates robust IgA, IgG and IgM antibody responses as compared to non- glycosylated versions.
Reference for experiment: EatA, an immunogenic protective antigen of enterotoxigenic Escherichia coli, degrades intestinal mucin. Example 6 - Monoclonal antibodies raised against glycosylated NmpC and TibA inhibits ETEC binding to intestinal epithelial cells to a higher extent compared antibodies raised against non-glycosylated NmpC and TibA protein version. Assay type: Adhesion Assay
Materials and methods:
In vitro, Caco-2 epithelial cell monolayers were infected with ETEC H 10407 at multiplicities of infection of approximately 100 (bacteria/cell) approximately 18 to 22 days after seeding into wells. Cultures of bacteria were grown overnight in Luria broth from frozen glycerol stocks, diluted 1 : 100, and grown for 1 h. One microliter of bacterial culture is added to confluent Caco-2 monolayers seeded into 96-well plates preincubated with or without antibodies. Two hours after inoculation, the monolayers were washed 3 times with tissue culture medium after which bacteria were isolated, serial diluted and plated to count CFU the following day.
Experimental outcome: Monoclonal antibodies raised against glycosylated NmpC and TibA inhibits ETEC binding to intestinal epithelial cells to a higher extent compared monoclonal antibodies raised against non-glycosylated NmpC and TibA protein version.
Example 7 - Monoclonal antibodies raised against glycosylated NmpC and TibA inhibits ETEC binding to intestinal epithelial cells to a higher extent compared to monoclonal antibodies raised against non-glycosylated NmpC and TibA protein version.
Assay type: Adhesion Assay coupled to cAMP enzyme immunoassay Materials and methods:
In vitro, Caco-2 epithelial cell monolayers were infected with ETEC H 10407 at multiplicities of infection of approximately 100 (bacteria/cell). Cultures of bacteria were grown overnight in Luria broth from frozen glycerol stocks, diluted 1 : 100, and grown for 1 h. One microliter of bacterial culture is added to confluent Caco-2 monolayers seeded into 96-well plates preincubated with or without antibodies. Two hours after inoculation, the monolayers were washed 3 times with tissue culture medium, a nd the medium was replaced with 100 μΙ of fresh medium/well and returned to the incubator (37°C, 5% C02) for 2.5 h . Subsequently, cyclic AMP (cAMP) enzyme imm unoassay (EIA) (Arbor Assays, Ann Arbor, MI) was used to exam ine the efficiency of toxin delivery.
Experimental outcome : Addition of antibodies raised against glycosylated Nm pC and TibA results in lower levels of released cAMP into the g rowth medium com pa red to monoclonal antibodies raised against non-glycosylated Nm pC and TibA protein version .
Exam ple 8 - Monoclonal antibodies ra ised against Nm pC a nd TibA g lycoepitopes results in lower equilibrium dissociation constants (Kd = k0ff / kon) compared to monoclona l antibodies raised against non-glycosylated Nm pC and TibA epitopes.
Assay type : Surface-plasmon-resonance-based (SPR) sensor (IBIS MX96) Materials a nd methods :
NmpC and TibA were d igested ON at 25C using a n appropriate protease.
Subsequently, peptides covering whole protein length or sequences known to be glycosylated were isolated using HPLC. Sta ndard protocols were employed to create an array containing peptides (+/- glycosylated va ria nts) as well as controls; huma n IgG, human serum album in (HSA) and em pty spots. After interaction with the antibodies the a rray was regenerated (cleaned) using a n acid step to wash a nd elute the antibody and to prepare the sensor for the subsequent Ab sam ple. In the continuous flow microspotter (CFM), va rious peptides were arrayed onto this layer where each feature contained a small peptide bound at saturating concentrations. The CFM-arrayed sensor was then inserted in the IBIS MX96 and a series of antigen binding antibodies were then sequentially injected and passed over the com plete sensor surface. Experimental outcome: Glycosylation changes the binding and affinity properties of the antibody dramatically as shown for monoclonal antibodies targeting the same linear sequence where one is modified and the other is not. Example 9 - Antibiotics susceptibility (Cephalothin and Polymyxin B) can be reduced with antibodies (polyclonal and monoclonal antibodies) targeting glycosylated NmpC epitopes
Assay type: MIC assay to test antibiotics susceptibility.
Materials and methods:
The MIC for a panel of antibiotics (e.g. Cephalothin and Polymyxin B) was determined by serial dilution in Mueller Hinton broth as recommended by the Clinical and Laboratory Standards Institute.
Experimental outcome: An nmpC isogenic knock-out strain is less susceptible to antibiotics compared to wild type H10407. By including antibodies which targets NmpC epitopes in the MIC assay, the uptake of antibiotics is reduced resulting in antibiotics susceptibility levels comparable to the nmpC isogenic knock-out strain.

Claims

Claims
1. A polypeptide comprising : a) SEQ ID NO: 20, b) a polypeptide fragment of SEQ ID NO: 20 that has at least 75 % sequence identity to SEQ ID NO: 20, or c) a B- or T-cell epitope of SEQ ID NO: 20, wherein the polypeptide is glycosylated at least in one position.
2. The polypeptide as defined in any of claim 1, wherein the polypeptide is glycosylated at least in two positions.
3. The polypeptide as defined in any of claims 1-2, wherein the polypeptide is glycosylated at least in three positions.
4. The polypeptide as defined in any of claims 1-3, wherein the polypeptide originates from Enterotoxigenic Escherichia coli (ETEC).
5. The polypeptide as defined in any of claims 1-4, wherein the glycosylated polypeptide is selected from the group of glycosylated polypeptides consisting of SEQ ID NOs: 21-30.
6. The polypeptide as defined in any of claims 1-5, wherein the polypeptide is a fusion polypeptide.
7. The polypeptide as defined in any of claims 1-6, wherein the polypeptide is fused to a polypeptide originating from ETEC.
8. An immunogenic composition comprising the polypeptide as defined in any of claims 1-7.
9. A pharmaceutical composition comprising the polypeptide as defined in any of claims 1-7 and at least one pharmaceutically acceptable carrier, excipient or diluent.
10. The immunogenic composition as defined in claim 8 or the pharmaceutical composition of claim 9, which is a vaccine against ETEC.
11. An immunogenic composition, a pharmaceutical composition, or a vaccine as defined in any of claims 8- 11, which is formulated for intradermal, transdermal, subcutaneous, intramuscular or mucosal application.
12. A nucleic acid sequence encoding a polypeptide as defined in any of claims 1-7.
13. A method for immunizing a mammal, the method comprising administering to the mammal the immunogenic composition, pharmaceutical composition or vaccine according to any of the preceding claims.
14. A method for treating a mammal, which is infected with ETEC comprising administering to the mammal the immunogenic composition, pharmaceutical composition or vaccine according to any of the preceding claims.
15. The method as defined in any of claims or polypeptide for use as defined in any of claims 13- 14, wherein the mammal is a human.
16. The polypeptide as defined in any of claims 1-7, immunogenic composition as defined in claim 8, pharmaceutical composition as defined in claim 9, or vaccine as defined in claim 10 for use in treating infection caused by ETEC.
17. The polypeptide as defined in any of claims 1-7, immunogenic composition as defined in claim 8, pharmaceutical composition as defined in claim 9, or vaccine as defined in claim 10 for use in the preparation of a medicament for treating infection caused by ETEC.
18. The polypeptide as defined in any of claims 1-7, immunogenic composition as defined in claim 8, pharmaceutical composition as defined in claim 9, or vaccine as defined in claim 10 for use in the diagnosis of an infection caused by ETEC.
PCT/DK2015/050089 2014-04-10 2015-04-10 Glycosylated polypeptides originating from enterotoxigenic escherichia coli (etec) Ceased WO2015154783A1 (en)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201461977838P 2014-04-10 2014-04-10
US61/977,838 2014-04-10

Publications (1)

Publication Number Publication Date
WO2015154783A1 true WO2015154783A1 (en) 2015-10-15

Family

ID=52991407

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/DK2015/050089 Ceased WO2015154783A1 (en) 2014-04-10 2015-04-10 Glycosylated polypeptides originating from enterotoxigenic escherichia coli (etec)

Country Status (1)

Country Link
WO (1) WO2015154783A1 (en)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2017059864A1 (en) * 2015-10-06 2017-04-13 Syddansk Universitet Glycosylated yghj polypeptides from enterotoxigenic escherichia coli (etec)

Non-Patent Citations (8)

* Cited by examiner, † Cited by third party
Title
C. LINDENTHAL ET AL: "Enterotoxigenic Escherichia coli TibA Glycoprotein Adheres to Human Intestine Epithelial Cells", INFECTION AND IMMUNITY, vol. 69, no. 1, 1 January 2001 (2001-01-01), pages 52 - 57, XP055195452, ISSN: 0019-9567, DOI: 10.1128/IAI.69.1.52-57.2001 *
CHRISTOPH LINDENTHAL ET AL: "Identification of a Glycoprotein Produced by Enterotoxigenic Escherichia coli", INFECTION AND IMMUNITY, vol. 67, no. 8, 1 August 1999 (1999-08-01) - 1 August 1999 (1999-08-01), UNITED STATES, pages 4084 - 4091, XP055195000, Retrieved from the Internet <URL:http://iai.asm.org/content/67/8/4084.abstract> *
DATABASE UniProt [online] 1 November 1999 (1999-11-01), "RecName: Full=Adhesin/invasin TibA autotransporter; Contains: RecName: Full=Adhesin/invasin TibA; AltName: Full=Glycoprotein TibA; Contains: RecName: Full=Adhesin/invasin TibA translocator; Flags: Precursor;", XP002740838, retrieved from EBI accession no. UNIPROT:Q9XD84 Database accession no. Q9XD84 *
HARRIS J A ET AL: "Directed evaluation of enterotoxigenic escherichia coli autotransporter proteins as putative vaccine candidates", PLOS NEGLECTED TROPICAL DISEASES, PUBLIC LIBRARY OF SCIENCE, US, vol. 5, no. 12, 6 December 2011 (2011-12-06), pages e1428 - 1, XP008151760, ISSN: 1935-2727, DOI: 10.1371/JOURNAL.PNTD.0001428 *
K. ROY ET AL: "Enterotoxigenic Escherichia coli Elicits Immune Responses to Multiple Surface Proteins", INFECTION AND IMMUNITY, vol. 78, no. 7, 10 May 2010 (2010-05-10), pages 3027 - 3035, XP055195400, ISSN: 0019-9567, DOI: 10.1128/IAI.00264-10 *
LU QIUHE ET AL: "An Iron-Containing Dodecameric Heptosyltransferase Family Modifies Bacterial Autotransporters in Pathogenesis", CELL HOST & MICROBE, ELSEVIER, NL, vol. 16, no. 3, 11 September 2014 (2014-09-11), pages 351 - 363, XP029054253, ISSN: 1931-3128, DOI: 10.1016/J.CHOM.2014.08.008 *
RAJ K. UPRETI ET AL: "Bacterial glycoproteins: Functions, biosynthesis and applications", PROTEOMICS, vol. 3, no. 4, 1 April 2003 (2003-04-01), pages 363 - 379, XP055007473, ISSN: 1615-9853, DOI: 10.1002/pmic.200390052 *
ROY K ET AL: "Vaccination with EtpA glycoprotein or flagellin protects against colonization with enterotoxigenic Escherichia coli in a murine model", VACCINE, ELSEVIER LTD, GB, vol. 27, no. 34, 23 July 2009 (2009-07-23), pages 4601 - 4608, XP026266826, ISSN: 0264-410X, [retrieved on 20090611], DOI: 10.1016/J.VACCINE.2009.05.076 *

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2017059864A1 (en) * 2015-10-06 2017-04-13 Syddansk Universitet Glycosylated yghj polypeptides from enterotoxigenic escherichia coli (etec)
US10647749B2 (en) 2015-10-06 2020-05-12 Syddansk Universitet Glycosylated YGHJ polypeptides from enterotoxigenic Escherichia coli (ETEC)
US11655274B2 (en) 2015-10-06 2023-05-23 Aarhus Universitet Glycosylated YghJ polypeptides from enterotoxigenic Escherichia coli (ETEC)

Similar Documents

Publication Publication Date Title
AU2010281313B2 (en) Porphyromonas gingivalis polypeptides
CN106008679A (en) Modified pneumolysin (PLY) polypeptide
JP2014529396A (en) Pasteurella vaccine
US20110268758A1 (en) Tuberculosis antigen detection assays and vaccines
US11655274B2 (en) Glycosylated YghJ polypeptides from enterotoxigenic Escherichia coli (ETEC)
US7169393B2 (en) Antigenic peptide fragments of VapA protein, and uses thereof
US7658929B2 (en) Immunogenic glycopeptides, screening, preparation and uses
EP2262828B1 (en) Compositions, methods and kits
WO2015154783A1 (en) Glycosylated polypeptides originating from enterotoxigenic escherichia coli (etec)
EP2508201A1 (en) Method for the identification of animals vaccinated against brucella
US20110212133A1 (en) Novel Methods of Diagnosis and Treatment of P. Aeruginosa Infection and Reagents Therefor
AU2016374289B2 (en) Helicobacter pylori vaccines
CN104730256B (en) For detection of composition and the application thereof of mycoplasma antibody
US20160046699A1 (en) Peptides and binding partners therefor
WO2008097812A1 (en) Toxoplasma gondii oocyst protein
AU2001252038B2 (en) Antigenic peptide fragments of vapa protein, and uses thereof
CN106442983A (en) Application of antigen protein Rv3793 of mycobacterium tuberculosis and T-cell epitope peptide thereof
JP2026501151A (en) Diagnosis of Bartonella using recombinant proteins
AU2016254447A1 (en) Modified Streptococcus pneumonia pneumolysin (PLY) polypeptides
AU2001252038A1 (en) Antigenic peptide fragments of VapA protein, and uses thereof
HK1149770B (en) Compositions, methods and kits
AU2005256177A1 (en) Novel methods of diagnosis of treatment of P. aeruginosa infection and reagents therefor

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 15717415

Country of ref document: EP

Kind code of ref document: A1

122 Ep: pct application non-entry in european phase

Ref document number: 15717415

Country of ref document: EP

Kind code of ref document: A1