WO2015144855A1 - Monoclonal antibodies to growth and differentiation factor 15 (gdf-15), and uses thereof for treating cancer cachexia and cancer - Google Patents
Monoclonal antibodies to growth and differentiation factor 15 (gdf-15), and uses thereof for treating cancer cachexia and cancer Download PDFInfo
- Publication number
- WO2015144855A1 WO2015144855A1 PCT/EP2015/056654 EP2015056654W WO2015144855A1 WO 2015144855 A1 WO2015144855 A1 WO 2015144855A1 EP 2015056654 W EP2015056654 W EP 2015056654W WO 2015144855 A1 WO2015144855 A1 WO 2015144855A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- antibody
- amino acid
- acid sequence
- seq
- antigen
- Prior art date
Links
- 206010028980 Neoplasm Diseases 0.000 title claims abstract description 214
- 201000011510 cancer Diseases 0.000 title claims abstract description 159
- 206010006895 Cachexia Diseases 0.000 title claims abstract description 153
- 102000000597 Growth Differentiation Factor 15 Human genes 0.000 title claims description 60
- 108010041834 Growth Differentiation Factor 15 Proteins 0.000 title claims description 60
- 230000012010 growth Effects 0.000 title description 7
- 230000004069 differentiation Effects 0.000 title description 3
- 238000000034 method Methods 0.000 claims abstract description 163
- 230000027455 binding Effects 0.000 claims description 377
- 239000000427 antigen Substances 0.000 claims description 279
- 102000036639 antigens Human genes 0.000 claims description 279
- 108091007433 antigens Proteins 0.000 claims description 279
- 101000893549 Homo sapiens Growth/differentiation factor 15 Proteins 0.000 claims description 129
- 102000046181 human GDF15 Human genes 0.000 claims description 129
- 210000004027 cell Anatomy 0.000 claims description 90
- 241000124008 Mammalia Species 0.000 claims description 67
- 230000037396 body weight Effects 0.000 claims description 48
- 230000005907 cancer growth Effects 0.000 claims description 43
- 230000005764 inhibitory process Effects 0.000 claims description 22
- 239000003814 drug Substances 0.000 claims description 21
- 210000000822 natural killer cell Anatomy 0.000 claims description 10
- 239000002773 nucleotide Substances 0.000 claims description 8
- 125000003729 nucleotide group Chemical group 0.000 claims description 8
- 210000001266 CD8-positive T-lymphocyte Anatomy 0.000 claims description 7
- 230000005880 cancer cell killing Effects 0.000 claims description 6
- 239000013604 expression vector Substances 0.000 claims description 6
- 108010087819 Fc receptors Proteins 0.000 claims description 5
- 102000009109 Fc receptors Human genes 0.000 claims description 5
- YQHZVYJAGWMHES-ZLUOBGJFSA-N Ser-Ala-Ser Chemical compound OC[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(O)=O YQHZVYJAGWMHES-ZLUOBGJFSA-N 0.000 claims description 5
- 230000006698 induction Effects 0.000 claims description 4
- 125000003275 alpha amino acid group Chemical group 0.000 claims 86
- 238000011282 treatment Methods 0.000 abstract description 66
- 239000008194 pharmaceutical composition Substances 0.000 abstract description 40
- 241001529936 Murinae Species 0.000 abstract description 25
- 150000001413 amino acids Chemical group 0.000 description 323
- 108090000765 processed proteins & peptides Proteins 0.000 description 51
- 208000016261 weight loss Diseases 0.000 description 49
- 230000004580 weight loss Effects 0.000 description 42
- 101100112922 Candida albicans CDR3 gene Proteins 0.000 description 36
- 230000000694 effects Effects 0.000 description 34
- 108090000623 proteins and genes Proteins 0.000 description 27
- 102000004196 processed proteins & peptides Human genes 0.000 description 25
- 102000004169 proteins and genes Human genes 0.000 description 25
- 241000699670 Mus sp. Species 0.000 description 18
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 17
- 229940079593 drug Drugs 0.000 description 17
- 238000005259 measurement Methods 0.000 description 17
- 239000004615 ingredient Substances 0.000 description 16
- 230000002401 inhibitory effect Effects 0.000 description 16
- 239000002953 phosphate buffered saline Substances 0.000 description 16
- 239000000872 buffer Substances 0.000 description 15
- 201000001441 melanoma Diseases 0.000 description 14
- 238000010186 staining Methods 0.000 description 14
- 238000010494 dissociation reaction Methods 0.000 description 13
- 230000005593 dissociations Effects 0.000 description 13
- 206010060862 Prostate cancer Diseases 0.000 description 11
- 239000002246 antineoplastic agent Substances 0.000 description 11
- 208000000236 Prostatic Neoplasms Diseases 0.000 description 10
- 108010003723 Single-Domain Antibodies Proteins 0.000 description 10
- 238000003556 assay Methods 0.000 description 10
- 210000002865 immune cell Anatomy 0.000 description 10
- 210000001519 tissue Anatomy 0.000 description 10
- 206010006187 Breast cancer Diseases 0.000 description 9
- 208000026310 Breast neoplasm Diseases 0.000 description 9
- 241000699666 Mus <mouse, genus> Species 0.000 description 9
- 206010033128 Ovarian cancer Diseases 0.000 description 9
- 238000002474 experimental method Methods 0.000 description 9
- 230000003993 interaction Effects 0.000 description 9
- AOJJSUZBOXZQNB-TZSSRYMLSA-N Doxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 description 8
- 206010018338 Glioma Diseases 0.000 description 8
- 238000010790 dilution Methods 0.000 description 8
- 239000012895 dilution Substances 0.000 description 8
- 230000002265 prevention Effects 0.000 description 8
- 208000003174 Brain Neoplasms Diseases 0.000 description 7
- 206010009944 Colon cancer Diseases 0.000 description 7
- 108020004414 DNA Proteins 0.000 description 7
- 208000032612 Glial tumor Diseases 0.000 description 7
- 241001465754 Metazoa Species 0.000 description 7
- 206010061535 Ovarian neoplasm Diseases 0.000 description 7
- -1 PDGF Proteins 0.000 description 7
- 210000004369 blood Anatomy 0.000 description 7
- 239000008280 blood Substances 0.000 description 7
- 239000013068 control sample Substances 0.000 description 7
- 210000004408 hybridoma Anatomy 0.000 description 7
- 238000011534 incubation Methods 0.000 description 7
- 210000002966 serum Anatomy 0.000 description 7
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 7
- 208000001333 Colorectal Neoplasms Diseases 0.000 description 6
- 208000005718 Stomach Neoplasms Diseases 0.000 description 6
- 239000002253 acid Substances 0.000 description 6
- 238000004458 analytical method Methods 0.000 description 6
- 206010017758 gastric cancer Diseases 0.000 description 6
- 230000000670 limiting effect Effects 0.000 description 6
- 238000004949 mass spectrometry Methods 0.000 description 6
- 230000001404 mediated effect Effects 0.000 description 6
- 238000006366 phosphorylation reaction Methods 0.000 description 6
- 239000002243 precursor Substances 0.000 description 6
- 108020003175 receptors Proteins 0.000 description 6
- 102000005962 receptors Human genes 0.000 description 6
- 201000011549 stomach cancer Diseases 0.000 description 6
- 210000004881 tumor cell Anatomy 0.000 description 6
- 102000004127 Cytokines Human genes 0.000 description 5
- 108090000695 Cytokines Proteins 0.000 description 5
- 241000238631 Hexapoda Species 0.000 description 5
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 5
- 238000011794 NU/NU nude mouse Methods 0.000 description 5
- 230000002776 aggregation Effects 0.000 description 5
- 238000004220 aggregation Methods 0.000 description 5
- 230000000903 blocking effect Effects 0.000 description 5
- 230000008499 blood brain barrier function Effects 0.000 description 5
- 210000001218 blood-brain barrier Anatomy 0.000 description 5
- 230000037451 immune surveillance Effects 0.000 description 5
- 238000001727 in vivo Methods 0.000 description 5
- 230000036961 partial effect Effects 0.000 description 5
- 238000012360 testing method Methods 0.000 description 5
- 230000001225 therapeutic effect Effects 0.000 description 5
- NDMPLJNOPCLANR-UHFFFAOYSA-N 3,4-dihydroxy-15-(4-hydroxy-18-methoxycarbonyl-5,18-seco-ibogamin-18-yl)-16-methoxy-1-methyl-6,7-didehydro-aspidospermidine-3-carboxylic acid methyl ester Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 NDMPLJNOPCLANR-UHFFFAOYSA-N 0.000 description 4
- AOJJSUZBOXZQNB-VTZDEGQISA-N 4'-epidoxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-VTZDEGQISA-N 0.000 description 4
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 4
- STQGQHZAVUOBTE-UHFFFAOYSA-N 7-Cyan-hept-2t-en-4,6-diinsaeure Natural products C1=2C(O)=C3C(=O)C=4C(OC)=CC=CC=4C(=O)C3=C(O)C=2CC(O)(C(C)=O)CC1OC1CC(N)C(O)C(C)O1 STQGQHZAVUOBTE-UHFFFAOYSA-N 0.000 description 4
- 206010005003 Bladder cancer Diseases 0.000 description 4
- 108010006654 Bleomycin Proteins 0.000 description 4
- 201000009030 Carcinoma Diseases 0.000 description 4
- 108010092160 Dactinomycin Proteins 0.000 description 4
- 208000002699 Digestive System Neoplasms Diseases 0.000 description 4
- HTIJFSOGRVMCQR-UHFFFAOYSA-N Epirubicin Natural products COc1cccc2C(=O)c3c(O)c4CC(O)(CC(OC5CC(N)C(=O)C(C)O5)c4c(O)c3C(=O)c12)C(=O)CO HTIJFSOGRVMCQR-UHFFFAOYSA-N 0.000 description 4
- 241000282412 Homo Species 0.000 description 4
- 206010058467 Lung neoplasm malignant Diseases 0.000 description 4
- 229930192392 Mitomycin Natural products 0.000 description 4
- NWIBSHFKIJFRCO-WUDYKRTCSA-N Mytomycin Chemical compound C1N2C(C(C(C)=C(N)C3=O)=O)=C3[C@@H](COC(N)=O)[C@@]2(OC)[C@@H]2[C@H]1N2 NWIBSHFKIJFRCO-WUDYKRTCSA-N 0.000 description 4
- ZDZOTLJHXYCWBA-VCVYQWHSSA-N N-debenzoyl-N-(tert-butoxycarbonyl)-10-deacetyltaxol Chemical compound O([C@H]1[C@H]2[C@@](C([C@H](O)C3=C(C)[C@@H](OC(=O)[C@H](O)[C@@H](NC(=O)OC(C)(C)C)C=4C=CC=CC=4)C[C@]1(O)C3(C)C)=O)(C)[C@@H](O)C[C@H]1OC[C@]12OC(=O)C)C(=O)C1=CC=CC=C1 ZDZOTLJHXYCWBA-VCVYQWHSSA-N 0.000 description 4
- 229930012538 Paclitaxel Natural products 0.000 description 4
- 206010061902 Pancreatic neoplasm Diseases 0.000 description 4
- 229940123237 Taxane Drugs 0.000 description 4
- 102000004142 Trypsin Human genes 0.000 description 4
- 108090000631 Trypsin Proteins 0.000 description 4
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 description 4
- JXLYSJRDGCGARV-WWYNWVTFSA-N Vinblastine Natural products O=C(O[C@H]1[C@](O)(C(=O)OC)[C@@H]2N(C)c3c(cc(c(OC)c3)[C@]3(C(=O)OC)c4[nH]c5c(c4CCN4C[C@](O)(CC)C[C@H](C3)C4)cccc5)[C@@]32[C@H]2[C@@]1(CC)C=CCN2CC3)C JXLYSJRDGCGARV-WWYNWVTFSA-N 0.000 description 4
- 229930183665 actinomycin Natural products 0.000 description 4
- 229930013930 alkaloid Natural products 0.000 description 4
- 229940100198 alkylating agent Drugs 0.000 description 4
- 239000002168 alkylating agent Substances 0.000 description 4
- 230000000340 anti-metabolite Effects 0.000 description 4
- 229940100197 antimetabolite Drugs 0.000 description 4
- 239000002256 antimetabolite Substances 0.000 description 4
- LMEKQMALGUDUQG-UHFFFAOYSA-N azathioprine Chemical compound CN1C=NC([N+]([O-])=O)=C1SC1=NC=NC2=C1NC=N2 LMEKQMALGUDUQG-UHFFFAOYSA-N 0.000 description 4
- 229960002170 azathioprine Drugs 0.000 description 4
- 229960001561 bleomycin Drugs 0.000 description 4
- OYVAGSVQBOHSSS-UAPAGMARSA-O bleomycin A2 Chemical compound N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC=C(N=1)C=1SC=C(N=1)C(=O)NCCC[S+](C)C)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1N=CNC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C OYVAGSVQBOHSSS-UAPAGMARSA-O 0.000 description 4
- 229960004562 carboplatin Drugs 0.000 description 4
- 190000008236 carboplatin Chemical compound 0.000 description 4
- 238000004113 cell culture Methods 0.000 description 4
- 229960004630 chlorambucil Drugs 0.000 description 4
- JCKYGMPEJWAADB-UHFFFAOYSA-N chlorambucil Chemical compound OC(=O)CCCC1=CC=C(N(CCCl)CCCl)C=C1 JCKYGMPEJWAADB-UHFFFAOYSA-N 0.000 description 4
- 229960004316 cisplatin Drugs 0.000 description 4
- DQLATGHUWYMOKM-UHFFFAOYSA-L cisplatin Chemical compound N[Pt](N)(Cl)Cl DQLATGHUWYMOKM-UHFFFAOYSA-L 0.000 description 4
- 230000008878 coupling Effects 0.000 description 4
- 238000010168 coupling process Methods 0.000 description 4
- 238000005859 coupling reaction Methods 0.000 description 4
- 231100000433 cytotoxic Toxicity 0.000 description 4
- 230000001472 cytotoxic effect Effects 0.000 description 4
- STQGQHZAVUOBTE-VGBVRHCVSA-N daunorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(C)=O)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 STQGQHZAVUOBTE-VGBVRHCVSA-N 0.000 description 4
- 229960000975 daunorubicin Drugs 0.000 description 4
- 230000003247 decreasing effect Effects 0.000 description 4
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 4
- 239000003534 dna topoisomerase inhibitor Substances 0.000 description 4
- 229960003668 docetaxel Drugs 0.000 description 4
- 230000003828 downregulation Effects 0.000 description 4
- 229960004679 doxorubicin Drugs 0.000 description 4
- 229960001904 epirubicin Drugs 0.000 description 4
- VJJPUSNTGOMMGY-MRVIYFEKSA-N etoposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@H](C)OC[C@H]4O3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 VJJPUSNTGOMMGY-MRVIYFEKSA-N 0.000 description 4
- 229960005420 etoposide Drugs 0.000 description 4
- 239000012634 fragment Substances 0.000 description 4
- 229960001101 ifosfamide Drugs 0.000 description 4
- HOMGKSMUEGBAAB-UHFFFAOYSA-N ifosfamide Chemical compound ClCCNP1(=O)OCCCN1CCCl HOMGKSMUEGBAAB-UHFFFAOYSA-N 0.000 description 4
- 210000000987 immune system Anatomy 0.000 description 4
- 229960004768 irinotecan Drugs 0.000 description 4
- UWKQSNNFCGGAFS-XIFFEERXSA-N irinotecan Chemical compound C1=C2C(CC)=C3CN(C(C4=C([C@@](C(=O)OC4)(O)CC)C=4)=O)C=4C3=NC2=CC=C1OC(=O)N(CC1)CCC1N1CCCCC1 UWKQSNNFCGGAFS-XIFFEERXSA-N 0.000 description 4
- 208000032839 leukemia Diseases 0.000 description 4
- 201000005202 lung cancer Diseases 0.000 description 4
- 208000020816 lung neoplasm Diseases 0.000 description 4
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 description 4
- 230000007246 mechanism Effects 0.000 description 4
- 229960004961 mechlorethamine Drugs 0.000 description 4
- HAWPXGHAZFHHAD-UHFFFAOYSA-N mechlorethamine Chemical compound ClCCN(C)CCCl HAWPXGHAZFHHAD-UHFFFAOYSA-N 0.000 description 4
- 108020004999 messenger RNA Proteins 0.000 description 4
- 229960004857 mitomycin Drugs 0.000 description 4
- 239000000203 mixture Substances 0.000 description 4
- 150000007523 nucleic acids Chemical class 0.000 description 4
- 229960001756 oxaliplatin Drugs 0.000 description 4
- DWAFYCQODLXJNR-BNTLRKBRSA-L oxaliplatin Chemical compound O1C(=O)C(=O)O[Pt]11N[C@@H]2CCCC[C@H]2N1 DWAFYCQODLXJNR-BNTLRKBRSA-L 0.000 description 4
- 229960001592 paclitaxel Drugs 0.000 description 4
- 201000002528 pancreatic cancer Diseases 0.000 description 4
- 208000008443 pancreatic carcinoma Diseases 0.000 description 4
- 230000026731 phosphorylation Effects 0.000 description 4
- 239000013612 plasmid Substances 0.000 description 4
- 238000002360 preparation method Methods 0.000 description 4
- 239000000126 substance Substances 0.000 description 4
- RCINICONZNJXQF-MZXODVADSA-N taxol Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 description 4
- NRUKOCRGYNPUPR-QBPJDGROSA-N teniposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@@H](OC[C@H]4O3)C=3SC=CC=3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 NRUKOCRGYNPUPR-QBPJDGROSA-N 0.000 description 4
- 229960001278 teniposide Drugs 0.000 description 4
- 229940044693 topoisomerase inhibitor Drugs 0.000 description 4
- 229960000303 topotecan Drugs 0.000 description 4
- UCFGDBYHRUNTLO-QHCPKHFHSA-N topotecan Chemical compound C1=C(O)C(CN(C)C)=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 UCFGDBYHRUNTLO-QHCPKHFHSA-N 0.000 description 4
- 229960000575 trastuzumab Drugs 0.000 description 4
- 239000012588 trypsin Substances 0.000 description 4
- 230000004614 tumor growth Effects 0.000 description 4
- 201000005112 urinary bladder cancer Diseases 0.000 description 4
- 229960000653 valrubicin Drugs 0.000 description 4
- ZOCKGBMQLCSHFP-KQRAQHLDSA-N valrubicin Chemical compound O([C@H]1C[C@](CC2=C(O)C=3C(=O)C4=CC=CC(OC)=C4C(=O)C=3C(O)=C21)(O)C(=O)COC(=O)CCCC)[C@H]1C[C@H](NC(=O)C(F)(F)F)[C@H](O)[C@H](C)O1 ZOCKGBMQLCSHFP-KQRAQHLDSA-N 0.000 description 4
- 229960003048 vinblastine Drugs 0.000 description 4
- JXLYSJRDGCGARV-XQKSVPLYSA-N vincaleukoblastine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1NC1=CC=CC=C21 JXLYSJRDGCGARV-XQKSVPLYSA-N 0.000 description 4
- 229960004528 vincristine Drugs 0.000 description 4
- OGWKCGZFUXNPDA-XQKSVPLYSA-N vincristine Chemical compound C([N@]1C[C@@H](C[C@]2(C(=O)OC)C=3C(=CC4=C([C@]56[C@H]([C@@]([C@H](OC(C)=O)[C@]7(CC)C=CCN([C@H]67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)C[C@@](C1)(O)CC)CC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-XQKSVPLYSA-N 0.000 description 4
- OGWKCGZFUXNPDA-UHFFFAOYSA-N vincristine Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(OC(C)=O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-UHFFFAOYSA-N 0.000 description 4
- 229960004355 vindesine Drugs 0.000 description 4
- UGGWPQSBPIFKDZ-KOTLKJBCSA-N vindesine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(N)=O)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1N=C1[C]2C=CC=C1 UGGWPQSBPIFKDZ-KOTLKJBCSA-N 0.000 description 4
- GBABOYUKABKIAF-GHYRFKGUSA-N vinorelbine Chemical compound C1N(CC=2C3=CC=CC=C3NC=22)CC(CC)=C[C@H]1C[C@]2(C(=O)OC)C1=CC([C@]23[C@H]([C@]([C@H](OC(C)=O)[C@]4(CC)C=CCN([C@H]34)CC2)(O)C(=O)OC)N2C)=C2C=C1OC GBABOYUKABKIAF-GHYRFKGUSA-N 0.000 description 4
- 229960002066 vinorelbine Drugs 0.000 description 4
- 102100033400 4F2 cell-surface antigen heavy chain Human genes 0.000 description 3
- 241000283707 Capra Species 0.000 description 3
- CMSMOCZEIVJLDB-UHFFFAOYSA-N Cyclophosphamide Chemical compound ClCCN(CCCl)P1(=O)NCCCO1 CMSMOCZEIVJLDB-UHFFFAOYSA-N 0.000 description 3
- 238000009007 Diagnostic Kit Methods 0.000 description 3
- 241000588724 Escherichia coli Species 0.000 description 3
- 208000022072 Gallbladder Neoplasms Diseases 0.000 description 3
- 208000017604 Hodgkin disease Diseases 0.000 description 3
- 208000021519 Hodgkin lymphoma Diseases 0.000 description 3
- 208000010747 Hodgkins lymphoma Diseases 0.000 description 3
- 101000800023 Homo sapiens 4F2 cell-surface antigen heavy chain Proteins 0.000 description 3
- XDXDZDZNSLXDNA-TZNDIEGXSA-N Idarubicin Chemical compound C1[C@H](N)[C@H](O)[C@H](C)O[C@H]1O[C@@H]1C2=C(O)C(C(=O)C3=CC=CC=C3C3=O)=C3C(O)=C2C[C@@](O)(C(C)=O)C1 XDXDZDZNSLXDNA-TZNDIEGXSA-N 0.000 description 3
- XDXDZDZNSLXDNA-UHFFFAOYSA-N Idarubicin Natural products C1C(N)C(O)C(C)OC1OC1C2=C(O)C(C(=O)C3=CC=CC=C3C3=O)=C3C(O)=C2CC(O)(C(C)=O)C1 XDXDZDZNSLXDNA-UHFFFAOYSA-N 0.000 description 3
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 3
- 206010062016 Immunosuppression Diseases 0.000 description 3
- 208000008839 Kidney Neoplasms Diseases 0.000 description 3
- 206010023825 Laryngeal cancer Diseases 0.000 description 3
- 208000034578 Multiple myelomas Diseases 0.000 description 3
- 108091007491 NSP3 Papain-like protease domains Proteins 0.000 description 3
- 208000001894 Nasopharyngeal Neoplasms Diseases 0.000 description 3
- 208000015914 Non-Hodgkin lymphomas Diseases 0.000 description 3
- 208000009565 Pharyngeal Neoplasms Diseases 0.000 description 3
- 206010035226 Plasma cell myeloma Diseases 0.000 description 3
- 206010038389 Renal cancer Diseases 0.000 description 3
- 208000024313 Testicular Neoplasms Diseases 0.000 description 3
- 206010057644 Testis cancer Diseases 0.000 description 3
- 208000024770 Thyroid neoplasm Diseases 0.000 description 3
- 239000008186 active pharmaceutical agent Substances 0.000 description 3
- 229940045799 anthracyclines and related substance Drugs 0.000 description 3
- 230000009286 beneficial effect Effects 0.000 description 3
- 210000004556 brain Anatomy 0.000 description 3
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 3
- 238000003776 cleavage reaction Methods 0.000 description 3
- 229960004397 cyclophosphamide Drugs 0.000 description 3
- 230000001419 dependent effect Effects 0.000 description 3
- 238000003745 diagnosis Methods 0.000 description 3
- 238000005516 engineering process Methods 0.000 description 3
- 238000000605 extraction Methods 0.000 description 3
- 238000000684 flow cytometry Methods 0.000 description 3
- 201000010175 gallbladder cancer Diseases 0.000 description 3
- 230000036541 health Effects 0.000 description 3
- 230000002440 hepatic effect Effects 0.000 description 3
- 229960000908 idarubicin Drugs 0.000 description 3
- 238000003384 imaging method Methods 0.000 description 3
- 230000002163 immunogen Effects 0.000 description 3
- 230000001506 immunosuppresive effect Effects 0.000 description 3
- 238000002347 injection Methods 0.000 description 3
- 239000007924 injection Substances 0.000 description 3
- 238000007912 intraperitoneal administration Methods 0.000 description 3
- 201000010982 kidney cancer Diseases 0.000 description 3
- 206010023841 laryngeal neoplasm Diseases 0.000 description 3
- 201000004962 larynx cancer Diseases 0.000 description 3
- 239000003446 ligand Substances 0.000 description 3
- 208000012987 lip and oral cavity carcinoma Diseases 0.000 description 3
- 208000025848 malignant tumor of nasopharynx Diseases 0.000 description 3
- 239000011159 matrix material Substances 0.000 description 3
- GLVAUDGFNGKCSF-UHFFFAOYSA-N mercaptopurine Chemical compound S=C1NC=NC2=C1NC=N2 GLVAUDGFNGKCSF-UHFFFAOYSA-N 0.000 description 3
- 229960001428 mercaptopurine Drugs 0.000 description 3
- CFCUWKMKBJTWLW-BKHRDMLASA-N mithramycin Chemical compound O([C@@H]1C[C@@H](O[C@H](C)[C@H]1O)OC=1C=C2C=C3C[C@H]([C@@H](C(=O)C3=C(O)C2=C(O)C=1C)O[C@@H]1O[C@H](C)[C@@H](O)[C@H](O[C@@H]2O[C@H](C)[C@H](O)[C@H](O[C@@H]3O[C@H](C)[C@@H](O)[C@@](C)(O)C3)C2)C1)[C@H](OC)C(=O)[C@@H](O)[C@@H](C)O)[C@H]1C[C@@H](O)[C@H](O)[C@@H](C)O1 CFCUWKMKBJTWLW-BKHRDMLASA-N 0.000 description 3
- 230000004048 modification Effects 0.000 description 3
- 238000012986 modification Methods 0.000 description 3
- 201000011216 nasopharynx carcinoma Diseases 0.000 description 3
- 210000000653 nervous system Anatomy 0.000 description 3
- 108020004707 nucleic acids Proteins 0.000 description 3
- 102000039446 nucleic acids Human genes 0.000 description 3
- 238000002823 phage display Methods 0.000 description 3
- 201000008006 pharynx cancer Diseases 0.000 description 3
- 229960003171 plicamycin Drugs 0.000 description 3
- 229920001184 polypeptide Polymers 0.000 description 3
- 229920000136 polysorbate Polymers 0.000 description 3
- 239000000047 product Substances 0.000 description 3
- 230000035755 proliferation Effects 0.000 description 3
- 230000002829 reductive effect Effects 0.000 description 3
- 239000000523 sample Substances 0.000 description 3
- 230000007017 scission Effects 0.000 description 3
- 239000000243 solution Substances 0.000 description 3
- 230000009870 specific binding Effects 0.000 description 3
- 238000010561 standard procedure Methods 0.000 description 3
- 210000002784 stomach Anatomy 0.000 description 3
- 238000010897 surface acoustic wave method Methods 0.000 description 3
- 208000024891 symptom Diseases 0.000 description 3
- 201000003120 testicular cancer Diseases 0.000 description 3
- 238000002560 therapeutic procedure Methods 0.000 description 3
- 201000002510 thyroid cancer Diseases 0.000 description 3
- 201000009825 uterine corpus cancer Diseases 0.000 description 3
- 238000001262 western blot Methods 0.000 description 3
- FDKXTQMXEQVLRF-ZHACJKMWSA-N (E)-dacarbazine Chemical compound CN(C)\N=N\c1[nH]cnc1C(N)=O FDKXTQMXEQVLRF-ZHACJKMWSA-N 0.000 description 2
- HZAXFHJVJLSVMW-UHFFFAOYSA-N 2-Aminoethan-1-ol Chemical compound NCCO HZAXFHJVJLSVMW-UHFFFAOYSA-N 0.000 description 2
- FPQQSJJWHUJYPU-UHFFFAOYSA-N 3-(dimethylamino)propyliminomethylidene-ethylazanium;chloride Chemical compound Cl.CCN=C=NCCCN(C)C FPQQSJJWHUJYPU-UHFFFAOYSA-N 0.000 description 2
- 238000009010 Bradford assay Methods 0.000 description 2
- 101100279186 Caenorhabditis elegans efn-4 gene Proteins 0.000 description 2
- 241000282836 Camelus dromedarius Species 0.000 description 2
- 206010008342 Cervix carcinoma Diseases 0.000 description 2
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 2
- 238000002965 ELISA Methods 0.000 description 2
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 2
- HVLSXIKZNLPZJJ-TXZCQADKSA-N HA peptide Chemical compound C([C@@H](C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](C)C(O)=O)NC(=O)[C@H]1N(CCC1)C(=O)[C@@H](N)CC=1C=CC(O)=CC=1)C1=CC=C(O)C=C1 HVLSXIKZNLPZJJ-TXZCQADKSA-N 0.000 description 2
- 101710154606 Hemagglutinin Proteins 0.000 description 2
- 101000960969 Homo sapiens Interleukin-5 Proteins 0.000 description 2
- 101000950695 Homo sapiens Mitogen-activated protein kinase 8 Proteins 0.000 description 2
- 108060003951 Immunoglobulin Proteins 0.000 description 2
- 108010055717 JNK Mitogen-Activated Protein Kinases Proteins 0.000 description 2
- 102000019145 JUN kinase activity proteins Human genes 0.000 description 2
- 102100037808 Mitogen-activated protein kinase 8 Human genes 0.000 description 2
- 101710093908 Outer capsid protein VP4 Proteins 0.000 description 2
- 101710135467 Outer capsid protein sigma-1 Proteins 0.000 description 2
- 101710176177 Protein A56 Proteins 0.000 description 2
- 238000011529 RT qPCR Methods 0.000 description 2
- 229920002684 Sepharose Polymers 0.000 description 2
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 2
- 102000004887 Transforming Growth Factor beta Human genes 0.000 description 2
- 108090001012 Transforming Growth Factor beta Proteins 0.000 description 2
- 229940122803 Vinca alkaloid Drugs 0.000 description 2
- 230000009471 action Effects 0.000 description 2
- 230000003213 activating effect Effects 0.000 description 2
- 239000012491 analyte Substances 0.000 description 2
- 208000022531 anorexia Diseases 0.000 description 2
- 239000003242 anti bacterial agent Substances 0.000 description 2
- 230000001093 anti-cancer Effects 0.000 description 2
- 230000001028 anti-proliverative effect Effects 0.000 description 2
- 230000000259 anti-tumor effect Effects 0.000 description 2
- 229940088710 antibiotic agent Drugs 0.000 description 2
- 239000003972 antineoplastic antibiotic Substances 0.000 description 2
- 230000008901 benefit Effects 0.000 description 2
- 230000015572 biosynthetic process Effects 0.000 description 2
- 210000004899 c-terminal region Anatomy 0.000 description 2
- 230000006037 cell lysis Effects 0.000 description 2
- 201000010881 cervical cancer Diseases 0.000 description 2
- 229940044683 chemotherapy drug Drugs 0.000 description 2
- 238000010367 cloning Methods 0.000 description 2
- 230000009137 competitive binding Effects 0.000 description 2
- 238000002591 computed tomography Methods 0.000 description 2
- 206010061428 decreased appetite Diseases 0.000 description 2
- 230000003111 delayed effect Effects 0.000 description 2
- 238000001514 detection method Methods 0.000 description 2
- 230000009977 dual effect Effects 0.000 description 2
- 238000009472 formulation Methods 0.000 description 2
- 230000006870 function Effects 0.000 description 2
- 239000000185 hemagglutinin Substances 0.000 description 2
- 210000005260 human cell Anatomy 0.000 description 2
- 102000018358 immunoglobulin Human genes 0.000 description 2
- 238000000338 in vitro Methods 0.000 description 2
- 230000001965 increasing effect Effects 0.000 description 2
- 238000011081 inoculation Methods 0.000 description 2
- 150000002500 ions Chemical class 0.000 description 2
- 210000004698 lymphocyte Anatomy 0.000 description 2
- 238000004519 manufacturing process Methods 0.000 description 2
- 238000013507 mapping Methods 0.000 description 2
- 108010082117 matrigel Proteins 0.000 description 2
- 238000000691 measurement method Methods 0.000 description 2
- 230000002503 metabolic effect Effects 0.000 description 2
- 239000013642 negative control Substances 0.000 description 2
- 230000001151 other effect Effects 0.000 description 2
- 238000011533 pre-incubation Methods 0.000 description 2
- 239000002244 precipitate Substances 0.000 description 2
- 238000011002 quantification Methods 0.000 description 2
- 230000002441 reversible effect Effects 0.000 description 2
- 229960004641 rituximab Drugs 0.000 description 2
- 230000009919 sequestration Effects 0.000 description 2
- 210000002027 skeletal muscle Anatomy 0.000 description 2
- 241000894007 species Species 0.000 description 2
- 230000008961 swelling Effects 0.000 description 2
- ZRKFYGHZFMAOKI-QMGMOQQFSA-N tgfbeta Chemical compound C([C@H](NC(=O)[C@H](C(C)C)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CCSC)C(C)C)[C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O)C1=CC=C(O)C=C1 ZRKFYGHZFMAOKI-QMGMOQQFSA-N 0.000 description 2
- 230000032258 transport Effects 0.000 description 2
- 238000011269 treatment regimen Methods 0.000 description 2
- 239000013598 vector Substances 0.000 description 2
- 238000005406 washing Methods 0.000 description 2
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 2
- NFGXHKASABOEEW-UHFFFAOYSA-N 1-methylethyl 11-methoxy-3,7,11-trimethyl-2,4-dodecadienoate Chemical compound COC(C)(C)CCCC(C)CC=CC(C)=CC(=O)OC(C)C NFGXHKASABOEEW-UHFFFAOYSA-N 0.000 description 1
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 1
- WOVKYSAHUYNSMH-RRKCRQDMSA-N 5-bromodeoxyuridine Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(Br)=C1 WOVKYSAHUYNSMH-RRKCRQDMSA-N 0.000 description 1
- SLXKOJJOQWFEFD-UHFFFAOYSA-N 6-aminohexanoic acid Chemical class NCCCCCC(O)=O SLXKOJJOQWFEFD-UHFFFAOYSA-N 0.000 description 1
- 102000009027 Albumins Human genes 0.000 description 1
- 108010088751 Albumins Proteins 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- BSYNRYMUTXBXSQ-UHFFFAOYSA-N Aspirin Chemical compound CC(=O)OC1=CC=CC=C1C(O)=O BSYNRYMUTXBXSQ-UHFFFAOYSA-N 0.000 description 1
- 102100022717 Atypical chemokine receptor 1 Human genes 0.000 description 1
- 102100038078 CD276 antigen Human genes 0.000 description 1
- 108020004635 Complementary DNA Proteins 0.000 description 1
- 241000557626 Corvus corax Species 0.000 description 1
- 230000006820 DNA synthesis Effects 0.000 description 1
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 1
- 206010014733 Endometrial cancer Diseases 0.000 description 1
- 206010014759 Endometrial neoplasm Diseases 0.000 description 1
- 108010037362 Extracellular Matrix Proteins Proteins 0.000 description 1
- 102000010834 Extracellular Matrix Proteins Human genes 0.000 description 1
- 241000287828 Gallus gallus Species 0.000 description 1
- 239000007995 HEPES buffer Substances 0.000 description 1
- 101000678879 Homo sapiens Atypical chemokine receptor 1 Proteins 0.000 description 1
- 101000884279 Homo sapiens CD276 antigen Proteins 0.000 description 1
- 101000581981 Homo sapiens Neural cell adhesion molecule 1 Proteins 0.000 description 1
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 1
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 1
- 108010054738 Immunologic Receptors Proteins 0.000 description 1
- 102000001749 Immunologic Receptors Human genes 0.000 description 1
- 238000000134 MTT assay Methods 0.000 description 1
- 108010052285 Membrane Proteins Proteins 0.000 description 1
- 102000018697 Membrane Proteins Human genes 0.000 description 1
- 206010027476 Metastases Diseases 0.000 description 1
- 241000699660 Mus musculus Species 0.000 description 1
- 101000893547 Mus musculus Growth/differentiation factor 15 Proteins 0.000 description 1
- 101710135898 Myc proto-oncogene protein Proteins 0.000 description 1
- 102100038895 Myc proto-oncogene protein Human genes 0.000 description 1
- 102000000812 NK Cell Lectin-Like Receptor Subfamily K Human genes 0.000 description 1
- 108010001657 NK Cell Lectin-Like Receptor Subfamily K Proteins 0.000 description 1
- 102100027347 Neural cell adhesion molecule 1 Human genes 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 241000276498 Pollachius virens Species 0.000 description 1
- 102000001253 Protein Kinase Human genes 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 108020004511 Recombinant DNA Proteins 0.000 description 1
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 1
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 1
- PLXBWHJQWKZRKG-UHFFFAOYSA-N Resazurin Chemical compound C1=CC(=O)C=C2OC3=CC(O)=CC=C3[N+]([O-])=C21 PLXBWHJQWKZRKG-UHFFFAOYSA-N 0.000 description 1
- 108091027967 Small hairpin RNA Proteins 0.000 description 1
- VMHLLURERBWHNL-UHFFFAOYSA-M Sodium acetate Chemical compound [Na+].CC([O-])=O VMHLLURERBWHNL-UHFFFAOYSA-M 0.000 description 1
- 238000000692 Student's t-test Methods 0.000 description 1
- QAOWNCQODCNURD-UHFFFAOYSA-N Sulfuric acid Chemical compound OS(O)(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-N 0.000 description 1
- 108091008874 T cell receptors Proteins 0.000 description 1
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 1
- IQFYYKKMVGJFEH-XLPZGREQSA-N Thymidine Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](CO)[C@@H](O)C1 IQFYYKKMVGJFEH-XLPZGREQSA-N 0.000 description 1
- 101710150448 Transcriptional regulator Myc Proteins 0.000 description 1
- 208000003721 Triple Negative Breast Neoplasms Diseases 0.000 description 1
- 239000007983 Tris buffer Substances 0.000 description 1
- 102000005789 Vascular Endothelial Growth Factors Human genes 0.000 description 1
- 108010019530 Vascular Endothelial Growth Factors Proteins 0.000 description 1
- 241000700605 Viruses Species 0.000 description 1
- 230000035508 accumulation Effects 0.000 description 1
- 238000009825 accumulation Methods 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 230000002730 additional effect Effects 0.000 description 1
- 210000000577 adipose tissue Anatomy 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 230000009824 affinity maturation Effects 0.000 description 1
- 150000001412 amines Chemical class 0.000 description 1
- 238000005571 anion exchange chromatography Methods 0.000 description 1
- 230000003042 antagnostic effect Effects 0.000 description 1
- 229940041181 antineoplastic drug Drugs 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 208000027697 autoimmune lymphoproliferative syndrome due to CTLA4 haploinsuffiency Diseases 0.000 description 1
- 238000002869 basic local alignment search tool Methods 0.000 description 1
- 239000011230 binding agent Substances 0.000 description 1
- 239000000090 biomarker Substances 0.000 description 1
- 230000017531 blood circulation Effects 0.000 description 1
- 230000001612 cachectic effect Effects 0.000 description 1
- 230000009702 cancer cell proliferation Effects 0.000 description 1
- 230000005773 cancer-related death Effects 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 238000005277 cation exchange chromatography Methods 0.000 description 1
- 230000032823 cell division Effects 0.000 description 1
- 239000002771 cell marker Substances 0.000 description 1
- 230000004663 cell proliferation Effects 0.000 description 1
- 230000006041 cell recruitment Effects 0.000 description 1
- 239000006285 cell suspension Substances 0.000 description 1
- 108091092356 cellular DNA Proteins 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- 239000003795 chemical substances by application Substances 0.000 description 1
- 238000002512 chemotherapy Methods 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 239000013599 cloning vector Substances 0.000 description 1
- 239000011248 coating agent Substances 0.000 description 1
- 238000000576 coating method Methods 0.000 description 1
- 208000029742 colonic neoplasm Diseases 0.000 description 1
- 238000007398 colorimetric assay Methods 0.000 description 1
- 238000010835 comparative analysis Methods 0.000 description 1
- 230000000295 complement effect Effects 0.000 description 1
- 239000002299 complementary DNA Substances 0.000 description 1
- 230000001010 compromised effect Effects 0.000 description 1
- 238000011109 contamination Methods 0.000 description 1
- NKLPQNGYXWVELD-UHFFFAOYSA-M coomassie brilliant blue Chemical compound [Na+].C1=CC(OCC)=CC=C1NC1=CC=C(C(=C2C=CC(C=C2)=[N+](CC)CC=2C=C(C=CC=2)S([O-])(=O)=O)C=2C=CC(=CC=2)N(CC)CC=2C=C(C=CC=2)S([O-])(=O)=O)C=C1 NKLPQNGYXWVELD-UHFFFAOYSA-M 0.000 description 1
- 239000012228 culture supernatant Substances 0.000 description 1
- 208000035250 cutaneous malignant susceptibility to 1 melanoma Diseases 0.000 description 1
- 239000000824 cytostatic agent Substances 0.000 description 1
- 231100000135 cytotoxicity Toxicity 0.000 description 1
- 230000003013 cytotoxicity Effects 0.000 description 1
- 229960003901 dacarbazine Drugs 0.000 description 1
- 238000012350 deep sequencing Methods 0.000 description 1
- 230000003412 degenerative effect Effects 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- 201000010099 disease Diseases 0.000 description 1
- 239000012636 effector Substances 0.000 description 1
- 238000010828 elution Methods 0.000 description 1
- 239000002158 endotoxin Substances 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 230000000925 erythroid effect Effects 0.000 description 1
- 210000002744 extracellular matrix Anatomy 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 1
- 238000013467 fragmentation Methods 0.000 description 1
- 238000006062 fragmentation reaction Methods 0.000 description 1
- 230000004927 fusion Effects 0.000 description 1
- 238000001502 gel electrophoresis Methods 0.000 description 1
- PCHJSUWPFVWCPO-UHFFFAOYSA-N gold Chemical compound [Au] PCHJSUWPFVWCPO-UHFFFAOYSA-N 0.000 description 1
- 239000010931 gold Substances 0.000 description 1
- 229910052737 gold Inorganic materials 0.000 description 1
- 239000003102 growth factor Substances 0.000 description 1
- 239000003966 growth inhibitor Substances 0.000 description 1
- 229940022353 herceptin Drugs 0.000 description 1
- 230000001900 immune effect Effects 0.000 description 1
- 238000003365 immunocytochemistry Methods 0.000 description 1
- 238000003364 immunohistochemistry Methods 0.000 description 1
- 230000020287 immunological synapse formation Effects 0.000 description 1
- 230000001771 impaired effect Effects 0.000 description 1
- 230000001976 improved effect Effects 0.000 description 1
- 238000007901 in situ hybridization Methods 0.000 description 1
- 238000010348 incorporation Methods 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 230000008595 infiltration Effects 0.000 description 1
- 238000001764 infiltration Methods 0.000 description 1
- 230000003834 intracellular effect Effects 0.000 description 1
- 238000011813 knockout mouse model Methods 0.000 description 1
- 238000001325 log-rank test Methods 0.000 description 1
- 238000002595 magnetic resonance imaging Methods 0.000 description 1
- 230000003211 malignant effect Effects 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 238000002493 microarray Methods 0.000 description 1
- 238000000386 microscopy Methods 0.000 description 1
- 230000002438 mitochondrial effect Effects 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- 239000000178 monomer Substances 0.000 description 1
- 210000003205 muscle Anatomy 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- 230000003472 neutralizing effect Effects 0.000 description 1
- 230000009871 nonspecific binding Effects 0.000 description 1
- 238000011580 nude mouse model Methods 0.000 description 1
- 230000035764 nutrition Effects 0.000 description 1
- 235000016709 nutrition Nutrition 0.000 description 1
- 230000003287 optical effect Effects 0.000 description 1
- 230000001575 pathological effect Effects 0.000 description 1
- 239000013610 patient sample Substances 0.000 description 1
- 230000010412 perfusion Effects 0.000 description 1
- 150000002978 peroxides Chemical class 0.000 description 1
- 239000000546 pharmaceutical excipient Substances 0.000 description 1
- 239000000825 pharmaceutical preparation Substances 0.000 description 1
- 229940127557 pharmaceutical product Drugs 0.000 description 1
- 230000004962 physiological condition Effects 0.000 description 1
- 210000002826 placenta Anatomy 0.000 description 1
- 238000010837 poor prognosis Methods 0.000 description 1
- 239000013641 positive control Substances 0.000 description 1
- 230000035935 pregnancy Effects 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 238000004393 prognosis Methods 0.000 description 1
- 238000011321 prophylaxis Methods 0.000 description 1
- 201000001514 prostate carcinoma Diseases 0.000 description 1
- 238000002731 protein assay Methods 0.000 description 1
- 108060006633 protein kinase Proteins 0.000 description 1
- 230000006337 proteolytic cleavage Effects 0.000 description 1
- 230000005180 public health Effects 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 230000002285 radioactive effect Effects 0.000 description 1
- 238000001959 radiotherapy Methods 0.000 description 1
- 230000008707 rearrangement Effects 0.000 description 1
- 230000008929 regeneration Effects 0.000 description 1
- 238000011069 regeneration method Methods 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 102220028358 rs386352325 Human genes 0.000 description 1
- 239000012146 running buffer Substances 0.000 description 1
- 208000001076 sarcopenia Diseases 0.000 description 1
- 230000009291 secondary effect Effects 0.000 description 1
- 230000028327 secretion Effects 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 238000002864 sequence alignment Methods 0.000 description 1
- 238000013207 serial dilution Methods 0.000 description 1
- 239000004055 small Interfering RNA Substances 0.000 description 1
- 235000017281 sodium acetate Nutrition 0.000 description 1
- 239000001632 sodium acetate Substances 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- RPENMORRBUTCPR-UHFFFAOYSA-M sodium;1-hydroxy-2,5-dioxopyrrolidine-3-sulfonate Chemical compound [Na+].ON1C(=O)CC(S([O-])(=O)=O)C1=O RPENMORRBUTCPR-UHFFFAOYSA-M 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 230000000087 stabilizing effect Effects 0.000 description 1
- 238000012289 standard assay Methods 0.000 description 1
- 230000004936 stimulating effect Effects 0.000 description 1
- 239000012089 stop solution Substances 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- 235000011149 sulphuric acid Nutrition 0.000 description 1
- 239000006228 supernatant Substances 0.000 description 1
- 238000001356 surgical procedure Methods 0.000 description 1
- 238000004885 tandem mass spectrometry Methods 0.000 description 1
- 230000008685 targeting Effects 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 231100000167 toxic agent Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- 239000003440 toxic substance Substances 0.000 description 1
- 206010044412 transitional cell carcinoma Diseases 0.000 description 1
- 230000001960 triggered effect Effects 0.000 description 1
- 208000022679 triple-negative breast carcinoma Diseases 0.000 description 1
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 1
- 230000005740 tumor formation Effects 0.000 description 1
- 239000000439 tumor marker Substances 0.000 description 1
- 238000000108 ultra-filtration Methods 0.000 description 1
- 230000003827 upregulation Effects 0.000 description 1
- 210000004291 uterus Anatomy 0.000 description 1
- 230000003612 virological effect Effects 0.000 description 1
- 230000000007 visual effect Effects 0.000 description 1
- 239000011534 wash buffer Substances 0.000 description 1
- 238000005303 weighing Methods 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/22—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against growth factors ; against growth regulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/3955—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/94—Stability, e.g. half-life, pH, temperature or enzyme-resistance
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/10—Cells modified by introduction of foreign genetic material
Definitions
- GDF-15 Monoclonal Antibodies to Growth and Differentiation Factor 15
- the present invention relates to monoclonal anti-human-GDF- 15 antibodies, pharmaceutical compositions, kits, methods and uses and the cell lines capable of producing the monoclonal antibodies described herein.
- the present invention further relates to antibodies to human GDF-15 capable of inhibiting cancer growth, treating cancer- induced weight loss and cancer cachexia .
- cancer cachexia a medical condition triggered by the cancer that typically involves weight loss and loss of skeletal muscle mass .
- Cancer cachexia accounts for more than 20 percent of all cancer-related deaths (Murphy KT and Lynch GS : Update on emerging drugs for cancer cachexia . Expert Opin Emerg Drugs . 2009 Dec ; 14 (4) : 619- 32. ) .
- growth factors including factors such as VEGF, PDGF, TGF- ⁇ and GDF-15.
- GDF-15 growth and differentiation factor-15
- TGF- ⁇ superfamil is a protein which is intracellularly expressed as a precursor, subsequently processed and eventually becomes secreted from the cell into the environment .
- Both the active, fully processed (mature) form and the precursor of GDF-15 can be found outside cells.
- the precursor covalently binds via its C00H- terminal amino acid sequence to the extracellular matrix (Bauskin AR et al . , Cancer Research 2005 ) and thus resides on the exterior of a cell .
- the active , fully processed (mature) form of GDF-15 is soluble and is found in blood sera .
- the processed form of GDF-15 may potentially act on any target cell within the body that is connected to the blood circulation, provided that the potential target cell expresses a receptor for the soluble GDF-15 ligand.
- GDF-15 is found under physiological conditions in the placenta .
- malignant cancers especially aggressive brain cancers , melanoma, lung cancer, gastrointestinal tumors , colon cancer, pancreatic cancer, prostate cancer and breast cancer (Mimeault M and Batra SK, J. Cell Physiol 2010 )
- GDF-15 levels exhibit increased GDF-15 levels in the tumor as well as i blood serum.
- correlations have been described between high GDF-15 expression and chemoresistance (Huang CY et al . , Clin. Cancer Res . 2009) and between high GDF- 15 expression and poor prognosis , respectively (Brown DA et al . , Clin. Cancer Res . 2009).
- GDF-15 is expressed in gliomas of different WHO grades as assessed by immunohistochemistry (Roth et al . , Clin. Cancer Res . 2010) . Further, Roth et al . stably expressed short hairpin RNA-expressing DNA constructs targeting endogenous GDF-15 or control constructs in SMA560 glioma cells . When using these pre-established stable cell lines , they observed that tumor formation in mice bearing GDF- 15 knockdown SMA560 cells was delayed compared to mice bearing control constructs .
- Patent application PCT/EP2013/070127 relates to monoclonal anti-GDF- 15 antibodies , in particular to an antibody produced by the hybridoma cell line Bl-23 deposited with the Deutsche Sammlung fiir Mikroorganismen und Zellkulturen GmbH (DSMZ) under the accession No. DSM ACC3142 under the Budapest treaty.
- PCT/EP2013/070127 also relates to uses of the anti- GDF-15 antibodies .
- Patent applications WO 2005/099746 and WO 2009/021293 relate to an anti-human-GDF- 15 antibody (Mab26) capable of antagonizing effects of human GDF-15 on tumor- induced weight loss in vivo in mice :
- immunologically compromised mice were administered with human tumor cells ⁇ prostate carcinoma cells DU145 ) transfected with plasmids overexpressing human GDF-15.
- Tumor cells carrying plasmids lacking a GDF-15 sequence served as a negative control .
- Those mice expressing xenograft GDF-15 exhibited a tumor- induced weight loss (clinical term : cachexia) and anorexia .
- a monoclonal antibody to human GDF- 15 can be used to treat cancer cachexia and to also treat cancer of human xenograft tumors in mice.
- an antibody to human GDF- 15 in accordance with the present invention has an equilibrium dissociation constant of about 790 pM for recombinant GDF- 15 even without additional affinity maturation, which is a higher affinity compared to most known therapeutic antibodies.
- the antibody to human GDF- 15 according to the present invention has superior properties compared to antibodies known from the art , and is particularly useful for inhibiting cancer growth and cancer cachexia .
- the antibody of the present invention is therefore useful for treating cancer and for treating cancer cachexia. Accordingly, the present invention was completed.
- the present invention solves the above-mentioned objects by providing the monoclonal antibodies , pharmaceutical compositions, kits, uses and the cell lines capable of producing the monoclonal antibodies described herein.
- the present inventors surprisingly show that monoclonal antibodies to human GDF-15 and antigen binding portions thereof according to the invention are capable of inhibiting cancer cachexia and/o cancer growth. This was unexpected because those monoclonal antibodies to GDF-15 that were previously known from the art (WO 2005/099746, WO 2009/021293 and Johnen H et al . , Nature Medicine, 2007) were only known to cause a reversal of cancer- induced weight loss (i.e. a reversal of a secondary symptom induced by the GDF-15 expressed by the cancer) , but were shown to fail at inhibiting growth of the cancer .
- the present inventors also surprisingly show that human GDF- 15 protein can be targeted by the antibodies of the invention in a way that both cancer growth is inhibited and cancer- induced weight loss and cancer cachexia is treated . It is expected that the same mechanisms of cancer growth inhibition and treatment of cancer- induced weight loss and cancer cachexia are applicable to a large number of cancers that overexpress human GDF-15 including the cancers listed below.
- the monoclonal antibodies and antigen-binding portions thereof according to the invention are derived from a murine anti-GDF-15 antibody, mAb-Bl-23 , which was described in PCT/EP2013/070127 and deposited with the Deutsche Sammlung fur Mikroorganismen und Zellkulturen GmbH (DSMZ) under the accession No. DSM ACC3142 under the Budapest treaty.
- the anti-human GDF-15 mAb-Bl-23 antibodies according to the invention can be generated by replacing constant domains of the murine antibody mAb-Bl-23 with the constant domains of a human IgGl antibody .
- the present invention relates to a monoclonal antibody capable of binding to human GDF-15 , or an antigen-binding portion thereof , wherein the heavy chain variable domain comprises a CDR3 region comprising the amino acid sequence of SEQ ID NO: 5 or an amino acid sequence at least 90% identical thereto , and wherein the light chain variable domain comprises a CDR3 region comprising the amino acid sequence of SEQ ID NO: 7 or an amino acid sequence at least 85% identical thereto wherein the constant domain of the heavy chain comprises the amino acid sequence of SEQ ID No : 29, or an amino acid sequence at least 85%, preferably at least 90%, more preferably at least 95% identical thereto, and wherein the constant domain of the light chain comprises the amino acid sequence of SEQ ID No : 32 , or an amino acid sequence at least 85% , preferably at least 90% , more preferably at least 95% identical thereto .
- the present invention also relates to a monoclonal antibody capable of binding to human GDF-15 , or an antigen-binding portion thereof , wherein the heavy chain variable domain comprises a CDR3 region comprising the amino acid sequence of SEQ ID NO: 5 or an amino acid sequence at least 90% identical thereto, and wherein the light chain variable domain comprises a CDR3 region comprising the amino acid sequence of
- SEQ ID NO: 7 or an amino acid sequence at least 85% identical thereto, for use in a method for treating cancer cachexia in a mammal.
- the method comprises administering the antibody or antigen-binding portion thereof to said mammal. Additionally, the present invention relates to a corresponding method for treatment .
- the invention also relates to a monoclonal antibody capable of binding to human GDF-15 , or an antigen-binding portion thereof , wherein the binding is binding to a conformational or discontinuous epitope on human GDF-15 comprised by the amino acid sequences of SEQ ID No: 25 and SEQ ID No: 26 , wherein the constant domain of the heavy chain comprises the ami o acid sequence of SEQ ID No: 29 , or an amino acid sequence at least 85%, preferably at least 90%, more pre erably at least 95% identical thereto, and wherein the constant domain of the light chain comprises the amino acid sequence of SEQ ID No: 32 , or an amino acid sequence at least 85%, preferably at least 90% , more preferably at least 95% identical thereto .
- the invention also relates to a monoclonal antibody capable of binding to human GDF-15 , or an antigen-binding portion thereof , wherein the binding is binding to a conformational or discontinuous epitope on human GDF-15 comprised by the amino acid sequences of SEQ ID No; 25 and SEQ ID No: 26, for use in a method for treating cancer cachexia in a mammal .
- the method comprises administering the antibody or antigen-binding portion thereof to said mammal .
- the present invention relates to a corresponding method for treatment .
- the invention also relates to a pharmaceutical composition comprising the antibody or antigen-binding portion thereof according to the invention .
- the invention also relates to an antibody or antigen-binding portion thereof according to the invention for use in medicine .
- the invention relates to an antibody or antigen- binding portion thereof or a pharmaceutical composition according to the invention for use in a method for treating cancer in a mammal .
- the method comprises administering the antibody or antigen-binding portion thereof or the pharmaceutical composition to said mammal.
- the invention relates to an antibody or antigen- binding portion thereof or a pharmaceutical composition according to the invention for use in a method for treating cancer cachexia in a mammal .
- the method comprises administering the antibody or antigen-binding portion thereof or the pharmaceutical composition to said mammal .
- the invention relates to a kit comprising the pharmaceutical composition according to the invention.
- the invention also relates to an expression vector comprising a nucleotide sequence encoding the antibody or antigen- binding portio thereof according to the invention .
- the invention relates to a ceil line capable of producing an antibody or antigen-binding portion thereof according to the invention.
- the present invention provides means for the treatment of cancer cachexia and a cancer growth inhibitor that meets the above- defined needs in the art .
- Figure 1 NKG2D Expression on NK Cells after Treatment with or without GDF-15.
- the ceil surface expression of NKG2D was determined on NK cells after treatment with the indicated cytokines in the presence or absence of the anti-GDF- 15 antibody mAb Bl-23.
- the figure displays specific fluorescence intensities determined by flow cytometry, quantified relative to an unspecific control antibody.
- FIG. 2 Akt Phosphorylation in the Ovarian Carcinoma Cell Line SK-OV-3.
- the ratio of phosphorylated Akt to the total amount of Akt was calculated and normalized to the untreated control.
- FIG. 3 JNK1/2 Phosphorylation in Immune Cells.
- the ratio of phosphorylated JNKl/2 to the total amount of JNK was calculated and normalized to the untreated control .
- FIG. 5 Treatment of cancer cachexia with anti-GDF- 15 antibodies .
- the figure shows a comparison of the mean body weight of all treated Balb/c nu / nu nude mice, which were inoculated with UACC-257 cells .
- the changes of the body weight are depicted in percent as compared to the starting body weight on day 0, for a period of 38 days .
- Figure 6 Coomassie stain of antibodies used in the study No.
- antibody refers to any functional antibody that is capable of specific binding to the antigen of interest, as generally outlined in chapter 7 of Paul , W.E. (Ed,).: Fundamental Immunology 2nd Ed. Raven Press , Ltd. , New York 1989 , which is incorporated herein by reference .
- the term “antibody” encompasses antibodies from any appropriate source species , including chicken and mammalian such as mouse , goat , non-human primate and human .
- the antibody is a humanized antibody.
- the antibody is preferably a monoclonal antibody which can be prepared by methods well-known in the art .
- antibody encompasses an IgG-1, -2 , -3 , or -4, IgE, IgA, IgM, or IgD isotype antibody.
- antibody encompasses monomeric antibodies (such as IgD, IgE, IgG) or oligomeric antibodies (such as IgA or IgM) .
- antibody also encompasses - without particular limitations - isolated antibodies and modified antibodies such as genetically engineered antibodies , e.g. chimeric antibodies .
- each monomer of an antibody comprises two heavy chains and two light chains , as generally known in the art .
- each heavy and light chain comprises a variable domain ( termed V3 ⁇ 4 for the heavy chain and V L for the light chain) which is important for antigen binding .
- V3 ⁇ 4 for the heavy chain and V L for the light chain
- These heavy and light chain variable domains comprise (in an N-terminal to C-terminal order) the regions FR1 , CDR1 , FR2 , CDR2 , FR3 , CDR3 , and FR4 (FR, framework region; CDR, complementarity determining region which is also known as hypervariable region) .
- the identification and assignment of the above-mentioned antibody regions within the antibody sequence is generally in accordance with Kabat et al . (Sequences of proteins of immunological interest , U.S. Dept . of Health and Human Services , Public Health Service , National Institutes of Health, Bethesda, Md. 1983) , or Chothia et al . ( Conformations of immunoglobulin hypervariable regions . Nature . 1989 Dec 21-28 ; 342 ( 6252 ): 877- 83.) , or may be performed by using the IMGT/V-QUEST software described in Giudicelli et al .
- IMGT/V-QUEST an integrated software program for immunoglobulin and T cell receptor V-J and V-D-J rearrangement analysis . Nucleic Acids Res . 2004 Jul 1 ; 32 (Web Server issue) : W435 -40. ) , which is incorporated herein by reference .
- the antibody regions indicated above are identified and assigned by using the IMGT/V-QUEST software .
- a “monoclonal antibody” is an antibody from an essentially homogenous population of antibodies , wherein the antibodies are substantially identical in sequence (i.e. identical except for minor fraction of antibodies containing naturally occurring sequence modifications such as amino acid modifications at their N- and C-termini) . Unlike polyclonal antibodies which contain a mixture of different antibodies directed to numerous epitopes , monoclonal antibodies are directed to the same epitope and are therefore highly specific .
- the term "monoclonal antibody” includes (but is not limited to) antibodies which are obtained from a monoclonal cell population derived from a single cell clone , as for instance the antibodies generated by the hybridoma method described in Kohler and Milstein (Nature, 1975 Aug 7;256 (5517) :495-7) or Harlow and Lane ("Antibodies : A Laboratory Manual” Cold Spring Harbor Laboratory Press, Cold Spring Harbor , New York 1988) .
- a monoclonal antibody may also be obtained from other suitable methods, including phage display techniques such as those described in Clackson et al . (Nature . 1991 Aug 15 ; 352 (6336) : 624-8) or Marks et al . (J Mol Biol .
- a monoclonal antibody may be an antibody that has been optimized for antigen-binding properties such as decreased Kd values, optimized association and dissociation kinetics by methods known in the art . For instance, Kd values may be optimized by display methods including phage display, resulting in affinity-matured monoclonal antibodies .
- the term "monoclonal antibody” is not limited to antibody sequences from particular species of origin or from one single species of origin. Thus , the meaning of the term “monoclonal antibody” encompasses chimeric monoclonal antibodies such as humanized monoclonal antibodies .
- Humanized antibodies are antibodies which contain human sequences and a minor portion of non-human sequences which confer binding specificity to an antigen of interest (e.g. human GDF-15) .
- humanized antibodies are generated by replacing hypervariable region sequences from a human acceptor antibody by hypervariable region sequences from a non-human donor antibody (e.g. a mouse , rabbit , rat donor antibody) that binds to an antigen of interest (e.g. human GDF-15) .
- f amework region sequences of the acceptor antibody may also be replaced by the corresponding sequences of the donor antibody.
- a "humanized antibody” may either contain other (additional or substitute) residues or sequences or not . Such other residues or sequences may serve to further improve antibody properties such as binding properties (e.g. to decrease Kd values) and/or immunogenic properties (e.g. to decrease antigenicity in humans ) .
- Non- limiting exam les for methods to generate humanized antibodies are known in the art , e.g. from Riechmann et al . (Nature. 1988 Mar 24 ; 332 ( 6162) : 323 - 7 ) or Jones et al. (Nature. 1986 May 29-Jun 4;321 (6069) : 522-5) .
- human antibody relates to an antibody containing human variable and constant domain sequences. This definition encompasses antibodies having human sequences bearing single ami o acid substitutions or modifications which may serve to further improve antibody properties such as binding properties (e.g. to decrease Kd values) and/or immunogenic properties (e.g. to decrease antigenicity in humans ) .
- human antibody excludes humanized antibodies where a portion of non-human sequences confers binding specificity to an antigen of interest .
- an “antigen-binding portion” of an antibody as used herein refers to a portion of an antibody that retains the capability of the antibody to specifically bind to the antigen (e.g. GDF- 15 ) , i.e. the "antigen-binding portion” is capable of competing with the antibody for specific binding to the antigen .
- the "antigen-binding portion” may contain one or more fragments of the antibody. Without part icular limitation, it can be produced by any suitable method known in the art , including recombinant DNA methods and preparation by chemical or enzymatic fragmentation of antibodies .
- Antigen-b: nding portions may be Fab fragments , F(ab') fragments, F (ab' ) 2 fragments , single chain antibodies (scFv) , single-domain antibodies , diabodies or any other portion (s) of the antibody that allow (s) to retain binding to the antigen.
- an “antibody” e.g. a monoclonal antibody
- an “antigen- binding portion” may have been derivatized or be linked to a different molecule .
- molecules that may be linked to the antibody are other proteins (e.g. other antibodies) , a molecular label (e.g. a fluorescent , luminescent , colored or radioactive molecule) , a pharmaceutical and/or a toxic agent .
- the antibody or antigen-binding portion may be linked directly (e.g. in form of a fusion between two proteins) , or via a linker molecule (e.g. any suitable type of chemical linker known in the art) .
- the terms "binding" or “bind” refer to specific binding to the antigen of interest (e.g. human GDF- 15) .
- the Kd value is less than 100 nM, more preferably less than 50 nM, still more preferably less than 10 nM, still more preferably less than 5 nM and most preferably less than 2 nM.
- epitope refers to a small portion of an antigen that forms the binding site for an antibody.
- binding or competitive binding of antibodies or their antigen-binding portions to the antigen of interest is measured by using surface plasmon resonance measurements as a reference standard assay, as described below.
- the terms or "3 ⁇ 4 value" relate to the equilibrium dissociation constant as known in the art .
- these terms relate to the equilibrium dissociation constant of an antibody with respect to a particular antigen of interest (e.g. human GDF-15) .
- the equilibrium dissociation constant is a measure of the propensity of a complex (e.g. an antigen- ntibody complex) to reversibly dissociate into its components (e.g. the antigen and the antibody) .
- Kjy values (such as those for the antigen human GDF-15) are generally determined by using surface plasmon resonance measurements as described below.
- cancer growth as used herein relates to any measureable growth of the cancer .
- cancer growth relates to a measurable increase in tumor volume over time . If the cancer has formed only a single tumor, “cancer growth” relates only to the increase in volume of the single tumor. If the cancer has formed multiple tumors such as metastases, “cancer growth” relates to the increase in volume of all measurable tumors .
- the tumor volume can be measured by any method known in the art, including magnetic resonance imaging and computed tomography (CT scan) .
- CT scan computed tomography
- cancer growth relates to a measurable increase in the number of cancer cells per blood volume.
- cancer cells can be identified from blood samples by using any method known in the art, including cell morphology measurements, or staining of tumor cell marker proteins such as tumor marker cell surface proteins, e.g. by staining with specific antibodies, and the cancer cells can be counted .
- inhibiting cancer growth refers to a measurable inhibition of cancer growth in patient treated with the antibody.
- the inhibition is statistically significant .
- Inhibition of cancer growth may be assessed by comparing cancer growth in a group of patients treated in accordance with the present invention to a control group of untreated patients , or by comparing a group of patients that receive a standard cancer treatment of the art plus a treatment according to the invention with a control group of patients that only receive a standard cancer treatment of the art .
- Such studies for assessing the inhibition of cancer growth are designed in accordance with accepted standards for clinical studies , e.g. double-blinded, randomized studies with sufficient statistical power .
- inhibiting cancer growth includes an inhibition of cancer growth where the cancer growth is inhibited partially (i.e. where the cancer growth in the patient is delayed compared to the control group of patients) , an inhibition where the cancer growth is inhibited completely (i.e. where the cancer growth in the patient is stopped) , and an inhibition where cancer growth is reversed (i.e. the cancer shrinks) .
- an "isolated antibody” as used herein is an antibody that has been identified and separated from the majority of components (by weight) of its source environment , e.g. from the components of a hybridoma cell culture or a different cell culture that was used for its production (e.g. producer cells such as CHO cells that recombinantly express the antibody) .
- the separation is performed such that it sufficiently removes components that may otherwise interfere with the suitability of the antibody for the desired applications (e.g. with a therapeutic use of the anti-human GDF- 15 antibody according to the invention) .
- Methods for preparing isolated antibodies are known in the art and include Protein A chromatography, anion exchange chromatography, cation exchange chromatography, virus retentive filtration and ultrafiltration.
- the isolated antibody preparation is at least 70 % pure (w/w) , more preferably at least 80 % pure (w/w) , still more preferably at least 90 % pure (w/w) , still more preferably at least 95 % pure (w/w) , and most preferably at least 99 % pure (w/w) , as measured by using the Lowry protein assay .
- a “diabody” as used herein is a small bivalent antigen- binding antibody portion which comprises a heavy chain variable domain linked to a light chain variable domain on the same polypeptide chain linked by a peptide linker that is too short to allow pairing between the two domains on the same chain. This results in pairing with the complementary domains of another chain and in the assembly of a dimeric molecule with two antigen binding sites .
- Diabodies may be bivalent and monospecific (such as diabodies with two antigen binding sites for human GDF- 15) , or may be bivalent and bispecific (e.g. diabodies with two antigen binding sites , one being a binding site for human GDF-15, and the other one being a binding site for a different antigen) . A detailed description of diabodies can be found in Holliger P et al .
- a “single-domain antibody” (which is also referred to as “NanobodyTM”) as used herein is an antibody fragment consisting of a single monomeric variable antibody domain. Structures of and methods for producing single-domain antibodies are known from the art, e.g. from Holt LJ et al .
- a value e.g. a GDF-15 level
- a value in a patient sample is higher than a value in a corresponding control sample or group of control samples.
- the difference is statistically significant.
- elevated GDF-15 levels means that the human patient has higher GDF-15 levels in blood serum before administration of the antibody or antigen-binding portion thereof or the pharmaceutical composition according to the invention, when compared to median GDF-15 levels in blood sera of healthy human control individuals as a
- a preferred median reference for GDF-15 level in blood sera of healthy human control individuals is ⁇ 0.8 ng/ml .
- the expected range is between 0.2 ng/ml and 1.2 ng/ml in healthy human controls (Reference: Tanno T et al . : “Growth differentiation factor 15 in erythroid health and disease.” Curr Opin Hematol . 2010 May; 17(3): 184-190.).
- the levels are 1.2 -fold higher, more preferably 1.5- fold higher, still more preferably 2-fold higher and most preferably 5 -fold higher.
- prior to administration means the period of time immediately before administration of the antibody, fragment thereof or the pharmaceutical composition according to the invention .
- the term “prior to administration” means a period of 30 days immediately before administration; most preferably a period of one week immediately before administration.
- cancer and “cancer cell” is used herein in accordance with their common meaning in the art (see for instance Weinberg R . et al.: The Biology of Cancer . Garland Science : New York 2006. 850p. ) .
- cancer-induced weight loss is used herein in accordance with its common meaning in the art . Cancer- induced weight loss is frequently seen as an adverse effect in individuals having cancer (see , for instance Fearon K. et al . : Definition and classification of cancer cachexia: an international consensus . Lancet Oncol . 2011 May; 12(5) : 489- 95. ; Tisdale MJ. : Mechanisms of cancer cachexia. Physiol Rev. 2009 Apr; 89(2) :381-410.) .
- the term "cancer-induced weight loss” relates to the body weight loss induced by the cancer . Additional body weight loss in addition to the cancer-induced weight loss - e.g.
- body weight loss induced by cancer treatments can also occur i individuals having cancer .
- cancer-induced weight loss does not include this additional body weight loss.
- the antibodies of the present invention - in addition to their effects on cancer- induced weight loss and on cancer growth - may have beneficial effects against such additional body weight loss , e.g. by reverting or partly reverting such additional weight loss, or by preventing or partly preventing such additional body weight loss .
- Body weight can easily be measured by weighing, and body weight is typically expressed in units of mass such as kg.
- cancer cachexia is used herein in accordance with its common meaning in the art ( see , for instance Fearon K . et al . : Definition and classification of cancer cachexia : an international consensus . Lancet Oncol . 2011 May; 12(5) : 489 - 95.; Tisdale MJ . : Mechanisms of cancer cachexia . Physiol Rev . 2009 Apr ; 89 (2) : 381-410.) .
- the most common symptom of cancer cachexia is cancer- induced weight loss .
- cancer cachexia is characterized by an ongoing loss of skeletal muscle mass (with or without loss of fat mass ) that cannot be fully reversed by conventional nutrition .
- cancer cachexia can be defined by a weight loss of more than 5% during the past 6 months , or by a body mass index of less than 20 g/m 2 and any degree of ongoing weight loss that is higher than 2% , or by sarcopenia (i.e. degenerative loss of muscle mass) and an ongoing weight loss that is higher than 2% (see , Fearon K. et al . : Definition and classification of cancer cachexia : an international consensus . Lancet Oncol . 2011 May; 12(5) : 489- 95. ) .
- a further symptom of cancer cachexia can be a depletion of adipose tissue .
- a “treatment” according to the present invention may be a treatment for preventing and/or a treatment for inhibiting or reverting cancer cachexia.
- a treatment for preventing cancer cachexia is a treatment that is given prophylac ically at a stage of the cancer disease where no cancer cachexia has yet occurred
- a treatment for inhibiting cancer cachexia is typically a treatment that is given at a stage of the cancer disease where some cancer cachexia has occurred, in order to inhibit a further progression of the cancer cachexia .
- a treatment for reverting cancer cachexia is typically a treatment that is started at a stage of the cancer where some cancer cachexia has occurred, and which reverts the cancer cachexia .
- the effect of the treatment can be a partial effect , i.e. a partial prevention, a partial inhibition or a partial reversion of cancer cachexia, or a complete effect , i.e. a complete prevention, a complete inhibition or a complete reversion of cancer cachexia .
- the effect of the treatment is a complete prevention, a complete inhibition or a complete reversion of cancer cachexia . More preferably, the effect of the treatment according to the present invention is a complete prevention or a complete reversion of cancer cachexia .
- the term “complete ( ly) " in connection with a treatment of cancer cachexia according to the invention means that in case of a treatment for preventing, no cancer cachexia occurs in the treated individual during and/or following the treatment .
- the term “complete (ly)” means that no further progression of the cancer cachexia occurs in the treated individual during and/or following the treatment .
- the term “complete (ly)” means that during or following the treatment , the cancer cachexia is completely reverted such that no cancer cachexia is present in the treated individual .
- the term “no cancer cachexia” means that by using standard methods for measurements and for diagnosis known in the art , no cancer cachexia is detectable .
- the term “no further progression of the cancer cachexia” means that by using standard methods for measurements and for diagnosis known in the art , no further progression of cancer cachexia is detectable.
- the methods known in the art and referred to herein are for instance described in Fearon KC . : Cancer cachexia : developing multimodal therapy for a multidimensional problem. Eur J Cancer . 2008 May;44 (8) : 1124- 32 ; Fearon K. et al . : Definition and classification of cancer cachexia : an international consensus . Lancet Oncol . 2011 May; 12 (5) : 489-95. ; or Tisdale J. : Mechanisms of cancer cachexia . Physiol Rev. 2009 Apr; 89 (2) : 381-410.
- the treatment methods and products for use in these methods according to the invention may increase the body weight of the treated mammal compared to its body weight before the onset of cancer cachexia .
- the term "before the onset of cancer cachexia” means a point in time during the course of the cancer disease , after which cancer cachexia becomes measurable by the methods known in the art such as the methods referred to above .
- the above-defined effects of the cancer cachexia treatment according to the invention are statistically significant when assessed against a suitable control group whereas individual patients who are treated would not show significant cachexia .
- each occurrence of the term “comprising” may optionally be substituted with the term “consisting of” .
- the methods used in the present invention are performed in accordance with procedures known in the art, e.g. the procedures described in Sambrook et al. ("Molecular Cloning: A Laboratory Manual.”, 2 nd Ed. , Cold Spring Harbor Laboratory Press, Cold Spring Harbor, New York 1989), Ausubel et al. ("Current Protocols in Molecular Biology.” Greene Publishing Associates and Wiley Interscience ; New York 1992) , and Harlow and Lane ("Antibodies : A Laboratory Manual” Cold Spring Harbor Laboratory Press , Cold Spring Harbor, New York 1988) , all of which are incorporated herein by reference .
- Molecular weight is measured by methods known in the art such as mass spectrometry. It is expressed in DaIton (Da) or Kilodalton (kDa) .
- Binding of monoclonal anti-human-GDF- 15 antibodies according to the invention is generally assessed by employing surface plasmon resonance measurements using a Bio-Rad ® ProteOnTM XPR36 system and Bio-Rad ® GLC sensor chips as described for murine anti -human GDF- 15 mAb-Bl-23 in Example 1.
- Sequence alignments of sequences according to the invention are performed by using the BLAST algorithm (see Altschul et al . (1990) "Basic local alignment search tool . " Journal of Molecular Biology 215. p. 403-410. ; Altschul et al . : (1997) Gapped BLAST and PSI -BLAST: a new generation of protein database search programs . Nucleic Acids Res . 25:3389-3402.).
- the following parameters are used: Max target sequences 10 ; Word size 3; BLOSUM 62 matrix; gap costs : existence 11, extension 1; conditional compositional score matrix adj ustment .
- Monoclonal antibodies according to the invention can be produced by any method known in the art, including but not limited to the methods referred to in Siegel DL ("Recombinant monoclonal antibody technology.” Transfus Clin Biol. 2002 Jan; 9 (1) : 15-22. ) .
- an antibody according to the invention is produced by the hybridoma cell line Bl-23 deposited with the Deutsche Sammlung fur Mikroorganismen und Zellkulturen GmbH (DS Z) under the accession No. DS ACC3142 under the Budapest treaty. The deposit was filed on September 29, 2011.
- Cell proli eration can be measured by suitable methods known in the art, including (but not limited to) visual microscopy, metabolic assays such as those which measure mitochondrial redox potential (e.g. MTT (3- (4 , 5-Dimethylthiazol-2-yl) -2,5- diphenyltetrazolium bromide) assay; Resazurin staining which is also known as Alamar Blue ® assay) , staining of known endogenous proliferation biomarkers (e.g. Ki- 67 ) , and methods measuring cellular DNA synthesis (e.g. BrdU and [ 3 H] - Thymidine incorporation assays) .
- MTT 3- (4 , 5-Dimethylthiazol-2-yl) -2,5- diphenyltetrazolium bromide
- Resazurin staining which is also known as Alamar Blue ® assay
- staining of known endogenous proliferation biomarkers e.g. Ki
- Immunosuppression can be measured by suitable methods known in the art , including (but not limited to) immune cell proliferation, cytokine secretion, intracellular cytokine staining by flow cytometry, cytokine measurement by qRT-PCR, redirected target cell lysis , further cytotoxicity or degranulation assays , downregulation of activating immune cell receptors (like NKG2D) , upregulation of inhibitory immune cell receptors , immunological synapse formation, immune cell infiltration .
- suitable methods known in the art including (but not limited to) immune cell proliferation, cytokine secretion, intracellular cytokine staining by flow cytometry, cytokine measurement by qRT-PCR, redirected target cell lysis , further cytotoxicity or degranulation assays , downregulation of activating immune cell receptors (like NKG2D) , upregulation of inhibitory immune cell receptors , immunological synapse formation, immune cell infiltration .
- an effect shall
- Human GDF- 15 levels can be measured by any method known in the art , including measurements of GDF- 15 mRNA levels by methods including (but not limited to) quantitative real-time PGR (qRT-PCR) for human GDF-15 mRNA using primers specific to human GDF-15, mRNA in situ hybridization with probes specific to human GDF-15 , mRNA deep sequencing methods ; and including measurements of GDF-15 protein levels by methods including (but not limited to) mass spectrometry for proteins or peptides derived from human GDF-15 , Western Blotting using antibodies specific to human GDF-15, flow cytometry using antibodies specific to human GDF-15, strip tests using antibodies specific to human GDF-15 , or immunocytochemistry using antibodies specific to human GDF-15.
- qRT-PCR quantitative real-time PGR
- the anti-human GDF-15 antibodies of the present invention are preferred, and the antibody of the invention produced by the hybridoma cell line Bl-23 deposited with the Deutsche Sammlung fur ikroorganismen und Zellkulturen GmbH (DSMZ) under the accession No. DSM ACC3142 is most pre erred.
- DSMZ Deutsche Sammlung fur ikroorganismen und Zellkulturen GmbH
- human GDF-15 protein can be targeted by an antibody in accordance with the invention in a way that cancer cachexia and cancer- induced weight loss can be treated and that also cancer growth is inhibited.
- the anti-GDF-15 antibodies known from WO 2005/099746, WO 2009/021293 and Johnen H et al . , Nature Medicine , 2007 only inhibit one of the effects of human GDF- 15 (i.e. cancer- induced weight loss) , but fail to inhibit other effects of human GDF-15 such as those related to cancer growth.
- the antibodies known from the above documents may only interfere with transport of human GDF-15 across the blood-brain barrier (by forming a large complex that cannot be transported across the blood- brain barrier) but are incapable of binding human GDF-15 in a way that renders it generally unable to interact with its receptor (e.g.
- the anti-GDF-15 antibodies known from WO 2005/099746, WO 2009/021293 and Johnen H et al . , Nature Medicine, 2007 did not lead to a detectable increase in the body weight of the mammals compared to its body weight before the onset of cancer cachexia.
- the following properties of the antibodies of the present invention are expected to contribute to their capability of inhibiting the effects of human GDF-15 more completely, including the treatment of cachexia and the inhibition of cancer growth:
- the antibodies of the present invention are capable of binding to mature recombinant human GDF-15 (represented by SEQ ID No: 8) and are therefore capable of binding to active , fully processed (mature) human GDF-15.
- the inventors show that the mAb-Bl-23 antibody according to the invention is capable of binding to the human GDF-15 precursor on human cells .
- binding and effects of the antibodies according to the present invention are not generally limited to effects on a particular form of human GDF-15.
- human GDF-15 As to the effects of human GDF-15 on cancer cachexia, these effects may be caused a subset of orms human GDF-15 , for instance to soluble forms human GDF-15 , which are capable of passing the blood-brain barrier.
- all of the tested anti- GDF- 15 antibodies according to the invention can be used to treat cancer-induced cachexia.
- the antibodies according to the present invention can interfere with the forms of human GDF-15 which are responsible for cancer cachexia.
- the antibodies and antigen binding portions thereof according to the invention have high binding affinity, as demonstrated by the mAb-Bl-23 antibody according to the invention which has an equilibrium dissociation constant of about 790pM for recombinant human GDF-15.
- affinity values are superior to most of the existing therapeutic antibodies , e.g. to the therapeutic antibody Rituximab which has an equilibrium dissociation constant of about 8 nM .
- High binding affinity will ensure that the antibody to human GDF-15 according to the invention stably binds to human GDF- 15 , such that effects of human GDF-15 including effects on cancer growth are effectively inhibited.
- stable binding of the antibodies according to the invention is expected to ensure that forms of human GDF-15 which cause cancer cachexia cannot carry out their pathological function. This may for instance be due to an antibody-dependent sequestration of these forms of human GDF-15 from their possible site of action in the brain. Such binding and sequestration may for instance take place at the site of the cancer, or the antibodies according to the inventio may interfere with the transport of human-GDF- 15 across the blood brain-barrier .
- the antibodies and antigen binding portions thereof according to the invention bind to a discontinuous or conformational epitope, as demonstrated below for a murine mAb-Bl-23 antibody according to the invention.
- Binding of antibodies and antigen binding portions thereof according to the invention to a discontinuous or conformational GDF-15 epitope may help to keep human GDF-15 in a specific conformation.
- This conformation-specificity may be advantageous to keep GDF-15 in a for that cannot be released from the tumor, or that cannot cross the blood brain-barrier and cause cancer cachexia at a possible site of action in the brain.
- binding to a discontinuous or conformational GDF- 15 epitope may contribute to the effective inhibition of effects of human GDF-15 including effects on cancer growth, e.g. by keeping GDF-15 in a conformation that cannot functionally interact with its receptor .
- the invention relates to the following embodiments :
- the invention relates to a monoclonal antibody capable of binding to human GDF-15 , or an antigen-binding portion thereof , wherein the heavy chain variable domain comprises a CDR3 region comprising the amino acid sequence of SEQ ID NO: 5 or an amino acid sequence at least 90% identical thereto, and where n the light chain variable domain comprises a CDR3 region comprising the amino acid sequence of SEQ ID NO: 7 or an amino acid sequence at least 85% identical thereto, wherein the constant domain of the heavy chain comprises the amino acid sequence of SEQ ID No : 29, or an amino acid sequence at least 85%, preferably at least 90% , more preferably at least 95% identical thereto, and wherein the constant domain of the light chain comprises the amino acid sequence of SEQ ID No : 32 , or an amino acid sequence at least 85%, preferably at least 90% , more preferably at least 95% identical thereto .
- the constant domain of the heavy chain comprises the amino acid sequence of SEQ ID No: 29, or an amino acid sequence at least 98%, preferably at least 99% identical thereto
- the constant domain of the light chain comprises the amino acid sequence of SEQ ID No : 32 , or an amino acid sequence at least 98%, preferably at least 99% identical thereto .
- the constant domain of the heavy chain comprises an amino acid sequence at least 85% identical to the amino acid, sequence of SEQ ID No: 29, and the constant domain of the light chain comprises the amino acid sequence of SEQ ID No; 32 , or an amino acid sequence at least 85% , preferably at least 90% , more preferably at least 95% , still more preferably at least 98%, and most preferably at least 99% identical thereto .
- the constant domain of the heavy chain comprises an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID No : 29
- the constant domain of the light chain comprises the amino acid sequence of SEQ ID No: 32 , or an amino acid sequence at least 85%, preferably at least 90% , more preferably at least 95% , still more preferably at least 98% , and most preferably at least 99% identical thereto .
- the constant domain of the heavy chain comprises an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID No: 29, and the constant domain of the light chain comprises the ami o acid sequence of SEQ ID No : 32 , or an amino acid sequence at least 85%, preferably at least 90% , more preferably at least 95% , still more preferably at least 98% , and most preferably at least 99% identical thereto .
- the constant domain of the heavy chain comprises an amino acid sequence at least 98% identical to the amino acid sequence of SEQ ID No:
- the constant domain of the light chain comprises the amino acid sequence of SEQ ID No: 32, or an amino acid sequence at least 85%, preferably at least 90%, more preferably at least 95%, still more preferably at least 98%, and most preferably at least 99% identical thereto.
- the constant domain of the heavy chain comprises an amino acid sequence at least 99% identical to the amino acid sequence of SEQ ID No : 29
- the constant domain of the light chain comprises the amino acid sequence of SEQ ID No: 32, or an amino acid sequence at least 85% , preferably at least 90% , more preferably at least 95%, still more preferably at least 98% , and most preferably at least 99% identical thereto .
- the constant domain of the heavy chain comprises the amino acid sequence of SEQ ID No : 29, or an amino acid sequence at least 85% , preferably at least 90%, more preferably at least 95% , still more preferably at least 98%, and most preferably at least 99% identical thereto, and the constant domain of the light chain comprises an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID No : 32.
- the constant domain of the heavy chain comprises the amino acid sequence of SEQ ID No : 29, or an amino acid sequence at least 85% , preferably at least 90% , more preferably at least 95% , still more preferably at least 98% , and most preferably at least 99% identical thereto
- the constant domain of the light chain comprises an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID No : 32.
- the constant domain of the heavy chain comprises the amino acid sequence of SEQ ID No : 29, or an amino acid sequence at least 85%, preferably at least 90%, more preferably at least 95%, still more preferably at least 98%, and most preferably at least 99% identical thereto, and the constant domain of the light chain comprises an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID No: 32.
- the constant domain of the heavy chain comprises the amino acid sequence of SEQ ID No: 29, or an amino acid sequence at least 85%, preferably at least 90%, more preferably at least 95%, still more preferably at least 98% , and most preferably at least 99% identical thereto, and the constant domain of the light chain comprises an amino acid sequence at least 98% identical to the amino acid sequence of SEQ ID No : 32.
- the constant dom in of the heavy chain comprises the amino acid sequence of SEQ ID No : 2 , or an amino acid sequence at least 85% , preferably at least 90% , more preferably at least 95% , still more preferably at least 98% , and most preferably at least 99% identical thereto, and the constant domain of the light chain comprises an amino acid sequence at least 99% identical to the amino acid sequence of SEQ ID No : 32.
- the constant domain of the heavy chain comprises the amino acid sequence of SEQ ID No: 29, and the constant domain of the light chain comprises the amino acid sequence of SEQ ID No : 32.
- the invention relates to a monoclonal antibody capable of binding to human GDF-15, or an antigen-binding portion thereof , wherein the heavy chain variable domain comprises a CDR3 region comprising the amino acid sequence of SEQ ID NO: 5 or an amino acid sequence that differs by not more than one amino acid from the amino acid sequence of SEQ ID NO : 5 , and wherein the light chain variable domain comprises a CDR3 region comprising the amino acid sequence of SEQ ID NO: 7 or an amino acid sequence or an amino acid sequence that differs by not more than one amino acid from the amino acid sequence of SEQ ID NO: 7, wherein the constant domain of the heavy chain comprises the amino acid sequence of SEQ ID No : 29, or an amino acid sequence at least 85%, preferably at least 90%, more preferably at least 95% identical thereto, and wherein the constant domain of the light chain comprises the amino acid sequence of SEQ ID No : 32 , or an amino acid sequence at least 85%, preferably at least 90% , more preferably at least 95% identical thereto, and wherein
- the constant domain of the heavy chain comprises the amino acid sequence of SEQ ID No : 29 , or an amino acid sequence at least 98% , preferably at least 99% identical thereto
- the constant domain of the light chain comprises the amino acid sequence of SEQ ID No : 32 , or an amino acid sequence at least 98%, preferably at least 99% identical thereto .
- the constant domain of the heavy chain comprises an ami o acid sequence at least 85% identical to the amino acid sequence of SEQ ID No: 29
- the constant domain of the light chain comprises the amino acid sequence of SEQ ID No : 32, or an ami o acid sequence at least 85%, preferably at least 90% , more preferably at least 95% , still more preferably at least 98% , and most preferably at least 99% identical thereto .
- the constant domain of the heavy chain comprises an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID No : 29, and the constant domain of the light chain comprises the amino acid sequence of SEQ ID No: 32 , or an amino acid sequence at least 85% , preferably at least 90%, more preferably at least 95% , still more preferably at least 98%, and most preferably at least 99% identical thereto .
- the constant domain of the heavy chain comprises an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID No: 29, and the constant domain of the light chain comprises the amino acid sequence of SEQ ID No : 32 , or an amino acid sequence at least 85%, preferably at least 90%, more preferably at least 95%, still more preferably at least 98%, and most preferably at least 99% identical thereto .
- the constant domain of the heavy chain comprises an amino acid sequence at least 98% identical to the amino acid sequence of SEQ ID No: 29, and the constant domain of the light chain comprises the amino acid sequence of SEQ ID No : 32 , or an amino acid sequence at least 85%, preferably at least 90% , more preferably at least 95% , still more pre erably at least 98%, and most preferably at least 99% identical thereto .
- the constant domain of the heavy chain comprises an amino acid sequence at least 99% identical to the amino acid sequence of SEQ ID No : 29
- the constant domain of the light chain comprises the amino acid sequence of SEQ ID No : 32 , or an amino acid sequence at least 85% , preferably at least 90%, more preferably at least 95% , still more preferably at least 98%, and most preferably at least 99% identical thereto .
- the constant domain of the heavy chain comprises the amino acid sequence of SEQ ID No: 29, or an amino acid sequence at least 85% , preferably at least 90% , more preferably at least 95%, still more preferably at least 98% , and most preferably at least 99% identical thereto
- the constant domain of the light chain comprises an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID No : 32.
- the constant domain of the heavy chain comprises the amino acid sequence of SEQ ID No: 29, or an amino acid sequence at least 85%, preferably at least 90%, more preferably at least 95%, still more preferably at least 98%, and most preferably at least 99% identical thereto, and the constant domain of the light chain comprises an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID No; 32.
- the constant domain of the heavy chain comprises the amino acid sequence of SEQ ID No: 29, or an amino acid sequence at least 85%, preferably at least 90%, more preferably at least 95% , still more preferably at least 98%, and most preferably at least 99% identical thereto, and the constant domain of the light chain comprises an amino acid sequence at least 95% identical to the amino acid sequence of SEQ ID No: 32.
- the constant domain of the heavy chain comprises the amino acid sequence of SEQ ID No : 29 , or an amino acid sequence at least 85%, preferably at least 90%, more preferably at least 95% , still more preferably at least 98% , and most preferably at least 99% identical thereto, and the constant domain of the light chain comprises an amino acid sequence at least 98% identical to the amino acid sequence of SEQ ID No : 32.
- the constant domain of the heavy chain comprises the amino acid sequence of SEQ ID No : 29 , or an amino acid sequence at least 85%, preferably at least 90% , more preferably at least 95% , still more preferably at least 98% , and most preferably at least 99% identical thereto, and the constant domain of the light chain comprises an ami o acid sequence at least 99% identical to the amino acid sequence of SEQ ID No: 32.
- the constant domain of the heavy chain comprises the amino acid sequence of SEQ ID No: 29, and the constant domain of the light chain comprises the amino acid sequence of SEQ ID No: 32.
- a monoclonal antibody capable of binding to human GDF- 15 , or an antigen-binding portion thereof is provided, wherein the heavy chain variable domain comprises a CDR3 region comprising the amino acid sequence of SEQ ID NO: 5 or an amino acid sequence at least 90% identical thereto, and wherein the light chain variable domain comprises a CDR3 region comprising the amino acid sequence of SEQ ID NO: 7 or an amino acid sequence at least 85% identical thereto .
- the constant dom in of the heavy chain of this monoclonal antibody or an igen-binding portion thereof comprises the amino acid sequence of SEQ ID No: 2 , or an amino acid sequence at least 85% , preferably at least 90%, more preferably at least 95% identical thereto
- the constant domain of the light chain of this monoclonal antibody or antigen-binding portion thereof comprises the amino acid sequence of SEQ ID No: 32 , or an amino acid sequence at least 85%, preferably at least 90%, more preferably at least 95% identical thereto .
- the constant domain of the heavy chain comprises the amino acid sequence of SEQ ID No : 29, or an amino acid sequence at least 98% , preferably at least 99% identical thereto
- the constant domain of the light chain comprises the amino acid sequence of SEQ ID No : 32 , or an amino acid sequence at least 98% , preferably at least 99% identical thereto
- the constant domain of the heavy chain comprises the amino acid sequence of SEQ ID No : 29, and the constant domain of the light chain comprises the amino acid sequence Of SEQ ID No: 32.
- a monoclonal antibody capable of binding to human GDF- 15 , or an antigen-binding portion thereof is provided, wherein the heavy chain variable domain comprises a CDR3 region comprising the amino acid sequence of SEQ ID NO: 5 or an amino acid sequence that differs by not more than one amino acid from the amino acid sequence of SEQ ID NO: 5, and wherein the light chain variable domain comprises a CDR3 region comprising the amino acid sequence of SEQ ID NO: 7 or an amino acid sequence or an amino acid sequence that differs by not more than one amino acid from the amino acid sequence of SEQ ID NO: 7.
- the constant domain of the heavy chain of this monoclonal antibody or antigen-binding portion thereof comprises the amino acid sequence of SEQ ID No: 29 , or an amino acid sequence at least 85% , preferably at least 90% , more preferably at least 95% identical thereto
- the constant domain of the light chain of this monoclonal antibody or antigen-binding portion thereof comprises the amino acid sequence of SEQ ID No: 32 , or an amino acid sequence at least 85%, preferably at least 90%, more preferably at least 95% identical thereto .
- the constant domain of the heavy chain comprises the amino acid sequence of SEQ ID No: 29, or an amino acid sequence at least 98% , preferably at least 99% identical thereto
- the constant domain of the light chain comprises the amino acid sequence of SEQ ID No: 32 , or an amino acid sequence at least 98%, preferably at least 99% identical thereto.
- the constant domain of the heavy chain comprises the amino acid sequence of SEQ ID No : 29
- the constant domain of the light chain comprises the amino acid sequence of SEQ ID NO: 32.
- the heavy chain variable domain of the monoclonal antibody or antigen-binding portion thereof comprises a CDR3 region comprising the amino acid sequence of SEQ ID NO : 5
- the light chain variable domain comprises a CDR3 region comprising the amino acid sequence of SEQ ID NO: 7
- the heavy chain variable domain of the monoclonal antibody or antigen-binding portion thereof comprises a CDR3 region comprising the amino acid sequence of SEQ ID NO: 5
- the light chain variable domain comprises a CDR3 region comprising the amino acid sequence of SEQ ID NO: 7.
- the heavy chain variable domain of the monoclonal antibody or antigen-binding portion thereof comprises a CDR1 region comprising the amino acid sequence of SEQ ID NO : 3 and a CDR2 region comprising the amino acid sequence of SEQ ID NO: 4, and the light chain variable domain of the monoclonal antibody or antigen-binding portion thereof comprises a CDRl region comprising the amino acid sequence of SEQ ID NO : 6 and a CDR2 region comprising the amino acid sequence ser-ala-ser .
- the antibody is a humanized antibody .
- all of the variable domains of the humanized antibody are humanized variable domains .
- the heavy chain variable domain of the monoclonal antibody or antigen-binding portion thereof comprises the amino acid sequence of SEQ ID No: 28 , or an amino acid sequence at least 90%, preferably at least 95%, more preferably at least 98%, still more preferably at least 99% identical thereto
- the light chain variable domain of the monoclonal antibody or antigen-binding portion thereof comprises the amino acid sequence of SEQ ID No : 31, or an amino acid sequence at least 90% , preferably at least 95% , more preferably at least 98%, still more preferably at least 99% identical thereto .
- the heav chain variable domain comprises the amino acid sequence of SEQ ID No: 28, and the light chain variable domain comprises the amino acid sequence of SEQ ID
- the heavy chain of the monoclonal antibody or antigen-binding portion thereof comprises the amino acid sequence of SEQ ID No: 27
- the light chain of the monoclonal antibody or antigen-binding portion thereof comprises the amino acid sequence of SEQ ID No: 30.
- the heavy chain variable domain of the monoclonal antibody or antigen-binding portion thereof comprises the amino acid sequence of SEQ ID No: 34 , or an amino acid sequence at least 75% , more preferably at least 80% , more preferably at least 85% , more preferably at least 90%, more preferably at least 95%, more preferably at least 98%, still more preferably at least 99% identical thereto, and the light chain variable domain of the monoclonal antibody or antigen-binding portion thereof comprises the amino acid sequence of SEQ ID No: 37 , or an amino acid sequence at least 80%, more preferably at least 85%, more preferably at least 90% , more preferably at least 95%, more preferably at least 98% , still more preferably at least 99% identical thereto .
- the heavy chain variable domain comprises the amino acid sequence of SEQ ID No : 34
- the light chai variable domain comprises the amino acid sequence
- the heavy chain variable domain comprises a region comprising an FR1, a CDR1 , an FR2 , a CDR2 and an FR3 region and comprising the amino acid sequence of SEQ ID NO: 1 or a sequence 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96% , 97%, 98% or 99% identical thereto
- the light chain variable domain comprises a region comprising an FRl, a CDR1, an FR2 , a CDR2 and an FR3 region and comprising the amino acid sequence of SEQ ID NO : 2 or a sequence 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical thereto.
- the heavy chain variable domain comprises a region comprising an FRl, a CDR1 , an FR2 , a CDR2 and an FR3 region and comprising the amino acid sequence of SEQ ID NO: 1 or a sequence 95% identical thereto
- the light chain variable domain comprises a region comprising an FRl , a CDR1, an FR2 , a CDR2 and an FR3 region and comprising the amino acid sequence of SEQ ID NO : 2 or a sequence 95% identical thereto .
- the heavy chain variable domain comprises a region comprising an FRl , a CDR1 , an FR2 , a CDR.2 and an FR3 region and comprising the amino acid sequence of SEQ ID NO : 1 or a sequence 98% identical thereto
- the light chain variable domain comprises a region comprising an FRl , a CDR1, an FR2 , a CDR2 and an FR3 region and comprising the amino acid sequence of SEQ ID NO: 2 or a sequence 98% identical thereto .
- the heavy chain variable domain comprises a region comprising an FRl , a CDR1 , an FR2 , a CDR2 and an FR3 region and comprising the amino acid sequence of SEQ ID NO : 1
- the light chain variable domain comprises a region comprising an FRl , a CDR1 , an FR2 , a CDR2 and an FR3 region and comprising the amino acid sequence of SEQ ID NO: 2.
- a monoclonal antibody capable of binding to human GDF-15 , or an antigen-binding portion thereof wherein the heavy chain variable domain comprises a CDR1 region comprising the amino acid, sequence of SEQ ID NO: 3 and a CDR2 region comprising the amino acid sequence of SEQ ID NO: 4, and wherein the light chain variable domain comprises a CDR1 region comprising the amino acid sequence of SEQ ID NO: 6 and a CDR2 region comprising the amino acid sequence of SEQ ID NO; 7.
- the antibody may have CDR3 sequences as defined in any of the embodiments of the invention described above.
- the a monoclonal antibody capable of binding to human GDF-15 , or an antigen-binding portion thereof is provided, wherein the antibody or antigen-binding portion thereof is capable of inhibiting cancer growth in a mammal, preferably a human patient.
- the invention relates to an antigen-binding portion capable of binding to human GDF-15 , wherein the antigen-binding portion is a single-domain antibody (also referred to as "NanobodyTM") .
- the single-domain antibody comprises the CDR1, CDR2 , and CDR3 amino acid sequences of SEQ ID NO: 3, SEQ ID NO : 4, and SEQ ID NO: 5, respectively .
- the single-domain antibody comprises the CDR1 , CDR2 , and CDR3 amino acid sequences of SEQ ID NO: 6 , SEQ ID NO: 7, and SEQ ID NO: 7 , respectively.
- the single-domain antibody is a humanized antibody .
- the antibodies of the invention capable of binding to human GDF-15 or the antigen-binding portions thereof have an equilibrium dissociation constant for human GDF- 15 that is equal to or less than 100 nM, less than 20 nM, preferably less than 10 nM, more preferably less than 5 nM and most preferably between 0.1 nM and 2 nM.
- the antibody capable of binding to human GDF-15 or the antigen-binding portion thereof binds to the same human GDF-15 epitope as the antibody to human GDF-15 obtainable from the cell line Bl-23 deposited with the Deutsche Sammlung fiir Mikroorganismen und Zellkulturen GmbH (DMSZ) under the accession No, DSM ACC3142.
- antibody binding to human GDF-15 in accordance wi h the present invention is assessed by surface plasmon resonance measurements as a reference standard method, in accordance with the procedures described in Example 1. Binding to the same epitope on human GDF- 15 can be assessed similarly by surface lasmon resonance competitive binding experiments of the antibody to human GDF- 15 obtainable from the cell line Bl-23 and the antibody that is expected to bind to the same human GDF-15 epitope as the antibody to human GDF-15 obtainable from the cell line Bl-23.
- the antibody is the monoclonal antibody capable of binding to human GDF-15 obtainable from the cell line Bl-23 deposited with the Deutsche Sammlung fur Mikroorganismen und Zellkulturen GmbH (DMSZ) under the accession No. DSM ACC3142 or an antigen- binding portion thereof .
- the antibody capable of binding to human GDF-15 or the an igen-binding portion thereof according to the invention is a humanized monoclonal antibody or an antigen-binding portion thereof .
- humanized monoclonal anti-human- GDF-15 antibodies of the invention or antigen-binding portions thereof can be generated in accordance with techniques known in the art, as described above .
- the monoclonal antibody capable of binding to human GDF-15 or antigen-binding portion thereof is a humanized antibody derived from the monoclonal antibody capable of binding to human GDF-15 obtainable from the cell line Bl- 23 deposited with the Deutsche Sammlung fur Mikroorganismen und Zellkulturen GmbH (DMSZ) under the accession No . DSM ACC3142 , or an antigen-binding portion thereof .
- DMSZ Deutsche Sammlung fur Mikroorganismen und Zellkulturen GmbH
- the heavy chain variable domain of the humanized antibody or antigen-binding portion thereof comprises a CDR3 region comprising the amino acid sequence of SEQ ID NO : 5
- the light chain variable domain of the humanized antibody or antigen-binding portion thereof comprises a CDR3 region comprising the amino acid sequence of SEQ ID NO : 7.
- the heavy chain variable domain of the humanized antibody or antigen- binding portio thereof comprises or further comprises a CDRl region comprising the amino acid sequence of SEQ ID NO : 3 and a CDR2 region comprising the amino acid sequence of SEQ ID NO: 4
- the light chain variable domain of the humanized antibody or antigen-binding portion thereof comprises or further comprises a CDRl region comprising the amino acid sequence of SEQ ID NO : 6 and a CDR2 region comprising the amino acid sequence of SEQ ID NO: 7.
- a monoclonal antibody capable of binding to human GDF-15, or an antigen-binding portion thereof is provided, wherein the binding is binding to a conformational or discontinuous epitope on human GDF-15 comprised by the amino acid sequences of SEQ ID No: 25 and SEQ ID No: 26.
- the antibody or antigen- binding portion thereof is an antibody or antigen-binding portion thereof as defined in any one of the above embodiments .
- the antibody capable of binding to human GDF-15 or the antigen-binding portion thereof is a diabody .
- the diabody is bivalent and monospecific , with two identical antigen binding sites for human GDF-15.
- the diabody is bivalent and bispecific, with one antigen binding site being a binding site for human GDF-15, and the other antigen binding site being a binding site for a different antigen.
- Non- limiting examples for the different antigen according to this second aspect of this embodiment are i ) cell surface antigens that are co-expressed with GDF- 15 at high levels on the same cancer (e.g.
- the antibody capable of binding to human GDF-15 or the antigen-binding portion thereof is linked to a drug .
- the drug can be a known anticancer agent and/or an immune- stimulatory molecule .
- known anticancer agents include alkylating agents such as cisplatin, carboplatin, oxaliplatin, mechlorethamine , eyelophosphamide , chlorambucil , and ifosfamide anti -metabolites such as azathioprine and mercaptopurine ; alkaloids such as vinca alkaloids (e.g.
- vincristine , vinblastine , vinorelbine, and vindesine e.g. paclitaxel , docetaxel
- taxanes e.g. paclitaxel , docetaxel
- topoisomerase inhibitors such as camptothecins (e.g. irinotecan and topotecan)
- cytotoxic antibiotics such as actinomycin, anthracyclines , doxorubicin, daunorubicin, valrubicin, ida ubicin, epirubicin, bleomycin, pl camycin and mitomycin
- radioisotopes e.g. paclitaxel , docetaxel
- topoisomerase inhibitors such as camptothecins (e.g. irinotecan and topotecan)
- cytotoxic antibiotics such as actinomycin, anthracyclines , doxorubicin, daunorubicin,
- Linking of the antibodies or the antigen-binding portions thereof of the invention to anticancer agents is expected to result in stronger cancer tumor growth inhibition compared to the antibody without the anticancer agent , because the resulting conjugate will accumulate at the site of the tumor due to the presence of GDF-15 in the tumor, leading to the accumulation of the anticancer agent at the site of the tumor and to enhanced ef ects of the anticancer agent on the tumor .
- the antibody capable of binding to human GDF-15 or the antigen-binding portion thereof is modified by an amino acid tag .
- tags include Polyhistidin (His- ) tags, FLAG- tag, Hemagglutinin (HA) tag, glycoprotein D (gD) tag, and c-myc tag .
- Tags may be used for various purposes . For instance, they may be used to assist purification of the antibody capable of binding to human GDF- 15 or the antige -binding portion thereof , or they may be used for detection of the antibody or the antigen-binding portion thereof ⁇ e.g. when used in diagnostic assays) .
- such tags are present at the C- terminus or N- terminus of the antibody capable of binding to human GDF-15 or the antigen-binding portion thereof .
- the antibody capable of binding to human GDF-15 or the antigen-binding portion thereof is capable of inhibiting cancer growth in a mammal , preferably a human patient .
- the human GDF-15 is recombinant human GDF-15 having the amino acid sequence represented by SEQ ID No: 8.
- the binding of the antibody capable of binding to human GDF-15 or the antigen-binding portion thereof is a binding to a conformational o discontinuous epitope on human GDF-15.
- the monoclonal antibodies of the present invention capable of binding to human GDF-15 or the antigen- binding portions thereof are isolated antibodies.
- the antibody has a size of more than 100 kDa, preferably more than 110 kDa, more preferably more than 120 kDa, still more preferably more than 130 kDa, and most preferably more than 140 kDa.
- the antibody is a full-length antibody, more preferably a full-length IgG antibody.
- the invention also relates to an expression vector comprising a nucleotide sequence encoding the antibody or antigen- binding portion thereof as defined above.
- the present invention also provides a cell line capable of producing an antibody or antigen-binding portion thereof according to the present invention.
- the cell line can be derived from any ceil line that is known in that art and suitable for the produc io of antibodies or antigen-binding portions thereof .
- the cell line is the cell line Bl- 23 deposited with the Deutsche Sammlung fur Mikroorganismen und Zellkulturen GmbH (DMSZ) under the accession No. DSM ACC3142.
- the cell line contains an expression vector according to the invention as defined above .
- the present invention relates to a pharmaceutical composition
- a pharmaceutical composition comprising any of the antibodies or antigen-binding portions thereof as defined above .
- compositions in accordance with the present invention are prepared in accordance with known standards for the preparation of pharmaceutical compositions containing antibodies and portions thereof .
- compositions are prepared in a way that they can be stored and administered appropriately, e.g. by using pharmaceutically acceptable components such as carriers , excipients or stabilizers .
- Such pharmaceutically acceptable components are not toxic in the amounts used when administering the pharmaceutical composition to a patient .
- the pharmaceutical acceptable components added to the pharmaceutical compositions may depend on the particular intended use of the pharmaceutical compositions and the route of administration.
- the pharmaceutica1ly acceptable components used in connection with the present invention are used in accordance with knowledge available in the art , e.g. from Remington's Pharmaceutical Sciences , Ed. AR Gennaro, 20th edition, 2000 , Williams &. Wilkins , PA, USA.
- the present invention further relates to a method for treating cancer cachexia in a mammal .
- the method comprises administering an antibody or antigen-binding portion thereof as defined above, or a pharmaceutical composition as defined above to said mammal .
- the present invention relates to an antibody or antigen-binding portion thereof as defined above , or a pharmaceutical composition as defined above for use in these methods .
- the mammal is a human patient.
- the present invention further relates to a method for treating cancer in a mammal .
- the method comprises administering an antibody or antigen-binding portion thereof as defined above , or a pharmaceutical composition as defined above to said mammal.
- the present invention relates to an antibody or antigen-binding portion thereof as defined above, or a pharmaceutical composition as defined above for use in these methods.
- the mammal is a human patient.
- the present invention relates to several surprising advantages compared to the effects observed in the art.
- one main benefit of the invention lies in that the anti-GDF-15 antibodies disclosed herein can be used to more effectively treat cancer- induced weight loss and/or cancer cachexia .
- the treatment with the antibodies according to the invention can completely prevent cancer cachexia (when given prophylactically) or completely reverse cancer cachexia ⁇ when given after the onset of cancer cachexia) .
- the antibodies according to the invention can even increase the body weight of the treated mammal during a prophylactic treatment for the prevention of cachexia .
- the antibodies according to the invention can not only reverse the loss in body weight, but also increase the body weight of the treated mammal compared to its body weight before the onset of cancer cachexia.
- the antibodies according to the invention may be beneficial in various clinical situations. For instance , administration of many ingredients that are pharmaceutically active against cancer (e.g. various chemotherapeutic drugs) can lead to a loss of body weight of mammals including human patients. Such an additional loss in body weight could be counteracted by the increase in body weight due to the administration of the antibodies according to the invention . Therefore , the uses of the antibodies according to the invention may be particularly advantageous and safe for combination regimens with additional chemotherapeutic drugs . Similarly, the uses of the antibodies according to the invention may be particularly advantageous for mammals such as human patients that already had a low body weight prior to the onset of cancer and/or prior to the onset of cancer cachexia . Patients with a low body weight may for instance be cachectic patients , e.g. patients with a body-mass-index of less than 18 kg/m 2 .
- the antibodies are not only effective for the treatment of cancer cachexia, but also effective for the treatment of cancer .
- the treatment methods and products for use of the antibodies according to the invention are expected to be particularly beneficial for the treatment of cancer patient sub-groups which suffer from cancer- induced weight loss and/or cancer cachexia, respectively.
- cancer and cancer cachexia treatments may be simplified by using the same treatment for all cancer patients, irrespective of whether or not they suffer from cancer- induced weight loss and/or cancer cachexia. This is because due to the dual effects of the antibodies against cancer and cancer cachexia, it is expected that these antibodies will obviate the need for additional drugs for the treatment of cancer cachexia .
- the method for treating cancer cachexia is a method for completely preventing or completely reverting cancer cachexia.
- the method for treating cancer cachexia is a method for completely preventing cancer cachexia .
- the method for treating cancer cachexia is a method for completely reverting cancer cachexia .
- the method increases body weight of the mammal compared to its body weight before the onset of cancer cachexia.
- the increase in body weight of the mammal is at least 1.5%, preferably at least 2.5%, more preferably at least 5% compared to its body weight before the onset of cancer cachexia.
- the method is a method for both trea ing cancer and treating cancer cachexia in the same mammal .
- the antibody has a size of more than 100 kDa, preferably more than 110 kDa, more preferably more than 120 kDa, still more preferably more than 130 kDa, and most preferably more than 140 kDa .
- the antibody is a full-length antibody, more preferably a full- length IgG antibody.
- the antibody has an Fc portion which is capable of binding to the Fc receptor.
- the cancer cells of the mammal endogenously express GDF-15 and/or the cancer cells of the mammal stimulate endogenous expression of GDF-15 in noncancerous cells of the mammal .
- the cancer cells of the mammal are characterized in that they endogenously express GDF-15.
- the mammal is human patient .
- the human GDF-15 is recombinant human GDF-15 having the amino acid sequence represented by SEQ ID No: 8.
- the human patient has elevated GDF-15 levels in blood serum before administration .
- the treatment methods according to the invention are expected to be particularly effective at inhibiting cancer growth .
- GDF-15 levels are GDF-15 protein levels measured using the antibody according to the invention obtainable from the hybridoma cell line Bl-23 deposited with the Deutsche Sammlung fur Mikroorganismen und Zellkulturen GmbH (DSMZ) under the accession No. DSM ACC3142 , preferably measured by immunochemistry .
- the antibody or antigen-binding portion thereof is the sole ingredient pharmaceutically active against cancer used in the method .
- the antibody or antigen-binding portion thereof is used in combination with one or more furthe ingredients pharmaceutically active against cancer .
- the one or more further ingredients pharmaceutically active against cancer is a known anticancer agent and/or an immune-stimulatory molecule as defined above .
- the anticancer agent can for instance be selected from alkylating agents such as cisplatin, carboplatin, oxaliplatin, mechlorethamine , cyclophosphamide , chlorambucil , and ifosfamide ; anti -metabolites such as azathioprine and mercaptopurine ; alkaloids such as vinca alkaloids (e.g. vincristine , vinblastine , vinorelbine , and vindesine) , taxanes (e.g. paclitaxel , docetaxel) etoposide and teniposide ; topoisomerase inhibitors such as camptothecins (e.g.
- irinotecan and topotecan cytotoxic antibiotics such as actinomycin, anthracyclines , doxorubicin, daunorubicin, valrubicin, idarubicin, epirubicin, bleomycin, plicamycin and mitomycin; and radioisotopes .
- cytotoxic antibiotics such as actinomycin, anthracyclines , doxorubicin, daunorubicin, valrubicin, idarubicin, epirubicin, bleomycin, plicamycin and mitomycin
- radioisotopes radioisotopes . Due to the increasing effect of the antibodies according to the invention on body weight of the mammals including human patients , these combined uses of the antibodies or antigen-binding portions thereof and the ingredients pharmaceutically active against cancer are expected to be particularly safe, because they may compensate a possible additional weight loss resulting from the administration of the ingredients pharmaceutically active against cancer.
- the cancer is selected from the group consisting of brain cancers including glioma, cancers of the nervous system, melanoma, lung cancer, lip and oral cavity cancer, hepatic carcinoma, leukemia, Hodgkin lymphoma , Non-Hodgkin lymphoma, bladder cancer, cervix uteri cancer, corpus uteri cancer, testis cancer, thyroid cancer, kidney cancer, gallbladder cancer, multiple myeloma, nasopharynx cancer, larynx cancer, pharynx cancer, oesophagus cancer, gastrointestinal tumors including stomach and colorectal cancer , pancreatic cancer, prostate cancer, ovarian cancer and breast cancer, preferably from the group consisting of melanoma , prostate cancer , breast cancer, brain cancers including glioma , colorectal cancer , stomach cancer, oe
- the cancer is selected from the above grou , which further comprises endometrial cancer, such as endomet ial carcinoma, breast cancer including subtypes of breast cancer, in particular triple-negative breast cancer and bladder cancer such as urothelial cell carcinoma .
- endometrial cancer such as endomet ial carcinoma
- breast cancer including subtypes of breast cancer, in particular triple-negative breast cancer and bladder cancer such as urothelial cell carcinoma .
- the tumor or tumors formed by the cancer have higher human GDF-15 levels prior to administration compared to a control sample of the same patient obtained from a non-cancerous part of the tissue which is the tissue of origin of the cancer, pre erably 1.2- fold higher levels, more preferably 1.5-fold higher levels, still more preferably 2- fold higher levels and most preferably 5-fold higher levels.
- the treatment methods according to the invention are expected to be particularly effective at inhibiting cancer growth .
- the method for treating cancer comprises inhibiting cancer growth.
- cancer growth is stopped.
- the cancer shrinks .
- the method for treating cancer comprises the induction of killing of cancer cells by NK cells and CD8+ T cells in the human patient . Due to their capability of preventing GDF- 15 mediated down-regulation of the known immune surveillance regulator NKG2D, the antibodies or antigen-binding portions thereof according to the invention are expected to restore immune surveillance and induce the killing of cancer cells by NK cells and CD8+ T cells , in addition to effects of the antibodies or antigen-binding portions thereof that are independent of the immune system .
- kits comprising the pharmaceutical compositions as defined above .
- kits are kits for use in the methods according to the invention as defined above .
- the present invention also provides a diagnostic kit comprising any of the antibodies or antigen- binding portions thereof according to the invention.
- the diagnostic kit may be used to detect whether the tumor or tumors of a cancer patient formed by the cancer have higher human GDF-15 levels compared to a control sample of the same patient obtained from a non- cancerous part of the tissue which is the tissue of origin of the cancer.
- the diagnostic kit may be used to detect whether a human cancer patient has elevated GDF-15 levels in blood serum.
- amino acid sequences referred to in the present application are as follows (in an N- terminal to C- terminal order; represented in the one-letter amino acid code) :
- SEQ ID No: 1 (Region of the Heavy Chain Variable Domain comprising an FR1, a CDR1, an FR2 , a CDR2 and an FR3 region from the Polypeptide Sequence of monoclonal anti-human GDF-15 mAb-Bl-23) :
- SEQ ID No : 2 (Region of the Light Chain Variable Domain comprising an FR1, a CDR1 , an FR2 , a CDR2 and an FR3 region from the Polypeptide Sequence of monoclonal anti -human GDF-15 mAb-Bl-23) :
- GFSLSTSGMG SEQ ID No: 4 (Heavy Chain CDR2 Region Peptide Sequence of monoclonal anti -human GDF-15 mAb-Bl-23 ) :
- SEQ ID No : 8 (recombinant mature human GDF-15 protein) :
- SEQ ID No: 9 (human GDF-15 precursor protein) :
- SEQ ID No : 10 human GDF-15 precursor protein + N- terminal and C-terminal GSGS linker
- SEQ ID No: 13 (peptide derived from human GDF-15) : ELHLRPQAARGRR
- SEQ ID No: 14 (peptide derived from human GDF-15) : LHLRPQAARGRRR
- SEQ ID No: 15 (peptide derived from human GDF-15) :
- SEQ ID No: 16 (peptide derived from human GDF-15) : LRPQAARGRRRAR
- SEQ ID No : 17 (peptide derived from human GDF-15) :
- SEQ ID No: 18 (peptide derived from human GDF-15) : PQAARGRR.RARAR
- SEQ ID No: 19 (peptide derived from human GDF- 15) : QAARGRRRARARN
- SEQ ID No: 20 (peptide derived from human GDF-15) : MHAQIKTSLHRLK
- SEQ ID No: 25 (GDF-15 peptide comprising part of the GDF-15 Epitope that binds to Bl-23) :
- EVQVTMCIGACPSQFR SEQ ID No: 26 (GDF-15 peptide comprising part of the GDF-15 Epitope that binds to Bl-23 ) :
- nucleic acid sequences referred to in the present application are as follows (in a 5' to 3' order; represented in accordance with the standard nucleic acid code) :
- SEQ ID No: 21 (DNA nucleotide sequence encoding the amino acid sequence defined in SEQ ID No: 1) :
- SEQ ID No: 22 (DNA nucleotide sequence encoding the amino acid sequence defined in SEQ ID No : 2) :
- SEQ ID No: 23 (DNA nucleotide sequence encoding the amino acid sequence defined in SEQ ID No: 5) :
- SEQ ID No : 24 (DNA nucleotide sequence encoding the amino acid sequence defined in SEQ ID No: 7) :
- SEQ ID No : 27 amino acid sequence of the heavy chain of the H1L5 humanized Bl-23 anti-GDF-15 antibody
- SEQ ID No: 28 amino acid sequence of the heavy chain variable domain of the H1L5 humanized Bl-23 anti-GDF-15 antibody
- SEQ ID No: 29 amino acid sequence of the heavy chain constant domain of the H1L5 humanized Bl-23 anti-GDF-15 antibody
- SEQ ID No : 30 amino acid sequence of the light chain of the H1L5 humanized Bl-23 anti-GDF-15 antibody
- SEQ ID No: 31 amino acid sequence of the light chain variable domain of the H1L5 humanized Bl-23 anti-GDF-15 antibody
- FTGSGSGTEFTLTISSLQPEDFAAYFCQQYNNFPYTFGGGTKLEIKR SEQ ID No: 32 ⁇ amino acid, sequence of the light chain constant domain of the H1L5 humanized Bl-23 anti-GDF-15 antibody) :
- SEQ ID No: 33 amino acid sequence of the heavy chain of the chimeric Bl-23 anti-GDF-15 antibody:
- SEQ ID No: 34 ⁇ amino acid sequence of the heavy chain variable domain of the chimeric Bl-23 anti-GDF-15 antibody) : QVKLQQSGPGILQSSQTLSLTCSFSGFSLSTSG GVSWIRQPSGKGLEWLAHIYWDDDKRY NPTLKSRLTISKDPSRNQVFLKITSVDTADTATYYCARSSYGAMDYWGQGTSVTVSS
- SEQ ID No: 35 amino acid sequence of the heavy chain constant domain of the chimeric Bl-23 anti-GDF-15 antibody
- SEQ ID No: 38 amino acid sequence of the light chain constant domain of the chimeric Bl-23 anti-GDF-15 antibody
- Example 1 Generation and characterization of the murine GDF- 15 Antibody Bl-23 , and generation of chimeric and humanized antibodies .
- the antibody Bl-23 was generated in a GDF- 15 knock out mouse .
- Recombinant human GDF- 15 (SEQ ID No: 8) was used as the immunogen.
- the hybridoma cell line Bl-23 producing mAb-Bl-23 was deposited with the Deutsche Sammlung fur Mikroorganismen und Zellkulturen GmbH (DMSZ) under the accession No . DS ACC3142, in accordance with the Budapest Treaty.
- Binding of the monoclonal anti -human-GDF- 15 antibody anti - human GDF- 15 mAb-Bl-23 was measured by employing surface plasmon resonance measurements using a Bio-Rad ® ProteOnTM XPR36 system and Bio-Rad* GLC sensor chips : For preparing the biosensors recombinant mature human GDF-15 protein was immobilized on flow cells 1 and 2, On one flow cell recombinant GDF-15 derived from Baculvirus-transfected insect cells (HighFive insect cells) and on the other recombinant protein derived from expression in E . coli was used.
- the non-reacted coupling groups were then quenched by perfusion with 1M ethanolamine pH 8.5 and the biosensor was equilibrated by perfusing the chip with running buffer ( 10M HEPES, 150mM NaCl, 3.4mM EDTA, 0.005% Tween ® 20, pH 7.4, referred to as HBS150 ) .
- running buffer 10M HEPES, 150mM NaCl, 3.4mM EDTA, 0.005% Tween ® 20, pH 7.4, referred to as HBS150
- HBS150 running buffer
- two flow cells were used, one empty with no protein coupled and one cou led with an non-physiological protein partner (human Interleukin- 5 ) , which was immobilized using the same coupling chemistry and the same coupling density.
- anti- human GDF-15 mAb-Bl-23 was dissolved in HBS150 and used in six di ferent concentrations as analyte (concentration: 0.4, 0.8, 3, 12 , 49 und 98 n ) .
- the analyte was perfused over the biosensor using the one-shot kinetics setup to avoid intermittent regeneration, all measurements were performed at 25°C and using a flow rate of ⁇ min -1 .
- For processing the bulk face effect and unspecific binding to the sensor matrix was removed by subtracting the SPR data of the empty flow cell (flow cell 3 ) from all other SPR data .
- the resulting sensogram was analyzed using the software ProteOn Manager version 3.0.
- the anti-human GDF-15 mAb-Bl-23 shows no binding to human interleukin- 5 and thus confirms the specificity of the interaction data and the anti -human GDF-15 mAb-Bl-23.
- the amino acid sequence of recombinant human GDF-15 (as expressed in Baculovirus- transfected insect cells) is :
- the dissociation constant (Kd) of 790pM was determined.
- the therapeutically used antibody Rituximab h s a significantly lower affinity (Kd - 8 nM) .
- a chimeric anti- human GDF-15 mAb-Bl-23 antibody according to the invention was generated by replacing constant domains of the murine antibody with the constant domains of a human IgGl antibody (trastuzumab backbone) .
- the amino acid sequence of the heavy- chain of this chimeric antibody is shown in SEQ ID No : 33
- the amino acid sequence of the light chain of this chimeric antibody is shown in SEQ ID No: 36.
- a humanized anti-human GDF-15 mAb-Bl-23 antibody according to the invention was developed by humanizing the variable domains of the chimeric antibody, i.e. by replacing the framework regions of the chimeric antibody with human sequences, The amino acid sequence of the heavy chain of this humanized antibody is shown in SEQ ID No; 27, and the amino acid sequence of the light chain of this humanized antibody is shown in SEQ ID No: 30.
- This antibody is referred to as H1L5 anti-GDF-15 antibody or humanized B1-23-H1L5 antibody or H1L5 antibody .
- the cDNAs encoding the antibody sequences were optimized, and the genes were synthesized.
- the gene sequences were then cloned into a cloning/expression vector system. From these vectors , plasmid DNA with low endotoxin levels was synthesized .
- the plasmid DNA was then transiently transfected into CHO cells , followed by an analysis and quantification of antibody expression using a protein A biosensor .
- the cDNA of candidate cultures for antibody expression was sequenced.
- the obtained monoclonal antibodies were analyzed ( see Exam les 7 to 9) .
- Example 2 Antagonization of GDF- 15 Mediated Effects with mAB Bl-23 a)
- the NKG2D (Natural Killer Group 2D) receptor which is expressed on NK cells and CD8+ T cells, is known to play an important role in the immune surveillance against tumors .
- Transformed as well as viral infected cells express ligands , which bind to the NKG2D receptor, thereby activating the cytotoxic effector functions of the described immune cells . In that way transformed cells can be detected and eliminated by the immune system .
- NKG2D Natural Killer Group 2D
- human GDF-15 downregulates expression of NKG2D on the cell surface of lymphocytes and thereby downregulates immune surveillance against tumors .
- the antibodies of the present invention are capable of preventing GDF- 15 mediated downregulation of NKG2D and should be capable of restoring immune surveillance and inducing the killing of cancer cells by NK cells and CD8+ T cells .
- the CDR regions of the mAb Bl-23 antibody correspond to CDR regions of the chimeric and humanized antibodies , it is expected that the functional properties including the binding properties of these antibodies are similar .
- AKT is a molecule, which is part of the PI3K-pathway and contributes to the activation and proliferation of cells .
- SK-OV-3 cells were treated with 10 ng/ml recombinant GDF-15 for 10 min at 37°C, 5% C02. 5 minutes preincubation of 2 ⁇ 3 mAb-Bl-23 with 10 ng/ml GDF-15 at 37°C blocked the GDF-15 mediated AKT-phosphorylation (Figure 2) . This showed the neutralizing effect of mAb-Bl-23.
- Example 4 mAb Bl-23 inhibits Growth of tumors in vivo The following in vivo study was carried out :
- Balb/c nu / nu nude mice were used in a xenograft setting with the melanoma cell line UACC-257. The mice were treated either with the antibody Bl-23 or with PBS . Each treatment cohort contained 10 Balb/c nu / nu nude mice.
- the UACC-257 melanoma cells Prior to injection, the UACC-257 melanoma cells were grown in complete medium, excluding any contamination . The cells were harvested when 70-80% confluence was reached in the cell culture flask . Cells were then washed with PBS and counted. lxlO 7 viable cells were suspended in PBS .
- the first inj ection/treatment was administered in 6 week old
- mice Balb/c nu /nu nude mice .
- the inoculation area of the mice was cleaned with ethanol .
- the UACC 257 cells were mixed and drawn into a syringe without a needle, in order to avoid negative pressure on the tumor cells .
- the cell suspension containing 1x10 ' cells in PBS was injected subcutaneously (s.c.) into the lower flank of the mice.
- the intraperitoneal (i.p.) injection of either Bl-23 (25mg/kg body weight) or the same volume of PBS started immediately after the tumor cell inoculation (defined as day 1) and was administered twice a week.
- the tumors were grown for 48 days.
- the tumor diameters were measured with a caliper and the tumor volume in mm 3 was calculated, by the formula:
- the tumor size of the animal cohort treated with Bl-23 was significantly decreased, compared to the PBS control grou .
- Example 5 mAb Bl-23 recognizes a conformational or a discontinuous epitope of human GDF-15
- the protein sequence was translated into I3mer peptides with a shift of one amino acid.
- the C- and N-termini were elongated by a neutral GSGS linker to avoid truncated peptides (bold letters) .
- Standard buffer PBS , pH 7,4 + 0.05% Tween ® 20
- Blocking buffer Rockland blocking buffer MB-070
- Incubation buffer Standard buffer with 10% Rockland blocking buffer MB-0 0
- Control antibodies Monoclonal anti-HA (12CA5) -LL-Atto 680 (1:1000), monoclonal anti -FLAG (M2 ) -FluoProbes752 (1:1000); staining in incubation buffer for 1 h at RT
- the peptide array with 10, 12 and I5mer B7H3 -derived linear peptides was incubated with secondary goat anti-mouse IgG (H+L) IRDye680 antibody only at a dilution of 1:5000 for lh at room temperature to analyze background interactions of the secondary antibody.
- the PEPperCHIP ® was washed 2x1 min with standard buffer, rinsed with dist, water and dried in a stream of air.
- the peptide microarray was incubated overnight at 4 °C with monoclonal mouse antibody GDF-15 at a dilution of 1:100. Repeated washing in standard buffer (2x1 min) was followed by incubation for 30 min with the secondary antibody at a dilution of 1:5000 at room temperature. After 2x10 sec. washing in standard buffer and short rinsing with dist. water, the PEPperCHIP ® was dried in a stream of air . Read-out was done with Odyssey ® Imaging System at a resolution of 21 ⁇ and green/red intensities of 7/7 before and after staining of control peptides by anti -HA and anti-FLAG ( 2 ) antibodies .
- Example 6 Structural identification of peptide ligand epitopes by mass spectrometric epitope excisio and epitope extraction
- the epitope of recombinant human GDF-15 which binds to the antibody Bl-23 was identified by means of the epitope excision method and epitope extraction method (Suckau et al . Proc Natl Acad Sci U S A. 1990 December; 87 (24) : 9848 9852. ; R . Stefanescu et al . , Eur .J. Mass Spectrom. 13 , 69-75 (2007) ) .
- the antibody Bl-23 was added to NHS-activated 6-aminohexanoic acid coupled sepharose .
- the sepharose-coupled antibody Bl-23 was then loaded into a 0 , 8 ml microcolumn and washed with blocking and washing buffers .
- Recombinant human GDF-15 was digested with trypsin for 2h at 37°C (in solution) , resulting in different peptides , according to the trypsin cleavage sites in the protein. After complete digestion, the peptides were loaded on the affinity column containing the immobilized antibody Bl-23. Unbound as well as potentially bound peptides of GDF-15 were used for mass spectrometry analysis . An identification of peptides by means of mass spectrometry was not possible. This was a further indicator that the binding region of GDF-15 in the immune complex Bl-23 comprises a discontinuous or conformational epitope.
- the digested peptides should bind its interaction partner, unless there was a trypsin cleavage site in the epitope peptide.
- a discontinuous or conformational epitope could be confirmed by the epitope excision method described in the following part .
- the immobilized antibody Bl-23 on the affinity column was then incubated with recombinant GDF-15 for 2h .
- the formed immune complex on the affinity column was then incubated with trypsin for 2h at 37°C.
- the cleavage resulted in different peptides derived from the recombinant GDF-15.
- the immobilized antibody itself is proteolytically stable .
- the resulting peptides of the digested GDF- 15 protein, which were shielded by the antibody and thus protected from proteolytic cleavage were eluted under acidic conditions (TFA, pH2 ) , collected and identified by mass spectrometry.
- the part of human GDF-15, which binds the antibody Bl-23 comprises a discontinuous or conformational epitope .
- Mass spectrometry identified 2 peptides in the GDF-15 protein, which are responsible for the formation of the immune complex. These peptides are restricted to the positions 40- 55 ⁇ EVQVTMCIGACPSQFR) and 94-114 ⁇ TDTGVSLQTYDDLLAKDCHCI ) in the GDF-15 amino acid sequence. Thus, these two peptides comprise an epitope of the GDF-15 protein that binds to the antibody Bl-23.
- Example 7 Treatment of cancer-induced weight loss with anti- GDF-15 antibodies .
- 10 Balb/c nu/nu m ice per treatment group were subcutaneously inoculated with lOxlO 6 UACC-257 cells per animal in a 1 : 1 volume ratio with matrigel (100 ⁇ cells + 100 ⁇ matrigel) .
- the animals were treated on the same day with the respective antibodies , as indicated below:
- the dacarbazine group (group 1) served as a reference group /positive control for tumor growth arrest (cytostatic drug for the treatment of malignant melanoma in humans ) .
- the PBS group (group 2) served as a growth control/vehicle control group , because all used substances of the other groups were administered in PBS .
- the group of the murine Bl-23 lead candidate antibody ( group 3) served as reference group for a comparison with the chimeric Bl-23 antibody and with the humanized Bl-23 H1L5 (groups 4 and 5 ) .
- Group 4 is the group of the chimerized Bl-23 lead candidate antibody, which contains murine variable domains and constant domains of a human IgGl antibody ( trastuzumab backbone) .
- Group 5 is the group of the H1L5 humanized Bl-23 lead candidate antibody, which contains humanized frameworks within the murine variable regions and constant domains of a human IgGl antibody (trastuzumab backbone) .
- Group 6 is the group of the B12 isotype antibody.
- the antibody B12 (Lot . No.: ID3195) was produced by the company Evitria AG .
- B12 binds to an HIV antigen and should therefore neither bind to antigens in nude mice nor to antigens of the human tumor .
- B12 was selected as a highly suitable isotype control , because the immunog1obu1in backbone of B12 also consists of the human IgGl antibody trastuzumab and is therefore almost identical to the chimeric Bl-23 and the H1L5 humanized Bl-23 antibodies , except for their variable regions .
- the study was carried out in a double-blinded manner for the treatment with the antibodies and for the treatment with PBS .
- mice of the groups that did not receive treatment with anti-GDF-15 antibodies exhibited a weight loss of more than 10%.
- a weight loss of as little as 5% over a period of 6 months is considered as being indicative of cancer cachexia (Fearon . et al . : Definition and classification of cancer cachexia : an international consensus . Lancet Oncol . 2011 May; 12 (5) : 489-95 , ) .
- Given the larger weight loss of the mice observed in the present study which even exceeded 10%, it is expected that the mice in the study, which did not receive treatment with anti-GDF-15 antibodies not only exhibited weight loss but also exhibited cancer cachexia . This effect is completely prevented by the anti-GDF-15 antibodies tested . It is therefore expected that the anti-GDF-15 antibodies in accordance with the invention are capable of both treating cancer- induced weight loss and treating cancer cachexia .
- the feed consumption of the mice was evaluated by pairwise comparisons of the study groups (Table 1) .
- the feed consumption of the mice in the anti-GDF-15 antibody groups (Bl-23 , chimeric Bl-23 and humanized Bl-23 -H1L5) was significantly higher than the feed consumption of the mice in the groups which did not receive the anti-GDF-15 antibodies .
- Table 1 Comparative evaluation of the feed consumption between the different treatment groups. For the measured time intervals (day 17-20, day 20-24 , day 24-27, day 27-31, day 31-34), the average feed consumption per mouse and day was calculated for each respective group. The values are indicated together with their standard deviation .
- the quality of the humanized anti-GDF-15 antibody B1-23-H1L5 used in the study was tested by using gel electrophoresis and coomassie staining of the antibodies (see Figure 6 ) .
- the band of the humanized anti-GDF-15 antibody Bl-23 -H1L5 was sharp and clear, whereas the bands of the murine Bl-23 anti- GDF- 15 antibody and the B12 control antibody appeared less sharp and at a higher molecular weight .
- the humanized anti-GDF-15 antibody Bl-23 -H1L5 is not prone to aggregation, and that some aggregation may have shifted the molecular weight of the other antibodies to higher values .
- Example 8 Determination of Kd values of anti-GDF-15 antibodies .
- the Kd values of different anti-GDF-15 antibodies were compared using Surface Acoustic Wave (SAW) gold chip biosensors technology (SAW Instruments GmbH, Schwertberger Str . 16, D-53177 Bonn, Germany) :
- the murine antibody (Bl-23 ) as well as the chimeric Bl-23 antibody were present in purified form.
- the H1L5 humanized Bl-23 antibody was a serum-free CHO cell culture supernatant.
- the Kd value of the murine Bl-23 deviates from the Kd values determined by Biacore ® analyses (surface plasmon resonance) by a factor of 35.
- the chimeric Bl-23 anti-GDF-15 antibody and the H1L5 humanized Bl-23 antibody exhibited affinities to human GDF-15 which were about 2 - fold and 5-fold higher, respectively, than the affinity of the murine Bl-23 anti-GDF- 15 antibody.
- the chimeric Bl-23 anti-GDF-15 antibody and the H1L5 humanized Bl-23 antibody are high affinity antibodies .
- Example 9 Aggregation studies of the anti-GDF-15 antibodies
- the antibodies were then lOfold concentrated via spin columns (Centricon, MWCO 30) . After this step, turbidity indicated the presence of precipitates in the sample containing Bl-23 , whereas ChimBl-23 and H1L5 showed no signs of aggregation . All concentrated eluates were then centrifuged for 5 min at 13000 rpm in order to precipitate antibody aggregates . The remaining amount of soluble antibodies was finally determined via Bradford assay from the supernatant .
- the antibodies, antigen-binding portions thereof, pharmaceutical compositions and kits according to the present invention may be industrially manufactured and sold as products for the claimed methods and uses ⁇ e.g. for treating cancer cachexia and cancer) , in accordance with known standards for the manufacture of pharmaceutical products. Accordingly, the present invention is industrially applicable .
- a monoclonal antibody capable of binding to human GDF- 15 , o an antigen-binding portion thereof , wherein the heavy chain variable domain comprises a CDR3 region comprising the amino acid sequence of SEQ ID NO: 5 or an amino acid sequence at least 90% identical thereto, and wherein the light chain variable domain comprises a CDR3 region comprising the amino acid sequence of SEQ ID NO: 7 or an amino acid sequence at least 85%
- the constant domain of the heavy chain comprises the amino acid sequence of SEQ ID No : 29, or an amino acid sequence at least 85% ,
- the constant domain of the light chain comprises the amino acid sequence of SEQ ID No: 32 , or an amino acid sequence at least 85% , preferably at least 90%, more preferably at least 95% identical thereto .
- the antibody or an antigen-binding portion thereof of item 1 or 2 wherein the constant domain of the heavy chain comprises the amino acid sequence of SEQ ID No: 29, or an amino acid sequence at least 98% , preferably at least 99% identical thereto, and wherein the
- constant domain of the light chain comprises the amino acid sequence of SEQ ID No: 32 , or an amino acid sequence at least 98%, preferably at least 99%
- variable domains of the antibody are humanized variable domains .
- the heavy chain variable domain comprises the amino acid sequence of SEQ ID No : 28 , or an amino acid sequence at least 90%, preferably at least 95% , more preferably at least 98% , still more preferably at least 99% identical thereto
- the light chain variable domain comprises the amino acid sequence of SEQ ID No : 31 , or an amino acid sequence at least 90% , preferably at least 95%, more preferably at least 98% , still more preferably at least 99% identical thereto.
- the heavy chain variable domain comprises the amino acid sequence of SEQ ID No : 28 , and wherein the light chain variable domain
- the heavy chain variable domain comprises the amino acid sequence of SEQ ID No : 34, or an amino acid sequence at least 75%, more preferably at least 90%, more preferably at least 95% , more preferably at least 98%, still more preferably at least 99% identical thereto
- the light chain variable domain comprises the amino acid sequence of SEQ ID No : 37 , or an amino acid sequence at least 80% , more preferably at least 90%, more preferably at least 95% , more preferably at least 98%, still more preferably at least 99% identical thereto .
- the antibody or antigen-binding portion thereof of item 10 wherein the heavy chain variable domain comprises the amino acid sequence of SEQ ID No : 34 , and wherein the light chain variable domain comprises the amino acid sequence of SEQ ID No : 37.
- the heavy chain variable domain comprises a CDR1 region comprising the amino acid sequence of SEQ ID NO: 3 and a CDR2 region
- the light chain variable domain comprises a CDR1 region comprising the amino acid sequence of SEQ ID NO: 6 and a CDR2 region comprising the amino acid sequence ser-ala- ser .
- the heavy chain variable domain comprises a CDR3 region comprising the amino acid sequence of SEQ ID NO: 5 or an amino acid sequence at least 90% identical thereto, and wherein the light chain variable domain comprises a CDR3 region
- the antibody has a size of more than 100 kDa, preferably more than 110 kDa, more preferably more than 120 kDa, still more preferably more than 130 kDa, and most preferably more than 140 kDa.
- the antibody is a full-length antibody .
- the antibody is a full-length IgG antibody, preferably a full-length IgGl antibody.
- the antibody or antigen-binding portion thereof of any one of items 1 to 17 wherein the antibody has an Fc portion which is capable of binding to the Fc receptor .
- the antibody or antigen-binding portion thereof of any one of items 1 to 18 wherein the human GDF-15 is recombinant human GDF-15 having the amino acid sequence represented by SEQ ID No: 8.
- the antibody or antigen-binding portion thereof of item 21 or 23-24 for the use according to item 21 or 23 -24 , wherein the method for treating cancer cachexia is a method for completely preventing or completely
- the antibody or antigen-binding portion thereof of item 25 for the use according to item 25 , wherein the method for treating cancer cachexia is a method for completely preventing cancer cachexia .
- any one of items 21 to 30 for the use according to any one of items 21 to 30 , wherein the cancer cells of the mammal endogenously express GDF- 15 and/or the cancer cells of the mammal stimulate endogenous expression of GDF- 15 in non- cancerous cells of the mammal .
- any one of items 22-33 for the use according to any one of items 22-33 , wherein the method for treating cancer comprises the induction of killing of cancer cells by NK cells and CD8+ T cells in the human patient .
- leukemia Hodgkin lymphoma , Non-Hodgkin lymphoma, bladder cancer, cervi uteri cancer, corpus uteri cancer, testis cancer, thyroid cancer, kidney cancer, gallbladder cancer, multiple myeloma, nasopharynx cancer, larynx cancer, pharynx cancer, oesophagus cancer , gastrointestinal tumors including stomach and colorectal cancer , pancreatic cancer, prostate cancer, ovarian cancer and breast cancer, preferably from the group consisting of melanoma, prostate cancer, breast cancer, brain cancers including glioma, colorectal cancer, stomach cancer, oesophagus cancer and ovarian cancer, and mos preferably is melanoma .
- the tumor or tumors formed by the cancer have higher human GDF- 15 levels compared to a control sample of the same patient obtained from a non-cancerous part of the tissue which is the tissue of origin of the cancer, preferably 1.2- fold higher levels , more preferably 1.5-fold higher levels , still more preferably 2-fold higher levels and most preferably 5-fold higher levels .
- the antibody or antigen-binding portion thereof of item 38 for the use according to item 38 wherein the an ibody or antigen-binding portion thereof is used in combination with one or more further ingredients pharmaceutically active against cancer, and wherein the one or more further ingredients pharmaceutically active against cancer are selected from the group consisting of: alkylating agents ; anti-metabolites ; alkaloids , taxanes ; topoisomerase inhibitors; cytotoxic
- mechlorethamine cyclophosphamide , chlorambucil , and ifosfamide ; azathioprine and merca topurine ;
- vincristine vinblastine, vinorelbine , and vindesine, paclitaxel , docetaxel , etoposide and. teniposide ;
- irinotecan and topotecan actinomycin, anthracyclines , doxorubicin, daunorubicin, valrubicin, idarubicin, epirubicin, bleomycin, plicamycin and mitomycin.
- a kit comprising the antibody or antigen-binding portion thereof of any one of items 1-19.
- An expression vector comprising a nucleotide sequence encoding the antibody or antigen-binding portion thereof according to any of items 1-19.
- the method for treating cancer cachexia is a method for completely preventing cancer cachexia .
- the antibody or antigen-binding portion thereof of item 47 for the use according to item 47 , wherein the method for treating cancer cachexia is a method for completely reverting cancer cachexia .
- the antibody or antigen-binding portion thereof of item 51 for the use according to item 51 wherein the increase in body weight of the mammal is at least 1.5%, preferably at least 2.5%, more preferably at least 5% compared to its body weight before the onset of cancer cachexia .
- any one of items 45-53 for the use according to any one of items 45-53 wherein the antibody has a size of more than 100 kDa, preferably more than 110 kDa, more preferably more than 120 kDa, still more preferably more than 130 kDa , and most preferably more than 140 kDa.
- the antibody is a full-length antibody.
- the antibody is a full-length IgG antibody .
- the antibody or antigen-binding portion thereof of any one of items 45 to 57 for the use according to any one of items 45 to 57 wherein the cancer cells of the mammal endogenously express GDF-15 and/or the cancer cells of the mammal stimulate endogenous expression of GDF-15 in non-cancerous cells of the mammal .
- any one of items 45 to 58 for the use according to any one of items 45 to 58 , wherein the cancer cells of the mammal endogenously express GDF-15.
- the heavy chain variable domain comprises a CDR3 region comprising the amino acid sequence of SEQ ID NO: 5 or an amino acid sequence at least 90% identical thereto, and wherein the light chain variable domain comprises a CDR3 region
- any one of items 45 and 47-61 for the use according to any one of items 45 and 47-61 , wherei the binding is binding to a conformational or discontinuous epitope on human GDF-15 that is comprised by the amino acid sequences of SEQ ID No: 25 and SEQ ID No: 26.
- the method for treating cancer is a method comprising inhibition of cancer growth.
- any one of items 53-64 for the use according to any one of items 53 - 64 , wherein the method for treating cancer comprises the induction of killing of cancer cells by NK cells and CD8+ T cells in the human patient .
- any one of items 45-65 for the use according to any one of items 45 -65 , wherein the heavy chain variable domain comprises a CDR1 region comprising the amino acid sequence of SEQ ID NO: 3 and a CDR2 region comprising the amino acid sequence of SEQ ID NO: 4, and wherein the light chain variable domain comprises a CDR1 region comprising the amino acid sequence of SEQ ID NO: 6 and a CDR2 region comprising the amino acid sequence ser- ala-ser .
- any one of items 45-66 for the use according to any one of items 45 - 66 wherein the constant domain of the heavy chain comprises the amino acid sequence of SEQ ID No: 29, or an amino acid sequence at least 85% , preferably at least 90% , more preferably at least 95% identical, thereto, and wherein the constant domain of the light chain comprises the amino acid sequence of SEQ ID No: 32, or an amino acid sequence at least 85% , preferably at least 90% , more preferably at least 95% identical thereto .
- the constant domain of the heavy chain comprises the amino acid sequence of SEQ ID No: 29, or an amino acid sequence at least 98%, preferably at least 99% identical thereto, and wherein the
- constant domain of the light chain comprises the amino acid sequence of SEQ ID No: 32 , or an amino acid sequence at least 98%, preferably at least 99%
- the heavy chain variable domain comprises the amino acid sequence of SEQ ID No: 28, or an amino acid sequence at least 90%, preferably at least 95%, more preferably at least 98%, still more preferably at least 99% identical thereto
- the light chain variable domain comprises the amino acid sequence of SEQ ID No: 31, or an amino acid sequence at least 90 ⁇ %, preferably at least 95%, more preferably at least 98%, still more preferably at least 99% identical thereto.
- the light chain variable domain comprises the amino acid sequence of SEQ ID No: 37, or an amino acid sequence at least 80%, more preferably at least 90%, more preferably at least 95% , more preferably at least 98% , still more
- DSMZ Mikroorganismen und Zellkulturen GmbH
- the heavy chain variable domain comprises a region comprising an FR1 , a CDR1 , an FR2 , a CDR2 and an FR3 region and comprising the amino acid sequence of SEQ ID NO: 1 or a sequence 95% identical thereto
- the light chain variable domain comprises a region comprising an FR1 , a CDR1 , an FR2 , a CDR2 and an FR3 region and comprising the amino acid sequence of SEQ ID NO: 2 or a sequence 95% identical thereto.
- the heavy chain variable domain comprises a region comprising an FR1 , a CDR1 , an FR2 , a CDR2 and an FR3 region and comprising the amino acid sequence of SEQ ID NO: 1 or a sequence 98% identical thereto
- the light chain variable domain comprises a region comprising an FR1, a CDR1, an FR2 , a CDR2 and an FR3 region and comprising the amino acid sequence of SEQ ID NO: 2 or a sequence 98% identical thereto .
- constant for human GDF-15 that is equal to or less than 20 nM, preferably less than 10 nM, more preferably less than 5 nM and most preferably between 0.1 nM and 2 nM.
- DMSZ Deutsche Sammlung fur Mikroorganismen und Zellkulturen GmbH
- any one of items 45-84 for the use according to any one of items 45 -84 wherein the cancer is selected from the group consisting of brain cancers including glioma, cancers of the nervous system, melanoma, lung cancer, lip and oral cavity cancer , hepatic carcinoma ,
- leukemia Hodgkin lymphoma, Non-Hodgkin lymphoma, bladder cancer, cervix uteri cancer, corpus uteri cancer, testis cancer , thyroid cancer, kidney cancer , gallbladder cancer, multiple myeloma, nasopharynx cancer, larynx cancer, pharynx cancer, oesophagus cancer, gastrointestinal tumors including stomach and colorectal cancer, pancreatic cancer, prostate cancer, ovarian cancer and breast cancer, preferably from the group consisting of melanoma, prostate cancer , breast cancer, brain cancers including glioma, colorectal cancer, stomach cancer, oesophagus cancer and ovarian cancer, and most preferably is melanoma .
- any one of items 45-85 for the use according to any one of items 45 - 85 wherein prior to administration, the tumor or tumors formed by the cancer have higher human GDF-15 levels compared to a control sample of the same patient obtained from a non-cancerous part of the tissue which is the tissue of origin of the cancer, preferably 1.2- fold higher levels , more preferably 1.5- fold higher levels , still more preferably 2-fold higher levels and most preferably 5-fold higher levels .
- mechlorethamine cyclophosphamide, chlorambucil, and ifosfamide; azathioprine and mercaptopurine ;
- vincristine vinblastine, vinorelbine, and vindesine, paclitaxel , docetaxel , etoposide and teniposide ;
- irinotecan and topotecan actinomycin, anthracyc1ines , doxorubicin, daunorubicin, valrubicin, idarubicin, epirubicin, bleomycin, plicamycin and mitomycin.
- Rabat et al . Sequences of proteins of immunological interest, U.S. Dept. of Health and Human Services, Public Health Service , National Institutes of Health, Bethesda, Md. 1983.
- Mimeault M and Batra SK "Divergent molecular mechanisms underlying the pleiotropic functions of macrophage inhibitory cytokine-1 in cancer. " J Cell Physiol.. 2010 Sep 224 (3) ; 626- 35.
Abstract
Description
Claims
Priority Applications (27)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
KR1020167029710A KR102520978B1 (en) | 2014-03-26 | 2015-03-26 | Monoclonal antibodies to growth and differentiation factor 15 (gdf-15), and uses thereof for treating cancer cachexia and cancer |
EP15712629.3A EP3122775B1 (en) | 2014-03-26 | 2015-03-26 | Monoclonal antibodies to growth and differentiation factor 15 (gdf-15), and uses thereof for treating cancer cachexia and cancer |
CA2943694A CA2943694A1 (en) | 2014-03-26 | 2015-03-26 | Monoclonal antibodies to growth and differentiation factor 15 (gdf-15), and uses thereof for treating cancer cachexia and cancer |
EP19205321.3A EP3653644B1 (en) | 2014-03-26 | 2015-03-26 | Monoclonal antibodies to growth and differentiation factor 15 (gdf-15), and uses thereof for treating cancer cachexia and cancer |
NZ724649A NZ724649A (en) | 2014-03-26 | 2015-03-26 | Monoclonal antibodies to growth and differentiation factor 15 (gdf-15), and uses thereof for treating cancer cachexia and cancer |
DK15712629.3T DK3122775T3 (en) | 2014-03-26 | 2015-03-26 | MONOCLONAL ANTIBODIES FOR GROWTH AND DIFFERENTIATION FACTOR 15 (GDF-15), AND ITS APPLICATIONS FOR TREATING CANCER KAKEKSI AND CANCER |
ES15712629T ES2763859T3 (en) | 2014-03-26 | 2015-03-26 | Monoclonal Antibodies to Growth and Differentiation Factor 15 (GDF-15), and Uses thereof to Treat Cancer Cachexia and Cancer |
PL15712629T PL3122775T3 (en) | 2014-03-26 | 2015-03-26 | Monoclonal antibodies to growth and differentiation factor 15 (gdf-15), and uses thereof for treating cancer cachexia and cancer |
BR112016022013A BR112016022013A2 (en) | 2014-03-26 | 2015-03-26 | monoclonal antibodies for growth factor and differentiation 15 (gdf-15) and uses of them to treat cancer cachexia |
JP2016559286A JP6865585B2 (en) | 2014-03-26 | 2015-03-26 | Monoclonal antibody against growth differentiation factor 15 (GDF-15) and its use for treating cancer cachexia and cancer |
EP23203704.4A EP4316596A3 (en) | 2014-03-26 | 2015-03-26 | Monoclonal antibodies to growth and differentiation factor 15 (gdf-15), and uses thereof for treating cancer cachexia and cancer |
RS20191652A RS59700B1 (en) | 2014-03-26 | 2015-03-26 | Monoclonal antibodies to growth and differentiation factor 15 (gdf-15), and uses thereof for treating cancer cachexia and cancer |
AU2015238264A AU2015238264B2 (en) | 2014-03-26 | 2015-03-26 | Monoclonal antibodies to growth and differentiation factor 15 (GDF-15), and uses thereof for treating cancer cachexia and cancer |
BR122023027559-4A BR122023027559A2 (en) | 2014-03-26 | 2015-03-26 | MONOCLONAL ANTIBODIES TO GROWTH AND DIFFERENTIATION FACTOR 15 (GDF-15), CASE COMPRISING THEM, EXPRESSION VECTOR THAT CODES THEM AND CELL LINE CAPABLE OF PRODUCING THEM |
SI201531059T SI3122775T1 (en) | 2014-03-26 | 2015-03-26 | Monoclonal antibodies to growth and differentiation factor 15 (gdf-15), and uses thereof for treating cancer cachexia and cancer |
US15/128,604 US20170204174A1 (en) | 2014-03-26 | 2015-03-26 | Monoclonal antibodies to growth and differentiation factor 15 (gdf-15), and uses thereof for treating cancer cachexia and cancer |
CN201580027932.8A CN106536553B (en) | 2014-03-26 | 2015-03-26 | Monoclonal antibodies to growth and differentiation factor 15(GDF-15) and their use for treating cancer cachexia and cancer |
LTEP15712629.3T LT3122775T (en) | 2014-03-26 | 2015-03-26 | Monoclonal antibodies to growth and differentiation factor 15 (gdf-15), and uses thereof for treating cancer cachexia and cancer |
IL248038A IL248038B (en) | 2014-03-26 | 2016-09-26 | Monoclonal antibodies to growth and differentiation factor 15 (gdf-15), and uses thereof for treating cancer cachexia and cancer |
US15/912,358 US10604565B2 (en) | 2014-03-26 | 2018-03-05 | Monoclonal antibodies to growth and differentiation factor 15 (GDF-15), and uses thereof for treating cancer cachexia and cancer |
CY20201100008T CY1122456T1 (en) | 2014-03-26 | 2020-01-08 | MONOCLONAL ANTIBODIES AGAINST GROWTH AND DIFFERENTIATION FACTOR 15 (GDF-15), AND USES THEREOF FOR THE THERAPEUTIC TREATMENT OF CANCER CACHESIS AND CANCER |
HRP20200034TT HRP20200034T1 (en) | 2014-03-26 | 2020-01-09 | Monoclonal antibodies to growth and differentiation factor 15 (gdf-15), and uses thereof for treating cancer cachexia and cancer |
US16/794,406 US11760795B2 (en) | 2014-03-26 | 2020-02-19 | Monoclonal antibodies to growth and differentiation factor 15 (GDF-15), and uses thereof for treating cancer cachexia and cancer |
US16/794,401 US11634482B2 (en) | 2014-03-26 | 2020-02-19 | Monoclonal antibodies to growth and differentiation factor 15 (GDF-15), and uses thereof for treating cancer cachexia and cancer |
IL276405A IL276405B (en) | 2014-03-26 | 2020-07-30 | Monoclonal antibodies to growth and differentiation factor 15 (gdf-15), and uses thereof for treating cancer cachexia and cancer |
AU2020260440A AU2020260440B2 (en) | 2014-03-26 | 2020-10-28 | Monoclonal antibodies to growth and differentiation factor 15 (GDF-15), and uses thereof for treating cancer cachexia and cancer |
US18/364,173 US20230382987A1 (en) | 2014-03-26 | 2023-08-02 | Monoclonal antibodies to growth and differentiation factor 15 (gdf-15), and usesthereof for treating cancer cachexia and cancer |
Applications Claiming Priority (4)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
GB1405475.3A GB2524552B (en) | 2014-03-26 | 2014-03-26 | Monoclonal antibodies to growth and differentiation factor 15 (GDF-15), and use thereof for treating cancer |
GB1405475.3 | 2014-03-26 | ||
GB1405477.9A GB2524553C (en) | 2014-03-26 | 2014-03-26 | Monoclonal antibodies to growth and differentiation factor 15 (GDF-15), and uses thereof for treating cancer cachexia |
GB1405477.9 | 2014-03-26 |
Related Child Applications (3)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US15/128,604 A-371-Of-International US20170204174A1 (en) | 2014-03-26 | 2015-03-26 | Monoclonal antibodies to growth and differentiation factor 15 (gdf-15), and uses thereof for treating cancer cachexia and cancer |
US201615128604A Continuation | 2014-03-26 | 2016-09-23 | |
US15/912,358 Continuation US10604565B2 (en) | 2014-03-26 | 2018-03-05 | Monoclonal antibodies to growth and differentiation factor 15 (GDF-15), and uses thereof for treating cancer cachexia and cancer |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2015144855A1 true WO2015144855A1 (en) | 2015-10-01 |
Family
ID=52745885
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/EP2015/056654 WO2015144855A1 (en) | 2014-03-26 | 2015-03-26 | Monoclonal antibodies to growth and differentiation factor 15 (gdf-15), and uses thereof for treating cancer cachexia and cancer |
Country Status (22)
Country | Link |
---|---|
US (5) | US20170204174A1 (en) |
EP (3) | EP3122775B1 (en) |
JP (3) | JP6865585B2 (en) |
KR (1) | KR102520978B1 (en) |
CN (1) | CN106536553B (en) |
AU (2) | AU2015238264B2 (en) |
BR (2) | BR122023027559A2 (en) |
CA (1) | CA2943694A1 (en) |
CY (1) | CY1122456T1 (en) |
DK (2) | DK3653644T3 (en) |
ES (2) | ES2763859T3 (en) |
FI (1) | FI3653644T3 (en) |
HR (2) | HRP20231514T1 (en) |
HU (2) | HUE047398T2 (en) |
IL (2) | IL248038B (en) |
LT (2) | LT3653644T (en) |
NZ (1) | NZ724649A (en) |
PL (2) | PL3122775T3 (en) |
PT (2) | PT3653644T (en) |
RS (1) | RS59700B1 (en) |
SI (1) | SI3122775T1 (en) |
WO (1) | WO2015144855A1 (en) |
Cited By (13)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2017055612A1 (en) * | 2015-10-02 | 2017-04-06 | Julius-Maximilians-Universität Würzburg | Gdf-15 as a diagnostic marker to predict the clinical outcome of a treatment with immune checkpoint blockers |
WO2017055614A1 (en) * | 2015-10-02 | 2017-04-06 | Julius-Maximilians-Universität Würzburg | Gdf-15 as a diagnostic marker for melanoma |
WO2017055613A3 (en) * | 2015-10-02 | 2017-07-06 | Julius-Maximilians-Universität Würzburg | Combination therapy using inhibitors of human growth and differentiation factor 15 (gdf-15) and immune checkpoint blockers |
WO2017189724A1 (en) * | 2016-04-27 | 2017-11-02 | Novartis Ag | Antibodies against growth differentiation factor 15 and uses thereof |
WO2018071493A1 (en) * | 2016-10-12 | 2018-04-19 | Janssen Biotech, Inc. | Methods for screening for modulators of gdf15-like biological activity |
WO2018102854A1 (en) * | 2016-12-06 | 2018-06-14 | St Vincent's Hospital Sydney Limited | Treatment of obesity and eating disorders |
KR20190025954A (en) * | 2016-07-06 | 2019-03-12 | 내셔날 리서치 카운실 오브 캐나다 | Humanized antibodies that pass through the blood-brain barrier and uses thereof |
WO2020039321A3 (en) * | 2018-08-20 | 2020-05-07 | Pfizer Inc. | Anti-gdf15 antibodies, compositions and methods of use |
EP3197493B1 (en) | 2014-09-25 | 2021-03-10 | Aveo Pharmaceuticals Inc. | Methods of reversing cachexia and prolonging survival comprising administering a gdf15 modulator and an anti-cancer agent |
WO2022101263A1 (en) * | 2020-11-10 | 2022-05-19 | Catalym Gmbh | Anti-gdf15 antibody and a dosage regimen for the treatment of cancer |
WO2022207846A1 (en) | 2021-03-31 | 2022-10-06 | Cambridge Enterprise Limited | Therapeutic inhibitors of gdf15 signalling |
RU2795457C2 (en) * | 2018-08-20 | 2023-05-03 | Пфайзер Инк. | Anti-gdf15 antibodies, compositions and methods of use |
WO2023217068A1 (en) * | 2022-05-09 | 2023-11-16 | 舒泰神(北京)生物制药股份有限公司 | Antibody that specifically recognizes gdf15 and use thereof |
Families Citing this family (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
RS59700B1 (en) | 2014-03-26 | 2020-01-31 | Univ Wuerzburg J Maximilians | Monoclonal antibodies to growth and differentiation factor 15 (gdf-15), and uses thereof for treating cancer cachexia and cancer |
IL310535A (en) | 2021-08-10 | 2024-03-01 | Byomass Inc | Anti-gdf15 antibodies, compositions and uses thereof |
WO2023122213A1 (en) | 2021-12-22 | 2023-06-29 | Byomass Inc. | Targeting gdf15-gfral pathway cross-reference to related applications |
Citations (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2005099746A1 (en) * | 2004-04-13 | 2005-10-27 | St Vincent's Hospital Sydney Limited | Method for modulating appetite |
WO2009021293A1 (en) * | 2007-08-16 | 2009-02-19 | St Vincent's Hospital Sydney Limited | Agents and methods for modulating macrophage inhibitory cytokine (mic-1) activity |
US20110262444A1 (en) * | 2010-03-03 | 2011-10-27 | Detroit R&D, Inc. | Form-specific antibodies for nag-1 (mic-1, gdf-15), h6d and other tgf-beta subfamily and heart disease and cancer diagnoses |
WO2014049087A1 (en) * | 2012-09-26 | 2014-04-03 | Julius-Maximilians-Universität Würzburg | Monoclonal antibodies to growth and differentiation factor 15 (gdf-15) |
WO2014100689A1 (en) * | 2012-12-21 | 2014-06-26 | Aveo Pharmaceuticals, Inc. | Anti-gdf15 antibodies |
Family Cites Families (15)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US6455677B1 (en) * | 1998-04-30 | 2002-09-24 | Boehringer Ingelheim International Gmbh | FAPα-specific antibody with improved producibility |
EP0953639A1 (en) * | 1998-04-30 | 1999-11-03 | Boehringer Ingelheim International GmbH | FAPalpha-specific antibody with improved producibility |
US6465181B2 (en) | 1999-03-25 | 2002-10-15 | Abbott Laboratories | Reagents and methods useful for detecting diseases of the prostate |
DE60032355T2 (en) | 1999-05-17 | 2007-04-26 | Biopharm Gesellschaft Zur Biotechnologischen Entwicklung Und Zum Vertrieb Von Pharmaka Mbh | NEUROPROTECTIVE PROPERTIES OF GDF-15, A REPRESENTATIVE OF THE TGF-β SUPERFAMILY |
US7141661B2 (en) | 2000-09-08 | 2006-11-28 | The United States Of America As Represented By The Department Of Health And Human Services | Non-steroidal anti-inflammatory drug activated gene with anti-tumorigenic properties |
HUE026132T2 (en) * | 2004-01-07 | 2016-05-30 | Novartis Vaccines & Diagnostics Inc | M-csf-specific monoclonal antibody and uses thereof |
CN101896192A (en) * | 2007-10-09 | 2010-11-24 | 圣文森特医院悉尼有限公司 | A kind of by removing or inactivation of macrophage inhibitive factor-1 is treated cachectic method |
ES2493042T3 (en) | 2008-09-29 | 2014-09-11 | Roche Glycart Ag | Antibodies against human IL-17 and their uses |
WO2011050407A1 (en) | 2009-10-28 | 2011-05-05 | St Vincent's Hospital Sydney Limited | Methods of diagnosing and prognosing colonic polyps |
DK2644698T3 (en) * | 2010-11-17 | 2018-01-22 | Chugai Pharmaceutical Co Ltd | MULTI-SPECIFIC ANTIGEN-BINDING MOLECULE WITH ALTERNATIVE FUNCTION TO BLOOD COAGULATION FACTOR FUNCTION VIII |
US8790651B2 (en) | 2011-07-21 | 2014-07-29 | Zoetis Llc | Interleukin-31 monoclonal antibody |
CN102321173B (en) | 2011-08-12 | 2013-04-03 | 中国医学科学院肿瘤研究所 | Humanized macrophage inhibitory factor 1 monoclonal antibody and application thereof |
EP2565262A1 (en) | 2011-08-31 | 2013-03-06 | VTU Holding GmbH | Protein expression |
CA2862745A1 (en) | 2012-01-26 | 2013-08-01 | Amgen Inc. | Growth differentiation factor 15 (gdf-15) polypeptides |
RS59700B1 (en) | 2014-03-26 | 2020-01-31 | Univ Wuerzburg J Maximilians | Monoclonal antibodies to growth and differentiation factor 15 (gdf-15), and uses thereof for treating cancer cachexia and cancer |
-
2015
- 2015-03-26 RS RS20191652A patent/RS59700B1/en unknown
- 2015-03-26 DK DK19205321.3T patent/DK3653644T3/en active
- 2015-03-26 BR BR122023027559-4A patent/BR122023027559A2/en unknown
- 2015-03-26 KR KR1020167029710A patent/KR102520978B1/en active IP Right Grant
- 2015-03-26 PT PT192053213T patent/PT3653644T/en unknown
- 2015-03-26 HU HUE15712629A patent/HUE047398T2/en unknown
- 2015-03-26 BR BR112016022013A patent/BR112016022013A2/en active Search and Examination
- 2015-03-26 PT PT157126293T patent/PT3122775T/en unknown
- 2015-03-26 JP JP2016559286A patent/JP6865585B2/en active Active
- 2015-03-26 HU HUE19205321A patent/HUE064573T2/en unknown
- 2015-03-26 EP EP15712629.3A patent/EP3122775B1/en active Active
- 2015-03-26 AU AU2015238264A patent/AU2015238264B2/en active Active
- 2015-03-26 SI SI201531059T patent/SI3122775T1/en unknown
- 2015-03-26 PL PL15712629T patent/PL3122775T3/en unknown
- 2015-03-26 CA CA2943694A patent/CA2943694A1/en active Pending
- 2015-03-26 LT LTEP19205321.3T patent/LT3653644T/en unknown
- 2015-03-26 DK DK15712629.3T patent/DK3122775T3/en active
- 2015-03-26 LT LTEP15712629.3T patent/LT3122775T/en unknown
- 2015-03-26 EP EP19205321.3A patent/EP3653644B1/en active Active
- 2015-03-26 CN CN201580027932.8A patent/CN106536553B/en active Active
- 2015-03-26 WO PCT/EP2015/056654 patent/WO2015144855A1/en active Application Filing
- 2015-03-26 US US15/128,604 patent/US20170204174A1/en not_active Abandoned
- 2015-03-26 FI FIEP19205321.3T patent/FI3653644T3/en active
- 2015-03-26 ES ES15712629T patent/ES2763859T3/en active Active
- 2015-03-26 HR HRP20231514TT patent/HRP20231514T1/en unknown
- 2015-03-26 NZ NZ724649A patent/NZ724649A/en unknown
- 2015-03-26 PL PL19205321.3T patent/PL3653644T3/en unknown
- 2015-03-26 ES ES19205321T patent/ES2965626T3/en active Active
- 2015-03-26 EP EP23203704.4A patent/EP4316596A3/en active Pending
-
2016
- 2016-09-26 IL IL248038A patent/IL248038B/en active IP Right Grant
-
2018
- 2018-03-05 US US15/912,358 patent/US10604565B2/en active Active
-
2020
- 2020-01-08 CY CY20201100008T patent/CY1122456T1/en unknown
- 2020-01-09 HR HRP20200034TT patent/HRP20200034T1/en unknown
- 2020-02-19 US US16/794,406 patent/US11760795B2/en active Active
- 2020-02-19 US US16/794,401 patent/US11634482B2/en active Active
- 2020-07-30 IL IL276405A patent/IL276405B/en unknown
- 2020-10-28 AU AU2020260440A patent/AU2020260440B2/en active Active
-
2021
- 2021-04-06 JP JP2021064572A patent/JP2021119138A/en active Pending
-
2023
- 2023-04-06 JP JP2023062338A patent/JP2023098966A/en active Pending
- 2023-08-02 US US18/364,173 patent/US20230382987A1/en active Pending
Patent Citations (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2005099746A1 (en) * | 2004-04-13 | 2005-10-27 | St Vincent's Hospital Sydney Limited | Method for modulating appetite |
WO2009021293A1 (en) * | 2007-08-16 | 2009-02-19 | St Vincent's Hospital Sydney Limited | Agents and methods for modulating macrophage inhibitory cytokine (mic-1) activity |
US20110262444A1 (en) * | 2010-03-03 | 2011-10-27 | Detroit R&D, Inc. | Form-specific antibodies for nag-1 (mic-1, gdf-15), h6d and other tgf-beta subfamily and heart disease and cancer diagnoses |
WO2014049087A1 (en) * | 2012-09-26 | 2014-04-03 | Julius-Maximilians-Universität Würzburg | Monoclonal antibodies to growth and differentiation factor 15 (gdf-15) |
WO2014100689A1 (en) * | 2012-12-21 | 2014-06-26 | Aveo Pharmaceuticals, Inc. | Anti-gdf15 antibodies |
Non-Patent Citations (1)
Title |
---|
W. DOUGLAS FAIRLIE ET AL: "Epitope Mapping of the Transforming Growth Factor-[beta] Superfamily Protein, Macrophage Inhibitory Cytokine-1 (MIC-1): Identification of at Least Five Distinct Epitope Specificities +", BIOCHEMISTRY, vol. 40, no. 1, 1 January 2001 (2001-01-01), pages 65 - 73, XP055089324, ISSN: 0006-2960, DOI: 10.1021/bi001064p * |
Cited By (31)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP3197493B1 (en) | 2014-09-25 | 2021-03-10 | Aveo Pharmaceuticals Inc. | Methods of reversing cachexia and prolonging survival comprising administering a gdf15 modulator and an anti-cancer agent |
AU2016333538B2 (en) * | 2015-10-02 | 2022-03-31 | Julius-Maximilians-Universität Würzburg | GDF-15 as a diagnostic marker to predict the clinical outcome of a treatment with immune checkpoint blockers |
EP4321866A3 (en) * | 2015-10-02 | 2024-03-20 | Julius-Maximilians-Universität Würzburg | Gdf-15 as a diagnostic marker to predict the clinical outcome of a treatment with immune checkpoint blockers |
KR102621034B1 (en) | 2015-10-02 | 2024-01-03 | 율리우스-막시밀리안스 우니버지태트 뷔르츠부르크 | GDF-15 as a diagnostic marker to predict the clinical course of treatment with immune checkpoint blockers |
EP4218809A3 (en) * | 2015-10-02 | 2023-08-09 | Julius-Maximilians-Universität Würzburg | Combination therapy using inhibitors of human growth and differentiation factor 15 (gdf-15) and immune checkpoint blockers |
KR20180054867A (en) * | 2015-10-02 | 2018-05-24 | 율리우스-막시밀리안스 우니버지태트 뷔르츠부르크 | GDF-15 as a diagnostic marker for predicting the clinical course of treatment with immune checkpoint blockers |
IL258393B1 (en) * | 2015-10-02 | 2023-04-01 | Univ Wuerzburg J Maximilians | Combination therapy using inhibitors of human growth and differentiation factor 15 (gdf-15) and immune checkpoint blockers |
CN108463246A (en) * | 2015-10-02 | 2018-08-28 | 尤利乌斯·马克西米利安维尔茨堡大学 | User's growth and differentiation factor 15 (GDF-15) inhibitor and immunologic test order the combination therapy of blocking agent |
AU2016333539B2 (en) * | 2015-10-02 | 2023-02-23 | Julius-Maximilians-Universitat Wurzburg | Combination therapy using inhibitors of human Growth and Differentiation Factor 15 (GDF-15) and immune checkpoint blockers |
WO2017055613A3 (en) * | 2015-10-02 | 2017-07-06 | Julius-Maximilians-Universität Würzburg | Combination therapy using inhibitors of human growth and differentiation factor 15 (gdf-15) and immune checkpoint blockers |
EP3355919B1 (en) | 2015-10-02 | 2022-12-07 | Julius-Maximilians-Universität Würzburg | Combination therapy using inhibitors of human growth and differentiation factor 15 (gdf-15) and immune checkpoint blockers |
WO2017055614A1 (en) * | 2015-10-02 | 2017-04-06 | Julius-Maximilians-Universität Würzburg | Gdf-15 as a diagnostic marker for melanoma |
US11464856B2 (en) | 2015-10-02 | 2022-10-11 | Julius-Maximilians-Universität Würzburg | Combination therapy using inhibitors of human growth and differentiation factor 15 (GDF-15) and immune checkpoint blockers |
US11262360B2 (en) | 2015-10-02 | 2022-03-01 | Julius-Maximilians-Universität Würzburg | GDF-15 as a diagnostic marker to predict the clinical outcome of a treatment with immune checkpoint blockers |
WO2017055612A1 (en) * | 2015-10-02 | 2017-04-06 | Julius-Maximilians-Universität Würzburg | Gdf-15 as a diagnostic marker to predict the clinical outcome of a treatment with immune checkpoint blockers |
JP2019521647A (en) * | 2016-04-27 | 2019-08-08 | ノバルティス アーゲー | Antibodies against growth differentiation factor 15 and their use |
JP7138567B2 (en) | 2016-04-27 | 2022-09-16 | ノバルティス アーゲー | Antibodies against growth differentiation factor 15 and their uses |
US11312766B2 (en) | 2016-04-27 | 2022-04-26 | Novartis Ag | Antibodies against growth differentiation factor 15 and uses thereof |
WO2017189724A1 (en) * | 2016-04-27 | 2017-11-02 | Novartis Ag | Antibodies against growth differentiation factor 15 and uses thereof |
KR20190025954A (en) * | 2016-07-06 | 2019-03-12 | 내셔날 리서치 카운실 오브 캐나다 | Humanized antibodies that pass through the blood-brain barrier and uses thereof |
KR102406610B1 (en) | 2016-07-06 | 2022-06-08 | 내셔날 리서치 카운실 오브 캐나다 | Humanized Antibodies Crossing the Blood-Brain Barrier and Uses Thereof |
WO2018071493A1 (en) * | 2016-10-12 | 2018-04-19 | Janssen Biotech, Inc. | Methods for screening for modulators of gdf15-like biological activity |
WO2018102854A1 (en) * | 2016-12-06 | 2018-06-14 | St Vincent's Hospital Sydney Limited | Treatment of obesity and eating disorders |
RU2795457C2 (en) * | 2018-08-20 | 2023-05-03 | Пфайзер Инк. | Anti-gdf15 antibodies, compositions and methods of use |
US11566066B2 (en) | 2018-08-20 | 2023-01-31 | Pfizer Inc. | Anti-GDF15 antibodies, compositions and methods of use |
WO2020039321A3 (en) * | 2018-08-20 | 2020-05-07 | Pfizer Inc. | Anti-gdf15 antibodies, compositions and methods of use |
TWI803682B (en) * | 2018-08-20 | 2023-06-01 | 美商輝瑞股份有限公司 | Anti-gdf15 antibodies, compositions and methods of use |
CN112912395A (en) * | 2018-08-20 | 2021-06-04 | 辉瑞公司 | anti-GDF 15 antibodies, compositions, and methods of use |
WO2022101263A1 (en) * | 2020-11-10 | 2022-05-19 | Catalym Gmbh | Anti-gdf15 antibody and a dosage regimen for the treatment of cancer |
WO2022207846A1 (en) | 2021-03-31 | 2022-10-06 | Cambridge Enterprise Limited | Therapeutic inhibitors of gdf15 signalling |
WO2023217068A1 (en) * | 2022-05-09 | 2023-11-16 | 舒泰神(北京)生物制药股份有限公司 | Antibody that specifically recognizes gdf15 and use thereof |
Also Published As
Similar Documents
Publication | Publication Date | Title |
---|---|---|
AU2020260440B2 (en) | Monoclonal antibodies to growth and differentiation factor 15 (GDF-15), and uses thereof for treating cancer cachexia and cancer | |
US11891436B2 (en) | Monoclonal antibodies to growth and differentiation factor 15 (GDF-15) | |
GB2524553A (en) | Monoclonal antibodies to growth and differentiation factor 15 (GDF-15), and use thereof for treating cancer cachexia | |
GB2524552A (en) | Monoclonal antibodies to growth and differentiation factor 15 (GDF-15), and use thereof for treating cancer |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 15712629 Country of ref document: EP Kind code of ref document: A1 |
|
ENP | Entry into the national phase |
Ref document number: 2943694 Country of ref document: CA |
|
WWE | Wipo information: entry into national phase |
Ref document number: 15128604 Country of ref document: US |
|
ENP | Entry into the national phase |
Ref document number: 2016559286 Country of ref document: JP Kind code of ref document: A |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
WWE | Wipo information: entry into national phase |
Ref document number: 248038 Country of ref document: IL |
|
REEP | Request for entry into the european phase |
Ref document number: 2015712629 Country of ref document: EP |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2015712629 Country of ref document: EP |
|
ENP | Entry into the national phase |
Ref document number: 2015238264 Country of ref document: AU Date of ref document: 20150326 Kind code of ref document: A |
|
ENP | Entry into the national phase |
Ref document number: 20167029710 Country of ref document: KR Kind code of ref document: A |
|
REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112016022013 Country of ref document: BR |
|
ENP | Entry into the national phase |
Ref document number: 112016022013 Country of ref document: BR Kind code of ref document: A2 Effective date: 20160923 |