WO2015048534A1 - Synthetic combinatorial aav capsid library for targeted gene therapy - Google Patents

Synthetic combinatorial aav capsid library for targeted gene therapy Download PDF

Info

Publication number
WO2015048534A1
WO2015048534A1 PCT/US2014/057842 US2014057842W WO2015048534A1 WO 2015048534 A1 WO2015048534 A1 WO 2015048534A1 US 2014057842 W US2014057842 W US 2014057842W WO 2015048534 A1 WO2015048534 A1 WO 2015048534A1
Authority
WO
WIPO (PCT)
Prior art keywords
aav
serotype
nucleic acid
virion
nucleotide sequence
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2014/057842
Other languages
French (fr)
Inventor
Damien MARSIC
Sergei Zolotukhin
Mavis Agbandje-Mckenna
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
University of Florida
University of Florida Research Foundation Inc
Original Assignee
University of Florida
University of Florida Research Foundation Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by University of Florida, University of Florida Research Foundation Inc filed Critical University of Florida
Priority to JP2016517431A priority Critical patent/JP6985795B2/en
Priority to AU2014324717A priority patent/AU2014324717B2/en
Priority to US15/024,431 priority patent/US20160369298A1/en
Priority to EP19207549.7A priority patent/EP3633041A3/en
Priority to CA2930549A priority patent/CA2930549C/en
Priority to EP14848603.8A priority patent/EP3049527A4/en
Publication of WO2015048534A1 publication Critical patent/WO2015048534A1/en
Anticipated expiration legal-status Critical
Priority to US16/208,127 priority patent/US11091777B2/en
Ceased legal-status Critical Current

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • C12N15/86—Viral vectors
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N7/00—Viruses; Bacteriophages; Compositions thereof; Preparation or purification thereof
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2750/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
    • C12N2750/00011—Details
    • C12N2750/14011—Parvoviridae
    • C12N2750/14111—Dependovirus, e.g. adenoassociated viruses
    • C12N2750/14122—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2750/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
    • C12N2750/00011—Details
    • C12N2750/14011—Parvoviridae
    • C12N2750/14111—Dependovirus, e.g. adenoassociated viruses
    • C12N2750/14141—Use of virus, viral particle or viral elements as a vector
    • C12N2750/14143—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2750/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
    • C12N2750/00011—Details
    • C12N2750/14011—Parvoviridae
    • C12N2750/14111—Dependovirus, e.g. adenoassociated viruses
    • C12N2750/14141—Use of virus, viral particle or viral elements as a vector
    • C12N2750/14145—Special targeting system for viral vectors

Definitions

  • the present invention relates to the fields of molecular biology, medicine, and virology. More particularly, the invention relates to compositions and methods for producing modified adeno-associated virus (AAV) cap genes and combinatorial libraries of chimeric AAV vectors and virions; and in particular embodiments, for selecting for virions displaying cell-specific tropisms; and also for producing helper vectors that contain one or more modified, AAV cap genes.
  • AAV adeno-associated virus
  • the synthetic combinatorial AAV capsid libraries of the invention are useful in introducing into selected target host cells one or more nucleic acid molecules.
  • the viral vectors and genetic constructs disclosed herein are also useful in a variety of diagnostic and/or therapeutic gene-therapy regimens.
  • the invention provides novel AAV variants that transduce mouse liver nearly 200 times more efficiently than the corresponding, wild-type, unmodified AAV.
  • Adeno-associated virus is a single-stranded DNA virus belonging to the Parvoviridae family (Muzyczka and Berns, 2001).
  • AAV-derived vectors are promising tools for human gene therapy applications because of their absence of pathogenicity, low immunogenicity, episomal localization and stable transgene expression.
  • significant limitations to the clinical use of AAV are its promiscuity and its susceptibility to neutralization by human antibodies (Jeune et al., 2013). Both of these limitations are determined by nature of the amino acid residues exposed at the surface of the capsid. Therefore, major efforts aiming at developing useful and effective gene therapy vectors have been devoted to obtaining and studying capsid variants (Wu et ah, 2006).
  • the first approach was to study naturally occurring AAV isolates. So far, 13 serotypes have been formally characterized and hundreds of variant isolates have been sequenced. Additional capsid variation has been investigated through the generation of mosaics (viral particles made of capsid proteins from more than one serotype) (Hauck et al., 2003; Stachler and Bartlett, 2006; Gigout et ah, 2005), chimeras (capsid proteins with domains from various origins) (Shen et ah, 2007), and various substitutional or insertional mutants (Wu et ah, 2000). However, the most significant advances are expected to result from directed evolution approaches through the development of capsid libraries.
  • the present invention overcomes these and other limitations inherent in the art by providing novel capsid libraries, and methods for developing AAV variants that are capable of effectively targeting specific tissues and/or organs.
  • Various strategies have been described to generate AAV capsid libraries, including random peptide display, error-prone PCR or DNA shuffling.
  • the novel, gene synthesis-based approach described in the present application permits the alteration of only the amino acid residues that have side chains exposed to the capsid surface, as well as restricting diversity to naturally-occurring variants, thus improving compatibility with capsid structure and function and increasing the probability of generating useful variants.
  • AAV capsid protein sequences show nine variable regions (commonly designated loops 1 to 9), while the rest of the capsid is highly conserved.
  • the DNA sequence encoding one of these regions also encodes another protein (Assembly-Activating Protein or AAP) in a different frame, which makes it unpractical to modify, AAP being required for proper assembly of functional viral particles. Therefore, the present capsid library construction involved the introduction of variations in the other eight loops only.
  • the invention provides a non-naturally occurring nucleic acid comprising: (a) a first nucleotide sequence encoding at least one AAV Rep protein; and (b) a second nucleotide sequence encoding at least one AAV Cap protein, wherein the second nucleotide sequence comprises: (i) a polynucleotide encoding a portion of a Cap protein found in an AAV of a first serotype but not in an AAV of a second serotype differing from the first serotype; and (ii) a polynucleotide encoding a portion of a Cap protein found in the AAV of the second serotype, but not in the AAV of the first serotype, wherein the non-naturally occurring nucleic acid further comprises a first AAV terminal repeat and a second AAV terminal repeat, and the first and second nucleotide sequences are interposed between the first and the second AAV terminal repeats.
  • the first and the second AAV terminal repeats are preferably from serotype 2, and the first serotype is preferably serotype 1, serotype 2, serotype 3, serotype 4, serotype 5, serotype 6, serotype 7, serotype 8, serotype 9, serotype 10, or serotype 11.
  • the nucleic acid is comprised within a vector, and the AAV Rep protein is preferably from serotype 2.
  • the nucleic acid further may further include a third nucleotide sequence that encodes at least one molecule providing one or more helper function(s) preferably from an adenovirus, a herpesvirus, or a combination thereof.
  • the invention also provides a vector library that includes at least a first vector and a second vector, the first vector comprising a nucleic acid comprising: (a) a first nucleotide sequence encoding at least one AAV Rep protein; and (b) a second nucleotide sequence encoding at least one AAV Cap protein, wherein the second nucleotide sequence comprises: (i) a polynucleotide encoding a portion of a Cap protein found in an AAV of a first serotype but not in an AAV of a second serotype differing from the first serotype, and ((ii) a polynucleotide encoding a portion of a Cap protein found in the AAV of the second serotype, but not in the AAV of the first serotype, wherein the nucleic acid further comprises a first AAV TR and a second AAV TR, and the first and second nucleotide sequences are interposed between the first and the second AAV TRs
  • the vector libraries of the present invention may be incorporated into at least one host cell, such as a mammalian or insect host cell.
  • the invention further provides an AAV virion that includes a nucleic acid comprising: (a) a first nucleotide sequence encoding at least one AAV Rep protein; (b) a second nucleotide sequence encoding at least one AAV Cap protein, wherein the second nucleotide sequence comprises (i) a polynucleotide encoding a portion of a Cap protein found in an AAV of a first serotype but not in an AAV of a second serotype differing from the first serotype, and (ii) a polynucleotide encoding a portion of a Cap protein found in the AAV of the second serotype, but not in the AAV of the first serotype; and (c) a first and a second AAV TR, wherein the first and the second nucleotide sequences are interposed between the first and the second AAV TRs.
  • a nucleic acid comprising: (a) a first nucleotide sequence encoding at
  • the AAV virion will further preferably include at least one AAV Cap protein encoded by the second nucleotide sequence, and in certain applications, the Cap protein is preferably a wild-type AAV Cap protein.
  • the second nucleotide sequence may further optionally include a polynucleotide that encodes a portion of a Cap protein found in an AAV of a fourth serotype but not found in a Cap protein of an AAV of the first, second or third serotypes, and may further still include a polynucleotide that encodes a portion of a Cap protein found in an AAV of a fifth serotype but not found in a Cap protein of an AAV of the first, second, third or fourth serotypes.
  • the AAV virions of the invention will include a second nucleotide sequence that further includes a polynucleotide that encodes a portion of a Cap protein found in an AAV of a sixth serotype but not found in a Cap protein of an AAV of the first, second, third, fourth or fifth serotypes.
  • the AAV virions of the invention may include a second nucleotide sequence that further includes a polynucleotide that encodes a portion of a Cap protein found in an AAV of a seventh serotype but not found in a Cap protein of an AAV of the first, second, third, fourth, fifth or sixth serotypes., or similarly, include a polynucleotide that encodes a portion of a Cap protein found in an AAV of an eight serotype but not found in a Cap protein of an AAV of the first, second, third, fourth, fifth, sixth or seventh serotypes.
  • the nucleic acid contained within the AAV vector will preferably further include a DNA sequence that encodes one or more diagnostic, therapeutic, and/or prophylactic molecules.
  • the nucleic acid preferably further includes one or more expression control sequence(s) that effect cell- or tissue-specific expression of the therapeutic molecule.
  • the expression control sequence includes one or more promoters operably linked to the sequence encoding the therapeutic molecule, which is preferably a polypeptide, a peptide, or an R A.
  • FIG. 1A and FIG. IB show the nucleotide sequence of CapLib variable regions (VRs) and corresponding amino acid diversity.
  • Each VR region shows a nucleotide sequence (lowercase letters) as designed and encoded by synthetic oligonucleotides, including degenerate positions (IUPAC nucleotide code) highlighted in yellow.
  • the corresponding amino acid sequence (UPPERCASE letters above nucleotide sequence) encoded by all possible codon combinations is shown in the line/s above. Amino acids highlighted in blue were selected for the inclusion into the library sequence because they were found in one or more naturally-occurring 150 variants used for the library design, while those that are not highlighted represent an additional amino acid diversity encoded by the degenerate nucleotides.
  • amino acid residues not encoded by the WT AAV2 sequence that were introduced during design to increase transduction efficiency (Y/F) or eliminate heparin binding (R/A).
  • the amino acid residues in logo style shows the alignment of the sequences deduced from the NextGen sequencing of the library viral DNA.
  • the X-axis designates residue position (VPl numbering), and the Y-axis - the relative frequency of each amino acid at that position.
  • Amino acids are colored according to their chemical properties: polar amino acids are green; basic, blue; acidic, red; and hydrophobic amino acids are black;
  • FIG 2 shows a schematic representation of the CapLib design and construction steps.
  • AAV2 capsid is shown at the top of the chart whereby numbers represent the respective amino acid residues.
  • Variable region (VR) sub-libraries were packaged and purified (indicated by differentially colored VRs). DNAs from these individual sub-libraries were purified and used construct a final combined library;
  • FIG 3A, FIG 3B, and FIG 3C show variable regions (VRs) on the AAV2 capsid surface.
  • FIG 3A AAV2 capsid full capsid (assembled from 60 VP3 monomers shown to the right), displaying the location of the eight VRs, colored as described below the image of the monomer .
  • FIG 3B and FIG 3C respectively: LiA and LiC full capsids variants and their respective monomers. The mutated residues and their positions are shown by color and by number, respectively;
  • FIG 4A, FIG 4B, FIG 4C, FIG 4D, and FIG 4E show the analysis of packaged viral library complexity.
  • FIG 4A Shannon entropy of the viral library computed from 840 individual protein sequences. The X-axis designates residue position (VP1 numbering) and the Y-axis - computed value of the entropy;
  • FIG 4B Distribution of the distinct capsid sequences and their copy numbers;
  • FIG 4C Distribution of the number of mutations in the sample of analyzed protein sequences;
  • FIG 4D Distribution of the number of mutant VRs. The different combinations of mutated VRs are designated by the respective colors shown to the right of the graph.
  • FIG 4E Comparison of expected and observed percentages of mutant residues.
  • the X-axis designates residue position (VP1 numbering); the respective VR boundaries are shown below amino acid numbers for better orientation.
  • the Y-axis designates the percentage of the expected (introduced by design) mutation (blue) vs experimentally deduced from the sequencing of the plasmid library (red) vs viral library (green).
  • the similitude of the graphs height at each position indicates a relative neutrality of this position for the capsid assembly/structure, whereas the difference between a theoretical (blue) and plasmid-derived sequences (red) indicates a selective pressure against this particular mutated residue within one single VR library, or within a context of all mutated VRs in the combined viral library (green). Because the sample of the sequenced plasmid library included only 21 individually sequenced random clones, due to the low sampling representation, the number of observed mutants (red) sometimes exceeds the expected frequency (blue) which always (with the exception of residues 444, 500, and 588) includes wt AAV2 residue.
  • FIG 5A, FIG 5B, FIG 5C, FIG 5D, FIG 5E, and FIG 5F show the selection of new variants from murine liver.
  • FIG 5A Amino acid sequences of the variable regions (VRs) of the variants selected from the library after three rounds of directed evolution in the mouse liver, wt AAV2 sequences are shown in bold for comparison;
  • FIG 5B Expression of luciferase transgene in the liver of mice at day 40 after tail-vein administration of rAAV vectors packaged into capsids as indicated;
  • FIG 5C Time course of rAAV-Luc expression in the liver as assessed by Luciferase imaging in vivo.
  • FIG 5F biodistribution study of
  • FIG 6 shows the nucleotide sequence of the Variable Region VIII (VR-VIII) in CapLib-3A and CapLib-3B plasmid and viral libraries. Shown are raw sequencing data to illustrate the selection pressure upon individual amino acid residues within one VR (VR-VIII) when all mutated VRs are combined in one library.
  • the mutagenized and wt AAV2 reference sequence are shown below;
  • FIG 7 shows the alignment of mutated regions in consensus and sequences found in more than 4 copies. Amino acid substitutions are highlighted, those occurring in the consensus (top sequence) are in yellow. The 9 sequences under the consensus were those found in more than 4 copies; copy number is indicated on the left. The total number of mutations is shown to the right of each sequence;
  • FIG 8 shows the amino acid composition in variable positions.
  • the X-axis designates residue position (VP1 numbering), and the Y-axis - the relative frequency of each amino acid at that position.
  • Amino acid color-coding is shown to the right of the graph. The respective VR boundaries are shown below amino acid numbers for better orientation;
  • FIG 9 shows the comparison of theoretical and experimental complexity at each variable amino acid position.
  • the X-axis designates residue position (VP1 numbering), and the Y-axis - the theoretical (blue) and experimental (red) complexities at that position as reflected by total number of mutations.
  • the respective VR boundaries are shown below amino acid numbers for better orientation;
  • FIG. 10 shows a diagram of in vivo directed evolution.
  • Viral library is injected intravenously (via tail vein). Three days post-injection, the liver is harvested and subjected to collagenase/protease treatment. Episomal Hirt DNA was isolated from the whole organ and utilized to amplify AAV capsid gene sequences. A new, Round one-enriched library was prepared and the cycle was repeated. After 3 cycles, individual clones were sequenced and analyzed. The recurrent variants were selected and cap gene sequence was subcloned to derive a helper plasmid. rAAV vectors incorporating reporter genes were then packaged and their biodistribution was analyzed after intravenous administration;
  • FIG. 11 shows barcoded AAV cassette.
  • FIG. 12 shows a diagram of Fragment 3 assembly. Top strand scaffold oligonucleotides (shown in black color) were annealed to bottom strand anchor (shown in red) oligonucleotides. Degenerate positions (IUPAC nucleotide code) are highlighted by yellow background.
  • the present invention also provides improved rAAV-based genetic constructs that encode one or more therapeutic agents useful in the preparation of medicaments for the prevention, treatment, and/or amelioration of one or more diseases, disorders or dysfunctions resulting from a deficiency in one or more cellular components.
  • the invention provides libraries of rAAV-based genetic constructs encoding one or more selected molecules of interest, such as, for example, one or more diagnostic or therapeutic agents (including, e.g., proteins, polypeptides, peptides, antibodies, antigen binding fragments, siRNAs, RNAis, antisense oligo- and poly-nucleotides, ribozymes, and variants and/or active fragments thereof), for use in the diagnosis, prevention, treatment, and/or amelioration of symptoms of mammalian diseases, disorders, dysfunctions, deficiencies, defects, trauma, injury, and such like.
  • diagnostic or therapeutic agents including, e.g., proteins, polypeptides, peptides, antibodies, antigen binding fragments, siRNAs, RNAis, antisense oligo- and poly-nucleotides, ribozymes, and variants and/or active fragments thereof.
  • the present invention also provides infectious rAAV virions, as well as nucleic acid molecules and rAAV vectors that encode the novel AAV vectors described herein, , as well as nucleic acids encoding one or more selected diagnostic and/or therapeutic agents for delivery to a selected population of mammalian cells.
  • the novel rAAV vectors, express constructs, and infectious virions and viral particles comprising them as disclosed herein preferably have an improved efficiency in transducing one or more of a variety of cells, tissues and organs of interest, when compared to wild-type, unmodified, expression constructs, and to the corresponding rAAV vectors and virions comprising them.
  • the improved rAAV vectors provided herein may transduce one or more selected host cells at higher-efficiencies (and often much higher efficiencies) than conventional, wild type (i.e., "unmodified") rAAV vectors.
  • vectors prepared as described herein may be of different AAV serotypes, and the mutation of one or more of the sequences described herein may result in improved viral vectors, which are capable of higher-efficiency transduction than that of the corresponding, non-substituted vectors from which the mutants were prepared.
  • next-generation rAAV viral vectors may dramatically reduce the number of viral particles needed for a conventional gene therapy regimen.
  • the rAAV vectors prepared as described herein may be more stable, less immunogenic, and/or can be produced at much lower cost, or in a higher titer, than an equivalent wild type viral vector prepared in conventional fashion.
  • native amino acids normally present in the sequence of a viral capsid protein may be substituted by one or more non-native amino acids, including, a substitution of one or more amino acids not normally present at a particular residue in the corresponding wild-type protein.
  • the invention also provides isolated and purified polynucleotides that encode one or more of the disclosed viral vectors as described herein, as well as polynucleotides that encode such vectors.
  • the vector constructs of the present invention further include at least one nucleic acid segment that encodes a diagnostic or therapeutic molecule operably linked to a promoter capable of expressing the nucleic acid segment in a suitable host cell comprising the vector.
  • the transduction efficiency of a mutated rAAV vector will be higher than that of the corresponding, unmodified, wild-type vector, and as such, will preferably possess a transduction efficiency in a mammalian cell that is at least 2-fold, at least about 4-fold, at least about 6-fold, at least about 8— fold, at least about 10-fold, or at least about 12-fold or higher in a selected mammalian host cell than that of a virion that comprises a corresponding, unmodified, rAAV vector.
  • the transduction efficiency of the rAAV vectors provided herein will be at least about 15 -fold higher, at least about 20-fold higher, at least about 25-fold higher, at least about 30-fold higher, or at least about 40, 45, or 50- fold or more greater than that of a virion that comprises a corresponding, wild-type vectors.
  • the present invention also concerns rAAV vectors, wherein the nucleic acid segment further comprises a promoter, an enhancer, a post-transcriptional regulatory sequence, a polyadenylation signal, or any combination thereof, operably linked to the nucleic acid segment that encodes the selected polynucleotide of interest.
  • the promoter is a heterologous promoter, a tissue-specific promoter, a cell-specific promoter, a constitutive promoter, an inducible promoter, or any combination thereof.
  • nucleic acid segments cloned into one or more of the novel rAAV expression vectors described herein will preferably express or encode one or more polypeptides, peptides, ribozymes, peptide nucleic acids, siR As, R Ais, antisense oligonucleotides, antisense polynucleotides, antibodies, antigen binding fragments, or any combination thereof.
  • the therapeutic agents useful in the invention may include one or more agonists, antagonists, anti-apoptosis factors, inhibitors, receptors, cytokines, cytotoxins, erythropoietic agents, glycoproteins, growth factors, growth factor receptors, hormones, hormone receptors, interferons, interleukins, interleukin receptors, nerve growth factors, neuroactive peptides, neuroactive peptide receptors, proteases, protease inhibitors, protein decarboxylases, protein kinases, protein kinase inhibitors, enzymes, receptor binding proteins, transport proteins or one or more inhibitors thereof, serotonin receptors, or one or more uptake inhibitors thereof, serpins, serpin receptors, tumor suppressors, diagnostic molecules, chemotherapeutic agents, cytotoxins, or any combination thereof.
  • vectors may also be prepared and packaged within virions of any known AAV serotype, including, for examples, AAV serotype 1 (AAVl), AAV serotype 3 (AAV3), AAV serotype 4 (AAV4), AAV serotype 5 (AAV5), AAV serotype 6 (AAV6), AAV serotype 7 (AAV7), AAV serotype 8 (AAV8), AAV serotype 9 (AAV9), AAV serotype 10 (AAV10), AAV serotype 11 (AAV11), or AAV serotype 12 (AAV 12).
  • AAV serotype 1 AAVl
  • AAV3 AAV serotype 3
  • AAV4 AAV serotype 4
  • AAV serotype 5 AAV5
  • AAV serotype 6 AAV6
  • AAV serotype 7 AAV7
  • AAV8 AAV serotype 8
  • AAV9 AAV serotype 9
  • AAV9 AAV serotype 10
  • AAV10 AAV
  • the invention further provides populations and pluralities of such rAAV vectors as prepared herein, as well as virions, infectious viral particles, and mammalian host cells that include one or more nucleic acid segments encoding them.
  • the mammalian host cells will be human host cells, including, for example blood cells, stem cells, hematopoietic cells, CD34 + cells, liver cells, cancer cells, vascular cells, pancreatic cells, neural cells, ocular or retinal cells, epithelial or endothelial cells, dendritic cells, fibroblasts, or any other cell of mammalian origin, including, without limitation, hepatic (i.e., liver) cells, lung cells, cardiac cells, pancreatic cells, intestinal cells, diaphragmatic cells, renal (i.e., kidney) cells, neural cells, blood cells, bone marrow cells, or any one or more selected tissues of a mammal for which viral-based gene therapy is contemplated.
  • human host cells including, for example blood cells, stem cells, hematopoietic cells, CD34 + cells, liver cells, cancer cells, vascular cells, pancreatic cells, neural cells, ocular or retinal cells, epithelial or endothelial cells, dend
  • the invention further provides composition and formulations that include one or more of the proteins nucleic acid segments viral vectors, host cells, or viral particles of the present invention together with one or more pharmaceutically-acceptable buffers, diluents, or excipients.
  • Such compositions may be included in one or more diagnostic or therapeutic kits, for diagnosing, preventing, treating or ameliorating one or more symptoms of a mammalian disease, injury, disorder, trauma or dysfunction.
  • the invention further includes a method for providing a mammal in need thereof with a diagnostically- or therapeutically-effective amount of a selected biological molecule, the method comprising providing to a cell, tissue or organ of a mammal in need thereof, an amount of an rAAV vector; and for a time effective to provide the mammal with a diagnostically- or a therapeutically-effective amount of the selected biological molecule.
  • the invention further provides a method for diagnosing, preventing, treating, or ameliorating at least one or more symptoms of a disease, a disorder, a dysfunction, an injury, an abnormal condition, or trauma in a mammal.
  • the method includes at least the step of administering to a mammal in need thereof one or more of the disclosed rAAV vectors, in an amount and for a time sufficient to diagnose, prevent, treat or ameliorate the one or more symptoms of the disease, disorder, dysfunction, injury, abnormal condition, or trauma in the mammal.
  • the invention also provides a method of transducing a population of mammalian cells.
  • the method includes at least the step of introducing into one or more cells of the population, a composition that comprises an effective amount of one or more of the rAAV vectors disclosed herein.
  • the invention also provides isolated nucleic acid segments that encode one or more of the mutant viral capsid proteins as described herein, and provides recombinant vectors, virus particles, infectious virions, and isolated host cells that comprise one or more of the improved vector sequences described and tested herein.
  • compositions as well as therapeutic and/or diagnostic kits that include one or more of the disclosed AAV compositions, formulated with one or more additional ingredients, or prepared with one or more instructions for their use.
  • the invention also demonstrates methods for making, as well as methods of using the disclosed improved rAAV vectors in a variety of ways, including, for example, ex situ, in vitro and in vivo applications, methodologies, diagnostic procedures, and/or gene therapy regimens. Because many of the improved vectors described herein are also resistant to proteasomal degradation, they possess significantly increased transduction efficiencies in vivo making them particularly well suited for viral vector-based human gene therapy regimens, and in particular, for delivering one or more genetic constructs to selected mammalian cells in vivo and/or in vitro.
  • the invention provides compositions comprising AAV vectors, virions, viral particles, and pharmaceutical formulations thereof, useful in methods for delivering genetic material encoding one or more beneficial or therapeutic product(s) to mammalian cells and tissues.
  • the compositions and methods of the invention provide a significant advancement in the art through their use in the treatment, prevention, and/or amelioration of symptoms of one or more mammalian diseases. It is contemplated that human gene therapy will particularly benefit from the present teachings by providing new and improved viral vector constructs for use in the treatment of a number of diverse diseases, disorders, and dysfunctions.
  • the invention concerns libraries of rAAV vector mutants that demonstrate improved properties useful in the delivery of one or more therapeutic agents to selected mammalian cells, and particularly for use in the prevention, treatment, and/or amelioration of one or more disorders in a mammal into which the vector construct may be introduced.
  • the rAAV vectors of the present invention may optionally further include one or more enhancer sequences that are each operably linked to the nucleic acid segment.
  • exemplary enhancer sequences include, but are not limited to, one or more selected from the group consisting of a CMV enhancer, a synthetic enhancer, a liver-specific enhancer, an vascular-specific enhancer, a brain-specific enhancer, a neural cell-specific enhancer, a lung-specific enhancer, a muscle-specific enhancer, a kidney-specific enhancer, a pancreas-specific enhancer, and an islet cell-specific enhancer.
  • Exemplary promoters useful in the practice of the invention include, without limitation, one or more heterologous, tissue-specific, constitutive or inducible promoters, including, for example, but not limited to, a promoter selected from the group consisting of a CMV promoter, a ⁇ -actin promoter, an insulin promoter, an enolase promoter, a BDNF promoter, an NGF promoter, an EGF promoter, a growth factor promoter, an axon-specific promoter, a dendrite-specific promoter, a brain-specific promoter, a hippocampal-specific promoter, a kidney-specific promoter, an elafin promoter, a cytokine promoter, an interferon promoter, a growth factor promoter, an i -antitrypsin promoter, a brain cell-specific promoter, a neural cell-specific promoter, a central nervous system cell-specific promoter, a peripheral nervous system cell- specific promoter, an interle
  • the vector-encoding nucleic acid segments may also further include one or more post- transcriptional regulatory sequences or one or more polyadenylation signals, including, for example, but not limited to, a woodchuck hepatitis virus post-transcription regulatory element, a polyadenylation signal sequence, or any combination thereof.
  • Exemplary diagnostic or therapeutic agents deliverable to host cells by the present vector constructs include, but are not limited to, an agent selected from the group consisting of a polypeptide, a peptide, an antibody, an antigen binding fragment, a ribozyme, a peptide nucleic acid, a siRNA, an RNAi, an antisense oligonucleotide, an antisense polynucleotide, and any combination thereof.
  • the rAAV vectors obtained by the disclosed methods will preferably encode at least one diagnostic or therapeutic protein or polypeptide selected from the group consisting of a molecular marker, an adrenergic agonist, an anti-apoptosis factor, an apoptosis inhibitor, a cytokine receptor, a cytokine, a cytotoxin, an erythropoietic agent, a glutamic acid decarboxylase, a glycoprotein, a growth factor, a growth factor receptor, a hormone, a hormone receptor, an interferon, an interleukin, an interleukin receptor, a kinase, a kinase inhibitor, a nerve growth factor, a netrin, a neuroactive peptide, a neuroactive peptide receptor, a neurogenic factor, a neurogenic factor receptor, a neuropilin, a neurotrophic factor, a neurotrophin, a neurotrophin receptor, an
  • the rAAV vectors of the present invention may include one or more nucleic acid segments that encode a polypeptide selected from the group consisting of BDNF, CNTF, CSF, EGF, FGF, G-SCF, GM-CSF, gonadotropin, IFN, IFG-1, M-CSF, NGF, PDGF, PEDF, TGF, TGF-B2, TNF, VEGF, prolactin, somatotropin, XIAP1, IL-1, IL-2, IL-3, IL- 4, IL-5, IL-6, IL-7, IL-8, IL-9, IL-10, IL-10(I87A), viral IL-10, IL-11, IL-12, IL-13, IL-14, IL-15, IL-16, IL-17, IL-18, and any combination thereof.
  • the invention concerns genetically-modified, improved- transduction-efficiency rAAV vectors that include at least a first nucleic acid segment that encodes one or more therapeutic agents that alter, inhibit, reduce, prevent, eliminate, or impair the activity of one or more endogenous biological processes in the cell.
  • therapeutic agents may be those that selectively inhibit or reduce the effects of one or more metabolic processes, dysfunctions, disorders, or diseases.
  • the defect may be caused by injury or trauma to the mammal for which treatment is desired.
  • the defect may be caused the over-expression of an endogenous biological compound, while in other embodiments still; the defect may be caused by the under-expression or even lack of one or more endogenous biological compounds.
  • the genetically-modified rAAV vectors and expression systems of the present invention may also further optionally include a second distinct nucleic acid segment that comprises, consists essentially of, or consists of, one or more enhancers, one or more regulatory elements, one or more transcriptional elements, or any combination thereof, that alter, improve, regulate, and/or affect the transcription of the nucleotide sequence of interest expressed by the modified rAAV vectors.
  • the rAAV vectors of the present invention may further include a second nucleic acid segment that comprises, consists essentially of, or consists of, a CMV enhancer, a synthetic enhancer, a cell-specific enhancer, a tissue-specific enhancer, or any combination thereof.
  • the second nucleic acid segment may also further comprise, consist essentially of, or consist of, one or more intron sequences, one or more post-transcriptional regulatory elements, or any combination thereof.
  • the improved vectors and expression systems of the present invention may also optionally further include a polynucleotide that comprises, consists essentially of, or consists of, one or more polylinkers, restriction sites, and/or multiple cloning region(s) to facilitate insertion (cloning) of one or more selected genetic elements, genes of interest, or therapeutic or diagnostic constructs into the rAAV vector at a selected site within the vector.
  • a polynucleotide that comprises, consists essentially of, or consists of, one or more polylinkers, restriction sites, and/or multiple cloning region(s) to facilitate insertion (cloning) of one or more selected genetic elements, genes of interest, or therapeutic or diagnostic constructs into the rAAV vector at a selected site within the vector.
  • the exogenous polynucleotide(s) that may be delivered into suitable host cells by the improved, capsid-modified, rAAV vectors disclosed herein are preferably of mammalian origin, with polynucleotides encoding one or more polypeptides or peptides of human, non-human primate, porcine, bovine, ovine, feline, canine, equine, epine, caprine, or lupine origin being particularly preferred.
  • the exogenous polynucleotide(s) that may be delivered into host cells by the disclosed capsid-modified viral vectors may, in certain embodiments, encode one or more proteins, one or more polypeptides, one or more peptides, one or more enzymes, or one or more antibodies (or antigen-binding fragments thereof), or alternatively, may express one or more siR As, ribozymes, antisense oligonucleotides, PNA molecules, or any combination thereof.
  • two or more different molecules may be produced from a single rAAV expression system, or alternatively, a selected host cell may be transfected with two or more unique rAAV expression systems, each of which may comprise one or more distinct polynucleotides that encode a therapeutic agent.
  • the invention also provides rAAV vector mutants that are comprised within an infectious adeno-associated viral particle or a virion, as well as pluralities of such virions or infectious particles.
  • Such vectors and virions may be comprised within one or more diluents, buffers, physiological solutions or pharmaceutical vehicles, or formulated for administration to a mammal in one or more diagnostic, therapeutic, and/or prophylactic regimens.
  • the vectors, virus particles, virions, and pluralities thereof of the present invention may also be provided in excipient formulations that are acceptable for veterinary administration to selected livestock, exotics, domesticated animals, and companion animals (including pets and such like), as well as to non-human primates, zoological or otherwise captive specimens, and such like.
  • the invention also concerns host cells that comprise at least one of the disclosed rAAV expression vectors, or one or more virus particles or virions that comprise such an expression vector.
  • host cells are particularly mammalian host cells, with human host cells being particularly highly preferred, and may be either isolated, in cell or tissue culture. In the case of genetically modified animal models, the transformed host cells may even be comprised within the body of a non-human animal itself.
  • the creation of recombinant non-human host cells, and/or isolated recombinant human host cells that comprise one or more of the disclosed rAAV vectors is also contemplated to be useful for a variety of diagnostic, and laboratory protocols, including, for example, means for the production of large-scale quantities of the rAAV vectors described herein.
  • virus production methods are particularly contemplated to be an improvement over existing methodologies including in particular, those that require very high titers of the viral stocks in order to be useful as a gene therapy tool.
  • the inventors contemplate that one very significant advantage of the present methods will be the ability to utilize lower titers of viral particles in mammalian transduction protocols, yet still retain transfection rates at a suitable level.
  • compositions comprising one or more of the disclosed rAAV vectors, expression systems, infectious AAV particles, or host cells also form part of the present invention, and particularly those compositions that further comprise at least a first pharmaceutically-acceptable excipient for use in therapy, and for use in the manufacture of medicaments for the treatment of one or more mammalian diseases, disorders, dysfunctions, or trauma.
  • Such pharmaceutical compositions may optionally further comprise one or more diluents, buffers, liposomes, a lipid, a lipid complex; or the tyrosine-modified rAAV vectors may be comprised within a microsphere or a nanoparticle.
  • compositions suitable for intramuscular, intravenous, or direct injection into an organ or tissue or a plurality of cells or tissues of a human or other mammal are particularly preferred, however, the compositions disclosed herein may also find utility in administration to discreet areas of the mammalian body, including for example, formulations that are suitable for direct injection into one or more organs, tissues, or cell types in the body.
  • Such injection sites include, but are not limited to, the brain, a joint or joint capsule, a synovium or subsynovium tissue, tendons, ligaments, cartilages, bone, peri-articular muscle or an articular space of a mammalian joint, as well as direct administration to an organ such as the heart, liver, lung, pancreas, intestine, brain, bladder, kidney, or other site within the patient's body, including, for example , introduction of the viral vectors via intraabdominal, intrathorascic, intravascular, or intracerebroventricular delivery.
  • adeno-associated virus virion particles, compositions, and host cells that comprise, consist essentially of, or consist of, one or more of the rAAV vectors disclosed herein, such as for example pharmaceutical formulations of the vectors intended for administration to a mammal through suitable means, such as, by intramuscular, intravenous, intra-articular, or direct injection to one or more cells, tissues, or organs of a selected mammal.
  • compositions may be formulated with pharmaceutically-acceptable excipients as described hereinbelow, and may comprise one or more liposomes, lipids, lipid complexes, microspheres or nanoparticle formulations to facilitate administration to the selected organs, tissues, and cells for which therapy is desired.
  • Kits comprising one or more of the disclosed rAAV vectors (as well as one or more virions, viral particles, transformed host cells or pharmaceutical compositions comprising such vectors); and instructions for using such kits in one or more therapeutic, diagnostic, and/or prophylactic clinical embodiments are also provided by the present invention.
  • kits may further comprise one or more reagents, restriction enzymes, peptides, therapeutics, pharmaceutical compounds, or means for delivery of the composition(s) to host cells, or to an animal (e.g., syringes, injectables, and the like).
  • exemplary kits include those for treating, preventing, or ameliorating the symptoms of a disease, deficiency, dysfunction, and/or injury, or may include components for the large-scale production of the viral vectors themselves, such as for commercial sale, or for use by others, including e.g., virologists, medical professionals, and the like.
  • Another important aspect of the present invention concerns methods of use of the disclosed rAAV vectors, virions, expression systems, compositions, and host cells described herein in the preparation of medicaments for diagnosing, preventing, treating or ameliorating at least one or more symptoms of a disease, a dysfunction, a disorder, an abnormal condition, a deficiency, injury, or trauma in an animal, and in particular, in a vertebrate mammal.
  • Such methods generally involve administration to a mammal in need thereof, one or more of the disclosed vectors, virions, viral particles, host cells, compositions, or pluralities thereof, in an amount and for a time sufficient to diagnose, prevent, treat, or lessen one or more symptoms of such a disease, dysfunction, disorder, abnormal condition, deficiency, injury, or trauma in the affected animal.
  • the methods may also encompass prophylactic treatment of animals suspected of having such conditions, or administration of such compositions to those animals at risk for developing such conditions either following diagnosis, or prior to the onset of symptoms.
  • the exogenous polynucleotide will preferably encode one or more proteins, polypeptides, peptides, ribozymes, or antisense oligonucleotides, or a combination of these.
  • the exogenous polynucleotide may encode two or more such molecules, or a plurality of such molecules as may be desired.
  • two or more different molecules may be produced from a single rAAV expression system, or alternatively, a selected host cell may be transfected with two or more unique rAAV expression systems, each of which will provide unique heterologous polynucleotides encoding at least two different such molecules.
  • compositions comprising one or more of the disclosed rAAV vectors, expression systems, infectious AAV particles, host cells also form part of the present invention, and particularly those compositions that further comprise at least a first pharmaceutically-acceptable excipient for use in the manufacture of medicaments and methods involving therapeutic administration of such rAAV vectors.
  • Such pharmaceutical compositions may optionally further comprise liposomes, a lipid, a lipid complex; or the rAAV vectors may be comprised within a microsphere or a nanoparticle.
  • Pharmaceutical formulations suitable for intramuscular, intravenous, or direct injection into an organ or tissue of a human are particularly preferred.
  • kits for diagnosing, preventing, treating or ameliorating one or more symptoms of a mammalian disease, injury, disorder, trauma or dysfunction.
  • kits may be useful in the diagnosis, prophylaxis, and/or therapy or a human disease, and may be particularly useful in the treatment, prevention, and/or amelioration of one or more symptoms of cancer, diabetes, autoimmune disease, kidney disease, cardiovascular disease, pancreatic disease, intestinal disease, liver disease, neurological disease, neuromuscular disorder, neuromotor deficit, neuroskeletal impairment, neurological disability, neurosensory dysfunction, stroke, ischemia, ⁇ , ⁇ - antitrypsin (AAT) deficiency, Batten's disease, Alzheimer's disease, sickle cell disease, ⁇ - thalassamia, Huntington's disease, Parkinson's disease, skeletal disease, trauma, pulmonary disease in a human.
  • AAT antitrypsin
  • the invention also provides for the use of a composition disclosed herein in the manufacture of a medicament for treating, preventing or ameliorating the symptoms of a disease, disorder, dysfunction, injury or trauma, including, but not limited to, the treatment, prevention, and/or prophylaxis of a disease, disorder or dysfunction, and/or the amelioration of one or more symptoms of such a disease, disorder or dysfunction.
  • the invention also provides a method for treating or ameliorating the symptoms of such a disease, injury, disorder, or dysfunction in a mammal.
  • Such methods generally involve at least the step of administering to a mammal in need thereof, one or more of the rAAV vectors as disclosed herein, in an amount and for a time sufficient to treat or ameliorate the symptoms of such a disease, injury, disorder, or dysfunction in the mammal.
  • Such treatment regimens are particularly contemplated in human therapy, via administration of one or more compositions either intramuscularly, intravenously, subcutaneously, intrathecally, intraperitoneally, or by direct injection into an organ or a tissue of the mammal under care.
  • the invention also provides a method for providing to a mammal in need thereof, a therapeutically-effective amount of an rAAV composition of the present invention, in an amount, and for a time effective to provide the patient with a therapeutically-effective amount of the desired therapeutic agent(s) encoded by one or more nucleic acid segments comprised within the rAAV vector.
  • exemplary therapeutic agents include, but are not limited to, a polypeptide, a peptide, an antibody, an antigen-binding fragment, a ribozyme, a peptide nucleic acid, an siR A, an R Ai, an antisense oligonucleotide, an antisense polynucleotide, or a combination thereof.
  • the genetic constructs of the present invention may be prepared in a variety of compositions, and may also be formulated in appropriate pharmaceutical vehicles for administration to human or animal subjects.
  • the invention also provides compositions comprising one or more of the disclosed rAAV vectors, expression systems, virions, viral particles, mammalian cells, or combinations thereof.
  • the present invention provides pharmaceutical formulations of one or more rAAV vectors disclosed herein for administration to a cell or an animal, either alone or in combination with one or more other modalities of therapy, and in particular, for therapy of human cells, tissues, and diseases affecting man.
  • Formulation of pharmaceutically-acceptable excipients and carrier solutions is well-known to those of skill in the art, as is the development of suitable dosing and treatment regimens for using the particular compositions described herein in a variety of treatment regimens, including e.g., oral, parenteral, intravenous, intranasal, intra-articular, intramuscular administration and formulation.
  • carrier is intended to include any solvent(s), dispersion medium, coating(s), diluent(s), buffer(s), isotonic agent(s), solution(s), suspension(s), colloid(s), inert(s) or such like, or a combination thereof, that is pharmaceutically acceptable for administration to the relevant animal.
  • delivery vehicles for chemical compounds in general, and chemotherapeutics in particular, is well known to those of ordinary skill in the pharmaceutical arts. Except insofar as any conventional media or agent is incompatible with the active ingredient, its use in the diagnostic, prophylactic, and therapeutic compositions is contemplated.
  • One or more supplementary active ingredient(s) may also be incorporated into, or administered in association with, one or more of the disclosed chemotherapeutic compositions.
  • chimeric rcAAV refers to a replication-competent AAV- derived nucleic acid containing at least one nucleotide sequence that 1) encodes an AAV protein and 2) differs from the corresponding native nucleotide sequence in one or more bases.
  • DNA segment refers to a DNA molecule that has been isolated free of total genomic DNA of a particular species. Therefore, a DNA segment obtained from a biological sample using one of the compositions disclosed herein refers to one or more DNA segments that have been isolated away from, or purified free from, total genomic DNA of the particular species from which they are obtained. Included within the term “DNA segment,” are DNA segments and smaller fragments of such segments, as well as recombinant vectors, including, for example, plasmids, cosmids, phage, viruses, and the like.
  • an effective amount would be understood by those of ordinary skill in the art to provide a therapeutic, prophylactic, or otherwise beneficial effect against the organism, its infection, or the symptoms of the organism or its infection, or any combination thereof.
  • expression control sequence refers to any genetic element (e.g., polynucleotide sequence) that can exert a regulatory effect on the replication or expression (transcription or translation) of another genetic element.
  • Common expression control sequences include promoters, polyadenylation (polyA) signals, transcription termination sequences, upstream regulatory domains, origins of replication, internal ribosome entry sites (IRES), enhancers, and the like.
  • a "tissue specific expression control sequence” is one that exerts a regulatory effect on the replication or expression (transcription or translation) of another genetic element in only one type of tissue or a small subset of tissues.
  • helper function is meant as a functional activity performed by a nucleic acid or polypeptide that is derived from a virus such as Adenovirus (Ad) or herpesvirus and that facilitates AAV replication in a host cell.
  • Ad Adenovirus
  • herpesvirus a virus that facilitates AAV replication in a host cell.
  • heterologous is defined in relation to a predetermined referenced gene sequence.
  • a heterologous promoter is defined as a promoter which does not naturally occur adjacent to the referenced structural gene, but which is positioned by laboratory manipulation.
  • a heterologous gene or nucleic acid segment is defined as a gene or segment that does not naturally occur adjacent to the referenced promoter and/or enhancer elements.
  • the term “homology” refers to a degree of complementarity between two or more polynucleotide or polypeptide sequences.
  • the word “identity” may substitute for the word “homology” when a first nucleic acid or amino acid sequence has the exact same primary sequence as a second nucleic acid or amino acid sequence.
  • Sequence homology and sequence identity can be determined by analyzing two or more sequences using algorithms and computer programs known in the art. Such methods may be used to assess whether a given sequence is identical or homologous to another selected sequence.
  • homologous means, when referring to polynucleotides, sequences that have the same essential nucleotide sequence, despite arising from different origins. Typically, homologous nucleic acid sequences are derived from closely related genes or organisms possessing one or more substantially similar genomic sequences. By contrast, an "analogous" polynucleotide is one that shares the same function with a polynucleotide from a different species or organism, but may have a significantly different primary nucleotide sequence that encodes one or more proteins or polypeptides that accomplish similar functions or possess similar biological activity. Analogous polynucleotides may often be derived from two or more organisms that are not closely related (e.g., either genetically or phylogenetically).
  • nucleic acid or polypeptide sequences refer to two or more sequences or subsequences that are the same or have a specified percentage of amino acid residues or nucleotides that are the same, when compared and aligned for maximum correspondence, as measured using one of the sequence comparison algorithms described below (or other algorithms available to persons of ordinary skill) or by visual inspection.
  • the phrase "in need of treatment” refers to a judgment made by a caregiver such as a physician or veterinarian that a patient requires (or will benefit in one or more ways) from treatment. Such judgment may made based on a variety of factors that are in the realm of a caregiver's expertise, and may include the knowledge that the patient is ill as the result of a disease state that is treatable by one or more compound or pharmaceutical compositions such as those set forth herein.
  • isolated or “biologically pure” refer to material that is substantially, or essentially, free from components that normally accompany the material as it is found in its native state.
  • isolated polynucleotides in accordance with the invention preferably do not contain materials normally associated with those polynucleotides in their natural, or in situ, environment.
  • kit may be used to describe variations of the portable, self- contained enclosure that includes at least one set of components to conduct one or more of the diagnostic or therapeutic methods of the invention.
  • a vector library refers to a collection of elements that differ from one another in at least one aspect.
  • a vector library is a collection of at least two vectors that differ from one another by at least one nucleotide.
  • a "virion library” is a collection of at least two virions that differ from one another by at least one nucleotide or at least one capsid protein.
  • Link refers to any method known in the art for functionally connecting one or more proteins, peptides, nucleic acids, or polynucleotides, including, without limitation, recombinant fusion, covalent bonding, disulfide bonding, ionic bonding, hydrogen bonding, electrostatic bonding, and the like.
  • master library refers to a pool of rAAV virions composed of chimeric rcAAV vectors encapsidated in cognate chimeric capsids ⁇ e.g., capsids containing a degenerate or otherwise modified Cap protein).
  • nucleic acid molecule or polypeptide when referring to a nucleic acid molecule or polypeptide, the term “native” refers to a naturally-occurring ⁇ e.g., a WT) nucleic acid or polypeptide.
  • Naturally occurring refers to the fact that an object can be found in nature.
  • a polypeptide or polynucleotide sequence that is present in an organism (including viruses) that can be isolated from a source in nature and which has not been intentionally modified by the hand of man in a laboratory is naturally- occurring.
  • laboratory strains of rodents that may have been selectively bred according to classical genetics are considered naturally occurring animals
  • nucleic acid means a chain of two or more nucleotides such as R A (ribonucleic acid) and DNA (deoxyribonucleic acid).
  • caps nucleic acid means a nucleic acid that encodes a Cap protein.
  • examples of cap nucleic acids include "wild-type” (WT) Cap-encoding nucleic acid sequences from AAV serotypes 1 , 2, and 5; a native form cap cDNA; a nucleic acid having sequences from which a cap cDNA can be transcribed; and/or allelic variants and homologs of the foregoing.
  • WT wild-type
  • the term "patient” refers to any host that can receive one or more of the pharmaceutical compositions disclosed herein.
  • the subject is a vertebrate animal, which is intended to denote any animal species (and preferably, a mammalian species such as a human being).
  • a "patient” refers to any animal host including without limitation any mammalian host.
  • the term refers to any mammalian host, the latter including but not limited to, human and non-human primates, bovines, canines, caprines, cavines, corvines, epines, equines, felines, hircines, lapines, leporines, lupines, murines, ovines, porcines, ranines, racines, vulpines, and the like, including livestock, zoological specimens, exotics, as well as companion animals, pets, and any animal under the care of a veterinary practitioner.
  • phrases "pharmaceutically-acceptable” refers to molecular entities and compositions that preferably do not produce an allergic or similar untoward reaction when administered to a mammal, and in particular, when administered to a human.
  • pharmaceutically acceptable salt refers to a salt that preferably retains the desired biological activity of the parent compound and does not impart any undesired toxico logical effects.
  • salts include, without limitation, acid addition salts formed with inorganic acids (e.g., hydrochloric acid, hydrobromic acid, sulfuric acid, phosphoric acid, nitric acid, and the like); and salts formed with organic acids including, without limitation, acetic acid, oxalic acid, tartaric acid, succinic acid, maleic acid, fumaric acid, gluconic acid, citric acid, malic acid, ascorbic acid, benzoic acid, tannic acid, pamoic (embonic) acid, alginic acid, naphthoic acid, polyglutamic acid, naphthalenesulfonic acids, naphthalenedisulfonic acids, polygalacturonic acid; salts with polyvalent metal cations such as zinc, calcium, bismuth, barium, magnesium, aluminum, copper, cobalt, nickel, cadmium, and the like; salts formed with an organic cation formed from ⁇ , ⁇ '-dibenzylethylened
  • pharmaceutically acceptable salt refers to a compound of the present disclosure derived from pharmaceutically acceptable bases, inorganic or organic acids.
  • suitable acids include, but are not limited to, hydrochloric, hydrobromic, sulfuric, nitric, perchloric, fumaric, maleic, phosphoric, glycollic, lactic, salicyclic, succinic, toluene-p- sulfonic, tartaric, acetic, citric, methanesulfonic, formic, benzoic, malonic, naphthalene-2- sulfonic, trifluoroacetic and benzenesulfonic acids.
  • Salts derived from appropriate bases include, but are not limited to, alkalis such as sodium and ammonia.
  • the term "plasmid” or "vector” refers to a genetic construct that is composed of genetic material (i.e., nucleic acids).
  • a plasmid or a vector contains an origin of replication that is functional in bacterial host cells, e.g., Escherichia coli, and selectable markers for detecting bacterial host cells including the plasmid.
  • Plasmids and vectors of the present invention may include one or more genetic elements as described herein arranged such that an inserted coding sequence can be transcribed and translated in a suitable expression cells.
  • the plasmid or vector may include one or more nucleic acid segments, genes, promoters, enhancers, activators, multiple cloning regions, or any combination thereof, including segments that are obtained from or derived from one or more natural and/or artificial sources.
  • polypeptide is intended to encompass a singular "polypeptide” as well as plural “polypeptides,” and includes any chain or chains of two or more amino acids.
  • polypeptide terms including, but not limited to “peptide,” “dipeptide,” “tripeptide,” “protein,” “enzyme,” “amino acid chain,” and “contiguous amino acid sequence” are all encompassed within the definition of a “polypeptide,” and the term “polypeptide” can be used instead of, or interchangeably with, any of these terms.
  • the term further includes polypeptides that have undergone one or more post-translational modification(s), including for example, but not limited to, glycosylation, acetylation, phosphorylation, amidation, derivatization, proteolytic cleavage, post-translation processing, or modification by inclusion of one or more non-naturally occurring amino acids.
  • the terms "prevent,” “preventing,” “prevention,” “suppress,” “suppressing,” and “suppression” as used herein refer to administering a compound either alone or as contained in a pharmaceutical composition prior to the onset of clinical symptoms of a disease state so as to prevent any symptom, aspect or characteristic of the disease state. Such preventing and suppressing need not be absolute to be deemed medically useful.
  • promoter refers to a region or regions of a nucleic acid sequence that regulates transcription.
  • Protein is used herein interchangeably with “peptide” and “polypeptide,” and includes both peptides and polypeptides produced synthetically, recombinantly, or in vitro and peptides and polypeptides expressed in vivo after nucleic acid sequences are administered into a host animal or human subject.
  • polypeptide is preferably intended to refer to any amino acid chain length, including those of short peptides from two to about 20 amino acid residues in length, oligopeptides from about 10 to about 100 amino acid residues in length, and longer polypeptides including those of about 100 or more amino acid residues in length.
  • the term is also intended to include enzymes, i.e., functional biomolecules including at least one amino acid polymer.
  • Polypeptides and proteins of the present invention also include polypeptides and proteins that are or have been post-translationally modified, and include any sugar or other derivative(s) or conjugate(s) added to the backbone amino acid chain.
  • proliferative typed is meant a nucleic acid or genome derived from a first AAV serotype that is encapsidated (packaged) into an AAV capsid containing at least one AAV Cap protein of a second serotype differing from the first serotype.
  • rcAAV vector refers to a replication-competent AAV- derived nucleic acid capable of DNA replication in a cell without any additional AAV genes or gene products.
  • the term "recombinant” indicates that the material ⁇ e.g., a polynucleotide or a polypeptide) has been artificially or synthetically (non-naturally) altered by human intervention. The alteration can be performed on the material within or removed from, its natural environment or state. Specifically, e.g., a promoter sequence is "recombinant” when it is produced by the expression of a nucleic acid segment engineered by the hand of man.
  • a "recombinant nucleic acid” is one that is made by recombining nucleic acids, e.g., during cloning, DNA shuffling or other procedures, or by chemical or other mutagenesis
  • a "recombinant polypeptide” or “recombinant protein” is a polypeptide or protein which is produced by expression of a recombinant nucleic acid
  • a "recombinant virus,” e.g., a recombinant AAV virus is produced by the expression of a recombinant nucleic acid.
  • regulatory element refers to a region or regions of a nucleic acid sequence that regulates transcription.
  • exemplary regulatory elements include, but are not limited to, enhancers, post-transcriptional elements, transcriptional control sequences, and such like.
  • RNA segment refers to an RNA molecule that has been isolated free of total cellular RNA of a particular species. Therefore, RNA segments can refer to one or more RNA segments (either of native or synthetic origin) that have been isolated away from, or purified free from, other R As. Included within the term “R A segment,” are R A segments and smaller fragments of such segments.
  • seed library is meant a pool of AAV virions composed of chimeric rcAAV vectors encapsidated into AAV capsids of a single serotype.
  • the percentage of sequence identity may be calculated over the entire length of the sequences to be compared, or may be calculated by excluding small deletions or additions which total less than about 25 percent or so of the chosen reference sequence.
  • the reference sequence may be a subset of a larger sequence, such as a portion of a gene or flanking sequence, or a repetitive portion of a chromosome.
  • the reference sequence will typically comprise at least about 18-25 nucleotides, more typically at least about 26 to 35 nucleotides, and even more typically at least about 40, 50, 60, 70, 80, 90, or even 100 or so nucleotides.
  • the extent of percent identity between the two sequences will be at least about 80%, preferably at least about 85%>, and more preferably about 90%) or 95 %> or higher, as readily determined by one or more of the sequence comparison algorithms well-known to those of skill in the art, such as e.g., the FASTA program analysis described by Pearson and Lipman (1988).
  • structural gene is intended to generally describe a polynucleotide, such as a gene, that is expressed to produce an encoded peptide, polypeptide, protein, ribozyme, catalytic RNA molecule, or antisense molecule.
  • subject describes an organism, including a mammal such as a human primate, to which treatment with one or more of the disclosed compositions may be provided.
  • Mammalian species that may benefit from the disclosed treatment methods include, without limitation, humans, non-human primates such as apes; chimpanzees; monkeys, and orangutans, domesticated animals, including dogs and cats, as well as livestock such as horses, cattle, pigs, sheep, and goats, or other mammalian species including, without limitation, mice, rats, guinea pigs, rabbits, hamsters, and the like.
  • Transcriptional regulatory element refers to a polynucleotide sequence that activates transcription alone or in combination with one or more other nucleic acid sequences.
  • a transcriptional regulatory element may include, for example, one or more promoters, one or more response elements, one or more negative regulatory elements, one or more enhancers, or any combination thereof.
  • transcription factor recognition site and a “transcription factor binding site” refer to a polynucleotide sequence(s) or sequence motif(s) that are identified as being sites for the sequence-specific interaction of one or more transcription factors, frequently taking the form of direct protein-DNA binding.
  • transcription factor binding sites can be identified by DNA footprinting, gel mobility shift assays, and the like, and/or can be predicted based on known consensus sequence motifs, or by other methods known to one of ordinary skill in the relevant molecular biological and virology arts.
  • Transcriptional unit refers to a polynucleotide sequence that comprises at least a first structural gene operably linked to at least a first cis-acting promoter sequence and optionally linked operably to one or more other cis-acting nucleic acid sequences necessary for efficient transcription of the structural gene sequences, and at least a first distal regulatory element as may be required for the appropriate tissue-specific and developmental transcription of the structural gene sequence operably positioned under the control of the promoter and/or enhancer elements, as well as any additional cis sequences that are necessary for efficient transcription and translation (e.g., polyadenylation site(s), mRNA stability controlling sequence(s), etc.
  • transformed cell is intended to mean a host cell whose nucleic acid complement has been altered by the introduction of one or more exogenous polynucleotides into that cell.
  • transformation is intended to generally describe a process of introducing an exogenous polynucleotide sequence (e.g., a viral vector, a plasmid, or a recombinant DNA or RNA molecule) into a host cell or protoplast in which the exogenous polynucleotide is incorporated into at least a first chromosome or is capable of autonomous replication within the transformed host cell.
  • an exogenous polynucleotide sequence e.g., a viral vector, a plasmid, or a recombinant DNA or RNA molecule
  • Transfection, electroporation, and "naked" nucleic acid uptake all represent examples of techniques used to transform a host cell with one or more polynucleotides.
  • the terms “treat,” “treating,” and “treatment” refer to the administration of one or more compounds (either alone or as contained in one or more pharmaceutical compositions) after the onset of clinical symptoms of a disease state so as to reduce, or eliminate any symptom, aspect or characteristic of the disease state. Such treating need not be absolute to be deemed medically useful.
  • the terms “treatment,” “treat,” “treated,” or “treating” may refer to therapy, or to the amelioration or the reduction, in the extent or severity of disease, of one or more symptom thereof, whether before or after its development afflicts a patient.
  • vector refers to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked, e.g., a plasmid.
  • a vector is an episome, i.e., a nucleic acid capable of extra-chromosomal replication.
  • Preferred vectors are those capable of autonomous replication and/or expression of nucleic acids to which they are linked.
  • An "rAAV vector” is a recombinant AAV-derived nucleic acid containing at least one terminal repeat (TR) sequence.
  • virion is meant to describe a virus particle that contains a nucleic acid and a protein coat (capsid).
  • An "rAAV virion” is a virion that includes nucleic acid sequences and/or proteins derived from a rAAV vector.
  • sequence essentially as set forth in SEQ ID NO:X means that the sequence substantially corresponds to a portion of SEQ ID NO:X and has relatively few nucleotides (or amino acids in the case of polypeptide sequences) that are not identical to, or a biologically functional equivalent of, the nucleotides (or amino acids) of SEQ ID NO :X.
  • biologically functional equivalent is well understood in the art, and is further defined in detail herein.
  • sequences that have about 85% to about 90%>; or more preferably, about 91%) to about 95%; or even more preferably, about 96%> to about 99%; of nucleotides that are identical or functionally equivalent to one or more of the nucleotide sequences provided herein are particularly contemplated to be useful in the practice of the invention.
  • Suitable standard hybridization conditions for the present invention include, for example, hybridization in 50% formamide, 5x Denhardt's solution, 5x SSC, 25 mM sodium phosphate, 0.1 % SDS and 100 ⁇ of denatured salmon sperm DNA at 42°C for 16 h followed by 1 hr sequential washes with O.lx SSC, 0.1% SDS solution at 60°C to remove the desired amount of background signal.
  • Lower stringency hybridization conditions for the present invention include, for example, hybridization in 35% formamide, 5x Denhardt's solution, 5x SSC, 25 mM sodium phosphate, 0.1% SDS and 100 ⁇ denatured salmon sperm DNA or E. coli DNA at 42°C for 16 h followed by sequential washes with 0.8x SSC, 0.1% SDS at 55°C.
  • Those of skill in the art will recognize that conditions can be readily adjusted to obtain the desired level of stringency.
  • nucleic acid segments that are complementary, essentially complementary, and/or substantially complementary to at least one or more of the specific nucleotide sequences specifically set forth herein.
  • Nucleic acid sequences that are “complementary” are those that are capable of base-pairing according to the standard Watson-Crick complementarity rules.
  • complementary sequences means nucleic acid sequences that are substantially complementary, as may be assessed by the same nucleotide comparison set forth above, or as defined as being capable of hybridizing to one or more of the specific nucleic acid segments disclosed herein under relatively stringent conditions such as those described immediately above.
  • the probes and primers of the present invention may be of any length.
  • an algorithm defining all probes or primers contained within a given sequence can be proposed:
  • n to n + y where n is an integer from 1 to the last number of the sequence and y is the length of the probe or primer minus one, where n + y does not exceed the last number of the sequence.
  • the collection of probes or primers correspond to bases 1 to 25, bases 2 to 26, bases 3 to 27, bases 4 to 28, and so on over the entire length of the sequence.
  • exemplary primer or probe sequence include, without limitation, sequences corresponding to bases 1 to 35, bases 2 to 36, bases 3 to 37, bases 4 to 38, and so on over the entire length of the sequence.
  • probes or primers may correspond to the nucleotides from the first basepair to bp 40, from the second bp of the sequence to bp 41, from the third bp to bp 42, and so forth
  • probes or primers may correspond to a nucleotide sequence extending from bp 1 to bp 50, from bp 2 to bp 51, from bp 3 to bp 52, from bp 4 to bp 53, and so forth.
  • nucleic acid segments of the present invention in combination with an appropriate detectable marker (i.e., a "label,”), such as in the case of employing labeled polynucleotide probes in determining the presence of a given target sequence in a hybridization assay.
  • an appropriate detectable marker i.e., a "label”
  • a wide variety of appropriate indicator compounds and compositions are known in the art for labeling oligonucleotide probes, including, without limitation, fluorescent, radioactive, enzymatic or other ligands, such as avidin/biotin, etc., which are capable of being detected in a suitable assay.
  • an enzyme tag such as urease, alkaline phosphatase or peroxidase
  • colorimetric, chromogenic, or fluorigenic indicator substrates are known that can be employed to provide a method for detecting the sample that is visible to the human eye, or by analytical methods such as scintigraphy, fluorimetry, spectrophotometry, and the like, to identify specific hybridization with samples containing one or more complementary or substantially complementary nucleic acid sequences.
  • multiplexing assays where two or more labeled probes are detected either simultaneously or sequentially, it may be desirable to label a first oligonucleotide probe with a first label having a first detection property or parameter (for example, an emission and/or excitation spectral maximum), which also labeled a second oligonucleotide probe with a second label having a second detection property or parameter that is different (i.e., discreet or discernable from the first label.
  • first detection property or parameter for example, an emission and/or excitation spectral maximum
  • polynucleotides, nucleic acid segments, nucleic acid sequences, and the like include, but are not limited to, DNAs (including and not limited to genomic or extragenomic DNAs), genes, peptide nucleic acids (PNAs) RNAs (including, but not limited to, rRNAs, mRNAs and tRNAs), nucleosides, and suitable nucleic acid segments either obtained from natural sources, chemically synthesized, modified, or otherwise prepared or synthesized in whole or in part by the hand of man.
  • DNAs including and not limited to genomic or extragenomic DNAs
  • genes include peptide nucleic acids (PNAs) RNAs (including, but not limited to, rRNAs, mRNAs and tRNAs), nucleosides, and suitable nucleic acid segments either obtained from natural sources, chemically synthesized, modified, or otherwise prepared or synthesized in whole or in part by the hand of man.
  • PNAs peptide nucleic acids
  • Methodologies to improve existing AAV vectors for gene therapy include either rational approaches or directed evolution to derive capsid variants characterized by superior transduction efficiencies in targeted tissues.
  • both approaches were integrated in one unified design strategy of "virtual family shuffling" to derive a combinatorial capsid library whereby only variable regions on the surface of the capsid are modified.
  • Individual sub-libraries were first assembled in order to pre-select compatible amino acid residues within restricted surface-exposed regions to minimize the generation of dead-end variants.
  • the successful families were interbred to derive a combined library of about 1 x 10 8 complexity.
  • Next-Gen sequencing of the packaged viral DNA revealed capsid surface areas susceptible to directed evolution thus providing guidance for future designs.
  • the utility of the library in gene therapy applications by deriving an AAV2 -based vector characterized by 20-fold higher transduction efficiency in murine liver, now equivalent to that of AAV8.
  • CapLib-6 amino acid sequence of the AAV2 capsid showing altered positions in the library (X) is shown below:
  • AAV is a single-stranded DNA virus belonging to the Parvoviridae family (Muzyczka and Berns, 2001).
  • AAV-derived vectors are promising tools for human gene therapy applications because of their absence of pathogenicity, episomal localization and stable transgene expression (Wu et al, 2006).
  • significant limitations to the clinical use of AAV are its promiscuity and its susceptibility to neutralization by human antibodies (Louis-Jeune et al., 2013). Both of these limitations are determined by the nature of amino acid residues exposed at the surface of the capsid.
  • Two main strategies are generally employed to improve AAV vectors: 1) mutagenizing capsid residues to facilitate binding, entry, and/or intracellular trafficking through a rational approach based on the knowledge of virus biology (Wu et al, 2000; Zhong et al, 2008; Lochrie et al, 2005; Aslanidi et al, 2012; Li et al, 2012; Gabriel et al, 2013; Pandya et al, 2013; Sen et al, 2013; Aslanidi et al, 2013); and 2) utilizing a process of directed evolution, a high- throughput method of introducing molecular modifications into the AAV capsids, manipulating both diversity and selection in a vastly hastened emulation of natural evolution (Muller et al, 2003; Perabo et al, 2003; Maheshri et al, 2006; Michelfelder et al, 2007; Kwon and Schaffer, 2008; Li et al, 2008; Koerber et al
  • the strategy adopted in the present invention integrated both approaches into one unified design.
  • AAV capsid structures Xie et al, 2002; Kaludov et al, 2003; Walters et al, 2004; Padron et al, 2005; Lane et al, 2005; DiMattia et al, 2005; Miller et al, 2006; Nam et al, 2007; Quesada et al, 2007; DiPrimio et al, 2008; Mitchell et al, 2009; Ng et al, 2010; Agbandje-McKennaand Kleinschmidt, 201 1; DiMattia et al, 2012; Govindasamy et al, 2013) and the sequence of 150 naturally-occurring variants, a process of "virtual family shuffling" in silico has been conducted to derive a combinatorial capsid library whereby only variable regions on the surface of the structure are modified.
  • Fragments were assembled by Enzymatic Ligation Assisted by Nucleases (ELAN) as described (Cost and Cozzarelli, 2007). Fragments for the six individual VR lineages were generated by overlap extension (Horton et al, 1989) of PCR products derived from pSub201 (Samulski et al, 1987) for the wild-type regions and from DHGFR products (or from the ELAN product if no suitable DHGFR template was available) for the variable regions.
  • ELAN Enzymatic Ligation Assisted by Nucleases
  • the assembled fragments were inserted into linearized pSubEagApa (a pSub201 derivative containing a deletion between Apal sites at 3764 and 4049 and including an Eagl site at position 4373, a silent mutation, thus allowing reconstitution of a full-length cap gene after insertion of a fragment between the Apal and Eagl sites), using isothermal DNA assembly (Gibson et al, 2009).
  • Viral libraries were generated as previously described (Maheshri et al, 2006) except that HEK 293 cells were co-transfected with 10 ng of the library plasmid and 70 ⁇ g of pHelper (a molar ratio of 1 :5000) for each 15-cm dish.
  • AAV was purified using iodixanol gradient (Zolotukhin et al, 1999) and titered by qPCR using primers specific to the rep gene (forward: 5'- GCAAGACCGGATGTTC AAAT-3 ' (SEQ ID NO: 165), reverse: 5 * -CCTCAACCACGTGATCCTTT-3', (SEQ ID NO: 166).
  • overlapping fragments containing variable regions were amplified from purified DNA isolated from the individual viral libraries, and assembled using overlap extension. The product was inserted into linearized pSubEagApa as described above. The final viral library was generated, purified and quantified as described above.
  • the resulting amplification product was gel-purified. It was then processed at the UF ICBR NextGen core laboratory on a PacBio RS instrument using one SMRT cell. In order to analyze the data, dedicated code was written using the Python 2.7 programming language. The code interpreted the original fastq file containing the CCS reads, corrected reads by aligning them to a reference sequence, translated the corrected reads into protein sequences, and then analyzed the results. Despite a high occurrence of sequencing errors, useful reads could be recovered, because most of the capsid sequence is conserved, and only the sequences in the variable regions are needed.
  • variable regions included 182 nucleotides out of 1399.
  • the corrected reads generated by caplib were therefore derived from the CCS reads that likely had no errors in the variable regions (exact match with the reference sequence, including the ambiguous nucleotides). Obviously, this approach excludes all reads with possible insertions or deletions in the variable regions, and ignores any possible variation in the conserved regions.
  • amplification products were inserted into linearized pSubEagApa as described above. Liver-enriched libraries were then generated, purified and quantified as described above.
  • amplified capsid DNA was inserted into linearized pACG2-m56, a vector derived from pACG-2 (Li et al., 1997) with the same modifications as pSubEagApa (deletion between two Apal sites and introduction of an Eagl site allowing cloning of amplified capsid fragments between the Apal and Eagl sites). Random clones were then analyzed by sequencing.
  • HEK 293 cells were co-transfected with selected capsid variants in pACG2-m56, luciferase-expressing barcoded vector pTR-UF50-BC (GenBank accession # KF926476) and pHelper in equimolar amounts, in a separate transfection for each variant. Each capsid variant was therefore physically linked to a different sequence identifier (barcode). Resulting transgenic AAVs were purified and quantified as described above, except that primers specific to the CBA promoter were used for qPCR:
  • Barcode Sequencing Sequencing of barcoded DNA was performed at the UF ICBR NextGen core laboratory using an lonTorrent PGM system. Samples were amplified using the following barcoded primers:
  • mice were followed for three months and bled monthly from the retro-orbital plexus using heparinized microcapillary tubes.
  • Plasma levels of hFIX antigen were measured by ELISA as published (Mingozzi et al, 2003; Cao et al, 2009).
  • each variable region including nucleotide sequence and resulting amino acid diversity, is shown in the accompanying figures.
  • nucleotide sequence including nucleotide sequence and resulting amino acid diversity.
  • the AAV2 capsid gene fragment incorporating all substitutions was assembled from synthetic oligonucleotides and inserted into a plasmid vector containing the AAV2 genome from which the corresponding WT sequence had been removed.
  • the plasmid library with an estimated complexity of l x l 0 8 , was analyzed by sequencing random clones and was found to reflect accurately the library's design, including expected nucleotide substitutions positions and types. This highly representative plasmid library, however, failed to produce packaged virus of higher titer. An apparent explanation was the presence of an alternative open reading frame (ORF) coding for the assembly-activating protein (AAP) (Sonntag et al, 2010). As the AAP ORF overlaps with coding regions for VRs I and II, their mutagenesis would potentially interfere with AAP structure and function, likely preventing many capsid variants from being assembled.
  • ORF open reading frame
  • the resulting sequence includes 136 degenerate positions and encodes 59 variable amino acid positions, each with 2 to 16 permutations resulting in a theoretical complexity (total number of possible amino acid combinations) of 4x 10 (Govindasamy et al., 2006).
  • Three-dimensional models of the VP3 monomer and the assembled capsid were rendered with variable amino acid positions colored according to VR identity.
  • a plasmid library was generated, with an estimated complexity of 9.2 x 10 7 , as deduced by extrapolating colony counts and correcting for positive clones. Its quality was assessed by sequencing a random sample of 21 clones where all corresponding 21 protein sequences were found to be unique. Each differed from the reference AAV2 sequence by 24 to 41 amino acid substitutions. Substitutions were distributed among five to seven VRs per sequence. VRs II and III were WT in all cases. Because of the assembly procedure, positions 444 and 500 exhibited Y/F polymorphism, with 1/21 and 8/21 containing WT Tyr residues in the respective positions.
  • Viral Library Characterization Extrapolating colony counts and sequencing random individual clones always overestimates the library complexity because a fraction of the variant genomes fails to form viable capsids.
  • the encapsidated viral DNA was subjected to Next-Gen sequencing. The distance between VRs, as well as their small size, would not allow accurate reconstruction of full-length sequence contigs from short reads. Therefore, despite its lower throughput and high error rate, the PacBio Circular Consensus Sequencing (CCS) platform was selected as the one with a compatible read length most suited for the current methodology.
  • CCS PacBio Circular Consensus Sequencing
  • caplib dedicated code
  • Liver is an important gene therapy target to treat many inherited disorders (Sands, 2011; Sharland et al, 2010).
  • Several serotypes target liver preferentially, with the highest transduction efficiency shown by AAV8 (Gao et al, 2002; Nakai et al, 2004) in murine liver, with expression levels two orders of magnitude higher than those of AAV2.
  • AAV8 Gao et al, 2002; Nakai et al, 2004
  • AAV8 is dramatically lower (Hurlbut et al, 2010), although AAV8 is still being considered one of the best candidate vectors for human liver-directed gene therapy.
  • AAV2 was used as the library's backbone, we asked whether a novel capsid variant could be isolated targeting the liver with an efficiency comparable to that of AAV8.
  • 2TS1 GTCTCCATGGTGCCACAGTATGGATACCTCACCCTGAACRACRRSMRSMAGGCAGTCGGACGC (SEQ ID NO :121)
  • 3TS1 CAGCCTAGGAACTGGCTTCCTGGACCCTGTTACCGCCA (SEQ ID NO :127)
  • 3TS4 AGCTATGGCAAGCCACRRGGACRRCRMSRRSARSTTTTTTCCTCAGAGCGGGGTTCTCA (SEQ ID NO :130)
  • 3PS1 TKKTKTTGAGACTCTCTGCTGGCGGTAACAGGGT (SEQ ID NO:153)
  • 3PS2 ATTGAGGTGGTACTTGGTAGCTCCTKKCCAGGAGA (SEQ ID NO:154)
  • mice were euthanized 42 days after injection to examine biodistribution of viral genomes in various tissues and organs. Total DNA was isolated from samples, quantitated and used as template for qPCR to determine viral genome copy numbers.
  • a bioinformatic analysis of the existing sequence database of 150 AAV naturally- occurring variants was used to create a consensus AAV capsid template whereby nine variable regions incorporated alternative residues present in a given position in at least one of the serotypes.
  • This in silico-derived algorithm was converted into a combinatorial plasmid DNA library using the only feasible approach - de novo DNA synthesis. Even though the plasmid library was found to reflect faithfully the initial design, a new selection trait of 3D structural compatibility had to be introduced to isolate structurally sound variants within each individual VR. Subsequently, the successful families were interbred to derive a combined viral library of about 1 x 10 8 complexity, which was characterized in depth using Next-Gen sequencing.
  • AAV2 variant (LiC) targeting murine liver with a 20-fold enhanced efficiency while differing from the WT parent by only four capsid residues. All mutations in both liver-specific variant that were analyzed are located in known antigenic sites for the AAV capsids and regions that control tissue transduction. Residue 263 in VR-I is within the binding site of the A20 monoclonal antibody (Lochrie et al, 2005), and within the ADKlb footprint on AAV1. This region is also known to control transduction (Lochrie et al., 2005).
  • the Q263A mutation is also one of the mutations in AAV2.5, the muscle tropic vector derived from AAV2 (Bowles et al, 2011).
  • the VR-V residues are within the ADKla footprint on AAV1 and the 4E4 footprint on AAV1 (Gurda et al, 2013).
  • Residues 490-500 are within the C37B footprint on AAV2 and 5H7 footprint on AAV1 (Gurda et al, 2013), and have been reported to affect liver tropism in AAV9 (Pu Norwayla et al, 2011).
  • VR-I is raised on the capsid and is not interacting with other monomers; VR-IV protrudes the furthest from the surface and only the base of this VR is interacting with other VP monomers.
  • VRs I, IV, VII, V and VI have the highest content of mutant positions, while VRs III, IX and, to a lesser extent, VIII are mostly invariable, consistent with previous reports (Ng et al, 2010).
  • AAV2 adeno-associated virus type 2
  • AAV-2 adeno-associated virus
  • compositions and methods disclosed and claimed herein can be made and executed without undue experimentation in light of the present disclosure. While the compositions and methods of this invention have been described in terms of preferred embodiments, it will be apparent to those of skill in the art that variations may be applied to the compositions and methods and in the steps or in the sequence of steps of the method described herein without departing from the concept, spirit and scope of the invention. More specifically, it will be apparent that certain agents that are chemically and/or physiologically related may be substituted for the agents described herein while the same or similar results would be achieved. All such similar substitutes and modifications apparent to those skilled in the art are deemed to be within the spirit, scope and concept of the invention as defined by the appended claims.

Landscapes

  • Life Sciences & Earth Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Organic Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Wood Science & Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Zoology (AREA)
  • Biochemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Virology (AREA)
  • Biomedical Technology (AREA)
  • Biotechnology (AREA)
  • General Engineering & Computer Science (AREA)
  • Biophysics (AREA)
  • Molecular Biology (AREA)
  • Medicinal Chemistry (AREA)
  • Microbiology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Plant Pathology (AREA)
  • Physics & Mathematics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Immunology (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Peptides Or Proteins (AREA)
  • Enzymes And Modification Thereof (AREA)

Abstract

Disclosed are compositions and methods for producing modified adeno-associated virus (AAV) cap genes and combinatorial libraries of chimeric AAV vectors and virions; selecting for virions displaying cell-specific tropisms; and, in certain embodiments, producing helper vectors containing one or more modified AAV cap genes. The synthetic combinatorial AAV capsid libraries of the invention are useful in introducing into selected target host cells one or more nucleic acid molecules. The viral vectors and genetic constructs disclosed herein are also useful in a variety of diagnostic and/or therapeutic gene-therapy regimens.

Description

SYNTHETIC COMBINATORIAL AAV CAPSID LIBRARY FOR TARGETED GENE THERAPY
DESCRIPTION
BACKGROUND OF THE INVENTION
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] The present application claims priority to U. S. Provisional Patent Appl. No. 61/883,063, filed September 26, 2013 (pending; Arty. Dkt. No. 36689.341). The content of which is specifically incorporated herein in its entirety by express reference thereto.
STATEMENT REGARDING FEDERALLY SPONSORED RESEARCH OR DEVELOPMENT
[0002] This invention was made with government support under Grant Nos. HL-097088 and GM-082946 awarded by the National Institutes of Health. The government has certain rights in the invention.
NAMES OF THE PARTIES TO A JOINT RESEARCH AGREEMENT
[0003] Not Applicable.
FIELD OF THE INVENTION
[0004] The present invention relates to the fields of molecular biology, medicine, and virology. More particularly, the invention relates to compositions and methods for producing modified adeno-associated virus (AAV) cap genes and combinatorial libraries of chimeric AAV vectors and virions; and in particular embodiments, for selecting for virions displaying cell-specific tropisms; and also for producing helper vectors that contain one or more modified, AAV cap genes.
[0005] The synthetic combinatorial AAV capsid libraries of the invention are useful in introducing into selected target host cells one or more nucleic acid molecules. The viral vectors and genetic constructs disclosed herein are also useful in a variety of diagnostic and/or therapeutic gene-therapy regimens. In an exemplary embodiment, the invention provides novel AAV variants that transduce mouse liver nearly 200 times more efficiently than the corresponding, wild-type, unmodified AAV.
DESCRIPTION OF RELATED ART
[0006] Adeno-associated virus (AAV) is a single-stranded DNA virus belonging to the Parvoviridae family (Muzyczka and Berns, 2001). AAV-derived vectors are promising tools for human gene therapy applications because of their absence of pathogenicity, low immunogenicity, episomal localization and stable transgene expression. However, significant limitations to the clinical use of AAV are its promiscuity and its susceptibility to neutralization by human antibodies (Jeune et al., 2013). Both of these limitations are determined by nature of the amino acid residues exposed at the surface of the capsid. Therefore, major efforts aiming at developing useful and effective gene therapy vectors have been devoted to obtaining and studying capsid variants (Wu et ah, 2006). The first approach was to study naturally occurring AAV isolates. So far, 13 serotypes have been formally characterized and hundreds of variant isolates have been sequenced. Additional capsid variation has been investigated through the generation of mosaics (viral particles made of capsid proteins from more than one serotype) (Hauck et al., 2003; Stachler and Bartlett, 2006; Gigout et ah, 2005), chimeras (capsid proteins with domains from various origins) (Shen et ah, 2007), and various substitutional or insertional mutants (Wu et ah, 2000). However, the most significant advances are expected to result from directed evolution approaches through the development of capsid libraries.
[0007] The various strategies to generate capsid libraries that have been developed so far all suffer from sequence bias or limited diversity. Random display peptide libraries (Govindasamy et al., 2006) are limited to an insertion at one particular capsid location. Libraries generated using error-prone PCR contain a very small fraction of gene variants encoding proteins that can fold properly and assemble into a functional capsid, due to the randomness of the mutations. DNA shuffling and staggered extension processes are more efficient because they recombine naturally- occurring parental sequences and therefore are more likely to generate actual capsid variants. However, they can only recombine blocks of DNA as opposed to single nucleotide positions, which results in sequence bias (parental polymorphisms will tend to cluster together instead of being randomly distributed).
BRIEF SUMMARY OF THE INVENTION
[0008] The present invention overcomes these and other limitations inherent in the art by providing novel capsid libraries, and methods for developing AAV variants that are capable of effectively targeting specific tissues and/or organs. Various strategies have been described to generate AAV capsid libraries, including random peptide display, error-prone PCR or DNA shuffling. The novel, gene synthesis-based approach described in the present application permits the alteration of only the amino acid residues that have side chains exposed to the capsid surface, as well as restricting diversity to naturally-occurring variants, thus improving compatibility with capsid structure and function and increasing the probability of generating useful variants. [0009] In addition, gene synthesis allows virtual recombination between naturally-occurring sequences at the nucleotide level, producing unique combinations that cannot be obtained through other methods. A comparison of naturally-occurring AAV capsid protein sequences shows nine variable regions (commonly designated loops 1 to 9), while the rest of the capsid is highly conserved. The DNA sequence encoding one of these regions (loop 2) also encodes another protein (Assembly-Activating Protein or AAP) in a different frame, which makes it unpractical to modify, AAP being required for proper assembly of functional viral particles. Therefore, the present capsid library construction involved the introduction of variations in the other eight loops only.
[0010] The invention provides a non-naturally occurring nucleic acid comprising: (a) a first nucleotide sequence encoding at least one AAV Rep protein; and (b) a second nucleotide sequence encoding at least one AAV Cap protein, wherein the second nucleotide sequence comprises: (i) a polynucleotide encoding a portion of a Cap protein found in an AAV of a first serotype but not in an AAV of a second serotype differing from the first serotype; and (ii) a polynucleotide encoding a portion of a Cap protein found in the AAV of the second serotype, but not in the AAV of the first serotype, wherein the non-naturally occurring nucleic acid further comprises a first AAV terminal repeat and a second AAV terminal repeat, and the first and second nucleotide sequences are interposed between the first and the second AAV terminal repeats. The first and the second AAV terminal repeats are preferably from serotype 2, and the first serotype is preferably serotype 1, serotype 2, serotype 3, serotype 4, serotype 5, serotype 6, serotype 7, serotype 8, serotype 9, serotype 10, or serotype 11.
[0011] In certain embodiments, the nucleic acid is comprised within a vector, and the AAV Rep protein is preferably from serotype 2.
[0012] In related embodiments, the nucleic acid further may further include a third nucleotide sequence that encodes at least one molecule providing one or more helper function(s) preferably from an adenovirus, a herpesvirus, or a combination thereof.
[0013] The invention also provides a vector library that includes at least a first vector and a second vector, the first vector comprising a nucleic acid comprising: (a) a first nucleotide sequence encoding at least one AAV Rep protein; and (b) a second nucleotide sequence encoding at least one AAV Cap protein, wherein the second nucleotide sequence comprises: (i) a polynucleotide encoding a portion of a Cap protein found in an AAV of a first serotype but not in an AAV of a second serotype differing from the first serotype, and ((ii) a polynucleotide encoding a portion of a Cap protein found in the AAV of the second serotype, but not in the AAV of the first serotype, wherein the nucleic acid further comprises a first AAV TR and a second AAV TR, and the first and second nucleotide sequences are interposed between the first and the second AAV TRs, and the second vector differing from the first vector by at least one nucleotide.
[0014] In exemplary embodiments, the vector libraries of the present invention may be incorporated into at least one host cell, such as a mammalian or insect host cell.
[0015] The invention further provides an AAV virion that includes a nucleic acid comprising: (a) a first nucleotide sequence encoding at least one AAV Rep protein; (b) a second nucleotide sequence encoding at least one AAV Cap protein, wherein the second nucleotide sequence comprises (i) a polynucleotide encoding a portion of a Cap protein found in an AAV of a first serotype but not in an AAV of a second serotype differing from the first serotype, and (ii) a polynucleotide encoding a portion of a Cap protein found in the AAV of the second serotype, but not in the AAV of the first serotype; and (c) a first and a second AAV TR, wherein the first and the second nucleotide sequences are interposed between the first and the second AAV TRs.
[0016] In particular embodiments, the AAV virion will further preferably include at least one AAV Cap protein encoded by the second nucleotide sequence, and in certain applications, the Cap protein is preferably a wild-type AAV Cap protein.
[0017] The second nucleotide sequence may further optionally include a polynucleotide that encodes a portion of a Cap protein found in an AAV of a fourth serotype but not found in a Cap protein of an AAV of the first, second or third serotypes, and may further still include a polynucleotide that encodes a portion of a Cap protein found in an AAV of a fifth serotype but not found in a Cap protein of an AAV of the first, second, third or fourth serotypes.
[0018] In further embodiments, the AAV virions of the invention will include a second nucleotide sequence that further includes a polynucleotide that encodes a portion of a Cap protein found in an AAV of a sixth serotype but not found in a Cap protein of an AAV of the first, second, third, fourth or fifth serotypes.
[0019] Likewise, the AAV virions of the invention may include a second nucleotide sequence that further includes a polynucleotide that encodes a portion of a Cap protein found in an AAV of a seventh serotype but not found in a Cap protein of an AAV of the first, second, third, fourth, fifth or sixth serotypes., or similarly, include a polynucleotide that encodes a portion of a Cap protein found in an AAV of an eight serotype but not found in a Cap protein of an AAV of the first, second, third, fourth, fifth, sixth or seventh serotypes.
[0020] In various gene therapy applications of the disclosed invention, the nucleic acid contained within the AAV vector will preferably further include a DNA sequence that encodes one or more diagnostic, therapeutic, and/or prophylactic molecules. In such embodiments, the nucleic acid preferably further includes one or more expression control sequence(s) that effect cell- or tissue-specific expression of the therapeutic molecule. In certain embodiments, the expression control sequence includes one or more promoters operably linked to the sequence encoding the therapeutic molecule, which is preferably a polypeptide, a peptide, or an R A.
BRIEF DESCRIPTION OF THE DRAWINGS
[0021] For promoting an understanding of the principles of the invention, reference will now be made to the embodiments, or examples, illustrated in the drawings and specific language will be used to describe the same. It will, nevertheless be understood that no limitation of the scope of the invention is thereby intended. Any alterations and further modifications in the described embodiments, and any further applications of the principles of the invention as described herein are contemplated as would normally occur to one of ordinary skill in the art to which the invention relates.
[0022] The following drawings form part of the present specification and are included to demonstrate certain aspects of the present invention. The application contains at least one drawing that is executed in color. Copies of this patent or patent application publication with color drawing(s) will be provided by the Patent and Trademark Office upon request and payment of the necessary fee. The invention may be better understood by reference to the following description taken in conjunction with the accompanying drawings, in which like reference numerals identify like elements, and in which:
[0023] FIG. 1A and FIG. IB show the nucleotide sequence of CapLib variable regions (VRs) and corresponding amino acid diversity. Each VR region shows a nucleotide sequence (lowercase letters) as designed and encoded by synthetic oligonucleotides, including degenerate positions (IUPAC nucleotide code) highlighted in yellow. The corresponding amino acid sequence (UPPERCASE letters above nucleotide sequence) encoded by all possible codon combinations is shown in the line/s above. Amino acids highlighted in blue were selected for the inclusion into the library sequence because they were found in one or more naturally-occurring 150 variants used for the library design, while those that are not highlighted represent an additional amino acid diversity encoded by the degenerate nucleotides. Highlighted in orange are amino acid residues not encoded by the WT AAV2 sequence that were introduced during design to increase transduction efficiency (Y/F) or eliminate heparin binding (R/A). The amino acid residues in logo style shows the alignment of the sequences deduced from the NextGen sequencing of the library viral DNA. The X-axis designates residue position (VPl numbering), and the Y-axis - the relative frequency of each amino acid at that position. Amino acids are colored according to their chemical properties: polar amino acids are green; basic, blue; acidic, red; and hydrophobic amino acids are black;
[0024] FIG 2 shows a schematic representation of the CapLib design and construction steps. AAV2 capsid is shown at the top of the chart whereby numbers represent the respective amino acid residues. Variable region (VR) sub-libraries were packaged and purified (indicated by differentially colored VRs). DNAs from these individual sub-libraries were purified and used construct a final combined library;
[0025] FIG 3A, FIG 3B, and FIG 3C show variable regions (VRs) on the AAV2 capsid surface. FIG 3A: AAV2 capsid full capsid (assembled from 60 VP3 monomers shown to the right), displaying the location of the eight VRs, colored as described below the image of the monomer . FIG 3B and FIG 3C, respectively: LiA and LiC full capsids variants and their respective monomers. The mutated residues and their positions are shown by color and by number, respectively;
[0026] FIG 4A, FIG 4B, FIG 4C, FIG 4D, and FIG 4E show the analysis of packaged viral library complexity. FIG 4A: Shannon entropy of the viral library computed from 840 individual protein sequences. The X-axis designates residue position (VP1 numbering) and the Y-axis - computed value of the entropy; FIG 4B: Distribution of the distinct capsid sequences and their copy numbers; FIG 4C: Distribution of the number of mutations in the sample of analyzed protein sequences; FIG 4D: Distribution of the number of mutant VRs. The different combinations of mutated VRs are designated by the respective colors shown to the right of the graph. The most frequently encountered mutant VRs combinations are also marked by the Roman numerals over the respective graph areas; FIG 4E: Comparison of expected and observed percentages of mutant residues. The X-axis designates residue position (VP1 numbering); the respective VR boundaries are shown below amino acid numbers for better orientation. The Y-axis designates the percentage of the expected (introduced by design) mutation (blue) vs experimentally deduced from the sequencing of the plasmid library (red) vs viral library (green). The similitude of the graphs height at each position indicates a relative neutrality of this position for the capsid assembly/structure, whereas the difference between a theoretical (blue) and plasmid-derived sequences (red) indicates a selective pressure against this particular mutated residue within one single VR library, or within a context of all mutated VRs in the combined viral library (green). Because the sample of the sequenced plasmid library included only 21 individually sequenced random clones, due to the low sampling representation, the number of observed mutants (red) sometimes exceeds the expected frequency (blue) which always (with the exception of residues 444, 500, and 588) includes wt AAV2 residue. [0027] FIG 5A, FIG 5B, FIG 5C, FIG 5D, FIG 5E, and FIG 5F show the selection of new variants from murine liver. FIG 5A: Amino acid sequences of the variable regions (VRs) of the variants selected from the library after three rounds of directed evolution in the mouse liver, wt AAV2 sequences are shown in bold for comparison; FIG 5B: Expression of luciferase transgene in the liver of mice at day 40 after tail-vein administration of rAAV vectors packaged into capsids as indicated; FIG 5C: Time course of rAAV-Luc expression in the liver as assessed by Luciferase imaging in vivo. The Y-axis designates the level of bioluminescence (n=3 mice per group); FIG 5D: Systemic expression of human F.IX in hemophilia B (C3H/HeJ/F9-/-) mice over 3 months following peripheral vein delivery of ApoE/hAAT-hF.IX transgene cassette packaged either in AAV8 (red), LiC (green) or AAV2-M3 (triple AAV2 mutant Y444F, Y500F and Y730F, blue) capsid (1010 vg/mouse, n=4/group); FIG 5E: Systemic expression of human F.IX in hemophilia B (C3H/HeJ/F9-/-) mice at 4 weeks following peripheral vein delivery of ApoE/hAAT-hF.IX transgene cassette packaged either in AAV8 (red) or LiA (yellow) capsid (1010 vg/mouse, n = 4/group); FIG 5F: biodistribution study of LiA and LiC variants (tabulated as a number of viral genomes per ng of genomic DNA, Y-axis) conducted 23 days after peripheral vein delivery in BALB/c male mice (n = 3), as compared to AAV2 and AAV8 (X-axis). Note predominantly liver-specific targeting of the selected variants LiA and LiC;
[0028] FIG 6 shows the nucleotide sequence of the Variable Region VIII (VR-VIII) in CapLib-3A and CapLib-3B plasmid and viral libraries. Shown are raw sequencing data to illustrate the selection pressure upon individual amino acid residues within one VR (VR-VIII) when all mutated VRs are combined in one library. The mutagenized and wt AAV2 reference sequence are shown below;
[0029] FIG 7 shows the alignment of mutated regions in consensus and sequences found in more than 4 copies. Amino acid substitutions are highlighted, those occurring in the consensus (top sequence) are in yellow. The 9 sequences under the consensus were those found in more than 4 copies; copy number is indicated on the left. The total number of mutations is shown to the right of each sequence;
[0030] FIG 8 shows the amino acid composition in variable positions. The X-axis designates residue position (VP1 numbering), and the Y-axis - the relative frequency of each amino acid at that position. Amino acid color-coding is shown to the right of the graph. The respective VR boundaries are shown below amino acid numbers for better orientation;
[0031] FIG 9 shows the comparison of theoretical and experimental complexity at each variable amino acid position. The X-axis designates residue position (VP1 numbering), and the Y-axis - the theoretical (blue) and experimental (red) complexities at that position as reflected by total number of mutations. The respective VR boundaries are shown below amino acid numbers for better orientation;
[0032] FIG. 10 shows a diagram of in vivo directed evolution. Viral library is injected intravenously (via tail vein). Three days post-injection, the liver is harvested and subjected to collagenase/protease treatment. Episomal Hirt DNA was isolated from the whole organ and utilized to amplify AAV capsid gene sequences. A new, Round one-enriched library was prepared and the cycle was repeated. After 3 cycles, individual clones were sequenced and analyzed. The recurrent variants were selected and cap gene sequence was subcloned to derive a helper plasmid. rAAV vectors incorporating reporter genes were then packaged and their biodistribution was analyzed after intravenous administration;
[0033] FIG. 11 shows barcoded AAV cassette. Top - diagram of barcoded AAV transgene cassette: TR- AAV2 terminal repeat; CBA- CMV-P-actin promoter; luc - firefly luciferase cDNA; furin-2A - furin cleavage site41 followed by a foot-and-mouth disease virus 2 A ribosomal skip peptide42; pA - bovine growth hormone gene polyadenylation site. Bottom - list of available 6 nt identifiers (barcodes); and
[0034] FIG. 12 shows a diagram of Fragment 3 assembly. Top strand scaffold oligonucleotides (shown in black color) were annealed to bottom strand anchor (shown in red) oligonucleotides. Degenerate positions (IUPAC nucleotide code) are highlighted by yellow background.
DESCRIPTION OF ILLUSTRATIVE EMBODIMENTS
[0035] Illustrative embodiments of the invention are described below. In the interest of clarity, not all features of an actual implementation are described in this specification. It will of course be appreciated that in the development of any such actual embodiment, numerous implementation- specific decisions must be made to achieve the developers' specific goals, such as compliance with system-related and business-related constraints, which will vary from one implementation to another. Moreover, it will be appreciated that such a development effort might be complex and time-consuming, but would be a routine undertaking for those of ordinary skill in the art having the benefit of this disclosure.
[0036] The present invention also provides improved rAAV-based genetic constructs that encode one or more therapeutic agents useful in the preparation of medicaments for the prevention, treatment, and/or amelioration of one or more diseases, disorders or dysfunctions resulting from a deficiency in one or more cellular components. In particular, the invention provides libraries of rAAV-based genetic constructs encoding one or more selected molecules of interest, such as, for example, one or more diagnostic or therapeutic agents (including, e.g., proteins, polypeptides, peptides, antibodies, antigen binding fragments, siRNAs, RNAis, antisense oligo- and poly-nucleotides, ribozymes, and variants and/or active fragments thereof), for use in the diagnosis, prevention, treatment, and/or amelioration of symptoms of mammalian diseases, disorders, dysfunctions, deficiencies, defects, trauma, injury, and such like.
[0037] The present invention also provides infectious rAAV virions, as well as nucleic acid molecules and rAAV vectors that encode the novel AAV vectors described herein, , as well as nucleic acids encoding one or more selected diagnostic and/or therapeutic agents for delivery to a selected population of mammalian cells.
[0038] Preferably, the novel rAAV vectors, express constructs, and infectious virions and viral particles comprising them as disclosed herein preferably have an improved efficiency in transducing one or more of a variety of cells, tissues and organs of interest, when compared to wild-type, unmodified, expression constructs, and to the corresponding rAAV vectors and virions comprising them.
[0039] The improved rAAV vectors provided herein may transduce one or more selected host cells at higher-efficiencies (and often much higher efficiencies) than conventional, wild type (i.e., "unmodified") rAAV vectors. Likewise, vectors prepared as described herein may be of different AAV serotypes, and the mutation of one or more of the sequences described herein may result in improved viral vectors, which are capable of higher-efficiency transduction than that of the corresponding, non-substituted vectors from which the mutants were prepared.
[0040] The development of next-generation rAAV viral vectors may dramatically reduce the number of viral particles needed for a conventional gene therapy regimen. In addition to having improved transduction efficiencies for various mammalian cells, the rAAV vectors prepared as described herein may be more stable, less immunogenic, and/or can be produced at much lower cost, or in a higher titer, than an equivalent wild type viral vector prepared in conventional fashion.
[0041] In the practice of the invention, native amino acids normally present in the sequence of a viral capsid protein, may be substituted by one or more non-native amino acids, including, a substitution of one or more amino acids not normally present at a particular residue in the corresponding wild-type protein.
[0042] The invention also provides isolated and purified polynucleotides that encode one or more of the disclosed viral vectors as described herein, as well as polynucleotides that encode such vectors. Preferably, the vector constructs of the present invention further include at least one nucleic acid segment that encodes a diagnostic or therapeutic molecule operably linked to a promoter capable of expressing the nucleic acid segment in a suitable host cell comprising the vector.
[0043] In the practice of the invention, the transduction efficiency of a mutated rAAV vector will be higher than that of the corresponding, unmodified, wild-type vector, and as such, will preferably possess a transduction efficiency in a mammalian cell that is at least 2-fold, at least about 4-fold, at least about 6-fold, at least about 8— fold, at least about 10-fold, or at least about 12-fold or higher in a selected mammalian host cell than that of a virion that comprises a corresponding, unmodified, rAAV vector. In certain embodiments, the transduction efficiency of the rAAV vectors provided herein will be at least about 15 -fold higher, at least about 20-fold higher, at least about 25-fold higher, at least about 30-fold higher, or at least about 40, 45, or 50- fold or more greater than that of a virion that comprises a corresponding, wild-type vectors.
[0044] The present invention also concerns rAAV vectors, wherein the nucleic acid segment further comprises a promoter, an enhancer, a post-transcriptional regulatory sequence, a polyadenylation signal, or any combination thereof, operably linked to the nucleic acid segment that encodes the selected polynucleotide of interest. Preferably, the promoter is a heterologous promoter, a tissue-specific promoter, a cell-specific promoter, a constitutive promoter, an inducible promoter, or any combination thereof. In certain embodiments, nucleic acid segments cloned into one or more of the novel rAAV expression vectors described herein will preferably express or encode one or more polypeptides, peptides, ribozymes, peptide nucleic acids, siR As, R Ais, antisense oligonucleotides, antisense polynucleotides, antibodies, antigen binding fragments, or any combination thereof.
[0045] As noted herein, the therapeutic agents useful in the invention may include one or more agonists, antagonists, anti-apoptosis factors, inhibitors, receptors, cytokines, cytotoxins, erythropoietic agents, glycoproteins, growth factors, growth factor receptors, hormones, hormone receptors, interferons, interleukins, interleukin receptors, nerve growth factors, neuroactive peptides, neuroactive peptide receptors, proteases, protease inhibitors, protein decarboxylases, protein kinases, protein kinase inhibitors, enzymes, receptor binding proteins, transport proteins or one or more inhibitors thereof, serotonin receptors, or one or more uptake inhibitors thereof, serpins, serpin receptors, tumor suppressors, diagnostic molecules, chemotherapeutic agents, cytotoxins, or any combination thereof.
[0046] While the inventors particularly contemplate the use of rAAV2 -based vectors in certain methods for gene therapy, vectors may also be prepared and packaged within virions of any known AAV serotype, including, for examples, AAV serotype 1 (AAVl), AAV serotype 3 (AAV3), AAV serotype 4 (AAV4), AAV serotype 5 (AAV5), AAV serotype 6 (AAV6), AAV serotype 7 (AAV7), AAV serotype 8 (AAV8), AAV serotype 9 (AAV9), AAV serotype 10 (AAV10), AAV serotype 11 (AAV11), or AAV serotype 12 (AAV 12).
[0047] The invention further provides populations and pluralities of such rAAV vectors as prepared herein, as well as virions, infectious viral particles, and mammalian host cells that include one or more nucleic acid segments encoding them.
[0048] Preferably, the mammalian host cells will be human host cells, including, for example blood cells, stem cells, hematopoietic cells, CD34+ cells, liver cells, cancer cells, vascular cells, pancreatic cells, neural cells, ocular or retinal cells, epithelial or endothelial cells, dendritic cells, fibroblasts, or any other cell of mammalian origin, including, without limitation, hepatic (i.e., liver) cells, lung cells, cardiac cells, pancreatic cells, intestinal cells, diaphragmatic cells, renal (i.e., kidney) cells, neural cells, blood cells, bone marrow cells, or any one or more selected tissues of a mammal for which viral-based gene therapy is contemplated.
[0049] The invention further provides composition and formulations that include one or more of the proteins nucleic acid segments viral vectors, host cells, or viral particles of the present invention together with one or more pharmaceutically-acceptable buffers, diluents, or excipients. Such compositions may be included in one or more diagnostic or therapeutic kits, for diagnosing, preventing, treating or ameliorating one or more symptoms of a mammalian disease, injury, disorder, trauma or dysfunction.
[0050] The invention further includes a method for providing a mammal in need thereof with a diagnostically- or therapeutically-effective amount of a selected biological molecule, the method comprising providing to a cell, tissue or organ of a mammal in need thereof, an amount of an rAAV vector; and for a time effective to provide the mammal with a diagnostically- or a therapeutically-effective amount of the selected biological molecule.
[0051] The invention further provides a method for diagnosing, preventing, treating, or ameliorating at least one or more symptoms of a disease, a disorder, a dysfunction, an injury, an abnormal condition, or trauma in a mammal. In an overall and general sense, the method includes at least the step of administering to a mammal in need thereof one or more of the disclosed rAAV vectors, in an amount and for a time sufficient to diagnose, prevent, treat or ameliorate the one or more symptoms of the disease, disorder, dysfunction, injury, abnormal condition, or trauma in the mammal.
[0052] The invention also provides a method of transducing a population of mammalian cells. In an overall and general sense, the method includes at least the step of introducing into one or more cells of the population, a composition that comprises an effective amount of one or more of the rAAV vectors disclosed herein. [0053] In a further embodiment, the invention also provides isolated nucleic acid segments that encode one or more of the mutant viral capsid proteins as described herein, and provides recombinant vectors, virus particles, infectious virions, and isolated host cells that comprise one or more of the improved vector sequences described and tested herein.
[0054] Additionally, the present invention provides compositions, as well as therapeutic and/or diagnostic kits that include one or more of the disclosed AAV compositions, formulated with one or more additional ingredients, or prepared with one or more instructions for their use.
[0055] The invention also demonstrates methods for making, as well as methods of using the disclosed improved rAAV vectors in a variety of ways, including, for example, ex situ, in vitro and in vivo applications, methodologies, diagnostic procedures, and/or gene therapy regimens. Because many of the improved vectors described herein are also resistant to proteasomal degradation, they possess significantly increased transduction efficiencies in vivo making them particularly well suited for viral vector-based human gene therapy regimens, and in particular, for delivering one or more genetic constructs to selected mammalian cells in vivo and/or in vitro.
[0056] In one aspect, the invention provides compositions comprising AAV vectors, virions, viral particles, and pharmaceutical formulations thereof, useful in methods for delivering genetic material encoding one or more beneficial or therapeutic product(s) to mammalian cells and tissues. In particular, the compositions and methods of the invention provide a significant advancement in the art through their use in the treatment, prevention, and/or amelioration of symptoms of one or more mammalian diseases. It is contemplated that human gene therapy will particularly benefit from the present teachings by providing new and improved viral vector constructs for use in the treatment of a number of diverse diseases, disorders, and dysfunctions.
[0057] In another aspect, the invention concerns libraries of rAAV vector mutants that demonstrate improved properties useful in the delivery of one or more therapeutic agents to selected mammalian cells, and particularly for use in the prevention, treatment, and/or amelioration of one or more disorders in a mammal into which the vector construct may be introduced.
[0058] The rAAV vectors of the present invention may optionally further include one or more enhancer sequences that are each operably linked to the nucleic acid segment. Exemplary enhancer sequences include, but are not limited to, one or more selected from the group consisting of a CMV enhancer, a synthetic enhancer, a liver-specific enhancer, an vascular-specific enhancer, a brain-specific enhancer, a neural cell-specific enhancer, a lung-specific enhancer, a muscle-specific enhancer, a kidney-specific enhancer, a pancreas-specific enhancer, and an islet cell-specific enhancer. [0059] Exemplary promoters useful in the practice of the invention include, without limitation, one or more heterologous, tissue-specific, constitutive or inducible promoters, including, for example, but not limited to, a promoter selected from the group consisting of a CMV promoter, a β-actin promoter, an insulin promoter, an enolase promoter, a BDNF promoter, an NGF promoter, an EGF promoter, a growth factor promoter, an axon-specific promoter, a dendrite-specific promoter, a brain-specific promoter, a hippocampal-specific promoter, a kidney-specific promoter, an elafin promoter, a cytokine promoter, an interferon promoter, a growth factor promoter, an i -antitrypsin promoter, a brain cell-specific promoter, a neural cell-specific promoter, a central nervous system cell-specific promoter, a peripheral nervous system cell- specific promoter, an interleukin promoter, a serpin promoter, a hybrid CMV promoter, a hybrid β-actin promoter, an EF1 promoter, a Ula promoter, a Ulb promoter, a Tet-inducible promoter, a VP16-LexA promoter, or any combination thereof. In exemplary embodiments, the promoter may include a mammalian or avian β-actin promoter.
[0060] The vector-encoding nucleic acid segments may also further include one or more post- transcriptional regulatory sequences or one or more polyadenylation signals, including, for example, but not limited to, a woodchuck hepatitis virus post-transcription regulatory element, a polyadenylation signal sequence, or any combination thereof.
[0061] Exemplary diagnostic or therapeutic agents deliverable to host cells by the present vector constructs include, but are not limited to, an agent selected from the group consisting of a polypeptide, a peptide, an antibody, an antigen binding fragment, a ribozyme, a peptide nucleic acid, a siRNA, an RNAi, an antisense oligonucleotide, an antisense polynucleotide, and any combination thereof.
[0062] In exemplary embodiments, the rAAV vectors obtained by the disclosed methods will preferably encode at least one diagnostic or therapeutic protein or polypeptide selected from the group consisting of a molecular marker, an adrenergic agonist, an anti-apoptosis factor, an apoptosis inhibitor, a cytokine receptor, a cytokine, a cytotoxin, an erythropoietic agent, a glutamic acid decarboxylase, a glycoprotein, a growth factor, a growth factor receptor, a hormone, a hormone receptor, an interferon, an interleukin, an interleukin receptor, a kinase, a kinase inhibitor, a nerve growth factor, a netrin, a neuroactive peptide, a neuroactive peptide receptor, a neurogenic factor, a neurogenic factor receptor, a neuropilin, a neurotrophic factor, a neurotrophin, a neurotrophin receptor, an N-methyl-D-aspartate antagonist, a plexin, a protease, a protease inhibitor, a protein decarboxylase, a protein kinase, a protein kinsase inhibitor, a proteolytic protein, a proteolytic protein inhibitor, a semaphorin,, a semaphorin receptor, a serotonin transport protein, a serotonin uptake inhibitor, a serotonin receptor, a serpin, a serpin receptor, a tumor suppressor, and any combination thereof.
[0063] In certain applications, the rAAV vectors of the present invention may include one or more nucleic acid segments that encode a polypeptide selected from the group consisting of BDNF, CNTF, CSF, EGF, FGF, G-SCF, GM-CSF, gonadotropin, IFN, IFG-1, M-CSF, NGF, PDGF, PEDF, TGF, TGF-B2, TNF, VEGF, prolactin, somatotropin, XIAP1, IL-1, IL-2, IL-3, IL- 4, IL-5, IL-6, IL-7, IL-8, IL-9, IL-10, IL-10(I87A), viral IL-10, IL-11, IL-12, IL-13, IL-14, IL-15, IL-16, IL-17, IL-18, and any combination thereof.
[0064] In another embodiment, the invention concerns genetically-modified, improved- transduction-efficiency rAAV vectors that include at least a first nucleic acid segment that encodes one or more therapeutic agents that alter, inhibit, reduce, prevent, eliminate, or impair the activity of one or more endogenous biological processes in the cell. In particular embodiments, such therapeutic agents may be those that selectively inhibit or reduce the effects of one or more metabolic processes, dysfunctions, disorders, or diseases. In certain embodiments, the defect may be caused by injury or trauma to the mammal for which treatment is desired. In other embodiments, the defect may be caused the over-expression of an endogenous biological compound, while in other embodiments still; the defect may be caused by the under-expression or even lack of one or more endogenous biological compounds.
[0065] The genetically-modified rAAV vectors and expression systems of the present invention may also further optionally include a second distinct nucleic acid segment that comprises, consists essentially of, or consists of, one or more enhancers, one or more regulatory elements, one or more transcriptional elements, or any combination thereof, that alter, improve, regulate, and/or affect the transcription of the nucleotide sequence of interest expressed by the modified rAAV vectors.
[0066] For example, the rAAV vectors of the present invention may further include a second nucleic acid segment that comprises, consists essentially of, or consists of, a CMV enhancer, a synthetic enhancer, a cell-specific enhancer, a tissue-specific enhancer, or any combination thereof. The second nucleic acid segment may also further comprise, consist essentially of, or consist of, one or more intron sequences, one or more post-transcriptional regulatory elements, or any combination thereof.
[0067] The improved vectors and expression systems of the present invention may also optionally further include a polynucleotide that comprises, consists essentially of, or consists of, one or more polylinkers, restriction sites, and/or multiple cloning region(s) to facilitate insertion (cloning) of one or more selected genetic elements, genes of interest, or therapeutic or diagnostic constructs into the rAAV vector at a selected site within the vector.
[0068] In further aspects of the present invention, the exogenous polynucleotide(s) that may be delivered into suitable host cells by the improved, capsid-modified, rAAV vectors disclosed herein are preferably of mammalian origin, with polynucleotides encoding one or more polypeptides or peptides of human, non-human primate, porcine, bovine, ovine, feline, canine, equine, epine, caprine, or lupine origin being particularly preferred.
[0069] The exogenous polynucleotide(s) that may be delivered into host cells by the disclosed capsid-modified viral vectors may, in certain embodiments, encode one or more proteins, one or more polypeptides, one or more peptides, one or more enzymes, or one or more antibodies (or antigen-binding fragments thereof), or alternatively, may express one or more siR As, ribozymes, antisense oligonucleotides, PNA molecules, or any combination thereof. When combinational gene therapies are desired, two or more different molecules may be produced from a single rAAV expression system, or alternatively, a selected host cell may be transfected with two or more unique rAAV expression systems, each of which may comprise one or more distinct polynucleotides that encode a therapeutic agent.
[0070] In other embodiments, the invention also provides rAAV vector mutants that are comprised within an infectious adeno-associated viral particle or a virion, as well as pluralities of such virions or infectious particles. Such vectors and virions may be comprised within one or more diluents, buffers, physiological solutions or pharmaceutical vehicles, or formulated for administration to a mammal in one or more diagnostic, therapeutic, and/or prophylactic regimens. The vectors, virus particles, virions, and pluralities thereof of the present invention may also be provided in excipient formulations that are acceptable for veterinary administration to selected livestock, exotics, domesticated animals, and companion animals (including pets and such like), as well as to non-human primates, zoological or otherwise captive specimens, and such like.
[0071] The invention also concerns host cells that comprise at least one of the disclosed rAAV expression vectors, or one or more virus particles or virions that comprise such an expression vector. Such host cells are particularly mammalian host cells, with human host cells being particularly highly preferred, and may be either isolated, in cell or tissue culture. In the case of genetically modified animal models, the transformed host cells may even be comprised within the body of a non-human animal itself.
[0072] In certain embodiments, the creation of recombinant non-human host cells, and/or isolated recombinant human host cells that comprise one or more of the disclosed rAAV vectors is also contemplated to be useful for a variety of diagnostic, and laboratory protocols, including, for example, means for the production of large-scale quantities of the rAAV vectors described herein. Such virus production methods are particularly contemplated to be an improvement over existing methodologies including in particular, those that require very high titers of the viral stocks in order to be useful as a gene therapy tool. The inventors contemplate that one very significant advantage of the present methods will be the ability to utilize lower titers of viral particles in mammalian transduction protocols, yet still retain transfection rates at a suitable level.
[0073] Compositions comprising one or more of the disclosed rAAV vectors, expression systems, infectious AAV particles, or host cells also form part of the present invention, and particularly those compositions that further comprise at least a first pharmaceutically-acceptable excipient for use in therapy, and for use in the manufacture of medicaments for the treatment of one or more mammalian diseases, disorders, dysfunctions, or trauma. Such pharmaceutical compositions may optionally further comprise one or more diluents, buffers, liposomes, a lipid, a lipid complex; or the tyrosine-modified rAAV vectors may be comprised within a microsphere or a nanoparticle.
[0074] Pharmaceutical formulations suitable for intramuscular, intravenous, or direct injection into an organ or tissue or a plurality of cells or tissues of a human or other mammal are particularly preferred, however, the compositions disclosed herein may also find utility in administration to discreet areas of the mammalian body, including for example, formulations that are suitable for direct injection into one or more organs, tissues, or cell types in the body. Such injection sites include, but are not limited to, the brain, a joint or joint capsule, a synovium or subsynovium tissue, tendons, ligaments, cartilages, bone, peri-articular muscle or an articular space of a mammalian joint, as well as direct administration to an organ such as the heart, liver, lung, pancreas, intestine, brain, bladder, kidney, or other site within the patient's body, including, for example , introduction of the viral vectors via intraabdominal, intrathorascic, intravascular, or intracerebroventricular delivery.
[0075] Other aspects of the invention concern recombinant adeno-associated virus virion particles, compositions, and host cells that comprise, consist essentially of, or consist of, one or more of the rAAV vectors disclosed herein, such as for example pharmaceutical formulations of the vectors intended for administration to a mammal through suitable means, such as, by intramuscular, intravenous, intra-articular, or direct injection to one or more cells, tissues, or organs of a selected mammal. Typically, such compositions may be formulated with pharmaceutically-acceptable excipients as described hereinbelow, and may comprise one or more liposomes, lipids, lipid complexes, microspheres or nanoparticle formulations to facilitate administration to the selected organs, tissues, and cells for which therapy is desired. [0076] Kits comprising one or more of the disclosed rAAV vectors (as well as one or more virions, viral particles, transformed host cells or pharmaceutical compositions comprising such vectors); and instructions for using such kits in one or more therapeutic, diagnostic, and/or prophylactic clinical embodiments are also provided by the present invention. Such kits may further comprise one or more reagents, restriction enzymes, peptides, therapeutics, pharmaceutical compounds, or means for delivery of the composition(s) to host cells, or to an animal (e.g., syringes, injectables, and the like). Exemplary kits include those for treating, preventing, or ameliorating the symptoms of a disease, deficiency, dysfunction, and/or injury, or may include components for the large-scale production of the viral vectors themselves, such as for commercial sale, or for use by others, including e.g., virologists, medical professionals, and the like.
[0077] Another important aspect of the present invention concerns methods of use of the disclosed rAAV vectors, virions, expression systems, compositions, and host cells described herein in the preparation of medicaments for diagnosing, preventing, treating or ameliorating at least one or more symptoms of a disease, a dysfunction, a disorder, an abnormal condition, a deficiency, injury, or trauma in an animal, and in particular, in a vertebrate mammal. Such methods generally involve administration to a mammal in need thereof, one or more of the disclosed vectors, virions, viral particles, host cells, compositions, or pluralities thereof, in an amount and for a time sufficient to diagnose, prevent, treat, or lessen one or more symptoms of such a disease, dysfunction, disorder, abnormal condition, deficiency, injury, or trauma in the affected animal. The methods may also encompass prophylactic treatment of animals suspected of having such conditions, or administration of such compositions to those animals at risk for developing such conditions either following diagnosis, or prior to the onset of symptoms.
[0078] As described above, the exogenous polynucleotide will preferably encode one or more proteins, polypeptides, peptides, ribozymes, or antisense oligonucleotides, or a combination of these. In fact, the exogenous polynucleotide may encode two or more such molecules, or a plurality of such molecules as may be desired. When combinational gene therapies are desired, two or more different molecules may be produced from a single rAAV expression system, or alternatively, a selected host cell may be transfected with two or more unique rAAV expression systems, each of which will provide unique heterologous polynucleotides encoding at least two different such molecules.
[0079] Compositions comprising one or more of the disclosed rAAV vectors, expression systems, infectious AAV particles, host cells also form part of the present invention, and particularly those compositions that further comprise at least a first pharmaceutically-acceptable excipient for use in the manufacture of medicaments and methods involving therapeutic administration of such rAAV vectors. Such pharmaceutical compositions may optionally further comprise liposomes, a lipid, a lipid complex; or the rAAV vectors may be comprised within a microsphere or a nanoparticle. Pharmaceutical formulations suitable for intramuscular, intravenous, or direct injection into an organ or tissue of a human are particularly preferred.
USE OF RAAV VECTORS IN PROPHYLAXIS, DIAGNOSIS, OR THERAPY
[0080] The present invention provides compositions including one or more of the disclosed rAAV vectors comprised within a kit for diagnosing, preventing, treating or ameliorating one or more symptoms of a mammalian disease, injury, disorder, trauma or dysfunction. Such kits may be useful in the diagnosis, prophylaxis, and/or therapy or a human disease, and may be particularly useful in the treatment, prevention, and/or amelioration of one or more symptoms of cancer, diabetes, autoimmune disease, kidney disease, cardiovascular disease, pancreatic disease, intestinal disease, liver disease, neurological disease, neuromuscular disorder, neuromotor deficit, neuroskeletal impairment, neurological disability, neurosensory dysfunction, stroke, ischemia, α,ι- antitrypsin (AAT) deficiency, Batten's disease, Alzheimer's disease, sickle cell disease, β- thalassamia, Huntington's disease, Parkinson's disease, skeletal disease, trauma, pulmonary disease in a human.
[0081] The invention also provides for the use of a composition disclosed herein in the manufacture of a medicament for treating, preventing or ameliorating the symptoms of a disease, disorder, dysfunction, injury or trauma, including, but not limited to, the treatment, prevention, and/or prophylaxis of a disease, disorder or dysfunction, and/or the amelioration of one or more symptoms of such a disease, disorder or dysfunction.
[0082] The invention also provides a method for treating or ameliorating the symptoms of such a disease, injury, disorder, or dysfunction in a mammal. Such methods generally involve at least the step of administering to a mammal in need thereof, one or more of the rAAV vectors as disclosed herein, in an amount and for a time sufficient to treat or ameliorate the symptoms of such a disease, injury, disorder, or dysfunction in the mammal. Such treatment regimens are particularly contemplated in human therapy, via administration of one or more compositions either intramuscularly, intravenously, subcutaneously, intrathecally, intraperitoneally, or by direct injection into an organ or a tissue of the mammal under care.
[0083] The invention also provides a method for providing to a mammal in need thereof, a therapeutically-effective amount of an rAAV composition of the present invention, in an amount, and for a time effective to provide the patient with a therapeutically-effective amount of the desired therapeutic agent(s) encoded by one or more nucleic acid segments comprised within the rAAV vector. Exemplary therapeutic agents include, but are not limited to, a polypeptide, a peptide, an antibody, an antigen-binding fragment, a ribozyme, a peptide nucleic acid, an siR A, an R Ai, an antisense oligonucleotide, an antisense polynucleotide, or a combination thereof.
PHARMACEUTICAL COMPOSITIONS
[0084] The genetic constructs of the present invention may be prepared in a variety of compositions, and may also be formulated in appropriate pharmaceutical vehicles for administration to human or animal subjects.
[0085] The invention also provides compositions comprising one or more of the disclosed rAAV vectors, expression systems, virions, viral particles, mammalian cells, or combinations thereof. In certain embodiments, the present invention provides pharmaceutical formulations of one or more rAAV vectors disclosed herein for administration to a cell or an animal, either alone or in combination with one or more other modalities of therapy, and in particular, for therapy of human cells, tissues, and diseases affecting man. Formulation of pharmaceutically-acceptable excipients and carrier solutions is well-known to those of skill in the art, as is the development of suitable dosing and treatment regimens for using the particular compositions described herein in a variety of treatment regimens, including e.g., oral, parenteral, intravenous, intranasal, intra-articular, intramuscular administration and formulation.
EXEMPLARY DEFINITIONS
[0086] Unless otherwise defined, all technical terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Commonly understood definitions of molecular biology terms can be found in Rieger et al., (1991); Lewin (1994). Commonly understood definitions of virology terms can be found in Granoff and Webster (1999) and Tidona and Darai (2002). Commonly understood definitions of microbiology can be found in Singleton and Sainsbury (2002).
[0087] In accordance with long standing patent law convention, the words "a" and "an" when used in this application, including the claims, denotes "one or more."
[0088] The terms "about" and "approximately" as used herein, are interchangeable, and should generally be understood to refer to a range of numbers around a given number, as well as to all numbers in a recited range of numbers {e.g., "about 5 to 15" means "about 5 to about 15" unless otherwise stated). Moreover, all numerical ranges herein should be understood to include each whole integer within the range. [0089] As used herein, the term "carrier" is intended to include any solvent(s), dispersion medium, coating(s), diluent(s), buffer(s), isotonic agent(s), solution(s), suspension(s), colloid(s), inert(s) or such like, or a combination thereof, that is pharmaceutically acceptable for administration to the relevant animal. The use of one or more delivery vehicles for chemical compounds in general, and chemotherapeutics in particular, is well known to those of ordinary skill in the pharmaceutical arts. Except insofar as any conventional media or agent is incompatible with the active ingredient, its use in the diagnostic, prophylactic, and therapeutic compositions is contemplated. One or more supplementary active ingredient(s) may also be incorporated into, or administered in association with, one or more of the disclosed chemotherapeutic compositions.
[0090] As used herein, the term "chimeric rcAAV" refers to a replication-competent AAV- derived nucleic acid containing at least one nucleotide sequence that 1) encodes an AAV protein and 2) differs from the corresponding native nucleotide sequence in one or more bases.
[0091] As used herein, the term "DNA segment" refers to a DNA molecule that has been isolated free of total genomic DNA of a particular species. Therefore, a DNA segment obtained from a biological sample using one of the compositions disclosed herein refers to one or more DNA segments that have been isolated away from, or purified free from, total genomic DNA of the particular species from which they are obtained. Included within the term "DNA segment," are DNA segments and smaller fragments of such segments, as well as recombinant vectors, including, for example, plasmids, cosmids, phage, viruses, and the like.
[0092] The term "e.g. ," as used herein, is used merely by way of example, without limitation intended, and should not be construed as referring only those items explicitly enumerated in the specification.
[0093] As used herein, "an effective amount" would be understood by those of ordinary skill in the art to provide a therapeutic, prophylactic, or otherwise beneficial effect against the organism, its infection, or the symptoms of the organism or its infection, or any combination thereof.
[0094] The phrase "expression control sequence" refers to any genetic element (e.g., polynucleotide sequence) that can exert a regulatory effect on the replication or expression (transcription or translation) of another genetic element. Common expression control sequences include promoters, polyadenylation (polyA) signals, transcription termination sequences, upstream regulatory domains, origins of replication, internal ribosome entry sites (IRES), enhancers, and the like. A "tissue specific expression control sequence" is one that exerts a regulatory effect on the replication or expression (transcription or translation) of another genetic element in only one type of tissue or a small subset of tissues. [0095] The phrase "helper function" is meant as a functional activity performed by a nucleic acid or polypeptide that is derived from a virus such as Adenovirus (Ad) or herpesvirus and that facilitates AAV replication in a host cell.
[0096] As used herein, a "heterologous" is defined in relation to a predetermined referenced gene sequence. For example, with respect to a structural gene sequence, a heterologous promoter is defined as a promoter which does not naturally occur adjacent to the referenced structural gene, but which is positioned by laboratory manipulation. Likewise, a heterologous gene or nucleic acid segment is defined as a gene or segment that does not naturally occur adjacent to the referenced promoter and/or enhancer elements.
[0097] As used herein, the term "homology" refers to a degree of complementarity between two or more polynucleotide or polypeptide sequences. The word "identity" may substitute for the word "homology" when a first nucleic acid or amino acid sequence has the exact same primary sequence as a second nucleic acid or amino acid sequence. Sequence homology and sequence identity can be determined by analyzing two or more sequences using algorithms and computer programs known in the art. Such methods may be used to assess whether a given sequence is identical or homologous to another selected sequence.
[0098] As used herein, "homologous" means, when referring to polynucleotides, sequences that have the same essential nucleotide sequence, despite arising from different origins. Typically, homologous nucleic acid sequences are derived from closely related genes or organisms possessing one or more substantially similar genomic sequences. By contrast, an "analogous" polynucleotide is one that shares the same function with a polynucleotide from a different species or organism, but may have a significantly different primary nucleotide sequence that encodes one or more proteins or polypeptides that accomplish similar functions or possess similar biological activity. Analogous polynucleotides may often be derived from two or more organisms that are not closely related (e.g., either genetically or phylogenetically).
[0099] The terms "identical" or percent "identity," in the context of two or more nucleic acid or polypeptide sequences, refer to two or more sequences or subsequences that are the same or have a specified percentage of amino acid residues or nucleotides that are the same, when compared and aligned for maximum correspondence, as measured using one of the sequence comparison algorithms described below (or other algorithms available to persons of ordinary skill) or by visual inspection.
[0100] As used herein, the phrase "in need of treatment" refers to a judgment made by a caregiver such as a physician or veterinarian that a patient requires (or will benefit in one or more ways) from treatment. Such judgment may made based on a variety of factors that are in the realm of a caregiver's expertise, and may include the knowledge that the patient is ill as the result of a disease state that is treatable by one or more compound or pharmaceutical compositions such as those set forth herein.
[0101] The phrases "isolated" or "biologically pure" refer to material that is substantially, or essentially, free from components that normally accompany the material as it is found in its native state. Thus, isolated polynucleotides in accordance with the invention preferably do not contain materials normally associated with those polynucleotides in their natural, or in situ, environment.
[0102] As used herein, the term "kit" may be used to describe variations of the portable, self- contained enclosure that includes at least one set of components to conduct one or more of the diagnostic or therapeutic methods of the invention.
[0103] The term "library" refers to a collection of elements that differ from one another in at least one aspect. For example, a vector library is a collection of at least two vectors that differ from one another by at least one nucleotide. As another example, a "virion library" is a collection of at least two virions that differ from one another by at least one nucleotide or at least one capsid protein.
[0104] Link" or "join" refers to any method known in the art for functionally connecting one or more proteins, peptides, nucleic acids, or polynucleotides, including, without limitation, recombinant fusion, covalent bonding, disulfide bonding, ionic bonding, hydrogen bonding, electrostatic bonding, and the like.
[0105] As used herein, the term "master" library refers to a pool of rAAV virions composed of chimeric rcAAV vectors encapsidated in cognate chimeric capsids {e.g., capsids containing a degenerate or otherwise modified Cap protein).
[0106] When referring to a nucleic acid molecule or polypeptide, the term "native" refers to a naturally-occurring {e.g., a WT) nucleic acid or polypeptide.
[0107] The term "naturally occurring" as used herein as applied to an object refers to the fact that an object can be found in nature. For example, a polypeptide or polynucleotide sequence that is present in an organism (including viruses) that can be isolated from a source in nature and which has not been intentionally modified by the hand of man in a laboratory is naturally- occurring. As used herein, laboratory strains of rodents that may have been selectively bred according to classical genetics are considered naturally occurring animals
[0108] As used herein, the phrase "nucleic acid" means a chain of two or more nucleotides such as R A (ribonucleic acid) and DNA (deoxyribonucleic acid). The phrases "cap nucleic acid," "cap gene," and "capsid gene" as used herein mean a nucleic acid that encodes a Cap protein. Examples of cap nucleic acids include "wild-type" (WT) Cap-encoding nucleic acid sequences from AAV serotypes 1 , 2, and 5; a native form cap cDNA; a nucleic acid having sequences from which a cap cDNA can be transcribed; and/or allelic variants and homologs of the foregoing.
[0109] As used herein, the term "patient" (also interchangeably referred to as "host" or "subject") refers to any host that can receive one or more of the pharmaceutical compositions disclosed herein. Preferably, the subject is a vertebrate animal, which is intended to denote any animal species (and preferably, a mammalian species such as a human being). In certain embodiments, a "patient" refers to any animal host including without limitation any mammalian host. Preferably, the term refers to any mammalian host, the latter including but not limited to, human and non-human primates, bovines, canines, caprines, cavines, corvines, epines, equines, felines, hircines, lapines, leporines, lupines, murines, ovines, porcines, ranines, racines, vulpines, and the like, including livestock, zoological specimens, exotics, as well as companion animals, pets, and any animal under the care of a veterinary practitioner.
[0110] The phrase "pharmaceutically-acceptable" refers to molecular entities and compositions that preferably do not produce an allergic or similar untoward reaction when administered to a mammal, and in particular, when administered to a human. As used herein, "pharmaceutically acceptable salt" refers to a salt that preferably retains the desired biological activity of the parent compound and does not impart any undesired toxico logical effects. Examples of such salts include, without limitation, acid addition salts formed with inorganic acids (e.g., hydrochloric acid, hydrobromic acid, sulfuric acid, phosphoric acid, nitric acid, and the like); and salts formed with organic acids including, without limitation, acetic acid, oxalic acid, tartaric acid, succinic acid, maleic acid, fumaric acid, gluconic acid, citric acid, malic acid, ascorbic acid, benzoic acid, tannic acid, pamoic (embonic) acid, alginic acid, naphthoic acid, polyglutamic acid, naphthalenesulfonic acids, naphthalenedisulfonic acids, polygalacturonic acid; salts with polyvalent metal cations such as zinc, calcium, bismuth, barium, magnesium, aluminum, copper, cobalt, nickel, cadmium, and the like; salts formed with an organic cation formed from Ν,Ν'-dibenzylethylenediamine or ethylenediamine; and combinations thereof.
[0111] The term "pharmaceutically acceptable salt" as used herein refers to a compound of the present disclosure derived from pharmaceutically acceptable bases, inorganic or organic acids. Examples of suitable acids include, but are not limited to, hydrochloric, hydrobromic, sulfuric, nitric, perchloric, fumaric, maleic, phosphoric, glycollic, lactic, salicyclic, succinic, toluene-p- sulfonic, tartaric, acetic, citric, methanesulfonic, formic, benzoic, malonic, naphthalene-2- sulfonic, trifluoroacetic and benzenesulfonic acids. Salts derived from appropriate bases include, but are not limited to, alkalis such as sodium and ammonia. [0112] As used herein, the term "plasmid" or "vector" refers to a genetic construct that is composed of genetic material (i.e., nucleic acids). Typically, a plasmid or a vector contains an origin of replication that is functional in bacterial host cells, e.g., Escherichia coli, and selectable markers for detecting bacterial host cells including the plasmid. Plasmids and vectors of the present invention may include one or more genetic elements as described herein arranged such that an inserted coding sequence can be transcribed and translated in a suitable expression cells. In addition, the plasmid or vector may include one or more nucleic acid segments, genes, promoters, enhancers, activators, multiple cloning regions, or any combination thereof, including segments that are obtained from or derived from one or more natural and/or artificial sources. As used herein, the term "polypeptide" is intended to encompass a singular "polypeptide" as well as plural "polypeptides," and includes any chain or chains of two or more amino acids. Thus, as used herein, terms including, but not limited to "peptide," "dipeptide," "tripeptide," "protein," "enzyme," "amino acid chain," and "contiguous amino acid sequence" are all encompassed within the definition of a "polypeptide," and the term "polypeptide" can be used instead of, or interchangeably with, any of these terms. The term further includes polypeptides that have undergone one or more post-translational modification(s), including for example, but not limited to, glycosylation, acetylation, phosphorylation, amidation, derivatization, proteolytic cleavage, post-translation processing, or modification by inclusion of one or more non-naturally occurring amino acids. Conventional nomenclature exists in the art for polynucleotide and polypeptide structures. For example, one-letter and three-letter abbreviations are widely employed to describe amino acids: Alanine (A; Ala), Arginine (R; Arg), Asparagine (N; Asn), Aspartic Acid (D; Asp), Cysteine (C; Cys), Glutamine (Q; Gin), Glutamic Acid (E; Glu), Glycine (G; Gly), Histidine (H; His), Isoleucine (I; He), Leucine (L; Leu), Methionine (M; Met), Phenylalanine (F; Phe), Proline (P; Pro), Serine (S; Ser), Threonine (T; Thr), Tryptophan (W; Trp), Tyrosine (Y; Tyr), Valine (V; Val), and Lysine (K; Lys). Amino acid residues described herein are preferred to be in the "L" isomeric form. However, residues in the "D" isomeric form may be substituted for any L-amino acid residue provided the desired properties of the polypeptide are retained.
[0113] As used herein, the terms "prevent," "preventing," "prevention," "suppress," "suppressing," and "suppression" as used herein refer to administering a compound either alone or as contained in a pharmaceutical composition prior to the onset of clinical symptoms of a disease state so as to prevent any symptom, aspect or characteristic of the disease state. Such preventing and suppressing need not be absolute to be deemed medically useful.
[0114] The term "promoter," as used herein refers to a region or regions of a nucleic acid sequence that regulates transcription. [0115] "Protein" is used herein interchangeably with "peptide" and "polypeptide," and includes both peptides and polypeptides produced synthetically, recombinantly, or in vitro and peptides and polypeptides expressed in vivo after nucleic acid sequences are administered into a host animal or human subject. The term "polypeptide" is preferably intended to refer to any amino acid chain length, including those of short peptides from two to about 20 amino acid residues in length, oligopeptides from about 10 to about 100 amino acid residues in length, and longer polypeptides including those of about 100 or more amino acid residues in length. Furthermore, the term is also intended to include enzymes, i.e., functional biomolecules including at least one amino acid polymer. Polypeptides and proteins of the present invention also include polypeptides and proteins that are or have been post-translationally modified, and include any sugar or other derivative(s) or conjugate(s) added to the backbone amino acid chain.
[0116] The term "pseudotyped" is meant a nucleic acid or genome derived from a first AAV serotype that is encapsidated (packaged) into an AAV capsid containing at least one AAV Cap protein of a second serotype differing from the first serotype.
[0117] As used herein, the term "rcAAV vector" refers to a replication-competent AAV- derived nucleic acid capable of DNA replication in a cell without any additional AAV genes or gene products.
[0118] The term "recombinant" indicates that the material {e.g., a polynucleotide or a polypeptide) has been artificially or synthetically (non-naturally) altered by human intervention. The alteration can be performed on the material within or removed from, its natural environment or state. Specifically, e.g., a promoter sequence is "recombinant" when it is produced by the expression of a nucleic acid segment engineered by the hand of man. For example, a "recombinant nucleic acid" is one that is made by recombining nucleic acids, e.g., during cloning, DNA shuffling or other procedures, or by chemical or other mutagenesis; a "recombinant polypeptide" or "recombinant protein" is a polypeptide or protein which is produced by expression of a recombinant nucleic acid; and a "recombinant virus," e.g., a recombinant AAV virus, is produced by the expression of a recombinant nucleic acid.
[0119] The term "regulatory element," as used herein, refers to a region or regions of a nucleic acid sequence that regulates transcription. Exemplary regulatory elements include, but are not limited to, enhancers, post-transcriptional elements, transcriptional control sequences, and such like.
[0120] The term "RNA segment" refers to an RNA molecule that has been isolated free of total cellular RNA of a particular species. Therefore, RNA segments can refer to one or more RNA segments (either of native or synthetic origin) that have been isolated away from, or purified free from, other R As. Included within the term "R A segment," are R A segments and smaller fragments of such segments.
[0121] By the term "seed library" is meant a pool of AAV virions composed of chimeric rcAAV vectors encapsidated into AAV capsids of a single serotype.
[0122] The terms "substantially corresponds to," "substantially homologous," or "substantial identity," as used herein, denote a characteristic of a nucleic acid or an amino acid sequence, wherein a selected nucleic acid or amino acid sequence has at least about 70 or about 75 percent sequence identity as compared to a selected reference nucleic acid or amino acid sequence. More typically, the selected sequence and the reference sequence will have at least about 76, 77, 78, 79, 80, 81, 82, 83, 84 or even 85 percent sequence identity, and more preferably, at least about 86, 87, 88, 89, 90, 91, 92, 93, 94, or 95 percent sequence identity. More preferably still, highly homologous sequences often share greater than at least about 96, 97, 98, or 99 percent sequence identity between the selected sequence and the reference sequence to which it was compared.
[0123] The percentage of sequence identity may be calculated over the entire length of the sequences to be compared, or may be calculated by excluding small deletions or additions which total less than about 25 percent or so of the chosen reference sequence. The reference sequence may be a subset of a larger sequence, such as a portion of a gene or flanking sequence, or a repetitive portion of a chromosome. However, in the case of sequence homology of two or more polynucleotide sequences, the reference sequence will typically comprise at least about 18-25 nucleotides, more typically at least about 26 to 35 nucleotides, and even more typically at least about 40, 50, 60, 70, 80, 90, or even 100 or so nucleotides.
[0124] When highly-homologous fragments are desired, the extent of percent identity between the two sequences will be at least about 80%, preferably at least about 85%>, and more preferably about 90%) or 95 %> or higher, as readily determined by one or more of the sequence comparison algorithms well-known to those of skill in the art, such as e.g., the FASTA program analysis described by Pearson and Lipman (1988).
[0125] As used herein, the term "structural gene" is intended to generally describe a polynucleotide, such as a gene, that is expressed to produce an encoded peptide, polypeptide, protein, ribozyme, catalytic RNA molecule, or antisense molecule.
[0126] The term "subject," as used herein, describes an organism, including a mammal such as a human primate, to which treatment with one or more of the disclosed compositions may be provided. Mammalian species that may benefit from the disclosed treatment methods include, without limitation, humans, non-human primates such as apes; chimpanzees; monkeys, and orangutans, domesticated animals, including dogs and cats, as well as livestock such as horses, cattle, pigs, sheep, and goats, or other mammalian species including, without limitation, mice, rats, guinea pigs, rabbits, hamsters, and the like.
[0127] As used herein, the terms "terminal repeat" or "TR" mean a nucleic acid sequence derived from an AAV that is required in cis for replication and packaging of AAV.
[0128] "Transcriptional regulatory element" refers to a polynucleotide sequence that activates transcription alone or in combination with one or more other nucleic acid sequences. A transcriptional regulatory element may include, for example, one or more promoters, one or more response elements, one or more negative regulatory elements, one or more enhancers, or any combination thereof.
[0129] As used herein, a "transcription factor recognition site" and a "transcription factor binding site" refer to a polynucleotide sequence(s) or sequence motif(s) that are identified as being sites for the sequence-specific interaction of one or more transcription factors, frequently taking the form of direct protein-DNA binding. Typically, transcription factor binding sites can be identified by DNA footprinting, gel mobility shift assays, and the like, and/or can be predicted based on known consensus sequence motifs, or by other methods known to one of ordinary skill in the relevant molecular biological and virology arts.
[0130] "Transcriptional unit" refers to a polynucleotide sequence that comprises at least a first structural gene operably linked to at least a first cis-acting promoter sequence and optionally linked operably to one or more other cis-acting nucleic acid sequences necessary for efficient transcription of the structural gene sequences, and at least a first distal regulatory element as may be required for the appropriate tissue-specific and developmental transcription of the structural gene sequence operably positioned under the control of the promoter and/or enhancer elements, as well as any additional cis sequences that are necessary for efficient transcription and translation (e.g., polyadenylation site(s), mRNA stability controlling sequence(s), etc.
[0131] As used herein, the term "transformed cell" is intended to mean a host cell whose nucleic acid complement has been altered by the introduction of one or more exogenous polynucleotides into that cell.
[0132] As used herein, the term "transformation" is intended to generally describe a process of introducing an exogenous polynucleotide sequence (e.g., a viral vector, a plasmid, or a recombinant DNA or RNA molecule) into a host cell or protoplast in which the exogenous polynucleotide is incorporated into at least a first chromosome or is capable of autonomous replication within the transformed host cell. Transfection, electroporation, and "naked" nucleic acid uptake all represent examples of techniques used to transform a host cell with one or more polynucleotides. [0133] As used herein, the terms "treat," "treating," and "treatment" refer to the administration of one or more compounds (either alone or as contained in one or more pharmaceutical compositions) after the onset of clinical symptoms of a disease state so as to reduce, or eliminate any symptom, aspect or characteristic of the disease state. Such treating need not be absolute to be deemed medically useful. As such, the terms "treatment," "treat," "treated," or "treating" may refer to therapy, or to the amelioration or the reduction, in the extent or severity of disease, of one or more symptom thereof, whether before or after its development afflicts a patient.
[0134] As used herein, the term "vector" refers to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked, e.g., a plasmid. One type of preferred vector is an episome, i.e., a nucleic acid capable of extra-chromosomal replication. Preferred vectors are those capable of autonomous replication and/or expression of nucleic acids to which they are linked. An "rAAV vector" is a recombinant AAV-derived nucleic acid containing at least one terminal repeat (TR) sequence.
[0135] The use of "virion" is meant to describe a virus particle that contains a nucleic acid and a protein coat (capsid). An "rAAV virion" is a virion that includes nucleic acid sequences and/or proteins derived from a rAAV vector.
[0136] The term "a sequence essentially as set forth in SEQ ID NO:X" means that the sequence substantially corresponds to a portion of SEQ ID NO:X and has relatively few nucleotides (or amino acids in the case of polypeptide sequences) that are not identical to, or a biologically functional equivalent of, the nucleotides (or amino acids) of SEQ ID NO :X. The term "biologically functional equivalent" is well understood in the art, and is further defined in detail herein. Accordingly, sequences that have about 85% to about 90%>; or more preferably, about 91%) to about 95%; or even more preferably, about 96%> to about 99%; of nucleotides that are identical or functionally equivalent to one or more of the nucleotide sequences provided herein are particularly contemplated to be useful in the practice of the invention.
[0137] Suitable standard hybridization conditions for the present invention include, for example, hybridization in 50% formamide, 5x Denhardt's solution, 5x SSC, 25 mM sodium phosphate, 0.1 % SDS and 100 μ^ιηΐ of denatured salmon sperm DNA at 42°C for 16 h followed by 1 hr sequential washes with O.lx SSC, 0.1% SDS solution at 60°C to remove the desired amount of background signal. Lower stringency hybridization conditions for the present invention include, for example, hybridization in 35% formamide, 5x Denhardt's solution, 5x SSC, 25 mM sodium phosphate, 0.1% SDS and 100 μ^ιηΐ denatured salmon sperm DNA or E. coli DNA at 42°C for 16 h followed by sequential washes with 0.8x SSC, 0.1% SDS at 55°C. Those of skill in the art will recognize that conditions can be readily adjusted to obtain the desired level of stringency.
[0138] Naturally, the present invention also encompasses nucleic acid segments that are complementary, essentially complementary, and/or substantially complementary to at least one or more of the specific nucleotide sequences specifically set forth herein. Nucleic acid sequences that are "complementary" are those that are capable of base-pairing according to the standard Watson-Crick complementarity rules. As used herein, the term "complementary sequences" means nucleic acid sequences that are substantially complementary, as may be assessed by the same nucleotide comparison set forth above, or as defined as being capable of hybridizing to one or more of the specific nucleic acid segments disclosed herein under relatively stringent conditions such as those described immediately above.
[0139] As described above, the probes and primers of the present invention may be of any length. By assigning numeric values to a sequence, for example, the first residue is 1 , the second residue is 2, etc., an algorithm defining all probes or primers contained within a given sequence can be proposed:
[0140] n to n + y, where n is an integer from 1 to the last number of the sequence and y is the length of the probe or primer minus one, where n + y does not exceed the last number of the sequence. Thus, for a 25-basepair probe or primer {i.e., a "25-mer"), the collection of probes or primers correspond to bases 1 to 25, bases 2 to 26, bases 3 to 27, bases 4 to 28, and so on over the entire length of the sequence. Similarly, for a 35-basepair probe or primer (i.e., a "35-mer), exemplary primer or probe sequence include, without limitation, sequences corresponding to bases 1 to 35, bases 2 to 36, bases 3 to 37, bases 4 to 38, and so on over the entire length of the sequence. Likewise, for 40-mers, such probes or primers may correspond to the nucleotides from the first basepair to bp 40, from the second bp of the sequence to bp 41, from the third bp to bp 42, and so forth, while for 50-mers, such probes or primers may correspond to a nucleotide sequence extending from bp 1 to bp 50, from bp 2 to bp 51, from bp 3 to bp 52, from bp 4 to bp 53, and so forth.
[0141] In certain embodiments, it will be advantageous to employ one or more nucleic acid segments of the present invention in combination with an appropriate detectable marker (i.e., a "label,"), such as in the case of employing labeled polynucleotide probes in determining the presence of a given target sequence in a hybridization assay. A wide variety of appropriate indicator compounds and compositions are known in the art for labeling oligonucleotide probes, including, without limitation, fluorescent, radioactive, enzymatic or other ligands, such as avidin/biotin, etc., which are capable of being detected in a suitable assay. In particular embodiments, one may also employ one or more fluorescent labels or an enzyme tag such as urease, alkaline phosphatase or peroxidase, instead of radioactive or other environmentally less- desirable reagents. In the case of enzyme tags, colorimetric, chromogenic, or fluorigenic indicator substrates are known that can be employed to provide a method for detecting the sample that is visible to the human eye, or by analytical methods such as scintigraphy, fluorimetry, spectrophotometry, and the like, to identify specific hybridization with samples containing one or more complementary or substantially complementary nucleic acid sequences. In the case of so- called "multiplexing" assays, where two or more labeled probes are detected either simultaneously or sequentially, it may be desirable to label a first oligonucleotide probe with a first label having a first detection property or parameter (for example, an emission and/or excitation spectral maximum), which also labeled a second oligonucleotide probe with a second label having a second detection property or parameter that is different (i.e., discreet or discernable from the first label. The use of multiplexing assays, particularly in the context of genetic amplification/detection protocols are well-known to those of ordinary skill in the molecular genetic arts.
[0142] In accordance with the present invention, polynucleotides, nucleic acid segments, nucleic acid sequences, and the like, include, but are not limited to, DNAs (including and not limited to genomic or extragenomic DNAs), genes, peptide nucleic acids (PNAs) RNAs (including, but not limited to, rRNAs, mRNAs and tRNAs), nucleosides, and suitable nucleic acid segments either obtained from natural sources, chemically synthesized, modified, or otherwise prepared or synthesized in whole or in part by the hand of man.
EXAMPLES
[0143] The following examples are included to demonstrate illustrative embodiments of the invention. It should be appreciated by those of ordinary skill in the art that the techniques disclosed in these examples represent techniques discovered to function well in the practice of the invention, and thus can be considered to constitute preferred modes for its practice. However, those of ordinary skill in the art should, in light of the present disclosure appreciate that many changes can be made in the specific embodiments which are disclosed and still obtain a like or similar result without departing from the spirit and scope of the invention.
EXAMPLE 1 - AAV VECTOR LIBRARY CONSTRUCTION
[0144] Methodologies to improve existing AAV vectors for gene therapy include either rational approaches or directed evolution to derive capsid variants characterized by superior transduction efficiencies in targeted tissues. In the present invention, both approaches were integrated in one unified design strategy of "virtual family shuffling" to derive a combinatorial capsid library whereby only variable regions on the surface of the capsid are modified. Individual sub-libraries were first assembled in order to pre-select compatible amino acid residues within restricted surface-exposed regions to minimize the generation of dead-end variants. Subsequently, the successful families were interbred to derive a combined library of about 1 x 108 complexity. Next-Gen sequencing of the packaged viral DNA revealed capsid surface areas susceptible to directed evolution thus providing guidance for future designs. The utility of the library in gene therapy applications by deriving an AAV2 -based vector characterized by 20-fold higher transduction efficiency in murine liver, now equivalent to that of AAV8.
EXPERIMENTAL METHODS
[0145] Experimental methods useful in the practice of the present invention may be found in the contemporary molecular genetics literature, and are well known to those of ordinary skill in the gene therapy arts. Detailed methods and protocols for the preparation and purification of AAV vectors may be found in U.S. Patent 7.220,577 (specifically incorporate herein in its entirety by express reference thereto).
[0146] The CapLib-6 amino acid sequence of the AAV2 capsid showing altered positions in the library (X) is shown below:
[0147]
MAADGYLPDWLEDTLSEGIRQWWKLKPGPPPPKPAERHKDDSRGLVLPGYKYLGPFNGLDKGEPV NEADAAALEHDKAYDRQLDSGDNPYLKYNHADAEFQERLKEDTSFGGNLGRAVFQAKKRVLEPLG LVEEPVKTAPGKKRPVEHSPVEPDSSSGTGKAGQQPARKRLNFGQTGDADSVPDPQPLGQPPAAP SGLGTNTMATGSGAPMADNNEGADGVGNSSGNWHCDSTWMGDRVITTSTRTWALPTYNNHLYKQI SSXXGXXNDNHYFGYSTPWGYFDFNRFHCHFSPRDWQRLINNNWGFRPKRLNFKLFNIQVKEVTQ NDGTT IANNLTSTVQVFTDSEYQLPYVLGSAHQGCLPPFPADVFMVPQYGYLTLNXXXXAVGRS SFYCLEYFPSQMLRTGNNFTFSYTFEDVPFHSSYAHSQSLDRLMNPLIDQYLYFLSRTNXXXGXX TXSXLXFSQXXASDIRDQSRNWLPGPCYRQQRVSXXXXXNNNSXFSWXGATKYHLNGRDSLVNPG PAMASHXDXXXXFFPQSGVLIFGKXXXXXXXXXXXXVMITDEEEIRTTNPVATEQYGSVSTNLQX XXXXAAXXXVXTQGVLPGMVWQDRDVYLQGPIWAKI PHTDGHFHPSPLMGGFGLKHPPPQILIKN TPVPANPSTTFSAAKFASFITQYSTGQVSVEIEWELQKENSKRWNPEIQYTSNXXXXXXVXXTVD TNGVYSEPRPIGTRFLTRNL (SEQ ID NO: 105) [0148] The library was injected in the bloodstream of mice, and capsid DNA was amplified from the liver three days later and used to generate a new viral library. After three such rounds of in vivo selection, the following variants were obtained:
Loop I 444 IV V c l ones subst (SEQ ID NOS)
AAV2 SQS6ASN Y NTPSGTTTQSRLQFS TSADNNNSEYSWTGATKYH (SEQ ID NO: 106)
LI-A SAS6ASN F NSE66SLTQSSL6FS TDGENNNSDFSWTGATKYH 21 14 (SEQ ID NO: 107)
LI-B SQS6ASN Y NTPSGTTTQSRLQFS TDGENNNSDFSWTGATKYH 4 5 (SEQ ID NO: 108)
LI-C SAS6ASN Y NTPSGTTTQSRLQFS TSADNNNSEFSWPGATTYH 3 4 (SEQ ID NO: 109)
LI-D SQS6ASN F NSEGGSLTQSSLGFS TDGENNNSDFSWTGATKYH 3 13 (SEQ ID NO: 110)
LI-E SAS6ASN Y NTPSGSLTQSSLGFS TDGENNNSDFSWTGATKYH 2 10 (SEQ ID NO : 111 )
LI-F SQS6ASN Y NTPSGTTTQSRLQFS TSADNNNSDFSWTGATKYH 2 2 (SEQ ID NO: 112)
LI-6 S1AGASN F NSEGGSLTQSSLGFS TDGENNNSDFSWTGATKYH 2 15 (SEQ ID NO: 113)
EXAMPLE 2 ~ INTEGRATING COMBINATORIAL AND RATIONAL APPROACHES TO DERIVE NOVEL AAV VARIANTS
[0149] AAV is a single-stranded DNA virus belonging to the Parvoviridae family (Muzyczka and Berns, 2001). AAV-derived vectors are promising tools for human gene therapy applications because of their absence of pathogenicity, episomal localization and stable transgene expression (Wu et al, 2006). However, significant limitations to the clinical use of AAV are its promiscuity and its susceptibility to neutralization by human antibodies (Louis-Jeune et al., 2013). Both of these limitations are determined by the nature of amino acid residues exposed at the surface of the capsid. Two main strategies are generally employed to improve AAV vectors: 1) mutagenizing capsid residues to facilitate binding, entry, and/or intracellular trafficking through a rational approach based on the knowledge of virus biology (Wu et al, 2000; Zhong et al, 2008; Lochrie et al, 2005; Aslanidi et al, 2012; Li et al, 2012; Gabriel et al, 2013; Pandya et al, 2013; Sen et al, 2013; Aslanidi et al, 2013); and 2) utilizing a process of directed evolution, a high- throughput method of introducing molecular modifications into the AAV capsids, manipulating both diversity and selection in a vastly hastened emulation of natural evolution (Muller et al, 2003; Perabo et al, 2003; Maheshri et al, 2006; Michelfelder et al, 2007; Kwon and Schaffer, 2008; Li et al, 2008; Koerber et al, 2008; Li et al, 2009; Yang et al, 2009; (Koerber et al, 2009; Maguire et al, 2010; Gray et al, 2010; Jang et al, 2011; Yang et al, 2011; Asuri et al, 2012; Dalkara et al, 2013; Yang and Xiao, 2013). Although both methodologies have been successful in creating vectors with superior transduction capabilities, their utility is limited by an understanding of AAV life cycle, and by the technical boundaries of the protocols for directed evolution.
[0150] The strategy adopted in the present invention integrated both approaches into one unified design. Using detailed knowledge of known AAV capsid structures (Xie et al, 2002; Kaludov et al, 2003; Walters et al, 2004; Padron et al, 2005; Lane et al, 2005; DiMattia et al, 2005; Miller et al, 2006; Nam et al, 2007; Quesada et al, 2007; DiPrimio et al, 2008; Mitchell et al, 2009; Ng et al, 2010; Agbandje-McKennaand Kleinschmidt, 201 1; DiMattia et al, 2012; Govindasamy et al, 2013) and the sequence of 150 naturally-occurring variants, a process of "virtual family shuffling" in silico has been conducted to derive a combinatorial capsid library whereby only variable regions on the surface of the structure are modified.
[0151] The utility of the resulting library was demonstrated by enhancing the transduction of murine liver by 20-fold with an AAV2-derived vector containing only four mutations — a combination of rational mutagenesis and directed evolution.
MATERIALS AND METHODS
[0152] Library Construction. The library was built in two steps: first, individual VR lineages (each with mutations in only one or two variable regions) were derived, selecting for amino acid combinations compatible with capsid assembly; then, structurally-compatible sequences were combined to generate the final library. DNA fragments were synthesized by Degenerate Homoduplex Gene Family Recombination (DHGFR) as described previously (Coco et al, 2002):
Fragments were assembled by Enzymatic Ligation Assisted by Nucleases (ELAN) as described (Cost and Cozzarelli, 2007). Fragments for the six individual VR lineages were generated by overlap extension (Horton et al, 1989) of PCR products derived from pSub201 (Samulski et al, 1987) for the wild-type regions and from DHGFR products (or from the ELAN product if no suitable DHGFR template was available) for the variable regions. The assembled fragments were inserted into linearized pSubEagApa (a pSub201 derivative containing a deletion between Apal sites at 3764 and 4049 and including an Eagl site at position 4373, a silent mutation, thus allowing reconstitution of a full-length cap gene after insertion of a fragment between the Apal and Eagl sites), using isothermal DNA assembly (Gibson et al, 2009). Viral libraries were generated as previously described (Maheshri et al, 2006) except that HEK 293 cells were co-transfected with 10 ng of the library plasmid and 70 μg of pHelper (a molar ratio of 1 :5000) for each 15-cm dish. AAV was purified using iodixanol gradient (Zolotukhin et al, 1999) and titered by qPCR using primers specific to the rep gene (forward: 5'- GCAAGACCGGATGTTC AAAT-3 ' (SEQ ID NO: 165), reverse: 5*-CCTCAACCACGTGATCCTTT-3', (SEQ ID NO: 166). In order to generate the final library, overlapping fragments containing variable regions were amplified from purified DNA isolated from the individual viral libraries, and assembled using overlap extension. The product was inserted into linearized pSubEagApa as described above. The final viral library was generated, purified and quantified as described above.
[0153] Library Sequencing. Purified viral DNA was amplified using the following primers:
5*-CAACCACCTCTACAAACAAATTTCCAG-3' (SEQ ID NO: 167) and
5'-CACGCCATTAGTGTCCACAG-3' (SEQ ID NO: 168) as forward and reverse, respectively.
[0154] The resulting amplification product was gel-purified. It was then processed at the UF ICBR NextGen core laboratory on a PacBio RS instrument using one SMRT cell. In order to analyze the data, dedicated code was written using the Python 2.7 programming language. The code interpreted the original fastq file containing the CCS reads, corrected reads by aligning them to a reference sequence, translated the corrected reads into protein sequences, and then analyzed the results. Despite a high occurrence of sequencing errors, useful reads could be recovered, because most of the capsid sequence is conserved, and only the sequences in the variable regions are needed.
[0155] In this example, the variable regions included 182 nucleotides out of 1399. The corrected reads generated by caplib were therefore derived from the CCS reads that likely had no errors in the variable regions (exact match with the reference sequence, including the ambiguous nucleotides). Obviously, this approach excludes all reads with possible insertions or deletions in the variable regions, and ignores any possible variation in the conserved regions.
[0156] In Vivo Selection. In each round of the in vivo selection approach, 2 male C57BL/6J mice, 8 to 10 weeks old, were injected with 1 x 1010 to 1 x 1011 vg of viral preparation (original library for the first round, target-enriched libraries in subsequent rounds) via the tail vein. Mice were euthanized 3 to 4 days later by cervical dislocation after being anesthetized with isoflurane. Episomal DNA was purified from harvested livers using modified Hirt DNA extraction (Arad, 1998) and used as template to amplify capsid DNA sequences using the following primers:
forward: 5'-GGATGGGCGACAGAGTCATC-3' (SEQ ID NO: 169) and
reverse: 5'-CAAGCAATTACAGATTACGAGTCAGG-3' (SEQ ID NO: 170)
[0157] After gel-purification, amplification products were inserted into linearized pSubEagApa as described above. Liver-enriched libraries were then generated, purified and quantified as described above. After the third round of selection, amplified capsid DNA was inserted into linearized pACG2-m56, a vector derived from pACG-2 (Li et al., 1997) with the same modifications as pSubEagApa (deletion between two Apal sites and introduction of an Eagl site allowing cloning of amplified capsid fragments between the Apal and Eagl sites). Random clones were then analyzed by sequencing.
[0158] Luciferase Expression. HEK 293 cells were co-transfected with selected capsid variants in pACG2-m56, luciferase-expressing barcoded vector pTR-UF50-BC (GenBank accession # KF926476) and pHelper in equimolar amounts, in a separate transfection for each variant. Each capsid variant was therefore physically linked to a different sequence identifier (barcode). Resulting transgenic AAVs were purified and quantified as described above, except that primers specific to the CBA promoter were used for qPCR:
forward: 5'-TCCCATAGTAACGCCAATAGG-3' (SEQ ID NO: 171)
reverse: 5'-CTTGGCATATGATACACTTGATG-3' (SEQ ID NO: 172)
[0159] An equimolar mixture (calculated from the qPCR-derived titers) was used as template to amplify the barcode region, which was then added to an lonTorrent sequencing reaction. Precise relative titering was achieved by quantifying barcodes specific to each variant. Nine- weeks-old male BALB/c mice (Charles River Laboratories) were injected via tail-vein with 1 x 10u vg (according to barcode-corrected titers) of viral preparation, three mice for each variant. Luciferase expression was monitored every 5 days during 40 days on a Xenogen IVIS imaging system 10 to 12 min after intra-peritoneal injection of 150 μg luciferin per g of body weight.
[0160] Barcode Sequencing. Sequencing of barcoded DNA was performed at the UF ICBR NextGen core laboratory using an lonTorrent PGM system. Samples were amplified using the following barcoded primers:
forward:
5'-CCATCTCATCCCTGCGTGTCTCCGACTCAGNNGGACGAGCTGTACAAGTAAATCG-3'
(SEQ ID NO: 173) and
reverse:
5'-CCTCTCTATGGGCAGTCGGTGATNNCCATTATAAGCTGCAATAAACAAG-3'
(SEQ ID NO: 174)
where "NN" designates a unique sequence. Each read therefore contains 3 barcodes: one identifying the capsid variant, located in the template, and two identifying the tissue sample, located in the primers. Sequencing data was analyzed by dna-barcode, a dedicated script written in Python 2.7. [0161] hFIX Expression. Viral vectors containing either AAV8 or LiC capsid and ApoE- hAAT-hF9 vector (Manno et al., 2006) were produced as described above. Male C57BL/6 mice (Jackson Laboratories), 6 to 8 weeks old, were injected in the tail vein with 1 x 1010 vg of either preparation, 4 mice for each vector. Injected mice were followed for three months and bled monthly from the retro-orbital plexus using heparinized microcapillary tubes. Plasma levels of hFIX antigen were measured by ELISA as published (Mingozzi et al, 2003; Cao et al, 2009).
[0162] Biodistribution. An equimolar mixture of viral preparations of barcoded capsid variants was tail vein-injected into three 9-weeks-old male BALB/c mice (Charles River Laboratories), at a dose of 2 x 10n vg per mouse. Mice were euthanized 3 weeks later as described above. Total DNA was isolated from tissue samples and quantified. Occurrence of AAV genomes in tissues was quantified by qPCR using primers specific to the CBA promoter as described above. Relative amounts of the various capsid variants in each sample were calculated from barcode sequencing data.
RESULTS
[0163] Library Design. Structural comparison of the AAV capsid protein among various serotypes has revealed highly homologous sequences interspersed with more evolutionary divergent areas. These amino acid stretches are commonly designated as variable regions I through IX (VRs, also known as "loops") (Govindasamy et ah, 2006). Incidentally, VRs are localized at the surface of the assembled capsid and are assumed to be responsible for the interaction with cell surface receptors and other host factors. Because of their location, VRs are also predicted to be less critical for capsid assembly. Therefore, the guiding principle of the library's design was to modify only surface VRs while keeping the backbone sequence unchanged to maintain the integrity of the assembling scaffold. All candidate positions for mutagenesis were selected from the alignment of 150 AAV naturally-occurring variants, and then evaluated on a 3D model of the AAV2 capsid (Xie et al, 2002).
[0164] Only those residues which were clearly exposed to the surface were selected for modification. To reduce the incidence of discordant residues, the selection of the introduced substitutions was restricted to those appearing in a given position in at least one from the analyzed 150 homologues. Adding to the rational design strategy, four more positions were modified: surface Y444F and Y500F to increase the transduction efficiency (Zhong et al, 2008) and surface R585F and R588F to de-target binding to heparan sulfate proteoglycan (Opie et al., 2003), the primary receptor for AAV2 (Summerford and Samulski, 1998). [0165] Detailed composition of each variable region, including nucleotide sequence and resulting amino acid diversity, is shown in the accompanying figures. To achieve the desired composition, in some cases more than one nucleotide needed to be changed per codon, resulting in additional amino acid diversity. The AAV2 capsid gene fragment incorporating all substitutions was assembled from synthetic oligonucleotides and inserted into a plasmid vector containing the AAV2 genome from which the corresponding WT sequence had been removed.
[0166] The plasmid library, with an estimated complexity of l x l 08, was analyzed by sequencing random clones and was found to reflect accurately the library's design, including expected nucleotide substitutions positions and types. This highly representative plasmid library, however, failed to produce packaged virus of higher titer. An apparent explanation was the presence of an alternative open reading frame (ORF) coding for the assembly-activating protein (AAP) (Sonntag et al, 2010). As the AAP ORF overlaps with coding regions for VRs I and II, their mutagenesis would potentially interfere with AAP structure and function, likely preventing many capsid variants from being assembled. Disruption of AAP, however, was not the only reason for the low viral library complexity from the initial design. Apparently, the high diversity rendered the library non-functional as some of the substitutions were incompatible within the context of the 3D structure. For example, both plasmid and encapsidated viral DNA showed the expected complexity when a single VR-III library was packaged, with all variable positions incorporating nucleotides as designed (CapLib3A). However, when the same VR-III was combined with VR-IV through VR-VIII plasmid libraries, the packaged virions incorporated mostly WT AAV2 genomes despite having expected diversity at the plasmid level (CapLib3B). Apparently, the presence of a multitude of simultaneous substitutions increased the likelihood of combinations that are incompatible with capsid folding and/or assembly, resulting in a dramatic decrease in the fraction of viable variants.
[0167] Structural Compatibility as a Selection Trait. As single VRs libraries appeared to produce both expected diversity and high titer viral stocks, a new strategy was undertaken to generate as much diversity as possible by selecting for compatibility with capsid folding for each individual VR. The recovered encapsidated viral DNAs were then used to create a final library by combining preselected structure-compatible variants. After sequence analysis of the constructed individual libraries, the viral DNA revealed no diversity (WT sequence only) in VR-II (as expected due to the overlapping AAP ORF), low diversity in VRs III and VI, and high diversity in all other VRs. The sequences from these VR lineages were then combined to generate the final library. The resulting sequence includes 136 degenerate positions and encodes 59 variable amino acid positions, each with 2 to 16 permutations resulting in a theoretical complexity (total number of possible amino acid combinations) of 4x 10 (Govindasamy et al., 2006). Three-dimensional models of the VP3 monomer and the assembled capsid were rendered with variable amino acid positions colored according to VR identity.
[0168] A plasmid library was generated, with an estimated complexity of 9.2 x 107, as deduced by extrapolating colony counts and correcting for positive clones. Its quality was assessed by sequencing a random sample of 21 clones where all corresponding 21 protein sequences were found to be unique. Each differed from the reference AAV2 sequence by 24 to 41 amino acid substitutions. Substitutions were distributed among five to seven VRs per sequence. VRs II and III were WT in all cases. Because of the assembly procedure, positions 444 and 500 exhibited Y/F polymorphism, with 1/21 and 8/21 containing WT Tyr residues in the respective positions.
[0169] Viral Library Characterization. Extrapolating colony counts and sequencing random individual clones always overestimates the library complexity because a fraction of the variant genomes fails to form viable capsids. To assess the library's complexity under more stringent conditions, the encapsidated viral DNA was subjected to Next-Gen sequencing. The distance between VRs, as well as their small size, would not allow accurate reconstruction of full-length sequence contigs from short reads. Therefore, despite its lower throughput and high error rate, the PacBio Circular Consensus Sequencing (CCS) platform was selected as the one with a compatible read length most suited for the current methodology. Because no software support existed to analyze the resulting dataset, the inventors also was developed a dedicated code (caplib) to process and analyze sequencing data. From the 19,455 original CCS reads, the caplib software generated a list of 840 corrected reads and translated them into protein sequences analyzed as described above.
[0170] As a convenient way of illustrating the complexity of each permutated VR, Shannon entropy (Shannon et al., 1948) was computed from an alignment of the 840 individual protein sequences. As the data revealed, entropy was highest in VRs I, IV and VII, moderate in VRs V, VI and VIII, very low in VR IX and almost non-existent in VR III. A comparison of the 840 protein sequences identified 699 distinct sequences, including 41 which were present in more than one copy. Each sequence had up to 43 mutations (substitutions), with an average of 19.16.
[0171] The frequency distribution and interdependence of mutagenized VRs revealed a majority (75%) of sequences have mutations in three to five VRs (average 3.76). Almost half of the sequences (414 or 49.3%) have one of the three mutant VR combinations I-IV-V-VII (179), I- IV-V-VI-VII (134) or I-IV-VII (101). Two thirds of the sequences (557 or 66.3%) have mutations in the 3 VRs I, IV and VII. Over 4/5 (677 or 80.6%) have mutations in at least VRs I and IV. [0172] A comparison of expected and observed - both in the plasmid and viral libraries - percentages of mutant residues at each variable amino acid position is shown in the accompanying figures. Comparing theoretical and plasmid libraries shows the effect of mutations in individual VRs on virion assembly, as the combined plasmid library was constructed from packaged viral DNA originating from individual VR libraries. Mutations in VRs IV, VI and VIII alone seem not to interfere significantly with capsid assembly, while mutations in VRs III and IX are strongly selected against. Comparing plasmid and viral libraries allows us to evaluate the effect of combining multiple mutated VRs. Mutant VRs I, IV and V seem to tolerate well additional mutations in other VRs (very little difference can be seen between numbers from plasmid and viral libraries), unlike VR VIII, and to a lesser extent VRs VI, VII and IX.
[0173] A consensus of the 840 sequences was aligned with the nine sequences that were found in more than four copies (only regions with mutations are displayed). In all cases, VRs III, VIII and IX were completely WT, which suggested that these regions may be most sensitive to changes affecting the efficiency of virion assembly. Interestingly, the consensus sequence itself was not identified among the 840 analyzed sequences.
[0174] Amino acid composition at each variable position was determined. Although some level of diversity is visible at most positions (only position 383 has a single identity), in many cases a single amino acid is predominant. However, 14 positions in which no single variant occurs in more than 50% of the sequences can be found, in VRs I (position 263), IV (450 to 461) and VII (548 to 550, 555 and 556).
[0175] The observed complexity of variable amino acid positions compared to theoretical values was also calculated. Experimental complexities vary between 1 and 14 with an average of 5.93, compared to a range of 1 to 16 and an average of 6.79 for theoretical complexities. Only position 383 has an observed complexity of 1, probably the result of sampling bias as only 14 sequences out of 840 have a mutation in VR III. Complexities of the eight variable regions were also computed as well (see Table 1). TABLE 1
AMINO ACID COMPLEXITY IN CAPLIB VARIABLE REGIONS
Theoretical Maximum
from Possible
Theoretical Observed Complexity Number of
Variable Complexity Amino Acid in the Experimental Single-Copy
Region from Design Complexity Sample Complexity Sequences
Loop I 288 396 396 76 23
Loop III 168 12 12 6 3
Loop IV 7.6 x 108 4.8 x 108 699 247 169
Loop V 7.4 x 104 1.4 x 104 699 47 29
Loop VI 2.7 x 103 2.0 x 103 699 89 45
Loop VII 2.4 x 108 1.1 x 108 699 197 135
Loop VIII 9.7 x 108 8.0 x 108 699 122 110
Loop IX 2.4 x 106 3.8 x 105 699 18 12
[0176] Interestingly, they were, in most cases, much smaller than expected. It appears that very few combinations were compatible with capsid assembly, or that different combinations resulted in dramatic differences in assembly efficiency, in effect reducing complexity at the VR level. Note however, that actual VR complexities were probably much higher than observed in the sample, as many sequences occurred as single copies. As for the complexity of the exemplary library itself, the small sample size did not permit its determination with confidence. The total number of possible VR combinations, however, based on the observed complexities (which are underestimated as explained above) is 2.0 x 1014. Applying the lowest observed to expected ratio obtained with amino acid combinations in VRs (18/699) would give 5.0 x 1012, still a much higher number than the limit of 9.2 x 107 described above. That limit needs to be adjusted according to the ratio between observed complexity and sample size (699/840). Therefore, an upper limit of 7.7 x 107 could be confidently estimated for the complexity of the library.
[0177] In Vivo Selection of Liver-Targeted AA V Variants. Liver is an important gene therapy target to treat many inherited disorders (Sands, 2011; Sharland et al, 2010). Several serotypes target liver preferentially, with the highest transduction efficiency shown by AAV8 (Gao et al, 2002; Nakai et al, 2004) in murine liver, with expression levels two orders of magnitude higher than those of AAV2. However, this does not translate to primates, in which the efficiency of AAV8 is dramatically lower (Hurlbut et al, 2010), although AAV8 is still being considered one of the best candidate vectors for human liver-directed gene therapy. Because AAV2 was used as the library's backbone, we asked whether a novel capsid variant could be isolated targeting the liver with an efficiency comparable to that of AAV8.
TABLE 2
Loss OF DIVERSITY DURING FINAL LIBRARY VIRUS PRODUCTION ESTIMATED FROM VARIATIONS IN THE OCCURRENCE OF MUTANT AMINO ACID POSITIONS WITHIN VARIABLE
REGIONS
VR Average % mutant Average % mutant Ratio
positions in plasmid positions in viral
library library
I+VI 59.3 33.2 0.56
III+V 25.8 22.6 0.88
IV 70.6 59.2 0.84
VII 64.3 46.8 0.73
VIII 89.4 12.1 0.14
IX 11.3 2.8 0.25
Product 0.010
[0178] After three rounds of in vivo selection, 41 clones were sequenced, and an alignment of the recurrent sequences' variable regions was generated. None of the 7 liver-selected sequences could be found among the 840 translated sequence reads, which indicates that their abundance in not the result of a pre-existing prevalence in the original library, but is most likely the result of genuine selection. Interestingly, the K507T substitution in LiC was not included into the library's design. A comparison of motif enrichments in the liver-selected variants is summarized in Table 3. TABLE 3
MOTIF ENRICHMENT IN SEQUENCED LIVER-SELECTED VARIANTS
Liver-Targeted
Region Motif CapLib Variants
262-268 SASGASN (SEQ ID NO: 175) 56/840 (6.7%) 26/41 (63.4%)
262-268 SGAGASN (SEQ ID NO: 176) 18/840 (2.1%) 2/41 ( 4.9%)
449-463 NSEGGSLTQSSLGFS (SEQ ID NO: 177) 3/840 (0.4%) 26/41 (63.4%)
491-501 TDGENNNSDFS (SEQ ID NO: 178) 299/840 (35.6%) 32/41 (78.0%)
498-506 SEFSWPGATT (SEQ ID NO: 179) 23/840 (2.7%) 4/41 ( 9.8%)
507 T 0/840 (0.0%) 4/41 ( 9.8%)
491-503 TSADNNNSDFSWT (SEQ ID NO: 180) 77/840 (9.2%) 2/41 ( 4.9%)
[0179] Bold characters in motifs indicate amino acid substitutions (compared to the AAV2 reference). The 2 columns on the right show the motif occurrences in the library sequencing sample (CapLib) and in the sequenced liver-selected variants.
[0180] Motifs with the highest enrichment are SASGASN (SEQ ID NO: 175) in VR I, NSEGGSLTQSSLGFS (SEQ ID NO: 177) in VR IV and SEFSWPGATT (SEQ ID NO: 179) in VR V, suggesting that variants LiA and LiC were the most strongly selected.
[0181] Characterization of Liver-Selected Variants LiA and LiC. Variant capsids LiA and LiC, as well as controls AAV2 and AAV8, were packaged with luciferase-expressing barcoded vector pTR-UF50-BC. The dynamics of luciferase expression in the liver were considerably different for all serotypes and variants: AAV8 mediated a fast initial increase followed by a slow leveling off. LiA followed a similar trend at a lower level of expression. LiC, on the other hand, provided steady gain converging with the levels of AAV8 after about 30 days. At day 40, the AAV8 and LiC-mediated luciferase expression exceeded that of AAV2 by 20-fold. Consistent with luciferase expression, hFIX transgene expression driven by ApoE-hAAT promoter followed the same pattern showing similar efficiencies for AAV8 and LiC, and a two-fold lower efficiency for LiA. TABLE 4
SYNTHETIC OLIGONUCLEOTIDES USED TO ASSEMBLE THE ORIGINAL CAPSID LIBRARY
DESIGNATION NUCLEIC ACID SEQUENCE SEQ ID NO:
1TS1 CCTGGGCCCTGCCCACCTACAACAACCACCT (SEQ ID NO :114)
1TS2 C ACAAACAAAT T T CCAGC WMDCAGGARS CAS CAACGACAAT CAC T AC T T T GGC T ACAG (SEQ ID NO :115)
1TS3 CACCCCTTGGGGGTATTTTGACTTCAACAGATTCCACTGCCACTTTTCACCACGGGACTG (SEQ ID NO :116)
1TS4 GCAAAGACTCATCAACAACAACTGGGGATTCCGCCCCAAGAGACTCAACTTCAAGCTCTT (SEQ ID NO :117)
1TS5 T AACAT T CAAGTCAAAGAGGT CACAMMGMRS RRS RGCRHGAMGACAAT T GC CAAT AACC T (SEQ ID NO :118)
1TS6 TACCAGCACAGTTCAGGTGTTTACTGACTCTGAGTACCAGCTCCCATACGTCCTCGGCAG (SEQ ID NO :119)
1TS7 CGCGCATCAAGGATGCCTCCCACCCTTCCCAGCAGACGTCTTCATGATGCCAC (SEQ ID NO :120)
2TS1 GTCTCCATGGTGCCACAGTATGGATACCTCACCCTGAACRACRRSMRSMAGGCAGTCGGACGC (SEQ ID NO :121)
2TS2 TCTTCATTTTACTGCCTGGAGTACTTTCCTTCTCAGATGCTGCGCACCGGAAAC (SEQ ID NO :122)
2TS3 AACTTTACCTTCAGCTACACTTTTGAGGACGTTCCTTTCCACAGCAGCTACG (SEQ ID NO :123)
2TS4 CTCACAGCCAGAGTCTGGACCGCCTGATGAATCCTCTCATCGACCAGTACCTGTA (SEQ ID NO :124)
2TS5 T T T C T T GAGCAGAACAAACRVC WS RS CGGAMNCVH S ACCMH S T CAWS C T T VD S T T T T CT CAG SBC (SEQ ID NO :125)
RG S G C GAG T G AC A
2TS6 TTCGGGACCAGTCTAGAAAC (SEQ ID NO :126)
3TS1 CAGCCTAGGAACTGGCTTCCTGGACCCTGTTACCGCCA (SEQ ID NO :127)
3TS2 GCAGAGAGT C T CAAMAMMAVN S RVC S RS AACAACAACAGTRAS T T C T CC T GGMMAGGAGC (SEQ ID NO :128)
3TS3 TACCAAGTACCACCTCAATGGCAGAGACTCTCTGGTGAATCCCGGACC (SEQ ID NO :129)
3TS4 AGCTATGGCAAGCCACRRGGACRRCRMSRRSARSTTTTTTCCTCAGAGCGGGGTTCTCA (SEQ ID NO :130)
DESIGNATION NUCLEIC ACID SEQUENCE SEQ ID NO:
3TS5 TCTTTGGGAAGSAARRCRSCRVSRVARVCRATRYCGMSNHCRVMVRSGTGATGATTACAGACGAAGA (SEQ. I D NO:131)
GGAGATCTGGAC
4TS1 GAAGAGGTGATCAGGACAACCAATCCCGTGGCTACAGAGCAGTATGGTTCT (SEQ. I D NO:132)
4TS2 GTCTCTACCAACCTCCAGWSWSMRSRVCVNSGCAGCTDHCWSRNSGTCVMSACACAAGGCGTTC (SEQ I D NO:133)
TTC
4TS3 CAGGCATGGTCTGGCAGGACAGAGATGTGTACCTTCAGGGACCCATCTGGGCA (SEQ I D NO:134)
4TS4 AAGATTCCACACACAGACGGACATTTTCACCCCTCTCCCCTCATGGGTGGATTCG (SEQ I D NO:135)
4TS5 GACTTAAACACCCTCCTCCACAGATTCTCATCAAGAACACCCCCGTACGTGC (SEQ I D NO:136)
5TS1 ACCCCGGTACCTGCGAATCCTTCTACCACCTTCAGTGCGGCAAAGTTTG (SEQ I D NO:137)
5TS2 CTTCCTTCAT C AC AC AG AC T C C AC AG G AC AG GTCAGCGTG GAGA (SEQ I D NO:138)
5TS3 TCGAGTGGGAGCTGCAGAAGGAAAACAGCAAACGCTGGAATCCCGA (SEQ I D NO:139)
5TS4 AATTCAGTACACTTCCAACTWCRVSVASMVSVHS DDTGTGSWS TKSACTGTGGACACTAATGGC (SEQ I D NO:140)
5TS5 GTGTATTCAGAGCCTCGGCCGATTG (SEQ I D NO:141)
1PS1 GCTGGAAATTTGTTTGTAGAGGTGGTTGTTGTAGGTG (SEQ I D NO:142)
1PS2 CCCCCAAGGGGTGCTGTAGCCAAAGTAGTGATT (SEQ I D NO:143)
1PS3 GTTGTTGATGAGTCTTTGCCAGTCCCGTGGTGAAA (SEQ I D NO:144)
1PS4 CCTCTTTGACTTGAATGTTAAAGAGCTTGAAGTTGAGTCT (SEQ I D NO:145)
1PS5 ACCTGAACTGTGCTGGTAAGGTTATTGGCAATTGTC (SEQ I D NO:146)
1PS6 ATCCTTGATGCGCGCTGCCGAGGACGTATG (SEQ I D NO:147)
2PS1 CAGGCAGTAAAATGAAGAGCGTCCGACTGCCT (SEQ I D NO:148)
DESIGNATION NUCLEIC ACID SEQUENCE SEQ ID NO:
2PS2 AGTGTAGCTGAAGGTAAAGTTGTTTCCGGTGCGC (SEQ ID NO:149)
2PS3 CCAGACTCTGGCTGTGAGCGTAGCTGCTGTGGAA (SEQ ID NO:150)
2PS4 GTTTGTTCTGCTCAAGAAATACAGGTACTGGTCGATGA (SEQ ID NO:151)
2PS5 TCTAGACTGGTCCCGAATGTCACTCGCSCYG (SEQ ID NO:152)
3PS1 TKKTKTTGAGACTCTCTGCTGGCGGTAACAGGGT (SEQ ID NO:153)
3PS2 ATTGAGGTGGTACTTGGTAGCTCCTKKCCAGGAGA (SEQ ID NO:154)
3PS3 GTGGCTTGCCATAGCTGGTCCGGGATTCACC (SEQ ID NO:155)
3PS4 GYYTTSCTTCCCAAAGATGAGAACCCCGCTCT (SEQ ID NO:156)
4PS1 C T GGAGG T T GG AGAGAC AGAAC CA AC GCTCTG AG (SEQ ID NO:157)
4PS2 GCCAGACCATGCCTGGAAGAACGCCTTGTGT (SEQ ID NO:158)
4PS3 CGTCTGTGTGTGGAATCTTTGCCCAGATGGGTC (SEQ ID NO:159)
4PS4 GAGGAGGGTGTTTAAGTCCGAATCCACCCATGAG (SEQ ID NO:160)
5PS1 GTACTGTGTGATGAAGGAAGCAAACTTTGCCGCAC (SEQ ID NO:161)
5PS2 GCAGCTCCCACTCGATCTCCACGCTGACCTG (SEQ ID NO:162)
5PS3 AGTTGGAAGTGTACTGAATTTCGGGATTCCAGCG (SEQ ID NO:163)
5PS4 CCGAGGCTCT G AAT AC AC GCCATTAGTGTCCACAGT (SEQ ID NO:164)
[0182] Mice were euthanized 42 days after injection to examine biodistribution of viral genomes in various tissues and organs. Total DNA was isolated from samples, quantitated and used as template for qPCR to determine viral genome copy numbers.
DISCUSSION
[0183] Recent advances in clinical trials involving AAV vectors, concomitant with a more favorable regulatory climate, stimulated efforts to derive vehicles with higher transduction efficiencies, higher target tropism, and lower immunogenicity. One of the most prolific approaches so far has been the isolation of novel AAV serotypes. In spite of its apparent success, characterization of new serotypes, one at a time, is very laborious. An alternative methodology has been to generate combinatorial capsid libraries of high complexity in hope to randomly create a new variant meeting the demands of a particular application. However, the various strategies available to generate capsid libraries suffer from sequence bias or limited diversity. Finally, a rational approach of mutagenizing amino acid residues based on understanding of the capsid structure may have its practical limits, as many favorable mutations apparently cannot be combined to produce additive effects (Aslanidi et al, 2013). In the present example, all three strategies (utilizing naturally existing serotypes, applying directed evolution, and rational mutagenesis) were developed in one unified approach to greatly improve the availability of AAV vectors for use in gene therapy and related methodologies.
[0184] A bioinformatic analysis of the existing sequence database of 150 AAV naturally- occurring variants was used to create a consensus AAV capsid template whereby nine variable regions incorporated alternative residues present in a given position in at least one of the serotypes. This in silico-derived algorithm was converted into a combinatorial plasmid DNA library using the only feasible approach - de novo DNA synthesis. Even though the plasmid library was found to reflect faithfully the initial design, a new selection trait of 3D structural compatibility had to be introduced to isolate structurally sound variants within each individual VR. Subsequently, the successful families were interbred to derive a combined viral library of about 1 x 108 complexity, which was characterized in depth using Next-Gen sequencing.
[0185] The utility of the library was demonstrated by reiterative selection of an AAV2 variant (LiC) targeting murine liver with a 20-fold enhanced efficiency while differing from the WT parent by only four capsid residues. All mutations in both liver-specific variant that were analyzed are located in known antigenic sites for the AAV capsids and regions that control tissue transduction. Residue 263 in VR-I is within the binding site of the A20 monoclonal antibody (Lochrie et al, 2005), and within the ADKlb footprint on AAV1. This region is also known to control transduction (Lochrie et al., 2005). The Q263A mutation is also one of the mutations in AAV2.5, the muscle tropic vector derived from AAV2 (Bowles et al, 2011). The VR-V residues are within the ADKla footprint on AAV1 and the 4E4 footprint on AAV1 (Gurda et al, 2013). Residues 490-500 are within the C37B footprint on AAV2 and 5H7 footprint on AAV1 (Gurda et al, 2013), and have been reported to affect liver tropism in AAV9 (Pulicherla et al, 2011).
[0186] The stepwise approach for the library's construction, as well as the Next-Gen sequencing of encapsidated viral genomes, was helpful in understanding the structural requirements of each individual VR for the whole capsid integrity. For example, a nucleotide sequence coding for VR-II, as it is overlapping with AAP ORF, appears to be critical, and cannot be mutagenized. VRs III and IX showed a low complexity value, indicating the importance of these regions for capsid structure. The residues in these VRs are closest to the 2-fold axis, which was shown to be important for assembly (Naumer et al, 2012). On the other hand, VRs I, IV and VII are the most tolerant and substitutions of their residues are compatible with mutations in other VRs. Sterically, VR-I is raised on the capsid and is not interacting with other monomers; VR-IV protrudes the furthest from the surface and only the base of this VR is interacting with other VP monomers. VRs I, IV, VII, V and VI have the highest content of mutant positions, while VRs III, IX and, to a lesser extent, VIII are mostly invariable, consistent with previous reports (Ng et al, 2010). These data provide a clear guidance for the design of next generation capsid libraries with an even higher complexity whereby structural compatibility of particular VRs may be successfully utilized as an indispensable selection trait.
REFERENCES
[0187] The following references, to the extent that they provide exemplary procedural or other details supplementary to those set forth herein, are specifically incorporated herein in their entirety by express reference thereto:
United States Patent No. 7.220,577 to Zolotukhin.
Agbandje-McKenna, M, and Kleinschmidt, J, "AAV capsid structure and cell interactions,"
Methods Mol. Biol. (Clifton, NJ), 807:47-92 (2011).
Arad, U, "Modified Hirt procedure for rapid purification of extrachromosomal DNA from mammalian cells," BioTechniques, 24:760-762 (1998).
Aslanidi, GV et al, "High-efficiency transduction of human monocyte-derived dendritic cells by capsid-modified recombinant AAV2 vectors," Vaccine, 30:3908-3917 (2012). Aslanidi, GV et al, "Optimization of the capsid of recombinant adeno-associated virus 2 (AAV2) vectors: the final threshold?" PloS One, 8:e59142 (2013).
Asuri, P et al, "Directed evolution of adeno-associated virus for enhanced gene delivery and gene targeting in human pluripotent stem cells," Mol. Then J. Am. Soc. Gene Then, 20:329-338
(2012).
Bowles, DE et al., "Phase 1 gene therapy for Duchenne muscular dystrophy using a translational optimized AAV vector," Mol. Then, 20:443-455 (2011).
Cao, O et al., "Impact of the underlying mutation and the route of vector administration on immune responses to factor IX in gene therapy for hemophilia B," Mol. Then J. Am. Soc.
Gene Then, 17: 1733-1742 (2009).
Coco, WM et al, "Growth factor engineering by degenerate homoduplex gene family recombination," Nat. Biotechnol., 20: 1246-1250 (2002).
Cost, G and Cozzarelli, N, "Directed assembly of DNA molecules via simultaneous ligation and digestion," BioTechniques, 42:84-89 (2007).
Dalkara, D et al., "In vzvo-directed evolution of a new adeno-associated virus for therapeutic outer retinal gene delivery from the vitreous," Sci. Transl. Med., 5: 189ra76 (2013).
DiMattia, M et al., "Production, purification, crystallization and preliminary X-ray structural studies of adeno-associated virus serotype 5," Acta Crystallograph. Sect. F Struct. Biol.
Cryst. Commun., 61:917-921 (2005).
DiMattia, MA et al., "Structural insight into the unique properties of adeno-associated virus serotype 9," J. Virol, 86:6947-6958 (2012).
DiPrimio, N et al., "Surface loop dynamics in adeno-associated virus capsid assembly," J. Virol.,
82:5178-5189 (2008).
Gabriel, N et al., "Bioengineering of AAV2 capsid at specific serine, threonine, or lysine residues improves its transduction efficiency in vitro and in vivo," Hum. Gene Ther. Methods, 24:80-93 (2013).
Gao, GP et al., "Novel adeno-associated viruses from rhesus monkeys as vectors for human gene therapy," Proc. Nat'l. Acad. Sci. USA, 99: 11854-11859 (2002).
Gibson, DG et al, "Enzymatic assembly of DNA molecules up to several hundred kilobases,"
Nat. Methods, 6:343-345 (2009).
Govindasamy, L et al, "Structural insights into adeno-associated virus serotype 5," J. Virol,
87: 11187-11199 (2013).
Govindasamy, L, et al, "Structurally mapping the diverse phenotype of adeno-associated virus serotype 4," J. Virol, 80(23): 11556-11570 (2006). Granoff and Webster, Encyclopedia of Virology, 2nd edition, Academic Press: San Diego, CA (1999).
Gray, SJ et al, "Directed evolution of a novel adeno-associated virus (AAV) vector that crosses the seizure-compromised blood-brain barrier (BBB)," Mol. Ther. J. Am. Soc. Gene Then, 18:570-578 (2010).
Gurda, BL et al, "Capsid antibodies to different adeno-associated virus serotypes bind common regions," J. Virol, 87:9111-9124 (2013).
Hauck, B et al, "Generation and characterization of chimeric recombinant AAV vectors," Mol.
Then, 7:419-425 (2003).
Horton, RM et al, "Engineering hybrid genes without the use of restriction enzymes: gene splicing by overlap extension," Gene, 77:61-68 (1989).
Hurlbut, GD et al, "Preexisting immunity and low expression in primates highlight translational challenges for liver-directed AAV8-mediated gene therapy," Mol. Then, 18: 1983-1994
(2010).
Jang, J-H et al, "An evolved adeno-associated viral variant enhances gene delivery and gene targeting in neural stem cells," Mol. Ther. J. Am. Soc. Gene Ther, 19:667-675 (2011). Jeune, VL et al, "Pre-existing anti-adeno-associated virus antibodies as a challenge in AAV gene therapy," Hum. Gene Ther. Methods, 24(2):59-67 (2013).
Kaludov, N et al, "Production, purification and preliminary X-ray crystallographic studies of adeno-associated virus serotype 4," Virology, 306: 1-6 (2003).
Koerber, JT et al, "DNA shuffling of adeno-associated virus yields functionally diverse viral progeny," Mol. Ther. J. Am. Soc. Gene Ther, 16: 1703-1709 (2008).
Koerber, JT et al, "Molecular evolution of adeno-associated virus for enhanced glial gene delivery," Mol. Ther. J. Am. Soc. Gene Ther, 17:2088-2095 (2009).
Kwon, I, and Schaffer, DV, "Designer gene delivery vectors: molecular engineering and evolution of adeno-associated viral vectors for enhanced gene transfer," Pharm. Res., 25:489-499
(2008).
Lane, MD et al, "Production, purification, crystallization and preliminary X-ray analysis of adeno-associated virus serotype 8," Acta Crystallograph. Sect. F Struct. Biol. Cryst. Commun., 61:558-561 (2005).
Lewin, A, Genes V, Oxford University Press: New York, NY (1994).
Li, C et al, "Single amino acid modification of adeno-associated virus capsid changes transduction and humoral immune profiles," J. Virol, 86:7752-7759 (2012). Li, J et al, "Role for highly regulated rep gene expression in adeno-associated virus vector production," J. Virol, 71:5236-5243 (1997).
Li, W et al, "Engineering and selection of shuffled AAV genomes: a new strategy for producing targeted biological nanoparticles," Mol. Ther. J. Am. Soc. Gene Then, 16: 1252-1260
(2008).
Li, W et al, "Generation of novel AAV variants by directed evolution for improved CFTR delivery to human ciliated airway epithelium," Mol. Ther. J. Am. Soc. Gene Ther, 17:2067-2077 (2009).
Lochrie, MA et al, "Mutations on the external surfaces of adeno-associated virus type 2 capsids that affect transduction and neutralization," J. Virol, 80:821-834 (2005).
Louis Jeune, V et al, "Pre-existing anti-adeno-associated virus antibodies as a challenge in AAV gene therapy," Hum. Gene Ther. Methods, 24:59-67 (2013).
Maguire, CA et al, "Directed evolution of adeno-associated virus for glioma cell transduction. J.
Neurooncol 96:337-347 (2010).
Maheshri, N et al, "Directed evolution of adeno-associated virus yields enhanced gene delivery vectors," Nat. Biotechnol, 24: 198-204 (2006).
Manno, CS et al, "Successful transduction of liver in hemophilia by AAV-Factor IX and limitations imposed by the host immune response," Nat. Med., 12:342-347 (2006).
Michelfelder, S et al, 'Vectors selected from adeno-associated viral display peptide libraries for leukemia cell-targeted cytotoxic gene therapy," Exp. Hematol, 35: 1766-1776 (2007). Miller, ΕΒ et al, "Production, purification and preliminary X-ray crystallographic studies of adeno-associated virus serotype 1," Acta Crystallograph. Sect. F Struct. Biol Cryst.
Commun., 62: 1271-1274 (2006).
Mingozzi, F et al, "Induction of immune tolerance to coagulation factor IX antigen by in vivo hepatic gene transfer," J. Clin. Invest, 111: 1347-1356 (2003).
Mitchell, M et al, "Production, purification and preliminary X-ray crystallographic studies of adeno-associated virus serotype 9," Acta Crystallograph. Sect. F Struct. Biol. Cryst.
Commun., 65:715-718 (2009).
Miiller, OJ et al, "Random peptide libraries displayed on adeno-associated virus to select for targeted gene therapy vectors," Nat. Biotechnol, 21: 1040-1046 (2003).
Muzyczka, N, and Berns, KI, in Fields Virol. 4th Edn 2327-2359 (Lippincott Williams & Wilkins)
(2001).
Nakai, H et al, 'Unrestricted hepatocyte transduction with adeno-associated virus serotype 8 vectors in mice," J. Virol, 79:214-224 (2004). Nam, H-J et al, "Structure of adeno-associated virus serotype 8, a gene therapy vector. J. Virol.
81: 12260-12271 (2007).
Naumer, M et al, "Properties of the adeno-associated virus assembly-activating protein," J. Virol
86: 13038-13048 (2012).
Ng, R et al, "Structural characterization of the dual glycan binding adeno-associated virus serotype 6," J. Virol, 84: 12945-12957 (2010).
Opie, SR et al, "Identification of amino acid residues in the capsid proteins of adeno-associated virus type 2 that contribute to heparan sulfate proteoglycan binding," J. Virol,
77(12):6995-7006 (2003).
Padron, E et al, "Structure of adeno-associated virus type 4," J. Virol, 79:5047-5058 (2005). Pandya, J et al, "Rationally designed capsid and transgene cassette of AAV6 vectors for dendritic cell-based cancer immunotherapy," Immunol. Cell Biol, 92: 116-123 (2014).
Perabo, L et al, "In vitro selection of viral vectors with modified tropism: the adeno-associated virus display," Mo/. Ther. J. Am. Soc. Gene Ther, 8: 151-157 (2003).
Pulicherla, N et al, "Engineering liver-detargeted AAV9 vectors for cardiac and musculoskeletal gene transfer," Mol. Ther, 19: 1070-1078 (2011).
Quesada, O et al, "Production, purification and preliminary X-ray crystallographic studies of adeno-associated virus serotype 7," Acta Crystallograph. Sect. F Struct. Biol. Cryst.
Commun., 63: 1073-1076 (2007).
Rieger et al, Glossary of Genetics: Classical and Molecular, 5th edition, Springer- Verlag: New
York, NY (1991).
Samulski, Rj et al, "A recombinant plasmid from which an infectious adeno-associated virus genome can be excised in vitro and its use to study viral replication," J. Virol, 61:3096- 3101 (1987).
Sands, MS, "AAV-mediated liver-directed gene therapy," Methods Mol Biol 807: 141-57 (2011). Sen, D et al, "Targeted modifications in adeno-associated virus serotype 8 capsid improves its hepatic gene transfer efficiency in vivo," Hum. Gene Ther. Methods, 24: 104-116 (2013). Shannon, CE "The mathematical theory of communication," Bell Syst. Tech. J., 27:379-423, 623-
656 (1948).
Sharland, A et al, "Liver-directed gene expression using recombinant AAV 2/8 vectors-a tolerogenic strategy for gene delivery?" Discov. Med., 9:519-27 (2010).
Sharma et al, "2A peptides provide distinct solutions to driving stop-carry on translational recoding," Nucleic Acids Res., 40:3143-3151 (2012). Shen, X et al, "Characterization of the relationship of AAV capsid domain swapping to liver transduction efficiency," Mol. Then, 15: 1955-1962 (2007).
Singleton and Sainsbury, Dictionary of Microbiology and Molecular Biology, 3rd edition, John
Wiley & Sons: New York, NY (2002).
Sonntag, F et al., "A viral assembly factor promotes AAV2 capsid formation in the nucleolus,"
Proc. Nat'l. Acad. Sci. USA, 107: 10220-10225 (2010).
Stachler, MD and Bartlett, JS, "Mosaic vectors comprised of modified AAVl capsid proteins for efficient vector purification and targeting to vascular endothelial cells," Gene Then,
13:926-931 (2006).
Summerford, C, and Samulski, RJ, "Membrane-associated heparan sulfate proteoglycan is a receptor for adeno-associated virus type 2 virions," J. Virol, 72: 1438-1445 (1998).
Tidona and Darai, The Springer Index of Viruses, 1st edition, Springer- Verlag: New York, NY (2002).
Walters, RW et al, "Structure of adeno-associated virus serotype 5," J. Virol, 78:3361-3371 (2004).
Wu, P et al, "Mutational analysis of the adeno-associated virus type 2 (AAV2) capsid gene and construction of AAV2 vectors with altered tropism," J. Virol. 74:8635-8647 (2000).
Wu, P et al, Mutational analysis of the adeno-associated virus type 2 (AAV2) capsid gene and construction of AAV2 vectors with altered tropism," J. Virol, 74:8635-8647 (2000).
Wu, Z et al, "Adeno-associated virus serotypes: vector toolkit for human gene therapy," Mol.
Ther. J. Am. Soc. Gene Then, 14:316-327 (2006).
Xie, Q et al, "The atomic structure of adeno-associated virus (AAV-2), a vector for human gene therapy," Proc. Nat'l. Acad. Sci. USA, 99: 10405-10410 (2002).
Yang, L and Xiao, X, "Creation of a cardiotropic adeno-associated virus: the story of viral directed evolution," Virol. J., 10:50 (2013).
Yang, L et al, "A myocardium tropic adeno-associated virus (AAV) evolved by DNA shuffling and in vivo selection," Proc. Nat'l. Acad. Sci. USA, 106:3946-3951 (2009).
Yang, L et al, "Directed evolution of adeno-associated virus (AAV) as vector for muscle gene therapy," Methods Mol. Biol. (Clifton, NJ), 709: 127-139 (2011).
Zhong, L et al, "Next generation of adeno-associated virus 2 vectors: point mutations in tyrosines lead to high-efficiency transduction at lower doses," Proc. Nat'l. Acad. Sci. USA,
105:7827-7832 (2008). Zolotukhin, S et al., "Recombinant adeno-associated virus purification using novel methods improves infectious titer and yield," Gene Then, 6:973-985 (1999).Gigout, L et al., "Altering AAV tropism with mosaic viral capsids," Mol. Then, 11:856-865 (2005).
[0188] It should be understood that the examples and embodiments described herein are for illustrative purposes only and that various modifications or changes in light thereof will be suggested to persons skilled in the art and are to be included within the spirit and purview of this application and the scope of the appended claims.
[0189] All references cited herein (including publications, patent applications and patents) are hereby incorporated by reference to the same extent as if each reference was individually and specifically indicated to be incorporated by reference and was set forth in its entirety herein.
[0190] Recitation of ranges of values herein are merely intended to serve as a shorthand method of referring individually to each separate value falling within the range, unless otherwise indicated herein, and each separate value is incorporated into the specification as if it were individually recited herein.
[0191] All methods described herein can be performed in any suitable order, unless otherwise indicated herein, or otherwise clearly contradicted by context.
[0192] The use of any and all examples, or exemplary language {e.g., "such as") provided herein, is intended merely to better illustrate the invention and does not pose a limitation on the scope of the invention unless otherwise indicated. No language in the specification should be construed as indicating any element is essential to the practice of the invention unless as much is explicitly stated.
[0193] The description herein of any aspect or embodiment of the invention using terms such as "comprising", "having", "including" or "containing" with reference to an element or elements is intended to provide support for a similar aspect or embodiment of the invention that "consists of, "consists essentially of, or "substantially comprises" that particular element or elements, unless otherwise stated or clearly contradicted by context {e.g., a composition described herein as comprising a particular element should be understood as also describing a composition consisting of that element, unless otherwise stated or clearly contradicted by context).
[0194] All of the compositions and methods disclosed and claimed herein can be made and executed without undue experimentation in light of the present disclosure. While the compositions and methods of this invention have been described in terms of preferred embodiments, it will be apparent to those of skill in the art that variations may be applied to the compositions and methods and in the steps or in the sequence of steps of the method described herein without departing from the concept, spirit and scope of the invention. More specifically, it will be apparent that certain agents that are chemically and/or physiologically related may be substituted for the agents described herein while the same or similar results would be achieved. All such similar substitutes and modifications apparent to those skilled in the art are deemed to be within the spirit, scope and concept of the invention as defined by the appended claims.

Claims

WHAT IS CLAIMED IS:
1. A non-naturally occurring nucleic acid comprising:
(a) a first nucleotide sequence encoding at least one AAV Rep protein; and
(b) a second nucleotide sequence encoding at least one AAV Cap protein, wherein the second nucleotide sequence comprises:
(i) a polynucleotide encoding a portion of a Cap protein found in an AAV of a first serotype but not in an AAV of a second serotype differing from the first serotype; and
(ii) a polynucleotide encoding a portion of a Cap protein found in the AAV of the second serotype, but not in the AAV of the first serotype,
wherein the non-naturally occurring nucleic acid further comprises a first AAV terminal repeat and a second AAV terminal repeat, and the first and second nucleotide sequences are interposed between the first and the second AAV terminal repeats.
The non-naturally occurring nucleic acid of claim 1 , wherein the first and the second AAV terminal repeats are from serotype 2.
The non-naturally occurring nucleic acid of claim 1, wherein the first serotype is serotype 1, serotype 2, serotype 3, serotype 4, serotype 5, serotype 6, serotype 7, or serotype 8.
The non-naturally occurring nucleic acid of claim 1, wherein the nucleic acid is comprised within a vector.
The non-naturally occurring nucleic acid of claim 1 , wherein the AAV Rep protein is from serotype 2.
6. The non-naturally occurring nucleic acid of claim 1, wherein the nucleic acid further comprises a third nucleotide sequence encoding at least one molecule providing helper function.
The non-naturally occurring nucleic acid of claim 6, wherein the third nucleotide sequence encoding at least one molecule providing helper function is a polynucleotide from a virus selected from the group consisting of: adenovirus and herpesvirus.
A vector library comprising at least a first vector and a second vector, the first vector comprising a nucleic acid comprising:
(a) a first nucleotide sequence encoding at least one AAV Rep protein; and
(b) a second nucleotide sequence encoding at least one AAV Cap protein, wherein the second nucleotide sequence comprises:
(i) a polynucleotide encoding a portion of a Cap protein found in an AAV of a first serotype but not in an AAV of a second serotype differing from the first serotype, and
(ii) a polynucleotide encoding a portion of a Cap protein found in the AAV of the second serotype, but not in the AAV of the first serotype, wherein the nucleic acid further comprises a first AAV TR and a second AAV TR, and the first and second nucleotide sequences are interposed between the first and the second AAV TRs, and the second vector differing from the first vector by at least one nucleotide.
The vector library of claim 8, wherein the vector library is incorporated into at least one host cell.
The vector library of claim 9, wherein the at least one host cell is an insect host cell.
An AAV virion comprising a nucleic acid comprising: (A) a first nucleotide sequence encoding at least one AAV Rep protein; (B) a second nucleotide sequence encoding at least one AAV Cap protein, wherein the second nucleotide sequence comprises (i) a polynucleotide encoding a portion of a Cap protein found in an AAV of a first serotype but not in an AAV of a second serotype differing from the first serotype, and (ii) a polynucleotide encoding a portion of a Cap protein found in the AAV of the second serotype, but not in the AAV of the first serotype; and (C) a first and a second AAV TR, wherein the first and the second nucleotide sequences are interposed between the first and the second AAV TRs.
12. The AAV virion of claim 11, wherein the first and second TRs are from serotype 2.
13. The AAV virion of claim 11, wherein the virion comprises an AAV Cap protein.
14. The AAV virion of claim 11 , wherein the AAV Rep protein is from serotype 2.
15. The AAV virion of claim 11, wherein the AAV virion is incorporated into a host cell.
16. The AAV virion of claim 15, wherein the host cell is a mammalian cell.
17. The AAV virion of claim 11, further comprising at least one AAV Cap protein encoded by the second nucleotide sequence.
18. The AAV virion of claim 17, wherein the Cap protein is a wild-type Cap protein.
19. The AAV virion of claim 11, wherein the second nucleotide sequence further comprises a polynucleotide encoding a portion of a Cap protein found in an AAV of a fourth serotype but not found in a Cap protein of an AAV of the first, second or third serotypes.
20. The AAV virion of claim 19, wherein the second nucleotide sequence further comprises a polynucleotide encoding a portion of a Cap protein found in an AAV of a fifth serotype but not found in a Cap protein of an AAV of the first, second, third or fourth serotypes.
21. The AAV virion of claim 20, wherein the second nucleotide sequence further comprises a polynucleotide encoding a portion of a Cap protein found in an AAV of a sixth serotype but not found in a Cap protein of an AAV of the first, second, third, fourth or fifth serotypes.
22. The AAV virion of claim 21, wherein the second nucleotide sequence further comprises a polynucleotide encoding a portion of a Cap protein found in an AAV of a seventh serotype but not found in a Cap protein of an AAV of the first, second, third, fourth, fifth or sixth serotypes.
The AAV virion of claim 22, wherein the second nucleotide sequence further comprises a polynucleotide encoding a portion of a Cap protein found in an AAV of an eight serotype but not found in a Cap protein of an AAV of the first, second, third, fourth, fifth, sixth or seventh serotypes.
The AAV virion of claim 11 , wherein the nucleic acid further comprises a sequence that encodes a therapeutic molecule.
The AAV virion of claim 24, wherein the nucleic acid further comprises an expression control sequence that effects cell- or tissue-specific expression of the therapeutic molecule.
The AAV virion of claim 11, wherein the virion is incorporated into a host cell.
The AAV virion of claim 25, wherein the expression control sequence comprises a promoter operably linked to the sequence encoding the therapeutic molecule.
The AAV virion of claim 27, wherein the therapeutic molecule is selected from the group consisting of a polypeptide, a peptide, and an RNA.
PCT/US2014/057842 2013-09-26 2014-09-26 Synthetic combinatorial aav capsid library for targeted gene therapy Ceased WO2015048534A1 (en)

Priority Applications (7)

Application Number Priority Date Filing Date Title
JP2016517431A JP6985795B2 (en) 2013-09-26 2014-09-26 Synthetic combinatorial AAV capsid library for targeted gene therapy
AU2014324717A AU2014324717B2 (en) 2013-09-26 2014-09-26 Synthetic combinatorial AAV capsid library for targeted gene therapy
US15/024,431 US20160369298A1 (en) 2013-09-26 2014-09-26 Synthetic combinatorial aav capsid library for targeted gene therapy
EP19207549.7A EP3633041A3 (en) 2013-09-26 2014-09-26 Synthetic combinatorial aav capsid library for targeted gene therapy
CA2930549A CA2930549C (en) 2013-09-26 2014-09-26 Synthetic combinatorial aav capsid library for targeted gene therapy
EP14848603.8A EP3049527A4 (en) 2013-09-26 2014-09-26 Synthetic combinatorial aav capsid library for targeted gene therapy
US16/208,127 US11091777B2 (en) 2013-09-26 2018-12-03 Synthetic combinatorial AAV capsid library for targeted gene therapy

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201361883063P 2013-09-26 2013-09-26
US61/883,063 2013-09-26

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US15/024,431 A-371-Of-International US20160369298A1 (en) 2013-09-26 2014-09-26 Synthetic combinatorial aav capsid library for targeted gene therapy
US16/208,127 Continuation US11091777B2 (en) 2013-09-26 2018-12-03 Synthetic combinatorial AAV capsid library for targeted gene therapy

Publications (1)

Publication Number Publication Date
WO2015048534A1 true WO2015048534A1 (en) 2015-04-02

Family

ID=52744537

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2014/057842 Ceased WO2015048534A1 (en) 2013-09-26 2014-09-26 Synthetic combinatorial aav capsid library for targeted gene therapy

Country Status (5)

Country Link
US (2) US20160369298A1 (en)
EP (2) EP3633041A3 (en)
JP (2) JP6985795B2 (en)
AU (1) AU2014324717B2 (en)
WO (1) WO2015048534A1 (en)

Cited By (32)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2017070476A3 (en) * 2015-10-22 2017-06-01 University Of Florida Research Foundation, Inc. Synthetic combinatorial aav3 capsid library
GB2545763A (en) * 2015-12-23 2017-06-28 Adverum Biotechnologies Inc Mutant viral capsid libraries and related systems and methods
WO2017212019A1 (en) * 2016-06-09 2017-12-14 Centre National De La Recherche Scientifique (Cnrs) Raav with chemically modified capsid
US9856539B2 (en) 2011-04-22 2018-01-02 The Regents Of The University Of California Adeno-associated virus virions with variant capsid and methods of use thereof
US9943573B2 (en) 2012-05-15 2018-04-17 Avalanche Australia Pty Ltd. Treatment of ocular neovascularization using anti-VEGF proteins
US10000741B2 (en) 2014-03-17 2018-06-19 Adverum Biotechnologies, Inc. Compositions and methods for enhanced gene expression in cone cells
US10046016B2 (en) 2003-06-30 2018-08-14 The Regents Of The University Of California Mutant adeno-associated virus virions and methods of use thereof
US10214566B2 (en) 2003-06-30 2019-02-26 The Regents Of The University Of California Mutant adeno-associated virus virions and methods of use thereof
WO2019158619A1 (en) * 2018-02-15 2019-08-22 Bjoerklund Tomas Modified viral capsids
US10494612B2 (en) 2010-10-06 2019-12-03 The Regents Of The University Of California Adeno-associated virus virions with variant capsid and methods of use thereof
US10577627B2 (en) 2014-06-09 2020-03-03 Voyager Therapeutics, Inc. Chimeric capsids
US10793606B2 (en) 2017-02-21 2020-10-06 University Of Florida Research Foundation, Incorporated Modified AAV capsid proteins and uses thereof
US10883117B2 (en) 2015-03-24 2021-01-05 The Regents Of The University Of California Adeno-associated virus variants and methods of use thereof
US11021519B2 (en) 2015-03-02 2021-06-01 Adverum Biotechnologies, Inc. Compositions and methods for intravitreal delivery of polynucleotides to retinal cones
US11091777B2 (en) 2013-09-26 2021-08-17 University Of Florida Research Foundation, Incorporated Synthetic combinatorial AAV capsid library for targeted gene therapy
US11136557B2 (en) 2013-05-31 2021-10-05 The Regents Of The University Of California Adeno-associated virus variants and methods of use thereof
US11192925B2 (en) 2016-10-19 2021-12-07 Adverum Biotechnologies, Inc. Modified AAV capsids and uses thereof
JP2022065003A (en) * 2015-12-14 2022-04-26 ザ ユニバーシティ オブ ノース カロライナ アット チャペル ヒル Modified capsid protein for enhanced delivery of parvovirus vector
US11382988B2 (en) 2019-11-08 2022-07-12 Coave Therapeutics Modified adeno-associated virus vectors and delivery thereof into the central nervous system
US11447797B2 (en) 2015-05-12 2022-09-20 The United States Of America,As Represented By The Secretary, Department Of Health And Human Service AAV with unique capsid protein VP1 and methods of using for treatment
US11554180B2 (en) 2016-07-29 2023-01-17 The Regents Of The University Of California Adeno-associated virus virions with variant capsid and methods of use thereof
US20230048732A1 (en) * 2020-05-26 2023-02-16 Shape Therapeutics Inc. High throughput engineering of functional aav capsids
US11680249B2 (en) 2017-08-28 2023-06-20 The Regents Of The University Of California Adeno-associated virus capsid variants and methods of use thereof
US11821009B2 (en) 2018-05-15 2023-11-21 Cornell University Genetic modification of the AAV capsid resulting in altered tropism and enhanced vector delivery
WO2024191778A1 (en) 2023-03-10 2024-09-19 Dyno Therapeutics, Inc. Capsid polypeptides and methods of use thereof
US12116385B2 (en) 2021-10-08 2024-10-15 Dyno Therapeutics, Inc. Capsid variants and methods of using the same
WO2025049993A1 (en) 2023-08-31 2025-03-06 Dyno Therapeutics, Inc. Capsid polypeptides and methods of use thereof
US12310997B2 (en) 2017-06-30 2025-05-27 The Regents Of The University Of California Compositions and methods of treating ocular diseases
WO2025171227A1 (en) 2024-02-08 2025-08-14 Dyno Therapeutics, Inc. Capsid polypeptides and methods of use thereof
US12545929B2 (en) 2021-05-12 2026-02-10 Coave Therapeutics Lactam-modified adeno-associated virus vectors
WO2026064442A2 (en) 2024-09-18 2026-03-26 Dyno Therapeutics, Inc. Capsid polypeptides and methods of use thereof
US12630805B2 (en) 2023-03-15 2026-05-19 The Regents Of The University Of California Compositions and methods of treatment

Families Citing this family (55)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN107106689A (en) 2014-11-05 2017-08-29 沃雅戈治疗公司 AADC polynucleotides for treating Parkinson's disease
CN112410338A (en) 2014-11-14 2021-02-26 沃雅戈治疗公司 Regulatory polynucleotides
IL292999A (en) 2014-11-14 2022-07-01 Voyager Therapeutics Inc Preparations and methods for the treatment of amyotrophic lateral sclerosis
WO2016094783A1 (en) 2014-12-12 2016-06-16 Voyager Therapeutics, Inc. Compositions and methods for the production of scaav
IL314171A (en) 2015-09-28 2024-09-01 Univ Florida Methods and compositions for stealth virus antibody vectors
WO2017189964A2 (en) 2016-04-29 2017-11-02 Voyager Therapeutics, Inc. Compositions for the treatment of disease
US11326182B2 (en) 2016-04-29 2022-05-10 Voyager Therapeutics, Inc. Compositions for the treatment of disease
SG11201809699XA (en) 2016-05-18 2018-12-28 Voyager Therapeutics Inc Modulatory polynucleotides
KR20220108216A (en) 2016-05-18 2022-08-02 보이저 테라퓨틱스, 인크. Compositions and methods of treating huntington's disease
CN110650673B (en) 2016-08-30 2024-04-09 加利福尼亚大学董事会 Methods for biomedical targeting and delivery and devices and systems for practicing the methods
JP2020518259A (en) 2017-05-05 2020-06-25 ボイジャー セラピューティクス インコーポレイテッドVoyager Therapeutics,Inc. Huntington's disease treatment compositions and methods
SG11201909870SA (en) 2017-05-05 2019-11-28 Voyager Therapeutics Inc Compositions and methods of treating amyotrophic lateral sclerosis (als)
JOP20190269A1 (en) 2017-06-15 2019-11-20 Voyager Therapeutics Inc Aadc polynucleotides for the treatment of parkinson's disease
JP7229989B2 (en) 2017-07-17 2023-02-28 ボイジャー セラピューティクス インコーポレイテッド Trajectory array guide system
TWI832036B (en) 2017-08-03 2024-02-11 美商航海家醫療公司 Compositions and methods for delivery of aav
MX2020003042A (en) 2017-09-29 2020-11-18 Voyager Therapeutics Inc Rescue of central and peripheral neurological phenotype of friedreich's ataxia by intravenous delivery.
US11434502B2 (en) 2017-10-16 2022-09-06 Voyager Therapeutics, Inc. Treatment of amyotrophic lateral sclerosis (ALS)
EP4454654A3 (en) 2017-10-16 2025-02-19 Voyager Therapeutics, Inc. Treatment of amyotrophic lateral sclerosis (als)
JP7406677B2 (en) 2018-04-03 2023-12-28 ギンコ バイオワークス インコーポレイテッド Viral vectors that evade antibodies
WO2019195423A1 (en) 2018-04-03 2019-10-10 Stridebio, Inc. Virus vectors for targeting ophthalmic tissues
WO2019195444A1 (en) 2018-04-03 2019-10-10 Stridebio, Inc. Antibody-evading virus vectors
JP7438981B2 (en) 2018-05-11 2024-02-27 マサチューセッツ アイ アンド イヤー インファーマリー Liver-specific tropism of adeno-associated virus
WO2019222329A1 (en) 2018-05-15 2019-11-21 Voyager Therapeutics, Inc. Compositions and methods for delivery of aav
EP3794126A1 (en) 2018-05-15 2021-03-24 Voyager Therapeutics, Inc. Compositions and methods for the treatment of parkinson's disease
WO2019241486A1 (en) 2018-06-13 2019-12-19 Voyager Therapeutics, Inc. Engineered 5' untranslated regions (5' utr) for aav production
JP2021530548A (en) 2018-07-24 2021-11-11 ボイジャー セラピューティクス インコーポレイテッドVoyager Therapeutics, Inc. Systems and methods for producing gene therapy products
CN113383010B (en) 2018-09-28 2025-09-09 沃雅戈治疗公司 Ataxin expression constructs with engineered promoters and methods of use thereof
TW202035689A (en) 2018-10-04 2020-10-01 美商航海家醫療公司 Methods for measuring the titer and potency of viral vector particles
JP2022512621A (en) 2018-10-05 2022-02-07 ボイジャー セラピューティクス インコーポレイテッド An engineered nucleic acid construct that encodes an AAV-producing protein
WO2020077165A1 (en) 2018-10-12 2020-04-16 Voyager Therapeutics, Inc. Compositions and methods for delivery of aav
EP3867389A1 (en) 2018-10-15 2021-08-25 Voyager Therapeutics, Inc. Expression vectors for large-scale production of raav in the baculovirus/sf9 system
MX2021008542A (en) 2019-01-18 2021-11-12 Voyager Therapeutics Inc Methods and systems for producing aav particles.
AR118465A1 (en) 2019-03-21 2021-10-06 Stridebio Inc RECOMBINANT ADENO-ASSOCIATED VIRUS VECTORS
US11981967B2 (en) 2019-04-26 2024-05-14 Sangamo Therapeutics, Inc. Engineering AAV
WO2020223274A1 (en) 2019-04-29 2020-11-05 Voyager Therapeutics, Inc. SYSTEMS AND METHODS FOR PRODUCING BACULOVIRAL INFECTED INSECT CELLS (BIICs) IN BIOREACTORS
WO2020227515A1 (en) 2019-05-07 2020-11-12 Voyager Therapeutics, Inc. Compositions and methods for the vectored augmentation of protein destruction, expression and/or regulation
US20220290182A1 (en) 2019-08-09 2022-09-15 Voyager Therapeutics, Inc. Cell culture medium for use in producing gene therapy products in bioreactors
WO2021041485A1 (en) 2019-08-26 2021-03-04 Voyager Therapeutics, Inc. Controlled expression of viral proteins
WO2021046155A1 (en) 2019-09-03 2021-03-11 Voyager Therapeutics, Inc. Vectorized editing of nucleic acids to correct overt mutations
US12570998B2 (en) 2019-09-09 2026-03-10 Massachusetts Eye & Ear Infirmary Methods and compositions for modulating the interaction between adeno-associated virus (AAV) and the AAV receptor (AAVR) for altered bio-distribution of AAV
KR20220083708A (en) 2019-10-17 2022-06-20 스트라이드바이오 인코포레이티드 AAV delivery cassette
AU2020367532A1 (en) 2019-10-17 2022-05-12 Ginkgo Bioworks, Inc. Adeno-associated viral vectors for treatment of Niemann-Pick disease type C
WO2021247995A2 (en) 2020-06-04 2021-12-09 Voyager Therapeutics, Inc. Compositions and methods of treating neuropathic pain
US20230285596A1 (en) 2020-07-27 2023-09-14 Voyager Therapeutics, Inc Compositions and methods for the treatment of niemann-pick type c1 disease
BR112023001456A2 (en) 2020-07-27 2023-04-11 Voyager Therapeutics Inc COMPOSITIONS AND METHODS FOR THE TREATMENT OF NEUROLOGICAL DISORDERS RELATED TO BETA-GLYCOSYLCERAMIDASE DEFICIENCY
WO2022032153A1 (en) 2020-08-06 2022-02-10 Voyager Therapeutics, Inc. Cell culture medium for use in producing gene therapy products in bioreactors
MX2023002016A (en) 2020-08-19 2023-06-26 Sarepta Therapeutics Inc Adeno-associated virus vectors for treatment of rett syndrome.
US20240141378A1 (en) 2021-03-03 2024-05-02 Voyager Therapeutics, Inc. Controlled expression of viral proteins
EP4301768A2 (en) 2021-03-03 2024-01-10 Voyager Therapeutics, Inc. Controlled expression of viral proteins
CA3238867A1 (en) 2021-11-29 2023-06-01 Shanghai Regenelead Therapies Co., Ltd. Aadc/gdnf polynucleotide, and use thereof in treating parkinson's disease
CN118660913A (en) 2022-02-21 2024-09-17 上海瑞宏迪医药有限公司 VEGF binding molecules and their medical uses
US20250313827A1 (en) * 2022-04-25 2025-10-09 Beijing Hanmoluojie Technology Co., Ltd. AAV Capsid 3D Surface Feature Mapping
US20260085328A1 (en) 2022-09-08 2026-03-26 Voyager Therapeutics, Inc. Controlled expression of viral proteins
TW202508610A (en) 2023-08-23 2025-03-01 大陸商上海瑞宏迪醫藥有限公司 Pharmaceutical composition and use thereof
CN119751595B (en) * 2024-07-16 2025-09-09 广州派真生物技术有限公司 Adeno-associated virus mutant and application thereof

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7186552B2 (en) * 1998-11-05 2007-03-06 The Trustees Of University Of Pennsylvania Adeno-associated virus serotype 1 nucleic acid sequences, vectors and host cells containing same
US7220577B2 (en) 2002-08-28 2007-05-22 University Of Florida Research Foundation, Inc. Modified AAV
US20090075357A1 (en) * 2002-04-30 2009-03-19 University Of Florida Research Foundation, Inc. Production of recombinant aav virions

Family Cites Families (28)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6156303A (en) 1997-06-11 2000-12-05 University Of Washington Adeno-associated virus (AAV) isolates and AAV vectors derived therefrom
ATE454445T1 (en) 1998-11-10 2010-01-15 Univ North Carolina VIRUS VECTORS AND METHODS FOR THEIR PRODUCTION AND ADMINISTRATION.
EP1487501B1 (en) 2001-10-09 2012-12-05 The Johns Hopkins University A phosphatase associated with metastasis
PL2357189T3 (en) 2003-06-19 2017-08-31 Genzyme Corporation AAV virions with decreased immunoreactivity and uses therefor
HUE054805T2 (en) 2003-09-30 2021-09-28 Univ Pennsylvania Adeno-associated virus (aav) clades, sequences, vectors containing same, and uses therefor
AU2005316476A1 (en) * 2004-12-15 2006-06-22 University Of Florida Research Foundation, Inc. Chimeric vectors
EP3085389A1 (en) 2005-04-07 2016-10-26 The Trustees Of The University Of Pennsylvania Method of increasing the function of an aav vector
US9725485B2 (en) 2012-05-15 2017-08-08 University Of Florida Research Foundation, Inc. AAV vectors with high transduction efficiency and uses thereof for gene therapy
HUE030719T2 (en) 2007-04-09 2017-05-29 Univ Florida RAAV vector formulations and methods comprising tyrosine-modified capsid proteins for their use
EP2315833B8 (en) 2008-05-20 2015-05-27 Eos Neuroscience, Inc. Vectors for delivery of light-sensitive proteins and methods of use
ES2683695T3 (en) 2010-01-12 2018-09-27 The University Of North Carolina At Chapel Hill Inverse restrictive terminal repeats for viral vectors
CN107828820B (en) 2010-10-27 2022-06-07 学校法人自治医科大学 Adeno-associated virus particles for gene transfer into nervous system cells
US9409953B2 (en) 2011-02-10 2016-08-09 The University Of North Carolina At Chapel Hill Viral vectors with modified transduction profiles and methods of making and using the same
JP6342886B2 (en) 2012-04-18 2018-06-13 ザ・チルドレンズ・ホスピタル・オブ・フィラデルフィアThe Children’S Hospital Of Philadelphia Composition and method for highly efficient gene transfer using AAV capsid variants
EP3470523A1 (en) * 2012-05-09 2019-04-17 Oregon Health & Science University Adeno associated virus plasmids and vectors
AU2014227766B2 (en) 2013-03-15 2018-10-04 The University Of North Carolina At Chapel Hill Methods and compositions for dual glycan binding AAV vectors
KR102298579B1 (en) 2013-05-21 2021-09-07 유니버시티 오브 플로리다 리서치 파운데이션, 인코포레이티드 Capsid-modified, raav3 vector compositions and uses in gene therapy of human liver cancer
AU2014324717B2 (en) 2013-09-26 2020-10-08 University Of Florida Research Foundation, Inc. Synthetic combinatorial AAV capsid library for targeted gene therapy
EP3066195A4 (en) 2013-11-08 2017-06-28 The Board of Trustees of the University of Arkansas Adeno-associated virus "x" oncogene
GB201403684D0 (en) 2014-03-03 2014-04-16 King S College London Vector
ES2768763T3 (en) 2014-03-04 2020-06-23 Univ Florida Enhanced rAAV vectors and methods for transduction of photoreceptors and EPR cells
US10648000B2 (en) 2015-02-16 2020-05-12 University Of Florida Research Foundation, Incorporated rAAV vector compositions, methods for targeting vascular endothelial cells and use in treatment of type I diabetes
ES2860712T3 (en) 2015-03-24 2021-10-05 Univ California Adeno-associated virus variants and methods of using them
US10081659B2 (en) 2015-04-06 2018-09-25 The United States Of America, As Represented By The Secretary, Dept. Of Health And Human Services Adeno-associated vectors for enhanced transduction and reduced immunogenicity
WO2017004514A1 (en) 2015-07-02 2017-01-05 University Of Florida Research Foundation, Inc. Recombinant adeno-associated virus vectors to target medullary thyroid carcinoma
IL314171A (en) 2015-09-28 2024-09-01 Univ Florida Methods and compositions for stealth virus antibody vectors
US12188037B2 (en) 2015-10-22 2025-01-07 University Of Florida Research Foundation, Incorporated Synthetic combinatorial AAV3 capsid library
CA3114549A1 (en) 2017-02-21 2018-08-30 University Of Florida Research Foundation, Incorporated Modified aav capsid proteins and uses thereof

Patent Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7186552B2 (en) * 1998-11-05 2007-03-06 The Trustees Of University Of Pennsylvania Adeno-associated virus serotype 1 nucleic acid sequences, vectors and host cells containing same
US20090075357A1 (en) * 2002-04-30 2009-03-19 University Of Florida Research Foundation, Inc. Production of recombinant aav virions
US7927585B2 (en) * 2002-04-30 2011-04-19 University Of Florida Research Foundation, Inc. Production of recombinant AAV virions
US7220577B2 (en) 2002-08-28 2007-05-22 University Of Florida Research Foundation, Inc. Modified AAV

Non-Patent Citations (77)

* Cited by examiner, † Cited by third party
Title
AGBANDJE-MCKENNA, MKLEINSCHMIDT, J: "AAV capsid structure and cell interactions", METHODS MOL. BIOL. (CLIFTON, NJ, vol. 807, 2011, pages 47 - 92
ARAD, U: "Modified Hirt procedure for rapid purification of extrachromosomal DNA from mammalian cells", BIOTECHNIQUES, vol. 24, 1998, pages 760 - 762
ASLANIDI, GV ET AL.: "High-efficiency transduction of human monocyte-derived dendritic cells by capsid-modified recombinant AAV2 vectors", VACCINE, vol. 30, 2012, pages 3908 - 3917, XP028488339, DOI: 10.1016/j.vaccine.2012.03.079
ASLANIDI, GV ET AL.: "Optimization of the capsid of recombinant adeno-associated virus 2 (AAV2) vectors: the final threshold?", PLOS ONE, vol. 8, 2013, pages e59142, XP055077091, DOI: 10.1371/journal.pone.0059142
ASURI, P ET AL.: "Directed evolution of adeno-associated virus for enhanced gene delivery and gene targeting in human pluripotent stem cells", MOL. THER. J. AM. SOC. GENE THER., vol. 20, 2012, pages 329 - 338, XP002730957, DOI: 10.1038/mt.2011.255
BOWLES, DE ET AL.: "Phase 1 gene therapy for Duchenne muscular dystrophy using a translational optimized AAV vector", MOL. THER., vol. 20, 2011, pages 443 - 455, XP055152225, DOI: 10.1038/mt.2011.237
CAO, O ET AL.: "Impact of the underlying mutation and the route of vector administration on immune responses to factor IX in gene therapy for hemophilia B", MOL. THER. J. AM. SOC. GENE THER., vol. 17, 2009, pages 1733 - 1742
COCO, WM ET AL.: "Growth factor engineering by degenerate homoduplex gene family recombination", NAT. BIOTECHNOL., vol. 20, 2002, pages 1246 - 1250, XP002491066, DOI: 10.1038/nbt757
COST, GCOZZARELLI, N: "Directed assembly of DNA molecules via simultaneous ligation and digestion", BIOTECHNIQUES, vol. 42, 2007, pages 84 - 89, XP008145964, DOI: 10.2144/000112283
DALKARA, D ET AL.: "In vivo-directed evolution of a new adeno-associated virus for therapeutic outer retinal gene delivery from the vitreous", SCI. TRANSL. MED., vol. 5, 2013, pages 189ra76, XP055452295
DIMATTIA, M ET AL.: "Production, purification, crystallization and preliminary X-ray structural studies of adeno-associated virus serotype 5", ACTA CRYSTALLOGRAPH. SECT. F STRUCT. BIOL. CRYST. COMMUN., vol. 61, 2005, pages 917 - 921
DIMATTIA, MA ET AL.: "Structural insight into the unique properties of adeno-associated virus serotype 9", J. VIROL., vol. 86, 2012, pages 6947 - 6958
DIPRIMIO, N ET AL.: "Surface loop dynamics in adeno-associated virus capsid assembly", J. VIROL., vol. 82, 2008, pages 5178 - 5189, XP055292595, DOI: 10.1128/JVI.02721-07
GABRIEL, N ET AL.: "Bioengineering of AAV2 capsid at specific serine, threonine, or lysine residues improves its transduction efficiency in vitro and in vivo", HUM. GENE THER. METHODS, vol. 24, 2013, pages 80 - 93, XP055076744, DOI: 10.1089/hgtb.2012.194
GAO, GP ET AL.: "Novel adeno-associated viruses from rhesus monkeys as vectors for human gene therapy", PROC. NAT'L. ACAD. SCI. USA, vol. 99, 2002, pages 11854 - 11859
GIBSON, DG ET AL.: "Enzymatic assembly of DNA molecules up to several hundred kilobases", NAT. METHODS, vol. 6, 2009, pages 343 - 345, XP055224105, DOI: 10.1038/nmeth.1318
GIGOUT, L ET AL.: "Altering AAV tropism with mosaic viral capsids", MOL. THER., vol. 11, 2005, pages 856 - 865, XP005002705, DOI: 10.1016/j.ymthe.2005.03.005
GOVINDASAMY, L ET AL.: "Structural insights into adeno-associated virus serotype 5", J. VIROL., vol. 87, 2013, pages 11187 - 11199
GOVINDASAMY, L ET AL.: "Structurally mapping the diverse phenotype of adeno-associated virus serotype 4", J. VIROL., vol. 80, no. 23, 2006, pages 11556 - 11570
GRAY, SJ ET AL.: "Directed evolution of a novel adeno-associated virus (AAV) vector that crosses the seizure-compromised blood-brain barrier (BBB", MOL. THER. J. AM. SOC. GENE THER., vol. 18, 2010, pages 570 - 578, XP055086790, DOI: 10.1038/mt.2009.292
GURDA, BL ET AL.: "Capsid antibodies to different adeno-associated virus serotypes bind common regions", J. VIROL., vol. 87, 2013, pages 9111 - 9124, XP055534980, DOI: 10.1128/JVI.00622-13
HAUCK, B ET AL.: "Generation and characterization of chimeric recombinant AAV vectors", MOL. THER., vol. 7, 2003, pages 419 - 425, XP055172354, DOI: 10.1016/S1525-0016(03)00012-1
HORTON, RM ET AL.: "Engineering hybrid genes without the use of restriction enzymes: gene splicing by overlap extension", GENE, vol. 77, 1989, pages 61 - 68, XP025737080, DOI: 10.1016/0378-1119(89)90359-4
HURLBUT, GD ET AL.: "Preexisting immunity and low expression in primates highlight translational challenges for liver-directed AAV8-mediated gene therapy", MOL. THER., vol. 18, 2010, pages 1983 - 1994, XP055563305, DOI: 10.1038/mt.2010.175
JANG, J-H ET AL.: "An evolved adeno-associated viral variant enhances gene delivery and gene targeting in neural stem cells", MOL. THER. J. AM. SOC. GENE THER., vol. 19, 2011, pages 667 - 675, XP055132115, DOI: 10.1038/mt.2010.287
KALUDOV, N ET AL.: "Production, purification and preliminary X-ray crystallographic studies of adeno-associated virus serotype 4", VIROLOGY, vol. 306, 2003, pages 1 - 6, XP002297596, DOI: 10.1016/S0042-6822(02)00037-5
KOERBER, JT ET AL.: "DNA shuffling of adeno-associated virus yields functionally diverse viral progeny", MOL. THER. J. AM. SOC. GENE THER., vol. 16, 2008, pages 1703 - 1709, XP055172086, DOI: 10.1038/mt.2008.167
KOERBER, JT ET AL.: "Molecular evolution of adeno-associated virus for enhanced glial gene delivery", MOL. THER. J. AM. SOC. GENE THER., vol. 17, 2009, pages 2088 - 2095, XP055468132, DOI: 10.1038/mt.2009.184
KWON, ISCHAFFER, DV: "Designer gene delivery vectors: molecular engineering and evolution of adeno-associated viral vectors for enhanced gene transfer", PHARM. RES., vol. 25, 2008, pages 489 - 499
LANE, MD ET AL.: "Production, purification, crystallization and preliminary X-ray analysis of adeno-associated virus serotype 8", ACTA CRYSTALLOGRAPH. SECT. F STRUCT. BIOL. CRYST. COMMUN., vol. 61, 2005, pages 558 - 561
LEWIN, A: "Genes V", 1994, OXFORD UNIVERSITY PRESS
LI, C ET AL.: "Single amino acid modification of adeno-associated virus capsid changes transduction and humoral immune profiles", J. VIROL., vol. 86, 2012, pages 7752 - 7759, XP055397425, DOI: 10.1128/JVI.00675-12
LI, J ET AL.: "Role for highly regulated rep gene expression in adeno-associated virus vector production", J. VIROL., vol. 71, 1997, pages 5236 - 5243, XP002924496
LI, W ET AL.: "Engineering and selection of shuffled AAV genomes: a new strategy for producing targeted biological nanoparticles", MOL. THER. J AM. SOC. GENE THER., vol. 16, 2008, pages 1252 - 1260, XP002610285, DOI: 10.1038/MT.2008.100
LI, W ET AL.: "Generation of novel AAV variants by directed evolution for improved CFTR delivery to human ciliated airway epithelium", MOL. THER. J. AM. SOC. GENE THER., vol. 17, 2009, pages 2067 - 2077, XP009137209, DOI: 10.1038/mt.2009.155
LOCHRIE, MA ET AL.: "Mutations on the external surfaces of adeno-associated virus type 2 capsids that affect transduction and neutralization", J. VIROL., vol. 80, 2005, pages 821 - 834, XP055549257, DOI: 10.1128/JVI.80.2.821-834.2006
LOUIS JEUNE, V ET AL.: "Pre-existing anti-adeno-associated virus antibodies as a challenge in AAV gene therapy", HUM. GENE THER. METHODS, vol. 24, no. 2, 2013, pages 59 - 67, XP055563307, DOI: 10.1089/hgtb.2012.243
MAGUIRE, CA ET AL.: "Directed evolution of adeno-associated virus for glioma cell transduction", J. NEUROONCOL., vol. 96, 2010, pages 337 - 347, XP019773413
MAHESHRI, N ET AL.: "Directed evolution of adeno-associated virus yields enhanced gene delivery vectors", NAT. BIOTECHNOL., vol. 24, 2006, pages 198 - 204, XP002393459, DOI: 10.1038/nbt1182
MANNO, CS ET AL.: "Successful transduction of liver in hemophilia by AAV-Factor IX and limitations imposed by the host immune response", NAT. MED., vol. 12, 2006, pages 342 - 347, XP002578131
MICHELFELDER, S ET AL.: "Vectors selected from adeno-associated viral display peptide libraries for leukemia cell-targeted cytotoxic gene therapy", EXP. HEMATOL., vol. 35, 2007, pages 1766 - 1776, XP022356316, DOI: 10.1016/j.exphem.2007.07.018
MILLER, EB ET AL.: "Production, purification and preliminary X-ray crystallographic studies of adeno-associated virus serotype 1", ACTA CRYSTALLOGRAPH. SECT. F STRUCT. BIOL. CRYST. COMMUN., vol. 62, 2006, pages 1271 - 1274
MINGOZZI, F ET AL.: "Induction of immune tolerance to coagulation factor IX antigen by in vivo hepatic gene transfer", J. CLIN. INVEST., vol. 111, 2003, pages 1347 - 1356
MITCHELL, M ET AL.: "Production, purification and preliminary X-ray crystallographic studies of adeno-associated virus serotype 9", ACTA CRYSTALLOGRAPH. SECT. F STRUCT. BIOL. CRYST. COMMUN., vol. 65, 2009, pages 715 - 718
MULLER, OJ ET AL.: "Random peptide libraries displayed on adeno-associated virus to select for targeted gene therapy vectors", NAT. BIOTECHNOL., vol. 21, 2003, pages 1040 - 1046, XP002596751, DOI: 10.1038/NBT856
MUZYCZKA, NBERNS, KI: "Fields Virol.", 2001, LIPPINCOTT WILLIAMS & WILKINS, pages: 2327 - 2359
NAKAI, H ET AL.: "Unrestricted hepatocyte transduction with adeno-associated virus serotype 8 vectors in mice", J. VIROL., vol. 79, 2004, pages 214 - 224, XP055174034, DOI: 10.1128/JVI.79.1.214-224.2005
NAM, H-J ET AL.: "Structure of adeno-associated virus serotype 8, a gene therapy vector", J. VIROL., vol. 81, 2007, pages 12260 - 12271
NAUMER, M ET AL.: "Properties of the adeno-associated virus assembly-activating protein", J. VIROL., vol. 86, 2012, pages 13038 - 13048, XP055372879, DOI: 10.1128/JVI.01675-12
NG, R ET AL.: "Structural characterization of the dual glycan binding adeno-associated virus serotype 6", J. VIROL., vol. 84, 2010, pages 12945 - 12957
OPIE, SR ET AL.: "Identification of amino acid residues in the capsid proteins of adeno-associated virus type 2 that contribute to heparan sulfate proteoglycan binding", J. VIROL., vol. 77, no. 12, 2003, pages 6995 - 7006, XP009018010, DOI: 10.1128/JVI.77.12.6995-7006.2003
PADRON, E ET AL.: "Structure of adeno-associated virus type 4", J. VIROL., vol. 79, 2005, pages 5047 - 5058
PANDYA, J ET AL.: "Rationally designed capsid and transgene cassette of AAV6 vectors for dendritic cell-based cancer immunotherapy", IMMUNOL. CELL BIOL., vol. 92, 2014, pages 116 - 123
PERABO, L ET AL.: "In vitro selection of viral vectors with modified tropism: the adeno-associated virus display", MOL. THER. J. AM. SOC. GENE THER., vol. 8, 2003, pages 151 - 157, XP003000206, DOI: 10.1016/S1525-0016(03)00123-0
PULICHERLA, N ET AL.: "Engineering liver-detargeted AAV9 vectors for cardiac and musculoskeletal gene transfer", MOL. THER., vol. 19, 2011, pages 1070 - 1078, XP008150248, DOI: 10.1038/mt.2011.22
QUESADA, O ET AL.: "Production, purification and preliminary X-ray crystallographic studies of adeno-associated virus serotype 7", ACTA CRYSTALLOGRAPH. SECT. F STRUCT. BIOL. CRYST. COMMUN., vol. 63, 2007, pages 1073 - 1076
RIEGER ET AL.: "Glossary of Genetics: Classical and Molecular", 1991, SPRINGER-VERLAG
SAMULSKI, RJ ET AL.: "A recombinant plasmid from which an infectious adeno-associated virus genome can be excised in vitro and its use to study viral replication", J. VIROL., vol. 61, 1987, pages 3096 - 3101, XP001097916
SANDS, MS: "AAV-mediated liver-directed gene therapy", METHODS MOL BIOL, vol. 807, 2011, pages 141 - 57, XP009167845, DOI: 10.1007/978-1-61779-370-7_6
See also references of EP3049527A4
SEN, D ET AL.: "Targeted modifications in adeno-associated virus serotype 8 capsid improves its hepatic gene transfer efficiency in vivo", HUM. GENE THER. METHODS, vol. 24, 2013, pages 104 - 116, XP055086037, DOI: 10.1089/hgtb.2012.195
SHANNON, CE: "The mathematical theory of communication", BELL SYST. TECH. J., vol. 27, 1948, pages 379 - 423,623-656
SHARLAND, A ET AL.: "Liver-directed gene expression using recombinant AAV 2/8 vectors-a tolerogenic strategy for gene delivery?", DISCOV. MED., vol. 9, 2010, pages 519 - 27
SHARMA ET AL.: "2A peptides provide distinct solutions to driving stop-carry on translational recoding", NUCLEIC ACIDS RES., vol. 40, 2012, pages 3143 - 3151
SHEN, X ET AL.: "Characterization of the relationship of AAV capsid domain swapping to liver transduction efficiency", MOL. THER., vol. 15, 2007, pages 1955 - 1962, XP002595612, DOI: 10.1038/sj.mt.6300293
SONNTAG, F ET AL.: "A viral assembly factor promotes AAV2 capsid formation in the nucleolus", PROC. NAT'L. ACAD. SCI. USA, vol. 107, 2010, pages 10220 - 10225, XP002591761, DOI: 10.1073/PNAS.1001673107
STACHLER, MDBARTLETT, JS: "Mosaic vectors comprised of modified AAV1 capsid proteins for efficient vector purification and targeting to vascular endothelial cells", GENE THER., vol. 13, 2006, pages 926 - 931, XP002598791
SUMMERFORD, CSAMULSKI, RJ: "Membrane-associated heparan sulfate proteoglycan is a receptor for adeno-associated virus type 2 virions", J. VIROL., vol. 72, 1998, pages 1438 - 1445
WALTERS, RW ET AL.: "Structure of adeno-associated virus serotype 5", J. VIROL., vol. 78, 2004, pages 3361 - 3371, XP002297595
WU, P ET AL.: "Mutational analysis of the adeno-associated virus type 2 (AAV2) capsid gene and construction of AAV2 vectors with altered tropism", J. VIROL., vol. 74, 2000, pages 8635 - 8647, XP055548655, DOI: 10.1128/JVI.74.18.8635-8647.2000
WU, Z ET AL.: "Adeno-associated virus serotypes: vector toolkit for human gene therapy", MOL. THER. J. AM. SOC. GENE THER., vol. 14, 2006, pages 316 - 327, XP005844824, DOI: 10.1016/j.ymthe.2006.05.009
XIE, Q ET AL.: "The atomic structure of adeno-associated virus (AAV-2), a vector for human gene therapy", PROC. NAT'L. ACAD. SCI. USA, vol. 99, 2002, pages 10405 - 10410, XP002255705, DOI: 10.1073/pnas.162250899
YANG, L ET AL.: "A myocardium tropic adeno-associated virus (AAV) evolved by DNA shuffling and in vivo selection", PROC. NAT'L. ACAD. SCI. USA, vol. 106, 2009, pages 3946 - 3951, XP055165570, DOI: 10.1073/pnas.0813207106
YANG, L ET AL.: "Directed evolution of adeno-associated virus (AAV) as vector for muscle gene therapy", METHODS MOL. BIOL., vol. 709, 2011, pages 127 - 139, XP008183486, DOI: 10.1007/978-1-61737-982-6_8
YANG, LXIAO, X: "Creation of a cardiotropic adeno-associated virus: the story of viral directed evolution", VIROL. J., vol. 10, 2013, pages 50, XP021139871, DOI: 10.1186/1743-422X-10-50
ZHONG, L ET AL.: "Next generation of adeno-associated virus 2 vectors: point mutations in tyrosines lead to high-efficiency transduction at lower doses", PROC. NAT'L. ACAD. SCI. USA, vol. 105, 2008, pages 7827 - 7832, XP002493284, DOI: 10.1073/pnas.0802866105
ZOLOTUKHIN, S ET AL.: "Recombinant adeno-associated virus purification using novel methods improves infectious titer and yield", GENE THER., vol. 6, 1999, pages 973 - 985, XP055559318, DOI: 10.1038/sj.gt.3300938

Cited By (59)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10046016B2 (en) 2003-06-30 2018-08-14 The Regents Of The University Of California Mutant adeno-associated virus virions and methods of use thereof
US10214566B2 (en) 2003-06-30 2019-02-26 The Regents Of The University Of California Mutant adeno-associated virus virions and methods of use thereof
US10494612B2 (en) 2010-10-06 2019-12-03 The Regents Of The University Of California Adeno-associated virus virions with variant capsid and methods of use thereof
US11236402B2 (en) 2011-04-22 2022-02-01 The Regents Of The University Of California Adeno-associated virus virions with variant capsid
US9856539B2 (en) 2011-04-22 2018-01-02 The Regents Of The University Of California Adeno-associated virus virions with variant capsid and methods of use thereof
US10214785B2 (en) 2011-04-22 2019-02-26 The Regents Of The University Of California Adeno-associated virus virions with variant capsid and methods of use thereof
US10202657B2 (en) 2011-04-22 2019-02-12 The Regents Of The University Of California Adeno-associated virus virions with variant capsid and methods of use thereof
US9943573B2 (en) 2012-05-15 2018-04-17 Avalanche Australia Pty Ltd. Treatment of ocular neovascularization using anti-VEGF proteins
US10004788B2 (en) 2012-05-15 2018-06-26 Avalanche Australia Pty Ltd. Treatment of ocular neovascularization using anti-VEGF proteins
US11634691B2 (en) 2013-05-31 2023-04-25 The Regents Of The University Of California Compositions and methods of treatment
US11136557B2 (en) 2013-05-31 2021-10-05 The Regents Of The University Of California Adeno-associated virus variants and methods of use thereof
US11091777B2 (en) 2013-09-26 2021-08-17 University Of Florida Research Foundation, Incorporated Synthetic combinatorial AAV capsid library for targeted gene therapy
US10000741B2 (en) 2014-03-17 2018-06-19 Adverum Biotechnologies, Inc. Compositions and methods for enhanced gene expression in cone cells
US12275959B2 (en) 2014-03-17 2025-04-15 Adverum Biotechnologies, Inc. Compositions and methods for enhanced gene expression in cone cells
US11248214B2 (en) 2014-03-17 2022-02-15 Adverum Biotechnologies, Inc. Compositions and methods for enhanced gene expression in cone cells
US10577627B2 (en) 2014-06-09 2020-03-03 Voyager Therapeutics, Inc. Chimeric capsids
US12180500B2 (en) 2014-06-09 2024-12-31 Voyager Therapeutics, Inc. Chimeric capsids
US11021519B2 (en) 2015-03-02 2021-06-01 Adverum Biotechnologies, Inc. Compositions and methods for intravitreal delivery of polynucleotides to retinal cones
US10883117B2 (en) 2015-03-24 2021-01-05 The Regents Of The University Of California Adeno-associated virus variants and methods of use thereof
US11447797B2 (en) 2015-05-12 2022-09-20 The United States Of America,As Represented By The Secretary, Department Of Health And Human Service AAV with unique capsid protein VP1 and methods of using for treatment
WO2017070476A3 (en) * 2015-10-22 2017-06-01 University Of Florida Research Foundation, Inc. Synthetic combinatorial aav3 capsid library
US12188037B2 (en) * 2015-10-22 2025-01-07 University Of Florida Research Foundation, Incorporated Synthetic combinatorial AAV3 capsid library
JP2022065003A (en) * 2015-12-14 2022-04-26 ザ ユニバーシティ オブ ノース カロライナ アット チャペル ヒル Modified capsid protein for enhanced delivery of parvovirus vector
US10584328B2 (en) 2015-12-23 2020-03-10 Adverum Biotechnologies, Inc. Mutant viral capsid libraries and related systems and methods
GB2545763A (en) * 2015-12-23 2017-06-28 Adverum Biotechnologies Inc Mutant viral capsid libraries and related systems and methods
US11427931B2 (en) 2015-12-23 2022-08-30 Adverum Biotechnologies, Inc. Mutant viral capsid libraries and related systems and methods
WO2017212019A1 (en) * 2016-06-09 2017-12-14 Centre National De La Recherche Scientifique (Cnrs) Raav with chemically modified capsid
US11865185B2 (en) 2016-06-09 2024-01-09 Centre National De La Recherche Scientifique (Cnrs) RAAV with chemically modified capsid
US11648319B2 (en) 2016-06-09 2023-05-16 Centre National De La Recherche Scientifique (Cnrs) rAAV with chemically modified capsid
JP7100629B2 (en) 2016-06-09 2022-07-13 セントレ・ナショナル・デ・ラ・レシェルシェ・サイエンティフィーク RAAV with chemically modified capsids
US11278631B2 (en) 2016-06-09 2022-03-22 Centre National De La Recherche Scientifique (Cnrs) RAAV with chemically modified capsid
JP2019520853A (en) * 2016-06-09 2019-07-25 セントレ・ナショナル・デ・ラ・レシェルシェ・サイエンティフィーク RAAV with chemically modified capsid
JP2022141723A (en) * 2016-06-09 2022-09-29 セントレ・ナショナル・デ・ラ・レシェルシェ・サイエンティフィーク RAAV with chemically modified capsid
US11554180B2 (en) 2016-07-29 2023-01-17 The Regents Of The University Of California Adeno-associated virus virions with variant capsid and methods of use thereof
US11565000B2 (en) 2016-07-29 2023-01-31 The Regents Of The University Of California Adeno-associated virus virions with variant capsid and methods of use thereof
US11565001B2 (en) 2016-07-29 2023-01-31 The Regents Of The University Of California Adeno-associated virus virions with variant capsid and methods of use thereof
US12030914B2 (en) 2016-10-19 2024-07-09 Adverum Biotechnologies, Inc. Modified AAV capsids and uses thereof
US11192925B2 (en) 2016-10-19 2021-12-07 Adverum Biotechnologies, Inc. Modified AAV capsids and uses thereof
US10793606B2 (en) 2017-02-21 2020-10-06 University Of Florida Research Foundation, Incorporated Modified AAV capsid proteins and uses thereof
US11767346B2 (en) 2017-02-21 2023-09-26 University Of Florida Research Foundation, Incorporated Modified AAV capsid proteins and uses thereof
US11332502B2 (en) 2017-02-21 2022-05-17 University Of Florida Research Foundation, Incorporated Modified AAV capsid proteins and uses thereof
US12310997B2 (en) 2017-06-30 2025-05-27 The Regents Of The University Of California Compositions and methods of treating ocular diseases
US11680249B2 (en) 2017-08-28 2023-06-20 The Regents Of The University Of California Adeno-associated virus capsid variants and methods of use thereof
CN112105630A (en) * 2018-02-15 2020-12-18 T·比约尔克隆德 Modified viral capsids
WO2019158619A1 (en) * 2018-02-15 2019-08-22 Bjoerklund Tomas Modified viral capsids
US11821009B2 (en) 2018-05-15 2023-11-21 Cornell University Genetic modification of the AAV capsid resulting in altered tropism and enhanced vector delivery
US11382988B2 (en) 2019-11-08 2022-07-12 Coave Therapeutics Modified adeno-associated virus vectors and delivery thereof into the central nervous system
US20230048732A1 (en) * 2020-05-26 2023-02-16 Shape Therapeutics Inc. High throughput engineering of functional aav capsids
US12630845B2 (en) 2020-08-07 2026-05-19 University Of Florida Research Foundation, Incorporated AAV capsid variants for targeting human glioblastoma cells
US12545929B2 (en) 2021-05-12 2026-02-10 Coave Therapeutics Lactam-modified adeno-associated virus vectors
US12528841B2 (en) 2021-10-08 2026-01-20 Dyno Therapeutics, Inc. Capsid variants and methods of using the same
US12331081B2 (en) 2021-10-08 2025-06-17 Dyno Therapeutics, Inc. Capsid variants and methods of using the same
US12331082B2 (en) 2021-10-08 2025-06-17 Dyno Therapeutics, Inc. Capsid variants and methods of using the same
US12116385B2 (en) 2021-10-08 2024-10-15 Dyno Therapeutics, Inc. Capsid variants and methods of using the same
WO2024191778A1 (en) 2023-03-10 2024-09-19 Dyno Therapeutics, Inc. Capsid polypeptides and methods of use thereof
US12630805B2 (en) 2023-03-15 2026-05-19 The Regents Of The University Of California Compositions and methods of treatment
WO2025049993A1 (en) 2023-08-31 2025-03-06 Dyno Therapeutics, Inc. Capsid polypeptides and methods of use thereof
WO2025171227A1 (en) 2024-02-08 2025-08-14 Dyno Therapeutics, Inc. Capsid polypeptides and methods of use thereof
WO2026064442A2 (en) 2024-09-18 2026-03-26 Dyno Therapeutics, Inc. Capsid polypeptides and methods of use thereof

Also Published As

Publication number Publication date
US20160369298A1 (en) 2016-12-22
EP3049527A4 (en) 2017-08-16
EP3633041A2 (en) 2020-04-08
JP6985795B2 (en) 2021-12-22
JP2019195338A (en) 2019-11-14
US11091777B2 (en) 2021-08-17
US20190249195A1 (en) 2019-08-15
EP3049527A1 (en) 2016-08-03
CA2930549A1 (en) 2015-04-02
JP2016533709A (en) 2016-11-04
AU2014324717B2 (en) 2020-10-08
EP3633041A3 (en) 2020-07-29
JP7007337B2 (en) 2022-01-24

Similar Documents

Publication Publication Date Title
US11091777B2 (en) Synthetic combinatorial AAV capsid library for targeted gene therapy
AU2014324717A1 (en) Synthetic combinatorial AAV capsid library for targeted gene therapy
JP7727029B2 (en) Liver-specific tropism of adeno-associated viruses
US12188037B2 (en) Synthetic combinatorial AAV3 capsid library
JP6921788B2 (en) Adeno-associated virus plasmids and vectors
AU2014274457B2 (en) Capsid-modified, rAAV3 vector compositions and uses in gene therapy of human liver cancer
US20230049066A1 (en) Novel aav3b variants that target human hepatocytes in the liver of humanized mice
WO2022126189A1 (en) Adeno-associated virus capsids and vectors
CN111718418A (en) A fusion protein that enhances gene editing and its application
CN111718420A (en) A kind of fusion protein for gene therapy and its application
WO2013159036A1 (en) Adeno associated virus plasmids and vectors
TW202325720A (en) Modified aav capsids and vectors
US20260041792A1 (en) Novel aav3b capsid variants with enhanced hepatocyte tropism
CA2930549C (en) Synthetic combinatorial aav capsid library for targeted gene therapy
US20230340526A1 (en) Novel aav3b variants that target hepatocytes and evade the humoral immune response
CN121203037B (en) AAV9 dominant mutant specifically targeting heart and muscle based on integrin engineering
US20250084129A1 (en) Aav5 capsid variants
RU2820088C1 (en) Isolated modified capsid protein vpi of adeno-associated virus serotype 5 (aav5), capsid and vector based thereon
CN118955653A (en) Mutants of adeno-associated virus capsid protein, nucleic acid encoding same and applications
WO2023022633A1 (en) Isolated modified aav5 capsid protein vp1

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 14848603

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 15024431

Country of ref document: US

ENP Entry into the national phase

Ref document number: 2016517431

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

REEP Request for entry into the european phase

Ref document number: 2014848603

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2014848603

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2014324717

Country of ref document: AU

Date of ref document: 20140926

Kind code of ref document: A

Ref document number: 2930549

Country of ref document: CA