WO2015031645A1 - Monoclonal antibodies to human 14-3-3 epsilon and human 14-3-3 epsilon sv - Google Patents
Monoclonal antibodies to human 14-3-3 epsilon and human 14-3-3 epsilon sv Download PDFInfo
- Publication number
- WO2015031645A1 WO2015031645A1 PCT/US2014/053207 US2014053207W WO2015031645A1 WO 2015031645 A1 WO2015031645 A1 WO 2015031645A1 US 2014053207 W US2014053207 W US 2014053207W WO 2015031645 A1 WO2015031645 A1 WO 2015031645A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- antibody
- seq
- epsilon
- amino acid
- tumor
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6851—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K49/00—Preparations for testing in vivo
- A61K49/001—Preparation for luminescence or biological staining
- A61K49/0013—Luminescence
- A61K49/0017—Fluorescence in vivo
- A61K49/005—Fluorescence in vivo characterised by the carrier molecule carrying the fluorescent agent
- A61K49/0058—Antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K51/00—Preparations containing radioactive substances for use in therapy or testing in vivo
- A61K51/02—Preparations containing radioactive substances for use in therapy or testing in vivo characterised by the carrier, i.e. characterised by the agent or material covalently linked or complexing the radioactive nucleus
- A61K51/04—Organic compounds
- A61K51/08—Peptides, e.g. proteins, carriers being peptides, polyamino acids, proteins
- A61K51/10—Antibodies or immunoglobulins; Fragments thereof, the carrier being an antibody, an immunoglobulin or a fragment thereof, e.g. a camelised human single domain antibody or the Fc fragment of an antibody
- A61K51/1045—Antibodies or immunoglobulins; Fragments thereof, the carrier being an antibody, an immunoglobulin or a fragment thereof, e.g. a camelised human single domain antibody or the Fc fragment of an antibody against animal or human tumor cells or tumor cell determinants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61N—ELECTROTHERAPY; MAGNETOTHERAPY; RADIATION THERAPY; ULTRASOUND THERAPY
- A61N5/00—Radiation therapy
- A61N5/10—X-ray therapy; Gamma-ray therapy; Particle-irradiation therapy
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/3023—Lung
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/575—Immunoassay; Biospecific binding assay; Materials therefor for cancer
- G01N33/5752—Immunoassay; Biospecific binding assay; Materials therefor for cancer of the lungs
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61N—ELECTROTHERAPY; MAGNETOTHERAPY; RADIATION THERAPY; ULTRASOUND THERAPY
- A61N5/00—Radiation therapy
- A61N5/10—X-ray therapy; Gamma-ray therapy; Particle-irradiation therapy
- A61N2005/1092—Details
- A61N2005/1098—Enhancing the effect of the particle by an injected agent or implanted device
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/51—Complete heavy chain or Fd fragment, i.e. VH + CH1
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/515—Complete light chain, i.e. VL + CL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/567—Framework region [FR]
Definitions
- the invention encompasses antibodies useful in the recognition of tumor cells and tumor specific delivery of drugs and therapies.
- 14-3-3 proteins are a group of highly conserved proteins that are involved in many vital cellular processes such as metabolism, protein trafficking, signal transduction, apoptosis and cell cycle regulation. 14-3-3 proteins are phospho- serine/phospho-threonine binding proteins that have a diverse array of partners including transcription factors, biosynthetic enzymes, cytoskeletal proteins, signalling molecules, apoptosis factors and tumor suppressors.
- the 14-3-3 family consists of 7 isoforms; beta, gamma, epsilon, sigma, zeta, tau and eta.
- 14-3-3 proteins are ubiquitously expressed and self-assemble into homo- and heterodimers, with the exception of 14-3-3 sigma, which exclusively forms homodimers and is found in cells of epithelial origin only. Each monomer contains an independent ligand-binding site, thus the 14-3-3 dimer can interact with two target proteins simultaneously.
- 14-3-3 proteins are highly rigid structures and ligand binding can induce conformational changes that alter the stability and/or catalytic activity of the ligand.
- 14-3-3 protein binding can physically occlude sequence-specific or structural motifs on the target that prevent molecular interactions and/or modulate the accessibility of a target protein to modifying enzymes such as kinases, phosphatases and proteases.
- 14-3-3 proteins can act as a scaffold molecule to anchor target proteins within close proximity of one another.
- 14-3-3 proteins represent an integration point for proliferative, survival, apoptotic and stress signalling pathways.
- Members of the 14-3-3 protein family enhance the activity of many proteins with proliferative and/or survival functions, such as Raf kinases, and antagonize the activity of proteins that promote cell death and
- 14-3-3 proteins have been integrated into the core regulatory pathways that are crucial for normal growth and development. 14-3-3 proteins are directly involved in cellular processes such as cytokinesis, cell-contact inhibition, anchorage-independent growth and cell adhesion, and it is these pathways that often become dysregulated in disease states such as cancer.
- IR ionizing radiation
- the present invention encompasses cell line that expresses an antibody comprising an amino acid sequence selected from the group consisting of SEQ ID NO:3 and SEQ ID NO:4, wherein the antibody specifically binds 14-3-3 epsilon.
- the present invention encompasses an isolated antibody that specifically binds 14-3-3 epsilon and comprises a light chain CDR3 comprising the amino acid sequence of SEQ ID NO:7 with zero to two amino acid substitutions.
- the present invention encompasses an isolated antibody that specifically binds 14-3-3 epsilon and comprises a heavy chain CDR3 comprising the amino acid sequence of SEQ ID NO:10 with zero to two amino acid substitutions.
- the present invention encompasses a method of detecting a tumor in a subject.
- the method comprises exposing a target area of the subject where the presence of a tumor is suspected to ionizing radiation;
- compositions to detect the presence of 14-3-3 epsilon in the target area comprising one or more targeting antibodies, wherein each targeting antibody specifically binds to 14-3-3 epsilon exposed on an irradiated cell and is conjugated to a detectable label; and detecting the detectable label to detect the presence of 14-3-3 epsilon, wherein the presence of 14-3-3 epsilon indicates the presence of a tumor in the target area of the subject.
- the present invention encompasses a method of enhancing radiotherapy in a subject.
- the method comprises administering a
- the present invention encompasses a method of delivering a therapeutic agent to a cell expressing 14-3-3 epsilon in a subject.
- the method comprises exposing a target area of the subject where the presence of a tumor is suspected to ionizing radiation; and administering an isolated anti-14-3-3 epsilon antibody of claim 7 or claim 9 to the subject.
- the present invention encompasses a method of detecting 14-3-3 epsilon in a sample.
- the method comprises obtaining a sample, and detecting and/or measuring the amount of 14-3-3 epsilon in the sample using an antibody of the invention.
- FIG. 1 shows the amino acid sequence of human 14-3-3 epsilon isoform 1 (SEQ ID NO:1 1 ).
- the underlined sequence identifies the binding epitope of antibody 7D4.
- FIG. 2 shows the amino acid sequence of human 14-3-3 epsilon isoform SV (SEQ ID NO:12). The underlined sequence identifies the binding epitope of antibody 7D4.
- FIG. 3 shows anti-14-3-3 epsilon antibody detecting protein on H23 (NSCLC) treated with 3Gyx3 and sham OGy.
- 7D4 antibody binds to irradiated H23 cells but not non-irradiated cells.
- the commercial antibody shows binding to non-irradiated cells.
- FIG. 4 shows anti-14-3-3 epsilon antibody reacting with human normal tissues.
- A Colon, liver, lung, pancreas
- B kidney and tongue tissue was evaluated.
- the 7D4 mouse monoclonal antibody to 14-3-3 epsilon showed no binding to colon, liver, pancreas, kidney or tongue. There was minimal binding to the lung.
- FIG. 5 shows flow cytometry of antibody binding to human lung cancer cell model H23.
- FIG. 6 shows that the 7D4 antibody activates phagocytosis by dendritic cells and monocytic cells.
- A-C Murine dendritic cells (mDCs) are attracted by 3Gyx3 irradiated H23 cells coated with McAb.
- A shows examples of phagocytic events (accumulation of red signal within mDCs; extension of pseudopodia; adhesion of mDCs to H23 cells).
- B and (C) controls show minimal phagocytic events.
- D 50 random high-power fields were counted for tallying of phagocytic events.
- FIG. 7 shows the ELISPOT IFN- ⁇ level test in H23 cells.
- A shows the production of interferon-gamma in cells treated with dendritic cells.
- Group 1 A,B,C, well 1 -6;
- Group 2 D,E,F, well 1 -6;
- Group 3 G,H, well 1 -6 & A 7-12;
- Group 4 B,C,D, well 7- 12;
- Group 5 E,F, well 7-12.
- (B) shows the quantification of interferon production.
- Group 1 3Gyx3 + 7D4 + mouse DC; Group 2: 3Gyx3 + 7D4 + 0; Group 3: 3Gyx3 + NMIgG + MDC; Group 4: OGy + 7D4 + MDC; Group 5: OGy + 0 + 0.
- the present invention provides antibodies that specifically bind 14-3-3 epsilon.
- these antibodies specifically bind to epitopes exposed on irradiated tumor cells and not normal cells.
- the antibodies may be used to provide tumor specific delivery, for instance, of drugs or therapeutic agents, as well as enhancing the efficacy of radiotherapy.
- 14-3-3 epsilon refers to human 14-3-3 epsilon and to orthologs from others species.
- orthologs are known in the art and include, but are not limited to the following NCBI Reference Sequences: XP_515815.4 (Pan troglodytes), NP_033562.3 (Mus musculus), NP_1 13791 .1 (Rattus norvegicus), NP_776916.1 (Bos taurus), XP_854358.1 (Canis familiaris), NP_001006219.1 (Gallus gallus), BC045025.1 (Xenopus laevis), ECU89595.1 (Xenopus tropicalis), BC045325.1 (Danio rerio), AY370883.1 (Oncorhynchus mykiss), AB037679.1 (Ciona intestinalis), NP_732309.1 (Drosophila me
- NP_010384.1 (Saccharomyces cerevisiae) , NP_594167.1 (Schizosaccharomyces pombe), NP_564451 .2 (Arabidopsis thaliana), CF51 152.1 (Vitis vinifera), AJ276594.1 (Oryza sativa), Y14200.1 (Hordeum vulgare), AY1 10486.1 (Zea mays), and
- 14-3-3 epsilon encompasses all 14- 3-3 epsilon splice variants.
- human 14-3-3 epsilon is encoded by the gene YWHAE (Entrez Gene ID 7531 ).
- Alternative splicing produces two isoforms— isoform 1 (SEQ ID NO:1 1 ) and isoform SV (SEQ ID NO:12).
- anti-14-3-3 epsilon antibodies of the invention may be used to detect 14-3-3 epsilon in vitro or in vivo.
- anti-14-3-3 epsilon antibodies useful herein also include antibodies that bind to specific regions of 14-3-3 epsilon, isoforms of 14-3-3 epsilon and to other forms of 14-3-3 epsilon. Specific regions of 14-3-3 epsilon include, but are not limited to, the C-terminal, the N-terminal, and other central domains.
- Isoforms of 14-3-3 epsilon include 14-3-3 epsilon isoform 1 (SEQ ID NO:1 1 ) and 14-3-3 epsilon isoform SV (SEQ ID NO:12), as well as splice variants from other species.
- Other forms of 14-3-3 epsilon include but are not limited to truncated, modified, soluble, insoluble, intracellular, extracellular, and dimerized or otherwise oligomerized forms, as well as 14-3-3 epsilon complexed with other proteins or molecules.
- anti-14-3-3 epsilon antibodies useful herein include those which are isolated, characterized, purified, functional and have been recovered (obtained) from a process for their preparation and thus available for use herein in a useful form in an amount sufficient for conjugation to a drug, drug delivery vehicles or imaging agent.
- antibodies useful herein include those antibodies which have been isolated, characterized, purified, are functional and have been recovered (obtained) from a process for their preparation and thus available for use herein in a useful form in an amount sufficient for an assay to detect and measure the amount of 14-3-3 epsilon in a biological sample.
- anti-14-3-3 epsilon antibodies useful herein include those which are isolated, characterized, purified, functional and have been recovered (obtained) from a process for their preparation and thus available for use herein in a useful form in a therapeutically and medicinally sufficient amount.
- anti-14-3-3 epsilon antibodies useful herein include all antibodies that specifically bind an epitope within 14-3-3 epsilon.
- the epitope is detectable on the surface of a tumor cell following irradiation.
- the epitope may or may not be detectable on the cell surface in the absence of irradiation.
- an epitope may be detectable on the surface of a tumor cell both in the absence of irradiation and following irradiation, though the detectable signal is greater following irradiation.
- antibody includes the term “monoclonal antibody.”
- “Monoclonal antibody” refers to an antibody that is derived from a single copy or clone, including e.g., any eukaryotic, prokaryotic, or phage clone. "Monoclonal antibody” is not limited to antibodies produced through hybridoma technology. Monoclonal antibodies can be produced using e.g., hybridoma techniques well known in the art, as well as recombinant technologies, phage display technologies, synthetic technologies or combinations of such technologies and other technologies readily known in the art. Furthermore, the monoclonal antibody may be labeled with a detectable label, immobilized on a solid phase and/or conjugated with a heterologous compound (e.g., an enzyme or toxin) according to methods known in the art.
- a heterologous compound e.g., an enzyme or toxin
- antibody is meant a functional monoclonal antibody, or an immunologically effective fragment thereof; such as an Fab, Fab', or F(ab')2 fragment thereof.
- fragments will be mentioned specifically for emphasis; nevertheless, it will be understood that regardless of whether fragments are specified, the term “antibody” includes such fragments as well as single-chain forms.
- antibody also included within the definition "antibody” for example are single chain forms, generally designated Fv, regions, of antibodies with this specificity.
- the antibodies useful in the discovery are produced recombinantly, as manipulation of the typically murine or other non-human antibodies with the appropriate specificity is required in order to convert them to humanized form.
- Antibodies may or may not be glycosylated, though glycosylated antibodies are preferred.
- Antibodies are properly cross-linked via disulfide bonds, as is known.
- the basic antibody structural unit of an antibody useful herein comprises a tetramer.
- Each tetramer is composed of two identical pairs of polypeptide chains, each pair having one "light/ (about 25 kDa) and one "heavy" chain (about 50-70 kDa).
- the amino-terminal portion of each chain includes a variable region of about 100 to 1 10 or more amino acid sequences primarily responsible for antigen recognition.
- the carboxy-terminal portion of each chain defines a constant region primarily responsible for effector function.
- Light chains are classified as gamma, mu, alpha, and lambda.
- Heavy chains are classified as gamma, mu, alpha, delta, or epsilon, and define the antibody's isotype as IgO, IgM, IgA, IgD and IgE, respectively.
- the variable and constant regions are joined by a "J" region of about 12 or more amino acid sequences, with the heavy chain also including a "D" region of about 10 more amino acid sequences.
- variable regions of each light/heavy chain pair form the antibody binding site.
- the chains exhibit the same general structure of relatively conserved framework regions (FR) joined by three hypervariable regions, also called complementarity determining regions (hereinafter referred to as "CDRs.")
- FR framework regions
- CDRs complementarity determining regions
- the CDRs from the two chains are aligned by the framework regions, enabling binding to a specific epitope.
- both light and heavy chains comprise the domains FR1 , CDR1 , FR2, CDR2, FR3, CDR3 and FR4 respectively.
- monoclonal anti-14-3-3 epsilon antibodies are generated with appropriate specificity by standard techniques of immunization of mammals, forming hybridomas from the antibody-producing cells of said mammals or otherwise immortalizing them, and culturing the hybridomas or immortalized cells to assess them for the appropriate specificity.
- such antibodies could be generated by immunizing a human, rabbit, rat or mouse, for example, with a peptide representing an epitope encompassing a region of the 14-3-3 epsilon protein coding sequence or an appropriate subregion thereof.
- Materials for recombinant manipulation can be obtained by retrieving the nucleotide sequences encoding the desired antibody from the hybridoma or other cell that produces it. These nucleotide sequences can then be manipulated and isolated, characterized, purified and, recovered to provide them in humanized form, for use herein if desired.
- humanized antibody includes an anti-14-3-3 epsilon antibody that is composed partially or fully of amino acid sequence sequences derived from a human antibody germline by altering the sequence of an antibody having non- human complementarity determining regions ("CDR").
- CDR complementarity determining regions
- the simplest such alteration may consist simply of substituting the constant region of a human antibody for the murine constant region, thus resulting in a human/murine chimera which may have sufficiently low immunogenicity to be acceptable for pharmaceutical use.
- the variable region of the antibody and even the CDR is also humanized by techniques that are by now well known in the art.
- the framework regions of the variable regions are substituted by the corresponding human framework regions leaving the non-human CDR substantially intact, or even replacing the CDR with sequences derived from a human genome.
- CDRs may also be randomly mutated such that binding activity and affinity for 14-3-3 epsilon is maintained or enhanced in the context of fully human germline framework regions or framework regions that are substantially human.
- Substantially human frameworks have at least 90%, 95%, or 99% sequence identity with a known human framework sequence.
- Fully useful human antibodies are produced in genetically modified mice whose immune systems have been altered to correspond to human immune systems. As mentioned above, it is sufficient for use in the methods of this discovery, to employ an immunologically specific fragment of the antibody, including fragments representing single chain forms.
- humanized antibody refers to an anti-14-3-3 epsilon antibody comprising a human framework, at least one CDR from a nonhuman antibody, and in which any constant region present is substantially identical to a human immunoglobulin constant region, i.e., at least about 85-90%, preferably at least 95% identical.
- all parts of a humanized antibody, except possibly the CDRs, are substantially identical to corresponding pairs of one or more native human immunoglobulin sequences.
- humanized immunoglobulins may be carried out as follows.
- the framework amino acid sequence of a human immunoglobulin to be used (acceptor immunoglobulin) is replaced by a framework amino acid sequence from a CDR- providing nonhuman immunoglobulin (donor immunoglobulin): (a) the amino acid sequence in the human framework region of the acceptor immunoglobulin is unusual for human immunoglobulin at that position, whereas the corresponding amino acid sequence in the donor immunoglobulin is typical for human immunoglobulin at that position; (b) the position of the amino acid sequence is immediately adjacent to one of the CDRs; or (c) any side chain atom of a framework amino acid sequence is within about 5-6 angstroms (center-to-center) of any atom of a CDR amino acid sequence in a three dimensional immunoglobulin model (Queen, et al., op.
- an antibody of the invention specifically binds 14-3-3 epsilon.
- an antibody of the invention specifically binds to human 14-3-3 epsilon isoform 1 (SEQ ID NO:1 1 ), human 14-3-3 epsilon isoform SV (SEQ ID NO:12), or human 14-3-3 epsilon isoform 1 and human 14-3-3 epsilon isoform SV.
- the phrase "specifically binds" herein means antibodies bind to the protein with an affinity constant or Affinity of interaction (KD) in the range of at least 0.1 mM to 1 pM, or in the range of at least 0.1 pM to 10 nM, with a preferred range being 0.1 pM to 1 nM.
- KD affinity constant or Affinity of interaction
- the antibodies of the present invention may also be used as fusion proteins known as single chain variable fragments (scFv). These scFvs are comprised of the heavy and light chain variable regions connected by a linker. In most instances, but not all, the linker may be a peptide. A linker peptide is preferably from about 10 to 25 amino acids in length. Preferably, a linker peptide is rich in glycine, as well as serine or threonine. ScFvs can be used to facilitate phage display or can be used for flow cytometry, immunohistochemistry, or as targeting domains. Methods of making and using scFvs are known in the art.
- the scFvs of the present invention are conjugated to a human constant domain.
- the heavy constant domain is derived from an IgG domain, such as lgG1 , lgG2, lgG3, or lgG4.
- the heavy chain constant domain may be derived from IgA, IgM, or IgE.
- the antibodies of the present invention may also be conjugated to a payload, such as a therapeutic agent, a detectable, and/or a delivery device (including, but not limited to, a liposome or a nanoparticle) containing the drug or detectable label.
- a payload such as a therapeutic agent, a detectable, and/or a delivery device (including, but not limited to, a liposome or a nanoparticle) containing the drug or detectable label.
- a delivery device including, but not limited to, a liposome or a nanoparticle
- Methods of conjugating an antibody to a therapeutic agent, a detectable label, a liposome, a nanoparticle or other delivery device are known in the art.
- the conjugation should not interfere with the antibody recognizing its target, and should not interfere with the active site of the target.
- an antibody may be generated with a cleavable linkage between the antibody and the payload.
- linker may allow release of the payload at a specific cellular location.
- Suitable linkers include, but are not limited to, amino acid chains and alkyl chains functionalized with reactive groups for conjugating to both the antibody of the invention and the detectable label and/or therapeutic agent.
- the therapeutic agent, detectable label, and delivery device are described in further detail below.
- the present invention encompasses a cell line, the cell line expressing an antibody comprising an amino acid sequence selected from the group consisting of SEQ ID NO:3 and SEQ ID NO:4, wherein the antibody specifically binds 14-3-3 epsilon.
- the present invention encompasses a cell line, the cell line expressing an antibody encoded by a nucleic acid sequence
- the cell line is an immortalized cell line.
- the cell line is a hybridoma. Methods of generating hybridomas capable of producing antibodies are known in the art
- a preferred antibody is a humanized form of mouse antibody derived from a hybridoma designated 7D4.
- the term “derived from” means that the “derived” antibody comprises at least one CDR region from the antibody produced by 7D4. Stated another way, the “derived antibody” comprises at least one CDR region comprised of the amino acid sequence selected from the group consisting of SEQ ID NO:5, 6, 7, 8, 9, and 10.
- an antibody of the invention may be derived from the hybridoma 7D4, and may be encoded by a nucleic acid sequence comprising 90, 91 , 92, 93, 94, 95, 96, 97, 98, or 99% identity to the light chain variable region of SEQ ID NO:1 , or may be encoded by a nucleic acid sequence comprising 90, 91 , 92, 93, 94, 95, 96, 97, 98, or 99% identity to the heavy chain variable region of SEQ ID NO:2.
- an antibody of the invention may be derived from the hybridoma 7D4, and may comprise an amino acid sequence with 90, 91 , 92, 93, 94, 95, 96, 97, 98, or 99% identity to the light chain variable region of SEQ ID NO:3, or may comprise an amino acid sequence with 90, 91 , 92, 93, 94, 95, 96, 97, 98, or 99% identity to the heavy chain variable region of SEQ ID NO:4.
- the antibody may be humanized.
- the antibody comprises the light chain nucleic acid sequence of SEQ ID NO:1 and the heavy chain nucleic acid sequence of SEQ ID NO:2 [i.e. the monoclonal antibody referred to herein as 7DR].
- the antibody comprises the light chain amino acid sequence of SEQ ID NO:3 and the heavy chain amino acid sequence of SEQ ID NO:4 [i.e. the monoclonal antibody referred to herein as 7DR].
- an antibody of the invention may comprise a light chain CDR1 , such as antibody 1 of Table A.
- an antibody of the invention may comprise a light chain CDR2, such as antibody 4 of Table A.
- an antibody of the invention may comprise a light chain CDR3, such as antibody 6 of Table A.
- an antibody of the invention may comprise a combination of two or three light chain CDRs, such as the antibodies 2, 3 and 5 of Table A.
- an antibody of the invention may comprise a heavy chain CDR1 , such as antibody 7 of Table A.
- an antibody of the invention may comprise a heavy chain CDR2, such as antibody 10 of Table A.
- an antibody of the invention may comprise a heavy chain CDR3, such as antibody 12 of Table A.
- an antibody of the invention may comprise a combination of two or three heavy chain CDRs, such as the antibodies 8, 9 and 1 1 of Table A.
- an antibody of the invention may comprise one or more light chain CDRs and one or more heavy chain CDRs, such as the antibodies 13-48 of Table A.
- SEQ ID NO:5 SEQ ID NO:6 SEQ ID NO:7 SEQ ID NO:8 SEQ ID NO:9 SEQ ID NO: 10
- SEQ ID NO:6 SEQ ID NO:7 SEQ ID NO:8 SEQ ID NO:9 SEQ ID NO: 10
- SEQ ID NO:7 SEQ ID NO:8 SEQ ID NO:9 SEQ ID NO: 10 46 SEQ ID NO:7 SEQ ID NO:9
- an antibody of the invention is humanized.
- a humanized antibody of the invention may comprise a light chain variable region comprising a CDR1 of amino acid sequence SEQ ID NO:5 with zero to two amino acid substitutions, a CDR2 of amino acid sequence SEQ ID NO:6 with zero to two amino acid substitutions, and a CDR3 of amino acid sequence SEQ ID NO:7 with zero to two amino acid substitutions, or may comprise a heavy chain variable region comprising a CDR1 of amino acid sequence SEQ ID NO:8 with zero to two amino acid substitutions, a CDR2 of amino acid sequence SEQ ID NO:9 with zero to two amino acid substitutions, and a CDR3 of amino acid sequence SEQ ID NO:10 with zero to two amino acid substitutions.
- a humanized antibody of the invention may comprise a light chain variable region comprising a CDR1 of amino acid sequence SEQ ID NO:5 with zero to two amino acid substitutions, a CDR2 of amino acid sequence SEQ ID NO:6 with zero to two amino acid substitutions, a CDR3 of amino acid sequence SEQ ID NO:7 with zero to two amino acid
- a heavy chain variable region comprising a CDR1 of amino acid sequence SEQ ID NO:8 with zero to two amino acid substitutions, a CDR2 of amino acid sequence SEQ ID NO:8 with zero to two amino acid substitutions, and a CDR3 of amino acid sequence SEQ ID NO:10 with zero to two amino acid substitutions.
- a humanized antibody of the invention may comprise a light chain variable region comprising a CDR1 of amino acid sequence SEQ ID NO:5, a CDR2 of amino acid sequence SEQ ID NO:6, a CDR3 of amino acid sequence SEQ ID NO:7, a heavy chain variable region comprising a CDR1 of amino acid sequence SEQ ID NO:8, a CDR2 of amino acid sequence SEQ ID NO:9, and a CDR3 of amino acid sequence SEQ ID NO:10.
- the invention also encompasses the corresponding nucleic acid sequences of SEQ ID NO:5, 6, 7, 8, 9, and 10, which can readily be determined by one of skill in the art, and may be incorporated into a vector or other large DNA molecule, such as a chromosome, in order to express an antibody of the invention.
- an antibody of the invention may be conjugated to a detectable label.
- a detectable label may be directly conjugated to an antibody of the invention or may be indirectly conjugated to an antibody of the invention.
- a detectable label may be complexed with a chelating agent that is conjugated to an antibody of the invention.
- a detectable label may be complexed with a chelating agent that is conjugated to a linker that is
- a detectable label may be conjugated to a linker that is conjugated to an antibody of the invention.
- a detectable label may be indirectly attached to an antibody of the invention by the ability of the label to be specifically bound by a second molecule.
- an indirectly attached label is a biotin label that can be specifically bound by the second molecule, streptavidin. Single, dual or multiple labeling may be advantageous.
- An isolated antibody of the present invention may be conjugated to one, two, three, four, or five types of detectable labels.
- a "detectable label” is any type of label which, when attached to an antibody of the invention renders the antibody detectable.
- a detectable label may also be toxic to cells or cytotoxic. Accordingly, a detectable label may also be a therapeutic agent or cytotoxic agent.
- detectable labels may include luminescent molecules, chemiluminescent molecules, fluorochromes, fluorophores, fluorescent quenching agents, colored molecules, radioisotopes, radionuclides, cintillants, massive labels such as a metal atom (for detection via mass changes), biotin, avidin, streptavidin, protein A, protein G, antibodies or fragments thereof, Grb2, polyhistidine, Ni 2+ , Flag tags, myc tags, heavy metals, enzymes, alkaline phosphatase, peroxidase, luciferase, electron donors/acceptors, acridinium esters, and colorimetric substrates.
- luminescent molecules chemiluminescent molecules, fluorochromes, fluorophores, fluorescent quenching agents, colored molecules, radioisotopes, radionuclides, cintillants, massive labels such as a metal atom (for detection via mass changes), biotin, avidin, streptavidin, protein A,
- a detectable label emits a signal that can be detected by a signal transducing machine. In some cases, the detectable label can emit a signal
- the detectable label comprises a label that can be detected using magnetic resonance imaging, scintigraphic imaging, ultrasound, or fluorescence.
- the detectable label comprises a label that can be detected using positron emission tomography, single photon emission computed tomography, gamma camera imaging, or rectilinear scanning.
- Suitable fluorophores include, but are not limited to, fluorescein isothiocyante (FITC), fluorescein thiosemicarbazide, rhodamine, Texas Red, CyDyes (e.g., Cy3, Cy5, Cy5.5), Alexa Fluors (e.g., Alexa488, Alexa555, Alexa594; Alexa647), near infrared (NIR) (700-900 nm) fluorescent dyes, and carbocyanine and aminostyryl dyes.
- FITC fluorescein isothiocyante
- fluorescein thiosemicarbazide e.g., Texas Red
- CyDyes e.g., Cy3, Cy5, Cy5.5
- Alexa Fluors e.g., Alexa488, Alexa555, Alexa594; Alexa647
- NIR near infrared
- B-12 or an analog thereof can be labeled for fluorescence detection by labeling the agent with a fluorophore using techniques well known in the art (see, e.g., Lohse et al., Bioconj Chem 8:503-509 (1997)).
- a fluorophore such as fluorescein may be bound to a lysine residue of a peptide linker.
- an alkyne modified dye such an Alexa Fluor dye
- an alkyne modified dye may be clicked to an azido modified B 2 using, for example, Sharpless click chemistry (Kolb et al., Angew Chem Int Ed 2001 ; 40: 2004- 2021 , which incorporated by reference in its entirety).
- a radionuclide may be a ⁇ -emitting radionuclide, Auger-emitting radionuclide, ⁇ -emitting radionuclide, an a-emitting radionuclide, or a positron-emitting radionuclide.
- a radionuclide may be a detectable label and/or a therapeutic agent.
- Non- limiting examples of suitable radionuclides may include carbon-1 1 , nitrogen-13, oxygen- 15, fluorine-18, fluorodeoxyglucose-18, phosphorous-32, scandium-47, copper-64, 65 and 67, gallium-67 and 68, bromine-75, 77 and 80m, rubidium-82, strontium-89, zirconium-89, ytthum-86 and 90, ruthenium-95, 97,103 and 105, rhenium-99m, 101 , 105, 186 and 188, technetium-99m, rhodium-105, mercury-107, palladium-109, indium- 1 1 1 , silver-1 1 1 , indium-1 13m, lanthanide-1 14m, tin-1 17m, tellurium-121 m, 122m and 125m, iodine-122, 123, 124, 125, 126, 131 and 133, praseodymium-142
- a radionuclide is selected from the group consisting of copper-64, zirconium-89, ytthum-86, yttrium-90, technetium-99m, iodine-125, iodine-131 , lutetium- 177, rhenium-186 and rhenium-188.
- the metal atom may generally be selected from the group of metal atoms comprised of metals with an atomic number of twenty or greater.
- the metal atoms may be calcium atoms, scandium atoms, titanium atoms, vanadium atoms, chromium atoms, manganese atoms, iron atoms, cobalt atoms, nickel atoms, copper atoms, zinc atoms, gallium atoms, germanium atoms, arsenic atoms, selenium atoms, bromine atoms, krypton atoms, rubidium atoms, strontium atoms, yttrium atoms, zirconium atoms, niobium atoms, molybdenum atoms, technetium atoms, ruthenium atoms, rhodium atoms, palladium atoms, silver atoms, c
- the metal atoms may be selected from the group comprising alkali metals with an atomic number greater than twenty. In other embodiments, the metal atoms may be selected from the group comprising alkaline earth metals with an atomic number greater than twenty. In one embodiment, the metal atoms may be selected from the group of metals comprising the lanthanides. In another embodiment, the metal atoms may be selected from the group of metals comprising the actinides. In still another embodiment, the metal atoms may be selected from the group of metals comprising the transition metals. In yet another embodiment, the metal atoms may be selected from the group of metals comprising the poor metals.
- the metal atoms may be selected from the group comprising gold atoms, bismuth atoms, tantalum atoms, and gadolinium atoms. In preferred embodiments, the metal atoms may be selected from the group comprising metals with an atomic number of 53 (i.e. iodine) to 83 (i.e. bismuth). In an alternative embodiment, the metal atoms may be atoms suitable for magnetic resonance imaging. In another alternative embodiment, the metal atoms may be selected from the group consisting of metals that have a K-edge in the x-ray energy band of CT. Preferred metal atoms include, but are not limited to, manganese, iron, gadolinium, gold, and iodine.
- the metal atoms may be metal ions in the form of +1 , +2, or +3 oxidation states.
- non-limiting examples include Ba 2+ , Bi 3+ , Cs + , Ca 2+ , Cr 2 *, Cr 3+ , Cr 6+ , Co 2+ , Co 3+ , Cu + , Cu 2+ , Cu 3+ , Ga 3+ , Gd 3+ , Au + , Au 3+ , Fe 2+ , Fe 3+ , F 3+ , Pb 2+ , Mn 2+ , Mn 3+ , Mn 4+ , Mn 7+ , Hg 2+ , Ni 2+ , Ni 3+ , Ag + , Sr 2+ , Sn 2+ , Sn 4+ , and Zn 2+ .
- the metal atoms may comprise a metal oxide.
- non-limiting examples of metal oxides may include iron oxide, manganese oxide, or gadolinium oxide. Additional examples may include magnetite
- an antibody of the invention may be conjugated to a therapeutic agent, such that the therapeutic agent can be selectively targeted to a cell expressing 14-3-3 epsilon.
- the therapeutic agent can be selectively targeted to an irradiated tumor cell expressing 14-3-3 epsilon.
- the therapeutic agent may be directly conjugated to an antibody of the invention or may be indirectly conjugated to an antibody of the invention.
- the therapeutic agent may be complexed with a chelating agent that is conjugated to an antibody of the invention.
- the therapeutic agent may be complexed with a chelating agent that is conjugated to a linker that is conjugated to an antibody of the invention.
- the therapeutic agent may be conjugated to a linker that is conjugated to an antibody of the invention.
- the therapeutic agent may be conjugated to a linker that is conjugated to a chelating agent that is complexed with a detectable label and conjugated to an antibody of the invention.
- a "therapeutic agent” is any compound known in the art that is used in the detection, diagnosis, or treatment of a condition or disease. Such compounds may be naturally-occurring, modified, or synthetic.
- therapeutic agents may include drugs, therapeutic compounds, genetic materials, metals (such as radioactive isotopes), proteins, peptides, carbohydrates, lipids, steroids, nucleic acid based materials, or derivatives, analogues, or combinations thereof in their native form or derivatized with hydrophobic or charged moieties to enhance incorporation or adsorption into a cell.
- Such therapeutic agents may be water soluble or may be hydrophobic.
- Non-limiting examples of therapeutic agents may include immune-related agents, thyroid agents, respiratory products, antineoplastic agents, anti-helmintics, antimalarials, mitotic inhibitors, hormones, anti-protozoans, anti-tuberculars, cardiovascular products, blood products, biological response modifiers, anti-fungal agents, vitamins, peptides, anti-allergic agents, anti-coagulation agents, circulatory drugs, metabolic potentiators, anti-virals, anti-anginals, antibiotics, anti-inflammatories, anti-rheumatics, narcotics, cardiac glycosides, neuromuscular blockers, sedatives, local anesthetics, general anesthetics, or radioactive atoms or ions.
- therapeutic agents are described below.
- a therapeutic agent may be a compound used in the detection diagnosis or treatment of cancer.
- the therapeutic agent preferably reduces or interferes with tumor growth or otherwise reduces the effect of the tumor within the body or organism.
- a therapeutic agent that reduces the symptoms produced by the tumor or reduces tumor growth is suitable for the present invention. Additionally, any therapeutic agent that reduces the symptoms associated with tumor cell growth will work for purposes of the present invention.
- An antibody of the invention may be conjugated to one, two, three, four, or five therapeutic agents.
- a linker may or may not be used to conjugate a therapeutic agent to an antibody of the invention. Generally speaking, the conjugation should not interfere with the antibody binding to 14-3-3 epsilon.
- an antibody of the invention may be generated with a cleavable linkage between the antibody and therapeutic agent. Such a linker may allow release of the therapeutic agent at a specific cellular location.
- a therapeutic agent of the invention may be a small molecule therapeutic, a therapeutic antibody, a therapeutic nucleic acid, or a chemotherapeutic agent.
- therapeutic antibodies may include muromomab, abciximab, rituximab, daclizumab, basiliximab, palivizumab, infliximab, trastuzumab, etanercept, gemtuzumab, alemtuzumab, ibritomomab, adalimumab, alefacept, omalizumab, tositumomab, efalizumab, cetuximab, bevacizumab, natalizumab, ranibizumab, panitumumab, eculizumab, and certolizunnab.
- a representative therapeutic nucleic acid may encode a polypeptide having an ability to induce an immune response and/or an anti-angiogenic response in vivo.
- Representative therapeutic proteins with immunostimulatory effects include but are not limited to cytokines (e.g., an interleukin (IL) such as IL2, IL4, IL7, IL12, interferons, granulocyte-macrophage colony-stimulating factor (GM-CSF), tumor necrosis factor alpha (TNF-a)), immunomodulatory cell surface proteins (e.g., human leukocyte antigen (HLA proteins), co-stimulatory molecules, and tumor-associated antigens.
- cytokines e.g., an interleukin (IL) such as IL2, IL4, IL7, IL12, interferons, granulocyte-macrophage colony-stimulating factor (GM-CSF), tumor necrosis factor alpha (TNF-a)
- immunomodulatory cell surface proteins
- Representative proteins with anti-angiogenic activities that can be used in accordance with the presently disclosed subject matter include: thrombospondin I (Kosfeld & Frazier, 1993; Tolsma et al., 1993; Dameron et al., 1994), metallospondin proteins (Carpizo & Iruela-Arispe, 2000), class I interferons (Albini et al., 2000), IL12 (Voest et al., 1995), protamine (Ingber et al., 1990), angiostatin (O'Reilly et al., 1994), laminin (Sakamoto et al., 1991 ), endostatin (O'Reilly et al., 1997), and a prolactin fragment (Clapp et al., 1993).
- anti-angiogenic peptides have been isolated from these proteins (Maione et al., 1990; Eijan et al., 1991 ; Woltering et al., 1991 ).
- Representative proteins with both immunostimulatory and anti- angiogenic activities may include IL12, interferon- ⁇ , or a chemokine.
- Other therapeutic nucleic acids that may be useful for cancer therapy include but are not limited to nucleic acid sequences encoding tumor suppressor gene products/antigens, antimetabolites, suicide gene products, and combinations thereof.
- a chemotherapeutic agent refers to a chemical compound that is useful in the treatment of cancer.
- the compound may be a cytotoxic agent that affects rapidly dividing cells in general, or it may be a targeted therapeutic agent that affects the deregulated proteins of cancer cells.
- a cytotoxic agent is any naturally-occurring, modified, or synthetic compound that is toxic to tumor cells. Such agents are useful in the treatment of neoplasms, and in the treatment of other symptoms or diseases characterized by cell proliferation or a hyperactive cell population.
- chemotherapeutic agent may be an alkylating agent, an anti-metabolite, an anti-tumor antibiotic, an anti-cytoskeletal agent, a topoisomerase inhibitor, an anti-hormonal agent, a targeted therapeutic agent, a photodynamic therapeutic agent, or a combination thereof.
- the chemotherapeutic agent is selected from the group consisting of liposomal doxorubicin and nanoparticle albumin docetaxel.
- Non-limiting examples of suitable alkylating agents may include altretamine, benzodopa, busulfan, carboplatin, carboquone, carmustine (BCNU), chlorambucil, chlornaphazine, cholophosphamide, chlorozotocin, cisplatin,
- cyclosphosphamide dacarbazine (DTIC), estramustine, fotemustine, ifosfamide, improsulfan, lipoplatin, lomustine (CCNU), mafosfamide, mannosulfan,
- TEPA triethylenephosphoramide
- thiophosphaoramide thiotepa
- Suitable anti-metabolites may include, but are not limited to
- aminopterin ancitabine
- azacitidine 8-azaguanine
- 6-azauridine capecitabine
- carmofur 1 -hexylcarbomoyl-5-fluorouracil
- cladribine clofarabine
- cytarabine cytosine
- arabinoside (Ara-C)
- decitabine denopterin
- dideoxyuridine dideoxyuridine
- doxifluridine enocitabine
- floxuridine fludarabine, 5-fluorouracil, gemcitabine, hydroxyurea (hydroxycarbamide), leucovorin (folinic acid), 6-mercaptopurine, methotrexate, nafoxidine, nelarabine, oblimersen, pemetrexed, pteropterin, raltitrexed, tegofur, tiazofurin, thiamiprine, tioguanine (thioguanine), and trimetrexate.
- Non-limiting examples of suitable anti-tumor antibiotics may include aclacinomysin, aclarubicin, actinomycins, adriamycin, aurostatin (for example, monomethyl auristatin E), authramycin, azaserine, bleomycins, cactinomycin,
- calicheamicin carabicin, caminomycin, carzinophilin, chromomycins, dactinomycin, daunorubicin, detorubicin, 6-diazo-5-oxo-L-norleucine, doxorubicin, epirubicin, epoxomicin, esorubicin, idarubicin, marcellomycin, mitomycins, mithramycin,
- mycophenolic acid nogalamycin, olivomycins, peplomycin, plicamycin, potfiromycin, puromycin, quelamycin, rodorubicin, sparsomycin, streptonigrin, streptozocin,
- tubercidin tubercidin, valrubicin, ubenimex, zinostatin, and zorubicin.
- Non-limiting examples of suitable anti-cytoskeletal agents may include cabazitaxel, colchicines, demecolcine, docetaxel, epothilones, ixabepilone, macromycin, omacetaxine mepesuccinate, ortataxel, paditaxel (for example, DHA-paclitaxel), taxane, tesetaxel, vinblastine, vincristine, vindesine, and vinorelbine.
- Suitable topoisomerase inhibitors may include, but are not limited to, amsacrine, etoposide (VP-16), irinotecan, mitoxantrone, RFS 2000, teniposide, and topotecan.
- Non-limiting examples of suitable anti-hormonal agents may include aminoglutethimide, antiestrogen, aromatase inhibiting 4(5)-imidazoles, bicalutamide, finasteride, flutamide, fluvestrant, goserelin, 4-hydroxytamoxifen, keoxifene, leuprolide, LY1 17018, mitotane, nilutamide, onapristone, raloxifene, tamoxifen, toremifene, and trilostane.
- Examples of targeted therapeutic agents may include, without limit, monoclonal antibodies such as alemtuzumab, cartumaxomab, edrecolomab, epratuzumab, gemtuzumab, gemtuzumab ozogamicin, glembatumumab vedotin, ibritumomab tiuxetan, reditux, rituximab, tositumomab, and trastuzumab; protein kinase inhibitors such as bevacizumab, cetuximab, crizonib, dasatinib, erlotinib, gefitinib, imatinib, lapatinib, mubritinib, nilotinib, panitumumab, pazopanib, sorafenib, sunitinib, toceranib, and vandetanib.
- monoclonal antibodies such
- Non limiting examples of angiogeneisis inhibitors may include angiostatin, bevacizumab, denileukin diftitox, endostatin, everolimus, genistein, interferon alpha, interleukin-2, interleukin-12, pazopanib, pegaptanib, ranibizumab, rapamycin (sirolimus), temsirolimus, and thalidomide.
- Non limiting examples of growth inhibitory polypeptides may include bortazomib, erythropoietin, interleukins (e.g., IL-1 , IL-2, IL-3, IL-6), leukemia inhibitory factor, interferons, romidepsin, thrombopoietin, TNF-a, CD30 ligand, 4-1 BB ligand, and Apo-1 ligand.
- bortazomib erythropoietin
- interleukins e.g., IL-1 , IL-2, IL-3, IL-6
- leukemia inhibitory factor e.g., interferons, romidepsin, thrombopoietin, TNF-a, CD30 ligand, 4-1 BB ligand, and Apo-1 ligand.
- Non-limiting examples of photodynamic therapeutic agents may include aminolevulinic acid, methyl aminolevulinate, retinoids (alitretinon, tamibarotene, tretinoin), and temoporfin.
- antineoplastic agents may include anagrelide, arsenic trioxide, asparaginase, bexarotene, bropirimine, celecoxib, chemically linked Fab, efaproxiral, etoglucid, ferruginol, lonidamide, masoprocol, miltefosine, mitoguazone, talapanel, trabectedin, and vorinostat.
- chemotherapeutic agent can and will vary depending upon the agent and the type of tumor or neoplasm. A skilled practitioner will be able to determine the appropriate dose of the chemotherapeutic agent
- chemotherapeutic agent may comprise a virus or a viral genome such as an oncolytic virus.
- An oncolytic virus comprises a naturally occurring virus that is capable of killing a cell in the target tissue (for example, by lysis) when it enters such a cell.
- An antibody of the invention may be conjugated to a vehicle for cellular delivery.
- typically an antibody of the invention which may or may not be conjugated to a detectable label and/or therapeutic agent, is encapsulated in a suitable vehicle to either aid in the delivery of the compound to target cells, to increase the stability of the antibody, or to minimize potential toxicity of the antibody.
- a variety of vehicles are suitable for delivering an antibody of the present invention.
- suitable structured fluid delivery systems may include nanoparticles, liposomes, microemulsions, micelles, dendrimers and other phospholipid-containing systems.
- a liposome delivery vehicle may be utilized.
- Liposomes depending upon the embodiment, are suitable for delivery of the antibody of the invention in view of their structural and chemical properties.
- liposomes are spherical vesicles with a phospholipid bilayer membrane.
- the lipid bilayer of a liposome may fuse with other bilayers (e.g., the cell membrane), thus delivering the contents of the liposome to cells.
- the antibody of the invention may be selectively delivered to a cell by encapsulation in a liposome that fuses with the targeted cell's membrane.
- Liposomes may be comprised of a variety of different types of phosolipids having varying hydrocarbon chain lengths.
- Phospholipids generally comprise two fatty acids linked through glycerol phosphate to one of a variety of polar groups. Suitable phospholids include phosphatidic acid (PA), phosphatidylserine (PS), phosphatidyl inositol (PI), phosphatidylglycerol (PG), diphosphatidylglycerol (DPG), phosphatidylcholine (PC), and phosphatidylethanolamine (PE).
- PA phosphatidic acid
- PS phosphatidylserine
- PI phosphatidyl inositol
- PG phosphatidylglycerol
- DPG diphosphatidylglycerol
- PC phosphatidylcholine
- PE phosphatidylethanolamine
- the fatty acid chains comprising the phospholipids may range from about 6 to about 26 carbon atoms in length, and the lipid chains may be saturated or unsaturated.
- Suitable fatty acid chains include (common name presented in parentheses) n-dodecanoate (laurate), n- tretradecanoate (myristate), n-hexadecanoate (palmitate), n-octadecanoate (stearate), n-eicosanoate (arachidate), n-docosanoate (behenate), n-tetracosanoate (lignocerate), cis-9-hexadecenoate (palmitoleate), cis-9-octadecanoate (oleate), cis,cis-9,12- octadecandienoate (linoleate), all cis-9, 12, 15-octadecatrienoate (linolen
- the two fatty acid chains of a phospholipid may be identical or different.
- Acceptable phospholipids include dioleoyl PS, dioleoyl PC, distearoyl PS, distearoyl PC, dimyristoyl PS, dimyristoyl PC, dipalmitoyl PG, stearoyl, oleoyl PS, palmitoyl, linolenyl PS, and the like.
- the phospholipids may come from any natural source, and, as such, may comprise a mixture of phospholipids.
- egg yolk is rich in PC, PG, and PE
- soy beans contains PC, PE, PI, and PA
- animal brain or spinal cord is enriched in PS.
- Phospholipids may come from synthetic sources too. Mixtures of phospholipids having a varied ratio of individual phospholipids may be used. Mixtures of different phospholipids may result in liposome compositions having advantageous activity or stability of activity properties.
- phospholipids may be mixed, in optimal ratios with cationic lipids, such as N-(1 -(2,3-dioleolyoxy)propyl)-N,N,N-trimethyl ammonium chloride, 1 ,1 '-dioctadecyl-3,3,3',3'-tetramethylindocarbocyanine
- Liposomes may optionally comprise sphingolipids, in which spingosine is the structural counterpart of glycerol and one of the one fatty acids of a
- phosphoglyceride or cholesterol, a major component of animal cell membranes.
- Liposomes may optionally, contain pegylated lipids, which are lipids covalently linked to polymers of polyethylene glycol (PEG). PEGs may range in size from about 500 to about 10,000 daltons.
- Liposomes may further comprise a suitable solvent.
- the solvent may be an organic solvent or an inorganic solvent.
- Suitable solvents include, but are not limited to, dimethylsulfoxide (DMSO), methyl pyrrol idone, N-methylpyrrolidone, acetronitrile, alcohols, dimethylformamide, tetrahydrofuran, or combinations thereof.
- Liposomes carrying the antibody of the invention may be prepared by any known method of preparing liposomes for drug delivery, such as, for example, detailed in U.S. Pat. Nos. 4,241 ,046, 4,394,448, 4,529,561 , 4,755,388, 4,828,837, 4,925,661 , 4,954,345, 4,957,735,
- liposomes may be prepared by sonicating lipids in an aqueous solution, solvent injection, lipid hydration, reverse evaporation, or freeze drying by repeated freezing and thawing.
- the liposomes are formed by sonication.
- the liposomes may be
- multilamellar which have many layers like an onion, or unilamellar.
- the liposomes may be large or small. Continued high-shear sonication tends to form smaller unilamellar lipsomes.
- liposome formation may be varied. These parameters include, but are not limited to, temperature, pH, concentration of methionine compound, concentration and composition of lipid, concentration of multivalent cations, rate of mixing, presence of and concentration of solvent.
- an antibody of the invention may be delivered to a cell as a microemulsion.
- Microemulsions are generally clear, thermodynamically stable solutions comprising an aqueous solution, a surfactant, and "oil.”
- the "oil” in this case, is the supercritical fluid phase.
- the surfactant rests at the oil-water interface. Any of a variety of surfactants are suitable for use in microemulsion formulations including those described herein or otherwise known in the art.
- the aqueous microdomains suitable for use in the invention generally will have characteristic structural dimensions from about 5 nm to about 100 nm. Aggregates of this size are poor scatterers of visible light and hence, these solutions are optically clear.
- microemulsions can and will have a multitude of different microscopic structures including sphere, rod, or disc shaped aggregates.
- the structure may be micelles, which are the simplest microemulsion structures that are generally spherical or cylindrical objects. Micelles are like drops of oil in water, and reverse micelles are like drops of water in oil.
- the microemulsion structure is the lamellae. It comprises consecutive layers of water and oil separated by layers of surfactant.
- the "oil" of microemulsions optimally comprises phospholipids. Any of the phospholipids detailed above for liposomes are suitable for embodiments directed to microemulsions.
- the antibody of the invention may be encapsulated in a
- microemulsion by any method generally known in the art.
- an antibody of the invention may be delivered in a dendritic macromolecule, or a dendrimer.
- a dendritic macromolecule or a dendrimer.
- dendrimer is a branched tree-like molecule, in which each branch is an interlinked chain of molecules that divides into two new branches (molecules) after a certain length. This branching continues until the branches (molecules) become so densely packed that the canopy forms a globe.
- properties of dendrimers are determined by the functional goups at their surface. For example, hydrophilic end groups, such as carboxyl groups, would typically make a water-soluble dendrimer.
- phospholipids may be incorporated in the surface of an dendrimer to facilitate absorption across the skin. Any of the phospholipids detailed for use in liposome embodiments are suitable for use in dendrimer embodiments.
- dendrimers may be produced by an iterative sequence of reaction steps, in which each additional iteration leads to a higher order dendrimer. Consequently, they have a regular, highly branched 3D structure, with nearly uniform size and shape.
- the final size of a dendrimer is typically controlled by the number of iterative steps used during synthesis.
- a variety of dendrimer sizes are suitable for use in the invention.
- the size of dend mers may range from about 1 nm to about 100 nm.
- the present invention provides anti-14-3-3 epsilon antibodies to detect to 14-3-3 epsilon in vitro and/or in vivo.
- anti-14-3-3 epsilon antibodies may be used to detect and measure the amount of 14-3-3 epsilon in a biological sample.
- anti-14-3-3 epsilon antibodies may be used to detect and measure the amount of 14-3-3 epsilon in a subject.
- the present invention provides anti-14-3-3 epsilon antibodies that can be used to provide tumor specific delivery, for instance, of drugs, therapeutic agents or imaging agents as well as enhancing the efficacy of radiotherapy.
- the present invention provides anti-14-3-3 epsilon antibodies that can be used to detect a tumor in a subject.
- the invention provides means to detect 14-3-3 epsilon in a sample.
- the invention provides means to measure the amount of 14-3-3 epsilon in a sample.
- the method generally comprises (i) obtaining a sample from, and (ii) detecting and/or measuring the amount of 14-3-3 epsilon in the sample using an antibody that specifically binds 14-3-3 epsilon. Suitable antibodies are described above in Section I.
- the sample may be obtained from a subject (i.e.
- biological sample or may be an immortalized cell line.
- biological sample refers to a sample obtained from a subject. Any biological sample containing 14-3-3 epsilon is suitable. Numerous types of biological samples are known in the art. Suitable biological sample may include, but are not limited to, tissue samples or bodily fluids. In some
- the sample may be a bodily fluid comprising a cell expressing 14-3-3 epsilon on the cell surface.
- suitable bodily fluids include blood, plasma, serum, lung aspirate, pleural fluid, and sputum.
- the fluid may be used "as is", the cellular components may be isolated from the fluid, or a protein fraction may be isolated from the fluid using standard techniques.
- the biological sample is a tissue sample such as a tissue biopsy.
- the tissue biopsy may be a biopsy of tumor.
- the biopsied tissue may be fixed, embedded in paraffin or plastic, and sectioned, or the biopsied tissue may be frozen and cryosectioned.
- the biopsied tissue may be processed into individual cells or an explant, or processed into a homogenate, a cell extract, a membranous fraction, or a protein extract.
- the sample may also be primary and/or transformed cell cultures derived from tissue from the subject.
- Suitable subjects include, but are not limited to, a human, a livestock animal, a companion animal, a lab animal, and a zoological animal.
- a subject may or may not be known to have a tumor comprising a cell expressing 14-3-3 epsilon on the cell surface.
- the subject may be a rodent, e.g. a mouse, a rat, a guinea pig, etc.
- the subject may be a livestock animal.
- suitable livestock animals may include pigs, cows, horses, goats, sheep, llamas and alpacas.
- the subject may be a companion animal.
- Non-limiting examples of companion animals may include pets such as dogs, cats, rabbits, and birds.
- the subject may be a zoological animal.
- a "zoological animal" refers to an animal that may be found in a zoo. Such animals may include non-human primates, large cats, wolves, and bears.
- the animal is a laboratory animal.
- Non-limiting examples of a laboratory animal may include rodents, canines, felines, and non-human primates.
- the subject is a human.
- the method of collecting a biological sample can and will vary depending upon the nature of the biological sample and the type of analysis to be performed. Any of a variety of methods generally known in the art may be utilized to collect a biological sample. Generally speaking, the method preferably maintains the integrity of the sample such that 14-3-3 epsilon can be accurately detected and the amount measured according to the invention. [0090] Once a sample is obtained, it is processed in vitro to detect and measure the amount of 14-3-3 epsilon using an anti-14-3-3 epsilon antibody. All suitable methods for detecting and measuring an amount of protein using an antibody known to one of skill in the art are contemplated within the scope of the invention.
- antibody-based methods Methods for detecting and measuring an amount of protein using an antibody (i.e. "antibody-based methods") are well known in the art.
- Non-limiting examples include an ELISA, a sandwich immunoassay, a radioimmunoassay, an immunoblot or Western blot, flow cytometry, immunohistochemistry, and an array.
- an antibody-based method of detecting and measuring an amount of 14-3-3 epsilon comprises contacting some of the sample, or all of the sample, comprising 14-3-3 epsilon with an anti-14-3-3 epsilon antibody under conditions effective to allow for formation of a complex between the antibody and the 14-3-3 epsilon protein.
- the entire sample is not needed, allowing one skilled in the art to repeatedly detect and measure the amount of 14-3-3 epsilon in the sample.
- the method may occur in solution, or the antibody or 14-3-3 epsilon protein comprising the sample may be immobilized on a solid surface.
- Non-limiting examples of suitable surfaces may include microtitre plates, test tubes, slides, beads, resins, and other polymers. Attachment to the substrate may occur in a wide variety of ways, as will be appreciated by those in the art.
- the substrate and the antibody may be derivatized with chemical functional groups for subsequent attachment of the two.
- the substrate may be derivatized with a chemical functional group including, but not limited to, amino groups, carboxyl groups, oxo groups or thiol groups. Using these functional groups, the antibody may be attached directly using the functional groups or indirectly using linkers.
- An anti-14-3-3 epsilon antibody may also be attached to the substrate non-covalently.
- a biotinylated anti-14-3-3 epsilon antibody may be prepared, which may bind to surfaces covalently coated with streptavidin, resulting in attachment.
- an antibody may be synthesized on the surface using techniques such as photopolymerization and photolithography.
- Non-limiting examples of suitable labels include luminescent molecules, chemiluminescent molecules, fluorochromes, fluorescent quenching agents, colored molecules, radioisotopes, scintillants, biotin, avidin, stretpavidin, protein A, protein G, antibodies or fragments thereof, polyhistidine, Ni 2+ , Flag tags, myc tags, heavy metals, and enzymes (including alkaline phosphatase, peroxidase, glucose oxidase, and luciferase). Methods of detecting and measuring an amount of an antibody-polypeptide complex based on the detection of a label or marker are well known in the art.
- an antibody-based method is an immunoassay.
- Immunoassays can be run in a number of different formats. Generally speaking, immunoassays can be divided into two categories- competitive immunoassays and noncompetitive immunoassays.
- a competitive immunoassay an unlabeled analyte in a sample competes with labeled analyte to bind an antibody. Unbound analyte is washed away and the bound analyte is measured.
- the antibody is labeled, not the analyte.
- Non-competitive immunoassays may use one antibody (e.g. the capture antibody is labeled) or more than one antibody (e.g. at least one capture antibody which is unlabeled and at least one "capping" or detection antibody which is labeled.) Suitable labels are described above.
- an antibody-based method is an immunoblot or Western blot. In yet other embodiments, an antibody-based method is flow cytometry.
- an antibody-based method is provided.
- IHC immunohistochemistry
- an antibody-based method is an array.
- An array comprises at least one address, wherein at least one address of the array has disposed thereon an anti-14-3-3 epsilon antibody.
- Arrays may comprise from about 1 to about several hundred thousand addresses.
- substrates suitable for the construction of arrays are known in the art, and one skilled in the art will appreciate that other substrates may become available as the art progresses. Suitable substrates are also described above.
- the array comprises at least one an anti- 14-3-3 epsilon antibody attached to the substrate is located at one or more spatially defined addresses of the array.
- an array may comprise at least one, at least two, at least three, at least four, or at least five anti-14-3-3 epsilon antibodies, each antibody recognizing the same or different epitope 14-3-3 epsilon epitope, and each antibody may be may be at one, two, three, four, five, six, seven, eight, nine, ten or more spatially defined addresses.
- the present invention proves a method of delivering a therapeutic agent to a cell expressing 14-3-3 epsilon.
- an antibody of the present invention as described in Section I, may be used in treating, stabilizing and preventing cancer and associated diseases in a subject.
- treating, stabilizing, or preventing cancer is meant causing a reduction in the size of a tumor or in the number of cancer cells, slowing or preventing an increase in the size of a tumor or cancer cell proliferation, increasing the disease-free survival time between the disappearance of a tumor or other cancer and its reappearance, preventing an initial or subsequent occurrence of a tumor or other cancer, or reducing an adverse symptom associated with a tumor or other cancer.
- an antibody of the invention activates phagocytosis of cells bound by the antibody thereby reducing the amount of cancer cells expressing 14-3-3 epsilon.
- the percent of tumor or cancerous cells surviving the treatment is at least 20, 40, 60, 80, or 100% lower than the initial number of tumor or cancerous cells, as measured using any standard assay (e.g., caspase assays, TUNEL and DNA fragmentation assays, cell permeability assays, and Annexin V assays).
- the decrease in the number of tumor or cancerous cells induced by administration of an antibody of the invention is at least 2, 5, 10, 20, or 50-fold greater than the decrease in the number of non-tumor or noncancerous cells.
- the methods of the present invention result in a decrease of 20, 40, 60, 80, or 100% in the size of a tumor or in the number of cancerous cells, as determined using standard methods.
- at least 20, 40, 60, 80, 90, or 95% of the treated subjects have a complete remission in which all evidence of the tumor or cancer disappears.
- the tumor or cancer does not reappear or reappears after at least 5, 10, 15, or 20 years.
- An antibody of the present invention may be indirectly or directly coupled to radionuclides or chemotherapeutic agents as described above in order to provide specific delivery of radiation and chemotherapy to the site of a tumor. Further, the composition of the present invention may be part of a combination therapy.
- a combination therapy would include the use of the antibody of the present invention along with a radiation therapy or chemotherapy course of treatment. It has also been suggested that antibody compositions, such as those described herein, may increase the susceptibility of tumor cells to the effects of chemotherapy or radiation. In preferred embodiments, the composition of the invention may be used to enhance the efficacy of cancer radiotherapy.
- the present invention provides a method of detecting a tumor in a subject.
- the method comprises exposing a target area of the subject where the presence of a tumor is suspected to ionizing radiation, administering to the subject a composition to detect the presence of 14-3-3 epsilon in the target area, wherein the composition comprises one or more targeting antibodies, wherein each targeting antibody specifically binds to 14-3-3 epsilon exposed on an irradiated cell and is conjugated to a detectable label, and detecting the detectable label to detect the presence of 14-3-3 epsilon, wherein the presence of 14-3-3 epsilon indicates the presence of a tumor in the target area of the subject.
- the method may be used to diagnose or image a cancer in a subject.
- a method for detecting a tumor can comprise (a) exposing a suspected tumor to ionizing radiation; (b) biopsing a suspected tumor; (c) contacting an antibody of the invention with the suspected tumor in vitro; and (d) detecting the detectable label, whereby a tumor is diagnosed.
- Binding may be detected using microscopy (fluorescent microscopy, confocal microscopy, or electron microscopy), magnetic resonance imaging (including MTI, MRS, DWI and fMRI), scintigraphic imaging (SPECT (Single Photon Emission Computed Tomography), PET (Positron Emission Tomography), gamma camera imaging, and rectilinear scanning), radiography, or ultrasound.
- the detectable label may be detectable in situ, in vivo, ex vivo, and in vitro.
- An antibody of the invention may be used to treat or recognize a tumor derived from a neoplasm or a cancer.
- the neoplasm may be malignant or benign, the cancer may be primary or metastatic; the neoplasm or cancer may be early stage or late stage.
- Non-limiting examples of neoplasms or cancers that may be treated include acute lymphoblastic leukemia, acute myeloid leukemia, adrenocortical carcinoma, AIDS-related cancers, AIDS-related lymphoma, anal cancer, appendix cancer, astrocytomas (childhood cerebellar or cerebral), basal cell carcinoma, bile duct cancer, bladder cancer, bone cancer, brainstem glioma, brain tumors (cerebellar astrocytoma, cerebral astrocytoma/malignant glioma, ependymoma, medulloblastoma, supratentorial primitive neuroectodermal tumors, visual pathway and hypothalamic gliomas), breast cancer, bronchial adenomas/carcinoids, Burkitt lymphoma, carcinoid tumors (childhood, gastrointestinal), carcinoma of unknown primary, central nervous system lymphoma (primary), cerebellar astrocytoma, cerebral
- myelogenous, hairy cell), lip and oral cavity cancer liver cancer (primary), lung cancers (non-small cell, small cell), lymphomas (AIDS-related, Burkitt, cutaneous T-cell,
- Hodgkin non-Hodgkin, primary central nervous system
- macroglobulinemia macroglobulinemia
- myeloma/plasma cell neoplasm mycosis fungoides, myelodysplastic syndromes, myelodysplastic/myeloproliferative diseases, myelogenous leukemia (chronic), myeloid leukemias (adult acute, childhood acute), multiple myeloma, myeloproliferative disorders (chronic), nasal cavity and paranasal sinus cancer, nasopharyngeal carcinoma, neuroblastoma, non-Hodgkin lymphoma, non-small cell lung cancer, oral cancer, oropharyngeal cancer, osteosarcoma/malignant fibrous histiocytoma of bone, ovarian cancer, ovarian epithelial cancer (surface epithelial-stromal tumor), ovarian germ cell tumor, ovarian low malignant potential tumor, pancreatic cancer, pancreatic cancer (islet cell), paranasal sinus and nasal cavity cancer, parathyroid cancer, penile cancer, pharyngeal cancer,
- rhabdomyosarcoma childhood
- salivary gland cancer salivary gland cancer
- sarcoma Ewing family of tumors, Kaposi, soft tissue, uterine
- Sezary syndrome skin cancers (nonmelanoma, melanoma), skin carcinoma (Merkel cell), small cell lung cancer, small intestine cancer, soft tissue sarcoma, squamous cell carcinoma, squamous neck cancer with occult primary (metastatic), stomach cancer, supratentorial primitive neuroectodermal tumor (childhood), T-Cell lymphoma (cutaneous), testicular cancer, throat cancer, thymoma (childhood), thymoma and thymic carcinoma, thyroid cancer, thyroid cancer (childhood), transitional cell cancer of the renal pelvis and ureter, trophoblastic tumor (gestational), enknown primary site (adult, childhood), ureter and renal pelvis transitional cell cancer, urethral cancer, uterine cancer (endometrial
- the neoplasm or cancer is non-small cell lung carcinoma.
- Suitable therapeutic agents for neoplasms and cancers are known in the art, and will depend upon the type and stage of cancer. Suitable therapeutic agents are described in Section I. Summaries of cancer drugs, including information regarding approved indications, may be found via the National Cancer Institute at the National Insitutes of Health (www.cancer.gov/cancertopics/druginfo/alphalist) and the FDA Approved Drug Product database (www.accessdata.fda.gov/scripts/cder/drugsatfda/). In a specific embodiment, the cancer is non-small cell lung carcinoma. Suitable
- therapeutics agents for the treatment of non-small cell lung carcinoma include, but are not limited to, EGFR inihbitors, VEGF inhibitors, tyrosine kinase inhibitors, and chemotherapeutics.
- drugs approved for the treatment of NSCLC include methotrexate, Abraxane, Afatinib, Alimta, Avastin, Bevacizumab, Carboplatin, Cisplatin, Crizotinib, Erlotinib hydrochloride, Folex, Folex PFS, gefitinib, Gilotrif, Gemcitabine hydrochloride, Gemzar, Iressa, Methotrexate, Mexate, Mexate-AQ, Paclitaxel, Paclitaxel-albumin stabilized nanoparticle formulation, Paraplat, Paraplatin, Platinol, Tarceva, Taxol, and Xalkori.
- the method comprises exposing a target area of a subject where the presence of a tumor is suspected to ionizing radiation.
- Low doses of radiation can be used for selective targeting using the antibody compositions disclosed herein.
- the dose of radiation comprises up to about 2 Gy ionizing radiation. Higher radiation doses can also be used, especially in the case of local radiation treatment as described hereinbelow.
- Radiation can be localized to a tumor using conformal irradiation, brachytherapy, or stereotactic irradiation.
- the threshold dose for inductive changes can thereby be exceeded in the target tissue but avoided in surrounding normal tissues.
- a "target tissue” as used herein refers to an intended site for accumulation of an antibody following administration to a subject.
- the methods disclosed herein can employ a target tissue comprising an irradiated tumor.
- a "control tissue” as used herein refers to a site suspected to substantially lack binding and/or accumulation of an administered antibody.
- a non-irradiated tumor and a non-cancerous tissue are control tissues.
- doses of at least about 2 Gy ionizing radiation can be used, and in some embodiments a dose of about 10 Gy to about 20 Gy ionizing radiation can be used.
- local irradiation enables differential drug administration and/or dose at each of the two or more tumors.
- whole body irradiation can be used, as permitted by the low doses of radiation required for targeting of antibodies disclosed herein. Radiotherapy methods suitable for use in the practice of the presently disclosed subject matter can be found in Leibel & Phillips, 1998, among other sources.
- the radiation treatment comprises administration of less than about 2 Gy ionizing radiation.
- the radiation treatment comprises at least about 2 Gy ionizing radiation, in some embodiments about 2 Gy to about 3 Gy ionizing radiation, and in some embodiments about 2 Gy to about 6 Gy ionizing radiation.
- radiation treatment comprises about 10 Gy to about 20 Gy ionizing radiation.
- Administration of a composition to a subject can be performed by irradiating the tumor prior to, concurrent with, or subsequent to administration of a composition of the invention. Accordingly, the tumor is irradiated in some embodiments 0 hours to about 24 hours before administration of the composition, and in some embodiments about 4 hours to about 24 hours before administration of the composition.
- a pharmacologically effective amount of an antibody of the invention may be administered to a subject.
- Administration is performed using standard effective techniques, including peripherally (i.e. not by administration into the central nervous system) or locally to the central nervous system.
- Peripheral administration includes but is not limited to intravenous, intraperitoneal, subcutaneous, pulmonary, transdermal, intramuscular, intranasal, buccal, sublingual, or suppository administration.
- Local administration, including directly into the central nervous system (CNS) includes but is not limited to via a lumbar, intraventricular or intraparenchymal catheter or using a surgically implanted controlled release formulation.
- compositions for effective administration are:
- Such surfactants are often derived from steroids or are cationic lipids, such as N-[1 -(2,3- dioleoyl)propyl]-N,N,N-trimethyl ammonium chloride (DOTMA) or various compounds such as cholesterol hemisuccinate, phosphatidyl glycerols and the like.
- DOTMA cationic lipids
- the concentration of antibody in formulations to be administered is an effective amount and ranges from as low as about 0.1 % by weight to as much as about 15 or about 20% by weight and will be selected primarily based on fluid volumes, viscosities, and so forth, in accordance with the particular mode of administration selected if desired.
- a typical composition for injection to a living patient could be made up to contain 1 mL sterile buffered water of phosphate buffered saline and about 1 -1000 mg of any one of or a combination of the humanized antibody of the present discovery.
- the antibody composition may have 100-300 mg of antibody per administration.
- the formulation could be sterile filtered after making the formulation, or otherwise made microbiologically acceptable.
- a typical composition for intravenous infusion could have volumes between 1 -250 mL of fluid, such as sterile Ringer's solution, and 1 -100 mg per ml, or more in anti-14-3-3 episilon antibody concentration.
- Therapeutic agents of the discovery can be frozen or lyophilized for storage and reconstituted in a suitable sterile carrier prior to use. Lyophilization and reconstitution may lead to varying degrees of antibody activity loss (e.g. with conventional immune globulins, IgM antibodies tend to have greater activity loss than IgG antibodies).
- the pH of the formulations generally pharmaceutical grade quality, will be selected to balance antibody stability (chemical and physical) and comfort to the patient when administered. Generally, a pH between 4 and 8 is tolerated. Doses will vary from individual to individual based on size, weight, and other physiobiological characteristics of the individual receiving the successful administration.
- a therapeutically effective amount of a composition of the invention is administered to a subject.
- a "therapeutically effective amount” is an amount of the therapeutic composition sufficient to produce a measurable biological tumor response (e.g., an immunostimulatory, an anti-angiogenic response, a cytotoxic response, or tumor regression).
- a measurable biological tumor response e.g., an immunostimulatory, an anti-angiogenic response, a cytotoxic response, or tumor regression.
- Actual dosage levels of active ingredients in a therapeutic composition of the invention can be varied so as to administer an amount of the active compound(s) that is effective to achieve the desired therapeutic response for a particular subject. The selected dosage level will depend upon a variety of factors including the activity of the therapeutic composition, formulation, the route of
- a minimal dose is administered, and dose is escalated in the absence of dose-limiting toxicity. Determination and adjustment of a therapeutically effective dose, as well as evaluation of when and how to make such adjustments, are known to those of ordinary skill in the art of medicine.
- a typical dose contains from about 0.01 mg/kg to about 100 mg/kg of an anti-14-3-3 epsilon antibody described herein. Doses can range from about 0.05 mg/kg to about 50 mg/kg, more preferably from about 0.1 mg/kg to about 25 mg/kg.
- a detectable amount of a composition of the invention is administered to a subject.
- a detectable amount will vary according to a variety of factors, including but not limited to chemical features of the drug being labeled, the detectable label, labeling methods, the method of imaging and parameters related thereto, metabolism of the labeled drug in the subject, the stability of the label (e.g.
- a detectable amount can vary and can be tailored to a particular application. After study of the present disclosure, and in particular the Examples, it is within the skill of one in the art to determine such a detectable amount.
- the frequency of dosing may be daily or once, twice, three times or more per week or per month, as needed as to effectively treat the symptoms.
- the timing of administration of the treatment relative to the disease itself and duration of treatment will be determined by the circumstances surrounding the case.
- Treatment could begin immediately, such as at the site of the injury as administered by emergency medical personnel. Treatment could begin in a hospital or clinic itself, or at a later time after discharge from the hospital or after being seen in an outpatient clinic. Duration of treatment could range from a single dose administered on a one-time basis to a life-long course of therapeutic treatments.
- Typical dosage levels can be determined and optimized using standard clinical techniques and will be dependent on the mode of administration.
- kits for use in diagnostic or therapeutic embodiments of the invention.
- the kit includes an antibody of the invention, and a detectable label, therapeutic agent, chelating agent, and/or a linker, as described in
- each component of the kit is separately packaged in the kit.
- the kit includes a predetermined amount of the antibody and the detectable label, therapeutic agent, chelating agent, and/or linker (e.g., an amount sufficient for diagnosing or treating cancer in a subject).
- the antibody and the detectable label, therapeutic agent, chelating agent, and/or linker can be lyophilized to enable long-term storage.
- the antibody and detectable label, therapeutic agent, chelating agent, and/or linker may be sealed in a sterilized container.
- the kit preferably includes instructions for using the kit and its contents.
- Irradiation of cancer elicits a stress response with transport of stored proteins to the surface of cancer cells. These inducible surface proteins can be
- McAb monoclonal antibodies
- OGy or 3Gy x 3 irradiated H23; H460 and H520 cells were used as antigen for subtractive immunization.
- Cyclophosphamide was used as an immuno- suppressing reagent.
- the mice with high immune response to irradiated cancer cells were chosen for cell fusion.
- the hybridomas were screened using both cells by FMAT and Dot-blot assays.
- the McAb was used to detect the induced antigen on OGy and 3Gy treated H23 cells by immunohistochemistry (IHC) and immunofluorescence (IF). ADCP and ELISPOT assays were applied to monitor antibody activation of the immune response. Cancer cells were pre-reacted with McAb labeled with a red dye then co- culture with mouse dendritic cells (MDC). The cells were then fixed and stained with DAPI. Stained cells were counted in 50 microscopic fields. Co-culture of antibody coated tumor cells and MDC were primary injected to C57BL/6J mice in groups and boosted. Specific numbers of lymphocytes from spleens were added to the wells that were coated with anti mouse INF- ⁇ .
- IHC immunohistochemistry
- IF immunofluorescence
- IFN- ⁇ was detected by ELISPOT.
- the mouse model Human lung cancer, H23 was used to study cancer specific binding by McAbs. Normal mouse IgG was used as a control antibody. Affinity purified antigen from H23 cells was detected and the antigen was analyzed by proteomics.
- Antibody 7D4 showed high specificity and affinity to irradiated H23 cells.
- the intensity of binding on tumor cells increased in response to irradiation while OGy or control antibody on irradiated H23 was negative on IHC and IF assays.
- ADCP and ELISPOT indicated that the antibody binds to irradiated H23 cells co-cultured with activated MDC, the phagocytic events increased with increasing irradiation dosage while OGy or control antibody was absent. Moreover, the INF- ⁇ levels on ELISPOT increased with the irradiation dosages and highest level at 3Gy x 3 group. This indicated that immune responses can be triggered by the antibody through ADCP and increasing of IFN-gamma from lymphocytes.
- a McAb against IR induced antigen on H23 by subtractive immunization was produced and it selectively binds to the cells with increased intensity on treated H23 cells.
- Immune response to opsonized tumor cells includes ADCP and IFN-gamma induction in T-lymphocytes 14-3-3 epsilon is a radiation-inducible
- the human 14-3-3 epsilon epitope and human 14-3-3 epsilon isoform SV epitope recognized by antibody 7D4 was determined by epitope mapping using peptides from whole human 14-3-3 protein epsilon sequence (Sigma Aldrich). These peptides span the full length of human 14-3-3 epsilon isoform 1 and 14-3-3 epsilon isoform SV. Each peptide contains 18 amino acids from N-terminal to C-terminal. Two amino acids overlap in each peptide, for a total of 31 peptides.
- the epitope mapping experiments showed that the monoclonal antibody reacted with high absorbance (strong binding) to a peptide comprising amino acids 177-194 of 14-3-3 epsilon isoform 1 (FIG. 1), and with light to medium absorbance (moderate binding) to a peptide comprising amino acids 145-162 of 14-3-3 epsilon SV (FIG. 2).
- H23 human lung cancer cells were irradiated with 3Gyx3. Cells were treated with 4% paraformaldehyde and rehydrated. Cells were then treated with blocking buffer followed by the addition of the 7D4 mouse monoclonal antibody to 14-3- 3 epsilon. Cells were then washed and incubated with the secondary antibody conjugated to HRP. Cells were then stained with DAB and counterstained with
- FIG. 3 Shown in FIG. 3 is the immunocytochemistry of 7D4 antibody binding to human lung cancer cell H23 following irradiation. These data show that the 7D4 mouse monoclonal antibody binds to lung cancer cells following treatment with radiation with minimal binding to cells that were not treated with radiation (lower panel). A commercial antibody to 14-3-3 was used as a positive control and shown in the center panels. This also showed that the anti-14-3-3 epsilon antibody binds following
- the negative control was secondary antibody that showed no increased binding to H23 cells without irradiation.
- FIG. 5 shows flow cytometry of antibody binding to human lung cancer cell model H23.
- H23 cells were treated with radiation, 3Gyx3. Cells were then treated with blocking buffer followed by the addition of the anti-14-3-3 epsilon antibody. Cells were then washed and stained with the secondary antibody conjugated to the
- FIG. 5 Shown in FIG. 5 is the percentage of cells staining positive with the anti-14-3-3 antibodies.
- Cells treated with 3Gyx3 showed a 20 fold increase in the percentage of cells staining positive with the 7D4 antibody following irradiation. In comparison, only 4% of cells showed positive staining with no irradiation.
- the commercial antibody showed less radiation induced binding as compared to the 7D4 monoclonal.
- FIG. 6 shows that the 7D4 antibody activates phagocytosis by dendritic cells and monocytic cells.
- H23 cells were treated with 3Gyx3 and incubated with the 7D4 monoclonal antibody to 14-3-3 epsilon.
- FIG. 6A-C shows that incubation with the antibody following irradiation activates phagocytosis of the antibody coated cancer cells.
- the isotype control shows no increase in phagocytosis.
- the number of dendritic cells that activate phagocytosis were then quantified by use of flow cytometry.
- FIG. 6D shows the quantification of phagocytosis.
- H23 cells were labeled with the fluorescent marker Dil.
- FIG. 6D shows that H23 cells treated with 3Gyx3 activated phagocytosis in 32 cells. In comparison, lower dose irradiation activated phagocytosis in 18 cells. Cells treated with no radiation activated phagocytosis in 14 cells. The negative control was the isotype control IgG which activated phagocytosis in 7 dendritic cells.
- FIG. 7 shows data of antigen presenting dendritic cells from FIG. 6 cocultured with T cells. Lung cancer antigen presentation to T cells by the activated dendritic cells from FIG. 6 was studied. In this experiment, dendritic cells from FIG. 6 were cocultured with CD4 and CD8 T lymphocytes.
- FIG. 6A-C shows the production of interferon-gamma in cells treated with dendritic cells. These ELISPOTs show that T cells treated with dendritic cells from irradiated H23 cancers coated with 7D4
- FIG. 7B shows the quantification of interferon production. The number of cells producing interferon-gamma were counted. Cells treated with 3Gyx3 followed by the 7D4 mouse monoclonal to 14-3-3 and the mouse dendritic cells showed the greatest number of T cell activation. In comparison, cells treated with radiation and antibody alone without dendritic cells showed a modest T cell activation. Likewise, cells treated with radiation and isotype control antibody showed modest T cell activation. Negative controls showed minimal T cell activation.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- General Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- Biomedical Technology (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Biochemistry (AREA)
- Cell Biology (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Epidemiology (AREA)
- Pathology (AREA)
- Urology & Nephrology (AREA)
- Hematology (AREA)
- Physics & Mathematics (AREA)
- Pharmacology & Pharmacy (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Radiology & Medical Imaging (AREA)
- Microbiology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- General Physics & Mathematics (AREA)
- Analytical Chemistry (AREA)
- Food Science & Technology (AREA)
- Biotechnology (AREA)
- Oncology (AREA)
- Optics & Photonics (AREA)
- Peptides Or Proteins (AREA)
Abstract
The present invention provides isolated antibodies that bind to 14-3-3 epsilon that are useful in the recognition of tumor cells and tumor specific delivery of drugs and therapies.
Description
MONOCLONAL ANTIBODIES TO HUMAN 14-3-3 EPSILON
AND HUMAN 14-3-3 EPSILON SV
GOVERNMENT SUPPORT
[0001 ] This invention was made with government support under 5R01 CA125757-06 awarded by the NIH. The government has certain rights in the invention.
CROSS REFERENCE TO RELATED APPLICATIONS
[0002] This application claims the priority of US provisional application number 61/871 ,1 15, filed August 28, 2013, and US provisional application number 61/907,677, filed November 22, 2013, each of which is hereby incorporated by reference in its entirety.
FIELD OF THE INVENTION
[0003] The invention encompasses antibodies useful in the recognition of tumor cells and tumor specific delivery of drugs and therapies.
BACKGROUND OF THE INVENTION
[0004] 14-3-3 proteins are a group of highly conserved proteins that are involved in many vital cellular processes such as metabolism, protein trafficking, signal transduction, apoptosis and cell cycle regulation. 14-3-3 proteins are phospho- serine/phospho-threonine binding proteins that have a diverse array of partners including transcription factors, biosynthetic enzymes, cytoskeletal proteins, signalling molecules, apoptosis factors and tumor suppressors. The 14-3-3 family consists of 7 isoforms; beta, gamma, epsilon, sigma, zeta, tau and eta. 14-3-3 proteins are ubiquitously expressed and self-assemble into homo- and heterodimers, with the exception of 14-3-3 sigma, which exclusively forms homodimers and is found in cells of epithelial origin only. Each monomer contains an independent ligand-binding site, thus the 14-3-3 dimer can interact with two target proteins simultaneously. 14-3-3 proteins are highly rigid structures and ligand binding can induce conformational changes that
alter the stability and/or catalytic activity of the ligand. Furthermore, 14-3-3 protein binding can physically occlude sequence-specific or structural motifs on the target that prevent molecular interactions and/or modulate the accessibility of a target protein to modifying enzymes such as kinases, phosphatases and proteases. In addition, 14-3-3 proteins can act as a scaffold molecule to anchor target proteins within close proximity of one another. 14-3-3 proteins represent an integration point for proliferative, survival, apoptotic and stress signalling pathways. Members of the 14-3-3 protein family enhance the activity of many proteins with proliferative and/or survival functions, such as Raf kinases, and antagonize the activity of proteins that promote cell death and
senescence, such as Bad, Bim and Bax. Because many 14-3-3 interactions are phosphorylation dependent, 14-3-3 proteins have been integrated into the core regulatory pathways that are crucial for normal growth and development. 14-3-3 proteins are directly involved in cellular processes such as cytokinesis, cell-contact inhibition, anchorage-independent growth and cell adhesion, and it is these pathways that often become dysregulated in disease states such as cancer.
[0005] Exposure of tumor cells to ionizing radiation (IR) is widely known to induce a number of cellular changes. One way that IR can affect tumor cells is through the development of neoantigens which are new molecules that tumor cells express at the cell membrane following some insult or change to the cell. There have been numerous reports in the literature of changes in both tumor and tumor vasculature cell surface molecule expression following treatment with IR. The usefulness of neoantigens for imaging and therapeutic applications lies in the fact that they are differentially expressed on the surface of irradiated tumor cells to a greater extent than on normal tissues. This differential expression provides a mechanism by which tumor cells can be "marked" by radiation for further targeting. Drug delivery vehicles or imaging agents conjugated to ligands that recognize and interact with the neoantigens can help to improve tumor-specific targeting and reduce systemic toxicity with cancer drugs.
SUMMARY OF THE INVENTION
[0006] In an aspect, the present invention encompasses cell line that expresses an antibody comprising an amino acid sequence selected from the group consisting of SEQ ID NO:3 and SEQ ID NO:4, wherein the antibody specifically binds 14-3-3 epsilon.
[0007] In another aspect, the present invention encompasses an isolated antibody that specifically binds 14-3-3 epsilon and comprises a light chain CDR3 comprising the amino acid sequence of SEQ ID NO:7 with zero to two amino acid substitutions.
[0008] In still another aspect, the present invention encompasses an isolated antibody that specifically binds 14-3-3 epsilon and comprises a heavy chain CDR3 comprising the amino acid sequence of SEQ ID NO:10 with zero to two amino acid substitutions.
[0009] In yet still another aspect, the present invention encompasses a method of detecting a tumor in a subject. The method comprises exposing a target area of the subject where the presence of a tumor is suspected to ionizing radiation;
administering to the subject a composition to detect the presence of 14-3-3 epsilon in the target area, wherein the composition comprises one or more targeting antibodies, wherein each targeting antibody specifically binds to 14-3-3 epsilon exposed on an irradiated cell and is conjugated to a detectable label; and detecting the detectable label to detect the presence of 14-3-3 epsilon, wherein the presence of 14-3-3 epsilon indicates the presence of a tumor in the target area of the subject.
[0010] In a different aspect, the present invention encompasses a method of enhancing radiotherapy in a subject. The method comprises administering a
pharmacologically effective amount of an isolated anti-14-3-3 epsilon antibody of claim 7 or claim 9 to the subject, such that radiotherapy is enhanced.
[001 1 ] In other aspects, the present invention encompasses a method of delivering a therapeutic agent to a cell expressing 14-3-3 epsilon in a subject. The method comprises exposing a target area of the subject where the presence of a tumor
is suspected to ionizing radiation; and administering an isolated anti-14-3-3 epsilon antibody of claim 7 or claim 9 to the subject.
[0012] In still other aspects, the present invention encompasses a method of detecting 14-3-3 epsilon in a sample. The method comprises obtaining a sample, and detecting and/or measuring the amount of 14-3-3 epsilon in the sample using an antibody of the invention.
BRIEF DESCRIPTION OF THE FIGURES
[0013] The application file contains at least one photograph executed in color. Copies of this patent application publication with color photographs will be provided by the Office upon request and payment of the necessary fee.
[0014] FIG. 1 shows the amino acid sequence of human 14-3-3 epsilon isoform 1 (SEQ ID NO:1 1 ). The underlined sequence identifies the binding epitope of antibody 7D4.
[0015] FIG. 2 shows the amino acid sequence of human 14-3-3 epsilon isoform SV (SEQ ID NO:12). The underlined sequence identifies the binding epitope of antibody 7D4.
[0016] FIG. 3 shows anti-14-3-3 epsilon antibody detecting protein on H23 (NSCLC) treated with 3Gyx3 and sham OGy. 7D4 antibody binds to irradiated H23 cells but not non-irradiated cells. The commercial antibody shows binding to non-irradiated cells.
[0017] FIG. 4 shows anti-14-3-3 epsilon antibody reacting with human normal tissues. (A) Colon, liver, lung, pancreas, (B) kidney and tongue tissue was evaluated. The 7D4 mouse monoclonal antibody to 14-3-3 epsilon showed no binding to colon, liver, pancreas, kidney or tongue. There was minimal binding to the lung.
[0018] FIG. 5 shows flow cytometry of antibody binding to human lung cancer cell model H23.
[0019] FIG. 6 shows that the 7D4 antibody activates phagocytosis by dendritic cells and monocytic cells. (A-C) Murine dendritic cells (mDCs) are attracted by 3Gyx3 irradiated H23 cells coated with McAb. (A) shows examples of phagocytic events
(accumulation of red signal within mDCs; extension of pseudopodia; adhesion of mDCs to H23 cells). (B) and (C) controls show minimal phagocytic events. (D) 50 random high-power fields were counted for tallying of phagocytic events.
[0020] FIG. 7 shows the ELISPOT IFN-γ level test in H23 cells. (A) shows the production of interferon-gamma in cells treated with dendritic cells. Group 1 : A,B,C, well 1 -6; Group 2: D,E,F, well 1 -6; Group 3: G,H, well 1 -6 & A 7-12; Group 4: B,C,D, well 7- 12; Group 5: E,F, well 7-12. (B) shows the quantification of interferon production. Group 1 : 3Gyx3 + 7D4 + mouse DC; Group 2: 3Gyx3 + 7D4 + 0; Group 3: 3Gyx3 + NMIgG + MDC; Group 4: OGy + 7D4 + MDC; Group 5: OGy + 0 + 0.
DETAILED DESCRIPTION
[0021 ] The present invention provides antibodies that specifically bind 14-3-3 epsilon. Advantageously, these antibodies specifically bind to epitopes exposed on irradiated tumor cells and not normal cells. The antibodies may be used to provide tumor specific delivery, for instance, of drugs or therapeutic agents, as well as enhancing the efficacy of radiotherapy.
[0022] As used herein, the term "14-3-3 epsilon" refers to human 14-3-3 epsilon and to orthologs from others species. Such orthologs are known in the art and include, but are not limited to the following NCBI Reference Sequences: XP_515815.4 (Pan troglodytes), NP_033562.3 (Mus musculus), NP_1 13791 .1 (Rattus norvegicus), NP_776916.1 (Bos taurus), XP_854358.1 (Canis familiaris), NP_001006219.1 (Gallus gallus), BC045025.1 (Xenopus laevis), ECU89595.1 (Xenopus tropicalis), BC045325.1 (Danio rerio), AY370883.1 (Oncorhynchus mykiss), AB037679.1 (Ciona intestinalis), NP_732309.1 (Drosophila melanogaster), XP_322009.2 (Anopheles gambiae),
NP_010384.1 (Saccharomyces cerevisiae) , NP_594167.1 (Schizosaccharomyces pombe), NP_564451 .2 (Arabidopsis thaliana), CF51 152.1 (Vitis vinifera), AJ276594.1 (Oryza sativa), Y14200.1 (Hordeum vulgare), AY1 10486.1 (Zea mays), and
AF548740.1 (Triticum aestivum). Further, the term "14-3-3 epsilon" encompasses all 14- 3-3 epsilon splice variants. For example, human 14-3-3 epsilon is encoded by the gene
YWHAE (Entrez Gene ID 7531 ). Alternative splicing produces two isoforms— isoform 1 (SEQ ID NO:1 1 ) and isoform SV (SEQ ID NO:12).
[0023] In an aspect, anti-14-3-3 epsilon antibodies of the invention may be used to detect 14-3-3 epsilon in vitro or in vivo. In another aspect, anti-14-3-3 epsilon antibodies useful herein also include antibodies that bind to specific regions of 14-3-3 epsilon, isoforms of 14-3-3 epsilon and to other forms of 14-3-3 epsilon. Specific regions of 14-3-3 epsilon include, but are not limited to, the C-terminal, the N-terminal, and other central domains. Isoforms of 14-3-3 epsilon include 14-3-3 epsilon isoform 1 (SEQ ID NO:1 1 ) and 14-3-3 epsilon isoform SV (SEQ ID NO:12), as well as splice variants from other species. Other forms of 14-3-3 epsilon include but are not limited to truncated, modified, soluble, insoluble, intracellular, extracellular, and dimerized or otherwise oligomerized forms, as well as 14-3-3 epsilon complexed with other proteins or molecules.
[0024] In another aspect, anti-14-3-3 epsilon antibodies useful herein include those which are isolated, characterized, purified, functional and have been recovered (obtained) from a process for their preparation and thus available for use herein in a useful form in an amount sufficient for conjugation to a drug, drug delivery vehicles or imaging agent.
[0025] In another aspect, antibodies useful herein include those antibodies which have been isolated, characterized, purified, are functional and have been recovered (obtained) from a process for their preparation and thus available for use herein in a useful form in an amount sufficient for an assay to detect and measure the amount of 14-3-3 epsilon in a biological sample.
[0026] In another aspect, anti-14-3-3 epsilon antibodies useful herein include those which are isolated, characterized, purified, functional and have been recovered (obtained) from a process for their preparation and thus available for use herein in a useful form in a therapeutically and medicinally sufficient amount.
[0027] The antibodies and methods of their use are described in further detail below.
I. ANTI-14-3-3 EPSILON ANTIBODIES
[0028] In an aspect, anti-14-3-3 epsilon antibodies useful herein include all antibodies that specifically bind an epitope within 14-3-3 epsilon. Generally speaking, the epitope is detectable on the surface of a tumor cell following irradiation. The epitope may or may not be detectable on the cell surface in the absence of irradiation.
Alternatively, an epitope may be detectable on the surface of a tumor cell both in the absence of irradiation and following irradiation, though the detectable signal is greater following irradiation.
[0029] The term "antibody' includes the term "monoclonal antibody."
"Monoclonal antibody" refers to an antibody that is derived from a single copy or clone, including e.g., any eukaryotic, prokaryotic, or phage clone. "Monoclonal antibody" is not limited to antibodies produced through hybridoma technology. Monoclonal antibodies can be produced using e.g., hybridoma techniques well known in the art, as well as recombinant technologies, phage display technologies, synthetic technologies or combinations of such technologies and other technologies readily known in the art. Furthermore, the monoclonal antibody may be labeled with a detectable label, immobilized on a solid phase and/or conjugated with a heterologous compound (e.g., an enzyme or toxin) according to methods known in the art.
[0030] Further by "antibody" is meant a functional monoclonal antibody, or an immunologically effective fragment thereof; such as an Fab, Fab', or F(ab')2 fragment thereof. In some contexts herein, fragments will be mentioned specifically for emphasis; nevertheless, it will be understood that regardless of whether fragments are specified, the term "antibody" includes such fragments as well as single-chain forms. As long as the protein retains the ability specifically to bind its intended target, it is included within the term "antibody." Also included within the definition "antibody" for example are single chain forms, generally designated Fv, regions, of antibodies with this specificity.
Preferably, but not necessarily, the antibodies useful in the discovery are produced recombinantly, as manipulation of the typically murine or other non-human antibodies with the appropriate specificity is required in order to convert them to humanized form.
Antibodies may or may not be glycosylated, though glycosylated antibodies are preferred. Antibodies are properly cross-linked via disulfide bonds, as is known.
[0031 ] The basic antibody structural unit of an antibody useful herein comprises a tetramer. Each tetramer is composed of two identical pairs of polypeptide chains, each pair having one "light/ (about 25 kDa) and one "heavy" chain (about 50-70 kDa). The amino-terminal portion of each chain includes a variable region of about 100 to 1 10 or more amino acid sequences primarily responsible for antigen recognition. The carboxy-terminal portion of each chain defines a constant region primarily responsible for effector function.
[0032] Light chains are classified as gamma, mu, alpha, and lambda. Heavy chains are classified as gamma, mu, alpha, delta, or epsilon, and define the antibody's isotype as IgO, IgM, IgA, IgD and IgE, respectively. Within light and heavy chains, the variable and constant regions are joined by a "J" region of about 12 or more amino acid sequences, with the heavy chain also including a "D" region of about 10 more amino acid sequences.
[0033] The variable regions of each light/heavy chain pair form the antibody binding site. Thus, an intact antibody has two binding sites. The chains exhibit the same general structure of relatively conserved framework regions (FR) joined by three hypervariable regions, also called complementarity determining regions (hereinafter referred to as "CDRs.") The CDRs from the two chains are aligned by the framework regions, enabling binding to a specific epitope. From N-terminal to C-terminal, both light and heavy chains comprise the domains FR1 , CDR1 , FR2, CDR2, FR3, CDR3 and FR4 respectively. The assignment of amino acid sequences to each domain is in accordance with known conventions (See, Kabat "Sequences of Proteins of Immunological Interest" National Institutes of Health, Bethesda, Md., 1987 and 1991 ; Chothia, et al, J. Mol. Bio. (1987) 196:901 -917; Chothia, et al., Nature (1989) 342:878-883).
[0034] In an aspect, monoclonal anti-14-3-3 epsilon antibodies are generated with appropriate specificity by standard techniques of immunization of mammals, forming hybridomas from the antibody-producing cells of said mammals or otherwise immortalizing them, and culturing the hybridomas or immortalized cells to assess them
for the appropriate specificity. In the present case, such antibodies could be generated by immunizing a human, rabbit, rat or mouse, for example, with a peptide representing an epitope encompassing a region of the 14-3-3 epsilon protein coding sequence or an appropriate subregion thereof. Materials for recombinant manipulation can be obtained by retrieving the nucleotide sequences encoding the desired antibody from the hybridoma or other cell that produces it. These nucleotide sequences can then be manipulated and isolated, characterized, purified and, recovered to provide them in humanized form, for use herein if desired.
[0035] As used herein "humanized antibody" includes an anti-14-3-3 epsilon antibody that is composed partially or fully of amino acid sequence sequences derived from a human antibody germline by altering the sequence of an antibody having non- human complementarity determining regions ("CDR"). The simplest such alteration may consist simply of substituting the constant region of a human antibody for the murine constant region, thus resulting in a human/murine chimera which may have sufficiently low immunogenicity to be acceptable for pharmaceutical use. Preferably, however, the variable region of the antibody and even the CDR is also humanized by techniques that are by now well known in the art. The framework regions of the variable regions are substituted by the corresponding human framework regions leaving the non-human CDR substantially intact, or even replacing the CDR with sequences derived from a human genome. CDRs may also be randomly mutated such that binding activity and affinity for 14-3-3 epsilon is maintained or enhanced in the context of fully human germline framework regions or framework regions that are substantially human.
Substantially human frameworks have at least 90%, 95%, or 99% sequence identity with a known human framework sequence. Fully useful human antibodies are produced in genetically modified mice whose immune systems have been altered to correspond to human immune systems. As mentioned above, it is sufficient for use in the methods of this discovery, to employ an immunologically specific fragment of the antibody, including fragments representing single chain forms.
[0036] Further, as used herein the term "humanized antibody" refers to an anti-14-3-3 epsilon antibody comprising a human framework, at least one CDR from a
nonhuman antibody, and in which any constant region present is substantially identical to a human immunoglobulin constant region, i.e., at least about 85-90%, preferably at least 95% identical. Hence, all parts of a humanized antibody, except possibly the CDRs, are substantially identical to corresponding pairs of one or more native human immunoglobulin sequences.
[0037] If desired, the design of humanized immunoglobulins may be carried out as follows. When an amino acid sequence falls under the following category, the framework amino acid sequence of a human immunoglobulin to be used (acceptor immunoglobulin) is replaced by a framework amino acid sequence from a CDR- providing nonhuman immunoglobulin (donor immunoglobulin): (a) the amino acid sequence in the human framework region of the acceptor immunoglobulin is unusual for human immunoglobulin at that position, whereas the corresponding amino acid sequence in the donor immunoglobulin is typical for human immunoglobulin at that position; (b) the position of the amino acid sequence is immediately adjacent to one of the CDRs; or (c) any side chain atom of a framework amino acid sequence is within about 5-6 angstroms (center-to-center) of any atom of a CDR amino acid sequence in a three dimensional immunoglobulin model (Queen, et al., op. cit., and Co, ct al, Proc. Natl. Acad. Sci. USA (1991 ) 88:2869). When each of the amino acid sequences in the human framework region of the acceptor immunoglobulin and a corresponding amino acid sequence in the donor immunoglobulin is unusual for human immunoglobulin at that position, such an amino acid sequence is replaced by an amino acid sequence typical for human immunoglobulin at that position.
[0038] In all instances, an antibody of the invention specifically binds 14-3-3 epsilon. In exemplary embodiments, an antibody of the invention specifically binds to human 14-3-3 epsilon isoform 1 (SEQ ID NO:1 1 ), human 14-3-3 epsilon isoform SV (SEQ ID NO:12), or human 14-3-3 epsilon isoform 1 and human 14-3-3 epsilon isoform SV. The phrase "specifically binds" herein means antibodies bind to the protein with an affinity constant or Affinity of interaction (KD) in the range of at least 0.1 mM to 1 pM, or in the range of at least 0.1 pM to 10 nM, with a preferred range being 0.1 pM to 1 nM. The sequence of 14-3-3 epsilon from a variety of species is known in the art, and
methods of determining whether an antibody binds to 14-3-3 epsilon are known in the art.
[0039] The antibodies of the present invention may also be used as fusion proteins known as single chain variable fragments (scFv). These scFvs are comprised of the heavy and light chain variable regions connected by a linker. In most instances, but not all, the linker may be a peptide. A linker peptide is preferably from about 10 to 25 amino acids in length. Preferably, a linker peptide is rich in glycine, as well as serine or threonine. ScFvs can be used to facilitate phage display or can be used for flow cytometry, immunohistochemistry, or as targeting domains. Methods of making and using scFvs are known in the art.
[0040] In a preferred embodiment, the scFvs of the present invention are conjugated to a human constant domain. In some embodiments, the heavy constant domain is derived from an IgG domain, such as lgG1 , lgG2, lgG3, or lgG4. In other embodiments, the heavy chain constant domain may be derived from IgA, IgM, or IgE.
[0041 ] The antibodies of the present invention, including scFVs, may also be conjugated to a payload, such as a therapeutic agent, a detectable, and/or a delivery device (including, but not limited to, a liposome or a nanoparticle) containing the drug or detectable label. Methods of conjugating an antibody to a therapeutic agent, a detectable label, a liposome, a nanoparticle or other delivery device are known in the art. Generally speaking, the conjugation should not interfere with the antibody recognizing its target, and should not interfere with the active site of the target. In some instances, an antibody may be generated with a cleavable linkage between the antibody and the payload. Such a linker may allow release of the payload at a specific cellular location. Suitable linkers include, but are not limited to, amino acid chains and alkyl chains functionalized with reactive groups for conjugating to both the antibody of the invention and the detectable label and/or therapeutic agent. The therapeutic agent, detectable label, and delivery device are described in further detail below.
[0042] In an aspect, the present invention encompasses a cell line, the cell line expressing an antibody comprising an amino acid sequence selected from the group consisting of SEQ ID NO:3 and SEQ ID NO:4, wherein the antibody specifically
binds 14-3-3 epsilon. In another embodiment, the present invention encompasses a cell line, the cell line expressing an antibody encoded by a nucleic acid sequence
comprising a nucleic acid sequence selected from the group consisting of SEQ ID NO:1 and SEQ ID NO:2, wherein the antibody specifically binds 14-3-3 epsilon. In some embodiments, the cell line is an immortalized cell line. In preferred embodiments, the cell line is a hybridoma. Methods of generating hybridomas capable of producing antibodies are known in the art
[0043] A preferred antibody is a humanized form of mouse antibody derived from a hybridoma designated 7D4. As used herein, the term "derived from" means that the "derived" antibody comprises at least one CDR region from the antibody produced by 7D4. Stated another way, the "derived antibody" comprises at least one CDR region comprised of the amino acid sequence selected from the group consisting of SEQ ID NO:5, 6, 7, 8, 9, and 10.
[0044] In one embodiment, an antibody of the invention may be derived from the hybridoma 7D4, and may be encoded by a nucleic acid sequence comprising 90, 91 , 92, 93, 94, 95, 96, 97, 98, or 99% identity to the light chain variable region of SEQ ID NO:1 , or may be encoded by a nucleic acid sequence comprising 90, 91 , 92, 93, 94, 95, 96, 97, 98, or 99% identity to the heavy chain variable region of SEQ ID NO:2. In another embodiment, an antibody of the invention may be derived from the hybridoma 7D4, and may comprise an amino acid sequence with 90, 91 , 92, 93, 94, 95, 96, 97, 98, or 99% identity to the light chain variable region of SEQ ID NO:3, or may comprise an amino acid sequence with 90, 91 , 92, 93, 94, 95, 96, 97, 98, or 99% identity to the heavy chain variable region of SEQ ID NO:4. In each of the above embodiments, the antibody may be humanized.
[0045] In an exemplary embodiment of an antibody of the invention that binds to anti-14-3-3 epsilon, the antibody comprises the light chain nucleic acid sequence of SEQ ID NO:1 and the heavy chain nucleic acid sequence of SEQ ID NO:2 [i.e. the monoclonal antibody referred to herein as 7DR]. In another exemplary embodiment of an antibody of the invention that binds to anti-14-3-3 epsilon, the antibody comprises
the light chain amino acid sequence of SEQ ID NO:3 and the heavy chain amino acid sequence of SEQ ID NO:4 [i.e. the monoclonal antibody referred to herein as 7DR].
[0046] In one embodiment, an antibody of the invention may comprise a light chain CDR1 , such as antibody 1 of Table A. In another embodiment, an antibody of the invention may comprise a light chain CDR2, such as antibody 4 of Table A. In yet another embodiment, an antibody of the invention may comprise a light chain CDR3, such as antibody 6 of Table A. In an alternative embodiment, an antibody of the invention may comprise a combination of two or three light chain CDRs, such as the antibodies 2, 3 and 5 of Table A.
[0047] Similarly, in one embodiment, an antibody of the invention may comprise a heavy chain CDR1 , such as antibody 7 of Table A. In another embodiment, an antibody of the invention may comprise a heavy chain CDR2, such as antibody 10 of Table A. In yet another embodiment, an antibody of the invention may comprise a heavy chain CDR3, such as antibody 12 of Table A. In an alternative embodiment, an antibody of the invention may comprise a combination of two or three heavy chain CDRs, such as the antibodies 8, 9 and 1 1 of Table A.
[0048] Alternatively, an antibody of the invention may comprise one or more light chain CDRs and one or more heavy chain CDRs, such as the antibodies 13-48 of Table A.
TABLE A
SEQ ID NO:9 SEQ ID NO: 10
SEQ ID NO: 10
SEQ ID NO:5 SEQ ID NO:8
SEQ ID NO:5 SEQ ID NO:8 SEQ ID NO:9
SEQ ID NO:5 SEQ ID NO:8 SEQ ID NO:9 SEQ ID NO: 10
SEQ ID NO:5 SEQ ID NO:9
SEQ ID NO:5 SEQ ID NO:9 SEQ ID NO: 10
SEQ ID NO:5 SEQ ID NO: 10
SEQ ID NO:5 SEQ ID NO:6 SEQ ID NO:8
SEQ ID NO:5 SEQ ID NO:6 SEQ ID NO:8 SEQ ID NO:9
SEQ ID NO:5 SEQ ID NO:6 SEQ ID NO:8 SEQ ID NO:9 SEQ ID NO: 10
SEQ ID NO:5 SEQ ID NO:6 SEQ ID NO:9
SEQ ID NO:5 SEQ ID NO:6 SEQ ID NO:9 SEQ ID NO: 10
SEQ ID NO:5 SEQ ID NO:6 SEQ ID NO: 10
SEQ ID NO:5 SEQ ID NO:6 SEQ ID NO:7 SEQ ID NO:8
SEQ ID NO:5 SEQ ID NO:6 SEQ ID NO:7 SEQ ID NO:8 SEQ ID NO:9
SEQ ID NO:5 SEQ ID NO:6 SEQ ID NO:7 SEQ ID NO:8 SEQ ID NO:9 SEQ ID NO: 10
SEQ ID NO:5 SEQ ID NO:6 SEQ ID NO:7 SEQ ID NO:9
SEQ ID NO:5 SEQ ID NO:6 SEQ ID NO:7 SEQ ID NO:9 SEQ ID NO: 10
SEQ ID NO:5 SEQ ID NO:6 SEQ ID NO:7 SEQ ID NO: 10
SEQ ID NO:6 SEQ ID NO:8
SEQ ID NO:6 SEQ ID NO:8 SEQ ID NO:9
SEQ ID NO:6 SEQ ID NO:8 SEQ ID NO:9 SEQ ID NO: 10
SEQ ID NO:6 SEQ ID NO:9
SEQ ID NO:6 SEQ ID NO:9 SEQ ID NO: 10
SEQ ID NO:6 SEQ ID NO: 10
SEQ ID NO:6 SEQ ID NO:7 SEQ ID NO:8
SEQ ID NO:6 SEQ ID NO:7 SEQ ID NO:8 SEQ ID NO:9
SEQ ID NO:6 SEQ ID NO:7 SEQ ID NO:8 SEQ ID NO:9 SEQ ID NO: 10
SEQ ID NO:6 SEQ ID NO:7 SEQ ID NO:9
SEQ ID NO:6 SEQ ID NO:7 SEQ ID NO:9 SEQ ID NO: 10
SEQ ID NO:6 SEQ ID NO:7 SEQ ID NO: 10
SEQ ID NO:7 SEQ ID NO:8
SEQ ID NO:7 SEQ ID NO:8 SEQ ID NO:9
SEQ ID NO:7 SEQ ID NO:8 SEQ ID NO:9 SEQ ID NO: 10
46 SEQ ID NO:7 SEQ ID NO:9
47 SEQ ID NO:7 SEQ ID NO:9 SEQ ID NO: 10
48 SEQ ID NO:7 SEQ ID NO: 10
[0049] In various embodiments, an antibody of the invention is humanized. For instance, in one embodiment, a humanized antibody of the invention may comprise a light chain variable region comprising a CDR1 of amino acid sequence SEQ ID NO:5 with zero to two amino acid substitutions, a CDR2 of amino acid sequence SEQ ID NO:6 with zero to two amino acid substitutions, and a CDR3 of amino acid sequence SEQ ID NO:7 with zero to two amino acid substitutions, or may comprise a heavy chain variable region comprising a CDR1 of amino acid sequence SEQ ID NO:8 with zero to two amino acid substitutions, a CDR2 of amino acid sequence SEQ ID NO:9 with zero to two amino acid substitutions, and a CDR3 of amino acid sequence SEQ ID NO:10 with zero to two amino acid substitutions. In a preferred embodiment, a humanized antibody of the invention may comprise a light chain variable region comprising a CDR1 of amino acid sequence SEQ ID NO:5 with zero to two amino acid substitutions, a CDR2 of amino acid sequence SEQ ID NO:6 with zero to two amino acid substitutions, a CDR3 of amino acid sequence SEQ ID NO:7 with zero to two amino acid
substitutions, a heavy chain variable region comprising a CDR1 of amino acid sequence SEQ ID NO:8 with zero to two amino acid substitutions, a CDR2 of amino acid sequence SEQ ID NO:8 with zero to two amino acid substitutions, and a CDR3 of amino acid sequence SEQ ID NO:10 with zero to two amino acid substitutions. In an
exemplary embodiment, a humanized antibody of the invention may comprise a light chain variable region comprising a CDR1 of amino acid sequence SEQ ID NO:5, a CDR2 of amino acid sequence SEQ ID NO:6, a CDR3 of amino acid sequence SEQ ID NO:7, a heavy chain variable region comprising a CDR1 of amino acid sequence SEQ ID NO:8, a CDR2 of amino acid sequence SEQ ID NO:9, and a CDR3 of amino acid sequence SEQ ID NO:10. The invention also encompasses the corresponding nucleic acid sequences of SEQ ID NO:5, 6, 7, 8, 9, and 10, which can readily be determined by
one of skill in the art, and may be incorporated into a vector or other large DNA molecule, such as a chromosome, in order to express an antibody of the invention.
(a) detectable label
[0050] In an aspect, an antibody of the invention may be conjugated to a detectable label. A detectable label may be directly conjugated to an antibody of the invention or may be indirectly conjugated to an antibody of the invention. In an embodiment, a detectable label may be complexed with a chelating agent that is conjugated to an antibody of the invention. In another embodiment, a detectable label may be complexed with a chelating agent that is conjugated to a linker that is
conjugated to an antibody of the invention. In still another embodiment, a detectable label may be conjugated to a linker that is conjugated to an antibody of the invention. In still yet another embodiment, a detectable label may be indirectly attached to an antibody of the invention by the ability of the label to be specifically bound by a second molecule. One example of this type of an indirectly attached label is a biotin label that can be specifically bound by the second molecule, streptavidin. Single, dual or multiple labeling may be advantageous. An isolated antibody of the present invention may be conjugated to one, two, three, four, or five types of detectable labels.
[0051 ] As used herein, a "detectable label" is any type of label which, when attached to an antibody of the invention renders the antibody detectable. A detectable label may also be toxic to cells or cytotoxic. Accordingly, a detectable label may also be a therapeutic agent or cytotoxic agent. In general, detectable labels may include luminescent molecules, chemiluminescent molecules, fluorochromes, fluorophores, fluorescent quenching agents, colored molecules, radioisotopes, radionuclides, cintillants, massive labels such as a metal atom (for detection via mass changes), biotin, avidin, streptavidin, protein A, protein G, antibodies or fragments thereof, Grb2, polyhistidine, Ni2+, Flag tags, myc tags, heavy metals, enzymes, alkaline phosphatase, peroxidase, luciferase, electron donors/acceptors, acridinium esters, and colorimetric substrates. The skilled artisan would readily recognize other useful labels that are not mentioned above, which may be employed in the operation of the present invention.
[0052] A detectable label emits a signal that can be detected by a signal transducing machine. In some cases, the detectable label can emit a signal
spontaneously, such as when the detectable label is a radionuclide. In other cases the detectable label emits a signal as a result of being stimulated by an external field such as when the detectable label is a relaxivity metal. Examples of signals include, without limitation, gamma rays, X-rays, visible light, infrared energy, and radiowaves. Examples of signal transducing machines include, without limitation, gamma cameras including SPECT/CT devices, PET scanners, fluorimeters, and Magnetic Resonance Imaging (MRI) machines. As such, the detectable label comprises a label that can be detected using magnetic resonance imaging, scintigraphic imaging, ultrasound, or fluorescence. In a specific embodiment, the detectable label comprises a label that can be detected using positron emission tomography, single photon emission computed tomography, gamma camera imaging, or rectilinear scanning.
[0053] Suitable fluorophores include, but are not limited to, fluorescein isothiocyante (FITC), fluorescein thiosemicarbazide, rhodamine, Texas Red, CyDyes (e.g., Cy3, Cy5, Cy5.5), Alexa Fluors (e.g., Alexa488, Alexa555, Alexa594; Alexa647), near infrared (NIR) (700-900 nm) fluorescent dyes, and carbocyanine and aminostyryl dyes. B-12 or an analog thereof can be labeled for fluorescence detection by labeling the agent with a fluorophore using techniques well known in the art (see, e.g., Lohse et al., Bioconj Chem 8:503-509 (1997)). For example, many known dyes are capable of being coupled to NH2-terminal groups. Alternatively, a fluorochrome such as fluorescein may be bound to a lysine residue of a peptide linker. In a specific embodiment, an alkyne modified dye, such an Alexa Fluor dye, may be clicked to an azido modified B 2 using, for example, Sharpless click chemistry (Kolb et al., Angew Chem Int Ed 2001 ; 40: 2004- 2021 , which incorporated by reference in its entirety).
[0054] A radionuclide may be a γ-emitting radionuclide, Auger-emitting radionuclide, β-emitting radionuclide, an a-emitting radionuclide, or a positron-emitting radionuclide. A radionuclide may be a detectable label and/or a therapeutic agent. Non- limiting examples of suitable radionuclides may include carbon-1 1 , nitrogen-13, oxygen- 15, fluorine-18, fluorodeoxyglucose-18, phosphorous-32, scandium-47, copper-64, 65
and 67, gallium-67 and 68, bromine-75, 77 and 80m, rubidium-82, strontium-89, zirconium-89, ytthum-86 and 90, ruthenium-95, 97,103 and 105, rhenium-99m, 101 , 105, 186 and 188, technetium-99m, rhodium-105, mercury-107, palladium-109, indium- 1 1 1 , silver-1 1 1 , indium-1 13m, lanthanide-1 14m, tin-1 17m, tellurium-121 m, 122m and 125m, iodine-122, 123, 124, 125, 126, 131 and 133, praseodymium-142, promethium- 149, samahum-153, gadolinium-159, thulium-165, 167 and 168, dysprosium-165, holmium-166, lutetium-177, rhenium-186 and 188, iridium-192, platinum-193 and 195m, gold-199, thallium-201 , titanium-201 , astatine-21 1 , bismuth-212 and 213, lead-212, radium-223, actinium-225, and nitride or oxide forms derived there from. In a specific embodiment, a radionuclide is selected from the group consisting of copper-64, zirconium-89, ytthum-86, yttrium-90, technetium-99m, iodine-125, iodine-131 , lutetium- 177, rhenium-186 and rhenium-188.
[0055] A variety of metal atoms may be used as a detectable label. The metal atom may generally be selected from the group of metal atoms comprised of metals with an atomic number of twenty or greater. For instance, the metal atoms may be calcium atoms, scandium atoms, titanium atoms, vanadium atoms, chromium atoms, manganese atoms, iron atoms, cobalt atoms, nickel atoms, copper atoms, zinc atoms, gallium atoms, germanium atoms, arsenic atoms, selenium atoms, bromine atoms, krypton atoms, rubidium atoms, strontium atoms, yttrium atoms, zirconium atoms, niobium atoms, molybdenum atoms, technetium atoms, ruthenium atoms, rhodium atoms, palladium atoms, silver atoms, cadmium atoms, indium atoms, tin atoms, antimony atoms, tellurium atoms, iodine atoms, xenon atoms, cesium atoms, barium atoms, lanthanum atoms, hafnium atoms, tantalum atoms, tungsten atoms, rhenium atoms, osmium atoms, iridium atoms, platinum atoms, gold atoms, mercury atoms, thallium atoms, lead atoms, bismuth atoms, francium atoms, radium atoms, actinium atoms, cerium atoms, praseodymium atoms, neodymium atoms, promethium atoms, samarium atoms, europium atoms, gadolinium atoms, terbium atoms, dysprosium atoms, holmium atoms, erbium atoms, thulium atoms, ytterbium atoms, lutetium atoms, thorium atoms, protactinium atoms, uranium atoms, neptunium atoms, plutonium atoms, americium atoms, curium atoms, berkelium atoms, californium atoms, einsteinium
atoms, fermium atoms, mendelevium atoms, nobelium atoms, or lawrencium atoms. In some embodiments, the metal atoms may be selected from the group comprising alkali metals with an atomic number greater than twenty. In other embodiments, the metal atoms may be selected from the group comprising alkaline earth metals with an atomic number greater than twenty. In one embodiment, the metal atoms may be selected from the group of metals comprising the lanthanides. In another embodiment, the metal atoms may be selected from the group of metals comprising the actinides. In still another embodiment, the metal atoms may be selected from the group of metals comprising the transition metals. In yet another embodiment, the metal atoms may be selected from the group of metals comprising the poor metals. In other embodiments, the metal atoms may be selected from the group comprising gold atoms, bismuth atoms, tantalum atoms, and gadolinium atoms. In preferred embodiments, the metal atoms may be selected from the group comprising metals with an atomic number of 53 (i.e. iodine) to 83 (i.e. bismuth). In an alternative embodiment, the metal atoms may be atoms suitable for magnetic resonance imaging. In another alternative embodiment, the metal atoms may be selected from the group consisting of metals that have a K-edge in the x-ray energy band of CT. Preferred metal atoms include, but are not limited to, manganese, iron, gadolinium, gold, and iodine.
[0056] The metal atoms may be metal ions in the form of +1 , +2, or +3 oxidation states. For instance, non-limiting examples include Ba2+, Bi3+, Cs+, Ca2+, Cr2*, Cr3+, Cr6+, Co2+, Co3+, Cu+, Cu2+, Cu3+, Ga3+, Gd3+, Au+, Au3+, Fe2+, Fe3+, F3+, Pb2+, Mn2+, Mn3+, Mn4+, Mn7+, Hg2+, Ni2+, Ni3+, Ag+, Sr2+, Sn2+, Sn4+, and Zn2+. The metal atoms may comprise a metal oxide. For instance, non-limiting examples of metal oxides may include iron oxide, manganese oxide, or gadolinium oxide. Additional examples may include magnetite, maghemite, or a combination thereof.
(b) therapeutic agent
[0057] In an aspect, an antibody of the invention may be conjugated to a therapeutic agent, such that the therapeutic agent can be selectively targeted to a cell expressing 14-3-3 epsilon. In a specific embodiment, the therapeutic agent can be
selectively targeted to an irradiated tumor cell expressing 14-3-3 epsilon. The therapeutic agent may be directly conjugated to an antibody of the invention or may be indirectly conjugated to an antibody of the invention. In an embodiment, the therapeutic agent may be complexed with a chelating agent that is conjugated to an antibody of the invention. In another embodiment, the therapeutic agent may be complexed with a chelating agent that is conjugated to a linker that is conjugated to an antibody of the invention. In still another embodiment, the therapeutic agent may be conjugated to a linker that is conjugated to an antibody of the invention. In still yet another embodiment, the therapeutic agent may be conjugated to a linker that is conjugated to a chelating agent that is complexed with a detectable label and conjugated to an antibody of the invention.
[0058] A "therapeutic agent" is any compound known in the art that is used in the detection, diagnosis, or treatment of a condition or disease. Such compounds may be naturally-occurring, modified, or synthetic. Non-limiting examples of therapeutic agents may include drugs, therapeutic compounds, genetic materials, metals (such as radioactive isotopes), proteins, peptides, carbohydrates, lipids, steroids, nucleic acid based materials, or derivatives, analogues, or combinations thereof in their native form or derivatized with hydrophobic or charged moieties to enhance incorporation or adsorption into a cell. Such therapeutic agents may be water soluble or may be hydrophobic. Non-limiting examples of therapeutic agents may include immune-related agents, thyroid agents, respiratory products, antineoplastic agents, anti-helmintics, antimalarials, mitotic inhibitors, hormones, anti-protozoans, anti-tuberculars, cardiovascular products, blood products, biological response modifiers, anti-fungal agents, vitamins, peptides, anti-allergic agents, anti-coagulation agents, circulatory drugs, metabolic potentiators, anti-virals, anti-anginals, antibiotics, anti-inflammatories, anti-rheumatics, narcotics, cardiac glycosides, neuromuscular blockers, sedatives, local anesthetics, general anesthetics, or radioactive atoms or ions. Non-limiting examples of therapeutic agents are described below. In a specific embodiment, a therapeutic agent may be a compound used in the detection diagnosis or treatment of cancer. The therapeutic agent preferably reduces or interferes with tumor growth or otherwise reduces the effect
of the tumor within the body or organism. A therapeutic agent that reduces the symptoms produced by the tumor or reduces tumor growth is suitable for the present invention. Additionally, any therapeutic agent that reduces the symptoms associated with tumor cell growth will work for purposes of the present invention.
[0059] An antibody of the invention may be conjugated to one, two, three, four, or five therapeutic agents. A linker may or may not be used to conjugate a therapeutic agent to an antibody of the invention. Generally speaking, the conjugation should not interfere with the antibody binding to 14-3-3 epsilon. In some instances, an antibody of the invention may be generated with a cleavable linkage between the antibody and therapeutic agent. Such a linker may allow release of the therapeutic agent at a specific cellular location.
[0060] A therapeutic agent of the invention may be a small molecule therapeutic, a therapeutic antibody, a therapeutic nucleic acid, or a chemotherapeutic agent. Non-limiting examples of therapeutic antibodies may include muromomab, abciximab, rituximab, daclizumab, basiliximab, palivizumab, infliximab, trastuzumab, etanercept, gemtuzumab, alemtuzumab, ibritomomab, adalimumab, alefacept, omalizumab, tositumomab, efalizumab, cetuximab, bevacizumab, natalizumab, ranibizumab, panitumumab, eculizumab, and certolizunnab. A representative therapeutic nucleic acid may encode a polypeptide having an ability to induce an immune response and/or an anti-angiogenic response in vivo. Representative therapeutic proteins with immunostimulatory effects include but are not limited to cytokines (e.g., an interleukin (IL) such as IL2, IL4, IL7, IL12, interferons, granulocyte-macrophage colony-stimulating factor (GM-CSF), tumor necrosis factor alpha (TNF-a)), immunomodulatory cell surface proteins (e.g., human leukocyte antigen (HLA proteins), co-stimulatory molecules, and tumor-associated antigens. See Kirk & Mule, 2000; Mackensen et al., 1997; Walther & Stein, 1999; and references cited therein. Representative proteins with anti-angiogenic activities that can be used in accordance with the presently disclosed subject matter include: thrombospondin I (Kosfeld & Frazier, 1993; Tolsma et al., 1993; Dameron et al., 1994), metallospondin proteins (Carpizo & Iruela-Arispe, 2000), class I interferons (Albini et al., 2000), IL12 (Voest et al., 1995), protamine (Ingber et al., 1990), angiostatin
(O'Reilly et al., 1994), laminin (Sakamoto et al., 1991 ), endostatin (O'Reilly et al., 1997), and a prolactin fragment (Clapp et al., 1993). In addition, several anti-angiogenic peptides have been isolated from these proteins (Maione et al., 1990; Eijan et al., 1991 ; Woltering et al., 1991 ). Representative proteins with both immunostimulatory and anti- angiogenic activities may include IL12, interferon-γ, or a chemokine. Other therapeutic nucleic acids that may be useful for cancer therapy include but are not limited to nucleic acid sequences encoding tumor suppressor gene products/antigens, antimetabolites, suicide gene products, and combinations thereof.
[0061 ] A chemotherapeutic agent refers to a chemical compound that is useful in the treatment of cancer. The compound may be a cytotoxic agent that affects rapidly dividing cells in general, or it may be a targeted therapeutic agent that affects the deregulated proteins of cancer cells. A cytotoxic agent is any naturally-occurring, modified, or synthetic compound that is toxic to tumor cells. Such agents are useful in the treatment of neoplasms, and in the treatment of other symptoms or diseases characterized by cell proliferation or a hyperactive cell population. The
chemotherapeutic agent may be an alkylating agent, an anti-metabolite, an anti-tumor antibiotic, an anti-cytoskeletal agent, a topoisomerase inhibitor, an anti-hormonal agent, a targeted therapeutic agent, a photodynamic therapeutic agent, or a combination thereof. In an exemplary embodiment, the chemotherapeutic agent is selected from the group consisting of liposomal doxorubicin and nanoparticle albumin docetaxel.
[0062] Non-limiting examples of suitable alkylating agents may include altretamine, benzodopa, busulfan, carboplatin, carboquone, carmustine (BCNU), chlorambucil, chlornaphazine, cholophosphamide, chlorozotocin, cisplatin,
cyclosphosphamide, dacarbazine (DTIC), estramustine, fotemustine, ifosfamide, improsulfan, lipoplatin, lomustine (CCNU), mafosfamide, mannosulfan,
mechlorethamine, mechlorethamine oxide hydrochloride, melphalan, meturedopa, mustine (mechlorethamine), mitobronitol, nimustine, novembichin, oxaliplatin, phenesterine, piposulfan, prednimustine, ranimustine, satraplatin, semustine, temozolomide, thiotepa, treosulfan, triaziquone, triethylenemelamine,
triethylenephosphoramide (TEPA), triethylenethiophosphaoramide (thiotepa), trimethylolomelamine, trofosfamide, uracil mustard and uredopa.
[0063] Suitable anti-metabolites may include, but are not limited to
aminopterin, ancitabine, azacitidine, 8-azaguanine, 6-azauridine, capecitabine, carmofur (1 -hexylcarbomoyl-5-fluorouracil), cladribine, clofarabine, cytarabine (cytosine
arabinoside (Ara-C)), decitabine, denopterin, dideoxyuridine, doxifluridine, enocitabine, floxuridine, fludarabine, 5-fluorouracil, gemcitabine, hydroxyurea (hydroxycarbamide), leucovorin (folinic acid), 6-mercaptopurine, methotrexate, nafoxidine, nelarabine, oblimersen, pemetrexed, pteropterin, raltitrexed, tegofur, tiazofurin, thiamiprine, tioguanine (thioguanine), and trimetrexate.
[0064] Non-limiting examples of suitable anti-tumor antibiotics may include aclacinomysin, aclarubicin, actinomycins, adriamycin, aurostatin (for example, monomethyl auristatin E), authramycin, azaserine, bleomycins, cactinomycin,
calicheamicin, carabicin, caminomycin, carzinophilin, chromomycins, dactinomycin, daunorubicin, detorubicin, 6-diazo-5-oxo-L-norleucine, doxorubicin, epirubicin, epoxomicin, esorubicin, idarubicin, marcellomycin, mitomycins, mithramycin,
mycophenolic acid, nogalamycin, olivomycins, peplomycin, plicamycin, potfiromycin, puromycin, quelamycin, rodorubicin, sparsomycin, streptonigrin, streptozocin,
tubercidin, valrubicin, ubenimex, zinostatin, and zorubicin.
[0065] Non-limiting examples of suitable anti-cytoskeletal agents may include cabazitaxel, colchicines, demecolcine, docetaxel, epothilones, ixabepilone, macromycin, omacetaxine mepesuccinate, ortataxel, paditaxel (for example, DHA-paclitaxel), taxane, tesetaxel, vinblastine, vincristine, vindesine, and vinorelbine.
[0066] Suitable topoisomerase inhibitors may include, but are not limited to, amsacrine, etoposide (VP-16), irinotecan, mitoxantrone, RFS 2000, teniposide, and topotecan.
[0067] Non-limiting examples of suitable anti-hormonal agents may include aminoglutethimide, antiestrogen, aromatase inhibiting 4(5)-imidazoles, bicalutamide, finasteride, flutamide, fluvestrant, goserelin, 4-hydroxytamoxifen, keoxifene, leuprolide,
LY1 17018, mitotane, nilutamide, onapristone, raloxifene, tamoxifen, toremifene, and trilostane.
[0068] Examples of targeted therapeutic agents may include, without limit, monoclonal antibodies such as alemtuzumab, cartumaxomab, edrecolomab, epratuzumab, gemtuzumab, gemtuzumab ozogamicin, glembatumumab vedotin, ibritumomab tiuxetan, reditux, rituximab, tositumomab, and trastuzumab; protein kinase inhibitors such as bevacizumab, cetuximab, crizonib, dasatinib, erlotinib, gefitinib, imatinib, lapatinib, mubritinib, nilotinib, panitumumab, pazopanib, sorafenib, sunitinib, toceranib, and vandetanib.
[0069] Non limiting examples of angiogeneisis inhibitors may include angiostatin, bevacizumab, denileukin diftitox, endostatin, everolimus, genistein, interferon alpha, interleukin-2, interleukin-12, pazopanib, pegaptanib, ranibizumab, rapamycin (sirolimus), temsirolimus, and thalidomide.
[0070] Non limiting examples of growth inhibitory polypeptides may include bortazomib, erythropoietin, interleukins (e.g., IL-1 , IL-2, IL-3, IL-6), leukemia inhibitory factor, interferons, romidepsin, thrombopoietin, TNF-a, CD30 ligand, 4-1 BB ligand, and Apo-1 ligand.
[0071 ] Non-limiting examples of photodynamic therapeutic agents may include aminolevulinic acid, methyl aminolevulinate, retinoids (alitretinon, tamibarotene, tretinoin), and temoporfin.
[0072] Other antineoplastic agents may include anagrelide, arsenic trioxide, asparaginase, bexarotene, bropirimine, celecoxib, chemically linked Fab, efaproxiral, etoglucid, ferruginol, lonidamide, masoprocol, miltefosine, mitoguazone, talapanel, trabectedin, and vorinostat.
[0073] Also included are pharmaceutically acceptable salts, acids, or derivatives of any of the above listed agents. The dose of the chemotherapeutic agent can and will vary depending upon the agent and the type of tumor or neoplasm. A skilled practitioner will be able to determine the appropriate dose of the
chemotherapeutic agent.
[0074] Other therapeutic agents may comprise a virus or a viral genome such as an oncolytic virus. An oncolytic virus comprises a naturally occurring virus that is capable of killing a cell in the target tissue (for example, by lysis) when it enters such a cell.
(c) delivery vehicle
[0075] An antibody of the invention may be conjugated to a vehicle for cellular delivery. In these embodiments, typically an antibody of the invention, which may or may not be conjugated to a detectable label and/or therapeutic agent, is encapsulated in a suitable vehicle to either aid in the delivery of the compound to target cells, to increase the stability of the antibody, or to minimize potential toxicity of the antibody. As will be appreciated by a skilled artisan, a variety of vehicles are suitable for delivering an antibody of the present invention. Non-limiting examples of suitable structured fluid delivery systems may include nanoparticles, liposomes, microemulsions, micelles, dendrimers and other phospholipid-containing systems. Methods of incorporating antibodies into delivery vehicles are known in the art. Although various embodiments are presented below, it will be appreciate that other methods known in the art to incorporate an antibody of the invention into a delivery vehicle are contemplated.
[0076] In one alternative embodiment, a liposome delivery vehicle may be utilized. Liposomes, depending upon the embodiment, are suitable for delivery of the antibody of the invention in view of their structural and chemical properties. Generally speaking, liposomes are spherical vesicles with a phospholipid bilayer membrane. The lipid bilayer of a liposome may fuse with other bilayers (e.g., the cell membrane), thus delivering the contents of the liposome to cells. In this manner, the antibody of the invention may be selectively delivered to a cell by encapsulation in a liposome that fuses with the targeted cell's membrane.
[0077] Liposomes may be comprised of a variety of different types of phosolipids having varying hydrocarbon chain lengths. Phospholipids generally comprise two fatty acids linked through glycerol phosphate to one of a variety of polar groups. Suitable phospholids include phosphatidic acid (PA), phosphatidylserine (PS),
phosphatidyl inositol (PI), phosphatidylglycerol (PG), diphosphatidylglycerol (DPG), phosphatidylcholine (PC), and phosphatidylethanolamine (PE). The fatty acid chains comprising the phospholipids may range from about 6 to about 26 carbon atoms in length, and the lipid chains may be saturated or unsaturated. Suitable fatty acid chains include (common name presented in parentheses) n-dodecanoate (laurate), n- tretradecanoate (myristate), n-hexadecanoate (palmitate), n-octadecanoate (stearate), n-eicosanoate (arachidate), n-docosanoate (behenate), n-tetracosanoate (lignocerate), cis-9-hexadecenoate (palmitoleate), cis-9-octadecanoate (oleate), cis,cis-9,12- octadecandienoate (linoleate), all cis-9, 12, 15-octadecatrienoate (linolenate), and all cis-5,8,1 1 ,14-eicosatetraenoate (arachidonate). The two fatty acid chains of a phospholipid may be identical or different. Acceptable phospholipids include dioleoyl PS, dioleoyl PC, distearoyl PS, distearoyl PC, dimyristoyl PS, dimyristoyl PC, dipalmitoyl PG, stearoyl, oleoyl PS, palmitoyl, linolenyl PS, and the like.
[0078] The phospholipids may come from any natural source, and, as such, may comprise a mixture of phospholipids. For example, egg yolk is rich in PC, PG, and PE, soy beans contains PC, PE, PI, and PA, and animal brain or spinal cord is enriched in PS. Phospholipids may come from synthetic sources too. Mixtures of phospholipids having a varied ratio of individual phospholipids may be used. Mixtures of different phospholipids may result in liposome compositions having advantageous activity or stability of activity properties. The above mentioned phospholipids may be mixed, in optimal ratios with cationic lipids, such as N-(1 -(2,3-dioleolyoxy)propyl)-N,N,N-trimethyl ammonium chloride, 1 ,1 '-dioctadecyl-3,3,3',3'-tetramethylindocarbocyanine
perchloarate, 3,3'-deheptyloxacarbocyanine iodide, 1 ,1 '-dedodecyl-3,3,3',3'- tetramethylindocarbocyanine perchloarate, 1 ,1 '-dioleyl-3,3,3',3'-tetramethylindo carbocyanine methanesulfonate, N-4-(delinoleylaminostyryl)-N-methylpyridinium iodide, or 1 ,1 ,-dilinoleyl-3,3,3',3'-tetramethylindocarbocyanine perchloarate.
[0079] Liposomes may optionally comprise sphingolipids, in which spingosine is the structural counterpart of glycerol and one of the one fatty acids of a
phosphoglyceride, or cholesterol, a major component of animal cell membranes.
Liposomes may optionally, contain pegylated lipids, which are lipids covalently linked to
polymers of polyethylene glycol (PEG). PEGs may range in size from about 500 to about 10,000 daltons.
[0080] Liposomes may further comprise a suitable solvent. The solvent may be an organic solvent or an inorganic solvent. Suitable solvents include, but are not limited to, dimethylsulfoxide (DMSO), methyl pyrrol idone, N-methylpyrrolidone, acetronitrile, alcohols, dimethylformamide, tetrahydrofuran, or combinations thereof.
[0081 ] Liposomes carrying the antibody of the invention (i.e., having at least one methionine compound) may be prepared by any known method of preparing liposomes for drug delivery, such as, for example, detailed in U.S. Pat. Nos. 4,241 ,046, 4,394,448, 4,529,561 , 4,755,388, 4,828,837, 4,925,661 , 4,954,345, 4,957,735,
5,043,164, 5,064,655, 5,077,21 1 and 5,264,618, the disclosures of which are hereby incorporated by reference in their entirety. For example, liposomes may be prepared by sonicating lipids in an aqueous solution, solvent injection, lipid hydration, reverse evaporation, or freeze drying by repeated freezing and thawing. In a preferred embodiment the liposomes are formed by sonication. The liposomes may be
multilamellar, which have many layers like an onion, or unilamellar. The liposomes may be large or small. Continued high-shear sonication tends to form smaller unilamellar lipsomes.
[0082] As would be apparent to one of ordinary skill, all of the parameters that govern liposome formation may be varied. These parameters include, but are not limited to, temperature, pH, concentration of methionine compound, concentration and composition of lipid, concentration of multivalent cations, rate of mixing, presence of and concentration of solvent.
[0083] In another embodiment, an antibody of the invention may be delivered to a cell as a microemulsion. Microemulsions are generally clear, thermodynamically stable solutions comprising an aqueous solution, a surfactant, and "oil." The "oil" in this case, is the supercritical fluid phase. The surfactant rests at the oil-water interface. Any of a variety of surfactants are suitable for use in microemulsion formulations including those described herein or otherwise known in the art. The aqueous microdomains suitable for use in the invention generally will have characteristic structural dimensions
from about 5 nm to about 100 nm. Aggregates of this size are poor scatterers of visible light and hence, these solutions are optically clear. As will be appreciated by a skilled artisan, microemulsions can and will have a multitude of different microscopic structures including sphere, rod, or disc shaped aggregates. In one embodiment, the structure may be micelles, which are the simplest microemulsion structures that are generally spherical or cylindrical objects. Micelles are like drops of oil in water, and reverse micelles are like drops of water in oil. In an alternative embodiment, the microemulsion structure is the lamellae. It comprises consecutive layers of water and oil separated by layers of surfactant. The "oil" of microemulsions optimally comprises phospholipids. Any of the phospholipids detailed above for liposomes are suitable for embodiments directed to microemulsions. The antibody of the invention may be encapsulated in a
microemulsion by any method generally known in the art.
[0084] In yet another embodiment, an antibody of the invention may be delivered in a dendritic macromolecule, or a dendrimer. Generally speaking, a
dendrimer is a branched tree-like molecule, in which each branch is an interlinked chain of molecules that divides into two new branches (molecules) after a certain length. This branching continues until the branches (molecules) become so densely packed that the canopy forms a globe. Generally, the properties of dendrimers are determined by the functional goups at their surface. For example, hydrophilic end groups, such as carboxyl groups, would typically make a water-soluble dendrimer. Alternatively, phospholipids may be incorporated in the surface of an dendrimer to facilitate absorption across the skin. Any of the phospholipids detailed for use in liposome embodiments are suitable for use in dendrimer embodiments. Any method generally known in the art may be utilized to make dendrimers and to encapsulate antibodies of the invention therein. For example, dendrimers may be produced by an iterative sequence of reaction steps, in which each additional iteration leads to a higher order dendrimer. Consequently, they have a regular, highly branched 3D structure, with nearly uniform size and shape.
Furthermore, the final size of a dendrimer is typically controlled by the number of iterative steps used during synthesis. A variety of dendrimer sizes are suitable for use in
the invention. Generally, the size of dend mers may range from about 1 nm to about 100 nm.
II. METHODS OF USING ANTI-14-3-3 EPSILON ANTIBODIES
[0085] In an aspect, the present invention provides anti-14-3-3 epsilon antibodies to detect to 14-3-3 epsilon in vitro and/or in vivo. For example, anti-14-3-3 epsilon antibodies may be used to detect and measure the amount of 14-3-3 epsilon in a biological sample. Alternatively, anti-14-3-3 epsilon antibodies may be used to detect and measure the amount of 14-3-3 epsilon in a subject. In another aspect, the present invention provides anti-14-3-3 epsilon antibodies that can be used to provide tumor specific delivery, for instance, of drugs, therapeutic agents or imaging agents as well as enhancing the efficacy of radiotherapy. In still another aspect, the present invention provides anti-14-3-3 epsilon antibodies that can be used to detect a tumor in a subject.
(a) methods to detect and measure the amount of 14-3-3 epsilon in a biological sample
[0086] In an aspect, the invention provides means to detect 14-3-3 epsilon in a sample. In another aspect, the invention provides means to measure the amount of 14-3-3 epsilon in a sample. The method generally comprises (i) obtaining a sample from, and (ii) detecting and/or measuring the amount of 14-3-3 epsilon in the sample using an antibody that specifically binds 14-3-3 epsilon. Suitable antibodies are described above in Section I. The sample may be obtained from a subject (i.e.
biological sample) or may be an immortalized cell line.
[0087] As used herein, the term "biological sample" refers to a sample obtained from a subject. Any biological sample containing 14-3-3 epsilon is suitable. Numerous types of biological samples are known in the art. Suitable biological sample may include, but are not limited to, tissue samples or bodily fluids. In some
embodiments, the sample may be a bodily fluid comprising a cell expressing 14-3-3 epsilon on the cell surface. Non-limiting examples of suitable bodily fluids include blood, plasma, serum, lung aspirate, pleural fluid, and sputum. The fluid may be used "as is",
the cellular components may be isolated from the fluid, or a protein fraction may be isolated from the fluid using standard techniques. In preferred embodiments, the biological sample is a tissue sample such as a tissue biopsy. The tissue biopsy may be a biopsy of tumor. The biopsied tissue may be fixed, embedded in paraffin or plastic, and sectioned, or the biopsied tissue may be frozen and cryosectioned. Alternatively, the biopsied tissue may be processed into individual cells or an explant, or processed into a homogenate, a cell extract, a membranous fraction, or a protein extract. The sample may also be primary and/or transformed cell cultures derived from tissue from the subject.
[0088] Suitable subjects include, but are not limited to, a human, a livestock animal, a companion animal, a lab animal, and a zoological animal. A subject may or may not be known to have a tumor comprising a cell expressing 14-3-3 epsilon on the cell surface. In one embodiment, the subject may be a rodent, e.g. a mouse, a rat, a guinea pig, etc. In another embodiment, the subject may be a livestock animal. Non- limiting examples of suitable livestock animals may include pigs, cows, horses, goats, sheep, llamas and alpacas. In yet another embodiment, the subject may be a companion animal. Non-limiting examples of companion animals may include pets such as dogs, cats, rabbits, and birds. In yet another embodiment, the subject may be a zoological animal. As used herein, a "zoological animal" refers to an animal that may be found in a zoo. Such animals may include non-human primates, large cats, wolves, and bears. In a preferred embodiment, the animal is a laboratory animal. Non-limiting examples of a laboratory animal may include rodents, canines, felines, and non-human primates. In another preferred embodiment, the subject is a human.
[0089] As will be appreciated by a skilled artisan, the method of collecting a biological sample can and will vary depending upon the nature of the biological sample and the type of analysis to be performed. Any of a variety of methods generally known in the art may be utilized to collect a biological sample. Generally speaking, the method preferably maintains the integrity of the sample such that 14-3-3 epsilon can be accurately detected and the amount measured according to the invention.
[0090] Once a sample is obtained, it is processed in vitro to detect and measure the amount of 14-3-3 epsilon using an anti-14-3-3 epsilon antibody. All suitable methods for detecting and measuring an amount of protein using an antibody known to one of skill in the art are contemplated within the scope of the invention. Methods for detecting and measuring an amount of protein using an antibody (i.e. "antibody-based methods") are well known in the art. Non-limiting examples include an ELISA, a sandwich immunoassay, a radioimmunoassay, an immunoblot or Western blot, flow cytometry, immunohistochemistry, and an array.
[0091 ] In general, an antibody-based method of detecting and measuring an amount of 14-3-3 epsilon comprises contacting some of the sample, or all of the sample, comprising 14-3-3 epsilon with an anti-14-3-3 epsilon antibody under conditions effective to allow for formation of a complex between the antibody and the 14-3-3 epsilon protein. Typically, the entire sample is not needed, allowing one skilled in the art to repeatedly detect and measure the amount of 14-3-3 epsilon in the sample. The method may occur in solution, or the antibody or 14-3-3 epsilon protein comprising the sample may be immobilized on a solid surface. Non-limiting examples of suitable surfaces may include microtitre plates, test tubes, slides, beads, resins, and other polymers. Attachment to the substrate may occur in a wide variety of ways, as will be appreciated by those in the art. For example, the substrate and the antibody may be derivatized with chemical functional groups for subsequent attachment of the two. For example, the substrate may be derivatized with a chemical functional group including, but not limited to, amino groups, carboxyl groups, oxo groups or thiol groups. Using these functional groups, the antibody may be attached directly using the functional groups or indirectly using linkers. An anti-14-3-3 epsilon antibody may also be attached to the substrate non-covalently. For example, a biotinylated anti-14-3-3 epsilon antibody may be prepared, which may bind to surfaces covalently coated with streptavidin, resulting in attachment. Alternatively, an antibody may be synthesized on the surface using techniques such as photopolymerization and photolithography.
[0092] Contacting the sample with an antibody under effective conditions for a period of time sufficient to allow formation of a complex generally involves adding the
anti-14-3-3 epsilon antibody composition to the sample and incubating the mixture for a period of time long enough for the anti-14-3-3 epsilon antibody to bind to any antigen present. After this time, the complex will be washed and the complex may be detected and the amount measured by any method well known in the art. Methods of detecting and measuring an amount of an antibody -polypeptide complex are generally based on the detection of a label or marker. The term "label", as used herein, refers to any substance attached to an antibody, or other substrate material, in which the substance is detectable by a detection method. Non-limiting examples of suitable labels include luminescent molecules, chemiluminescent molecules, fluorochromes, fluorescent quenching agents, colored molecules, radioisotopes, scintillants, biotin, avidin, stretpavidin, protein A, protein G, antibodies or fragments thereof, polyhistidine, Ni2+, Flag tags, myc tags, heavy metals, and enzymes (including alkaline phosphatase, peroxidase, glucose oxidase, and luciferase). Methods of detecting and measuring an amount of an antibody-polypeptide complex based on the detection of a label or marker are well known in the art.
[0093] In some embodiments, an antibody-based method is an immunoassay. Immunoassays can be run in a number of different formats. Generally speaking, immunoassays can be divided into two categories- competitive immunoassays and noncompetitive immunoassays. In a competitive immunoassay, an unlabeled analyte in a sample competes with labeled analyte to bind an antibody. Unbound analyte is washed away and the bound analyte is measured. In a non-competitive immunoassay, the antibody is labeled, not the analyte. Non-competitive immunoassays may use one antibody (e.g. the capture antibody is labeled) or more than one antibody (e.g. at least one capture antibody which is unlabeled and at least one "capping" or detection antibody which is labeled.) Suitable labels are described above.
[0094] In other embodiments, an antibody-based method is an immunoblot or Western blot. In yet other embodiments, an antibody-based method is flow cytometry.
[0095] In different embodiments, an antibody-based method is
immunohistochemistry (IHC). IHC uses an antibody to detect and quantify antigens in intact tissue samples. The tissue samples may be fresh-frozen and/or formalin-fixed,
paraffin-embedded (or plastic-embedded) tissue blocks prepared for study by IHC. Methods of preparing tissue block for study by IHC, as well as methods of performing IHC are well known in the art.
[0096] In alternative embodiments, an antibody-based method is an array. An array comprises at least one address, wherein at least one address of the array has disposed thereon an anti-14-3-3 epsilon antibody. Arrays may comprise from about 1 to about several hundred thousand addresses. Several substrates suitable for the construction of arrays are known in the art, and one skilled in the art will appreciate that other substrates may become available as the art progresses. Suitable substrates are also described above. In some embodiments, the array comprises at least one an anti- 14-3-3 epsilon antibody attached to the substrate is located at one or more spatially defined addresses of the array. For example, an array may comprise at least one, at least two, at least three, at least four, or at least five anti-14-3-3 epsilon antibodies, each antibody recognizing the same or different epitope 14-3-3 epsilon epitope, and each antibody may be may be at one, two, three, four, five, six, seven, eight, nine, ten or more spatially defined addresses.
(b) tumor specific delivery
[0097] In another aspect, the present invention proves a method of delivering a therapeutic agent to a cell expressing 14-3-3 epsilon. Accordingly, an antibody of the present invention, as described in Section I, may be used in treating, stabilizing and preventing cancer and associated diseases in a subject. By "treating, stabilizing, or preventing cancer" is meant causing a reduction in the size of a tumor or in the number of cancer cells, slowing or preventing an increase in the size of a tumor or cancer cell proliferation, increasing the disease-free survival time between the disappearance of a tumor or other cancer and its reappearance, preventing an initial or subsequent occurrence of a tumor or other cancer, or reducing an adverse symptom associated with a tumor or other cancer. The inventors have shown that an antibody of the invention activates phagocytosis of cells bound by the antibody thereby reducing the amount of cancer cells expressing 14-3-3 epsilon. In a desired embodiment, the percent of tumor
or cancerous cells surviving the treatment is at least 20, 40, 60, 80, or 100% lower than the initial number of tumor or cancerous cells, as measured using any standard assay (e.g., caspase assays, TUNEL and DNA fragmentation assays, cell permeability assays, and Annexin V assays). Desirably, the decrease in the number of tumor or cancerous cells induced by administration of an antibody of the invention is at least 2, 5, 10, 20, or 50-fold greater than the decrease in the number of non-tumor or noncancerous cells. Desirably, the methods of the present invention result in a decrease of 20, 40, 60, 80, or 100% in the size of a tumor or in the number of cancerous cells, as determined using standard methods. Desirably, at least 20, 40, 60, 80, 90, or 95% of the treated subjects have a complete remission in which all evidence of the tumor or cancer disappears. Desirably, the tumor or cancer does not reappear or reappears after at least 5, 10, 15, or 20 years.
[0098] An antibody of the present invention may be indirectly or directly coupled to radionuclides or chemotherapeutic agents as described above in order to provide specific delivery of radiation and chemotherapy to the site of a tumor. Further, the composition of the present invention may be part of a combination therapy.
Preferably, a combination therapy would include the use of the antibody of the present invention along with a radiation therapy or chemotherapy course of treatment. It has also been suggested that antibody compositions, such as those described herein, may increase the susceptibility of tumor cells to the effects of chemotherapy or radiation. In preferred embodiments, the composition of the invention may be used to enhance the efficacy of cancer radiotherapy.
[0099] In yet another aspect, the present invention provides a method of detecting a tumor in a subject. The method comprises exposing a target area of the subject where the presence of a tumor is suspected to ionizing radiation, administering to the subject a composition to detect the presence of 14-3-3 epsilon in the target area, wherein the composition comprises one or more targeting antibodies, wherein each targeting antibody specifically binds to 14-3-3 epsilon exposed on an irradiated cell and is conjugated to a detectable label, and detecting the detectable label to detect the presence of 14-3-3 epsilon, wherein the presence of 14-3-3 epsilon indicates the
presence of a tumor in the target area of the subject. In preferred embodiments, the method may be used to diagnose or image a cancer in a subject. In some
embodiments, a method for detecting a tumor can comprise (a) exposing a suspected tumor to ionizing radiation; (b) biopsing a suspected tumor; (c) contacting an antibody of the invention with the suspected tumor in vitro; and (d) detecting the detectable label, whereby a tumor is diagnosed.
[0100] Binding may be detected using microscopy (fluorescent microscopy, confocal microscopy, or electron microscopy), magnetic resonance imaging (including MTI, MRS, DWI and fMRI), scintigraphic imaging (SPECT (Single Photon Emission Computed Tomography), PET (Positron Emission Tomography), gamma camera imaging, and rectilinear scanning), radiography, or ultrasound. The detectable label may be detectable in situ, in vivo, ex vivo, and in vitro.
[0101 ] The antibody compositions and subject are as described above. The cancer, the radiotherapy, and the administration of the compositions are described below.
[0102] An antibody of the invention may be used to treat or recognize a tumor derived from a neoplasm or a cancer. The neoplasm may be malignant or benign, the cancer may be primary or metastatic; the neoplasm or cancer may be early stage or late stage. Non-limiting examples of neoplasms or cancers that may be treated include acute lymphoblastic leukemia, acute myeloid leukemia, adrenocortical carcinoma, AIDS-related cancers, AIDS-related lymphoma, anal cancer, appendix cancer, astrocytomas (childhood cerebellar or cerebral), basal cell carcinoma, bile duct cancer, bladder cancer, bone cancer, brainstem glioma, brain tumors (cerebellar astrocytoma, cerebral astrocytoma/malignant glioma, ependymoma, medulloblastoma, supratentorial primitive neuroectodermal tumors, visual pathway and hypothalamic gliomas), breast cancer, bronchial adenomas/carcinoids, Burkitt lymphoma, carcinoid tumors (childhood, gastrointestinal), carcinoma of unknown primary, central nervous system lymphoma (primary), cerebellar astrocytoma, cerebral astrocytoma/malignant glioma, cervical cancer, childhood cancers, chronic lymphocytic leukemia, chronic myelogenous leukemia, chronic myeloproliferative disorders, colon cancer, cutaneous T-cell
lymphoma, desmoplastic small round cell tumor, endometrial cancer, ependymoma, esophageal cancer, Ewing's sarcoma in the Ewing family of tumors, extracranial germ cell tumor (childhood), extragonadal germ cell tumor, extrahepatic bile duct cancer, eye cancers (intraocular melanoma, retinoblastoma), gallbladder cancer, gastric (stomach) cancer, gastrointestinal carcinoid tumor, gastrointestinal stromal tumor, germ cell tumors (childhood extracranial, extragonadal, ovarian), gestational trophoblastic tumor, gliomas (adult, childhood brain stem, childhood cerebral astrocytoma, childhood visual pathway and hypothalamic), gastric carcinoid, hairy cell leukemia, head and neck cancer, hepatocellular (liver) cancer, Hodgkin lymphoma, hypopharyngeal cancer, hypothalamic and visual pathway glioma (childhood), intraocular melanoma, islet cell carcinoma, Kaposi sarcoma, kidney cancer (renal cell cancer), laryngeal cancer, leukemias (acute lymphoblastic, acute myeloid, chronic lymphocytic, chronic
myelogenous, hairy cell), lip and oral cavity cancer, liver cancer (primary), lung cancers (non-small cell, small cell), lymphomas (AIDS-related, Burkitt, cutaneous T-cell,
Hodgkin, non-Hodgkin, primary central nervous system), macroglobulinemia
(Waldenstrom), malignant fibrous histiocytoma of bone/osteosarcoma, medulloblastoma (childhood), melanoma, intraocular melanoma, Merkel cell carcinoma, mesotheliomas (adult malignant, childhood), metastatic squamous neck cancer with occult primary, mouth cancer, multiple endocrine neoplasia syndrome (childhood), multiple
myeloma/plasma cell neoplasm, mycosis fungoides, myelodysplastic syndromes, myelodysplastic/myeloproliferative diseases, myelogenous leukemia (chronic), myeloid leukemias (adult acute, childhood acute), multiple myeloma, myeloproliferative disorders (chronic), nasal cavity and paranasal sinus cancer, nasopharyngeal carcinoma, neuroblastoma, non-Hodgkin lymphoma, non-small cell lung cancer, oral cancer, oropharyngeal cancer, osteosarcoma/malignant fibrous histiocytoma of bone, ovarian cancer, ovarian epithelial cancer (surface epithelial-stromal tumor), ovarian germ cell tumor, ovarian low malignant potential tumor, pancreatic cancer, pancreatic cancer (islet cell), paranasal sinus and nasal cavity cancer, parathyroid cancer, penile cancer, pharyngeal cancer, pheochromocytoma, pineal astrocytoma, pineal germinoma, pineoblastoma and supratentorial primitive neuroectodermal tumors (childhood),
pituitary adenoma, plasma cell neoplasia, pleuropulmonary blastoma, primary central nervous system lymphoma, prostate cancer, rectal cancer, renal cell carcinoma (kidney cancer), renal pelvis and ureter transitional cell cancer, retinoblastoma,
rhabdomyosarcoma (childhood), salivary gland cancer, sarcoma (Ewing family of tumors, Kaposi, soft tissue, uterine), Sezary syndrome, skin cancers (nonmelanoma, melanoma), skin carcinoma (Merkel cell), small cell lung cancer, small intestine cancer, soft tissue sarcoma, squamous cell carcinoma, squamous neck cancer with occult primary (metastatic), stomach cancer, supratentorial primitive neuroectodermal tumor (childhood), T-Cell lymphoma (cutaneous), testicular cancer, throat cancer, thymoma (childhood), thymoma and thymic carcinoma, thyroid cancer, thyroid cancer (childhood), transitional cell cancer of the renal pelvis and ureter, trophoblastic tumor (gestational), enknown primary site (adult, childhood), ureter and renal pelvis transitional cell cancer, urethral cancer, uterine cancer (endometrial), uterine sarcoma, vaginal cancer, visual pathway and hypothalamic glioma (childhood), vulvar cancer, Waldenstrom
macroglobulinemia, and Wilms tumor (childhood). In specific embodiments, the neoplasm or cancer is non-small cell lung carcinoma.
[0103] Suitable therapeutic agents for neoplasms and cancers are known in the art, and will depend upon the type and stage of cancer. Suitable therapeutic agents are described in Section I. Summaries of cancer drugs, including information regarding approved indications, may be found via the National Cancer Institute at the National Insitutes of Health (www.cancer.gov/cancertopics/druginfo/alphalist) and the FDA Approved Drug Product database (www.accessdata.fda.gov/scripts/cder/drugsatfda/). In a specific embodiment, the cancer is non-small cell lung carcinoma. Suitable
therapeutics agents for the treatment of non-small cell lung carcinoma include, but are not limited to, EGFR inihbitors, VEGF inhibitors, tyrosine kinase inhibitors, and chemotherapeutics. Non-limiting examples of drugs approved for the treatment of NSCLC include methotrexate, Abraxane, Afatinib, Alimta, Avastin, Bevacizumab, Carboplatin, Cisplatin, Crizotinib, Erlotinib hydrochloride, Folex, Folex PFS, gefitinib, Gilotrif, Gemcitabine hydrochloride, Gemzar, Iressa, Methotrexate, Mexate, Mexate-AQ,
Paclitaxel, Paclitaxel-albumin stabilized nanoparticle formulation, Paraplat, Paraplatin, Platinol, Tarceva, Taxol, and Xalkori.
[0104] In an aspect, the method comprises exposing a target area of a subject where the presence of a tumor is suspected to ionizing radiation. Low doses of radiation can be used for selective targeting using the antibody compositions disclosed herein. In some embodiments, the dose of radiation comprises up to about 2 Gy ionizing radiation. Higher radiation doses can also be used, especially in the case of local radiation treatment as described hereinbelow.
[0105] Radiation can be localized to a tumor using conformal irradiation, brachytherapy, or stereotactic irradiation. The threshold dose for inductive changes can thereby be exceeded in the target tissue but avoided in surrounding normal tissues. A "target tissue" as used herein refers to an intended site for accumulation of an antibody following administration to a subject. For example, the methods disclosed herein can employ a target tissue comprising an irradiated tumor. A "control tissue" as used herein refers to a site suspected to substantially lack binding and/or accumulation of an administered antibody. For example, in accordance with the methods of the presently disclosed subject matter, a non-irradiated tumor and a non-cancerous tissue are control tissues. In some embodiments, doses of at least about 2 Gy ionizing radiation can be used, and in some embodiments a dose of about 10 Gy to about 20 Gy ionizing radiation can be used. For treatment of a subject having two or more tumors, local irradiation enables differential drug administration and/or dose at each of the two or more tumors. Alternatively, whole body irradiation can be used, as permitted by the low doses of radiation required for targeting of antibodies disclosed herein. Radiotherapy methods suitable for use in the practice of the presently disclosed subject matter can be found in Leibel & Phillips, 1998, among other sources.
[0106] In an embodiment, the radiation treatment comprises administration of less than about 2 Gy ionizing radiation. In another embodiment, the radiation treatment comprises at least about 2 Gy ionizing radiation, in some embodiments about 2 Gy to about 3 Gy ionizing radiation, and in some embodiments about 2 Gy to about 6 Gy
ionizing radiation. In other embodiments, radiation treatment comprises about 10 Gy to about 20 Gy ionizing radiation.
[0107] Administration of a composition to a subject can be performed by irradiating the tumor prior to, concurrent with, or subsequent to administration of a composition of the invention. Accordingly, the tumor is irradiated in some embodiments 0 hours to about 24 hours before administration of the composition, and in some embodiments about 4 hours to about 24 hours before administration of the composition.
[0108] In certain aspects, a pharmacologically effective amount of an antibody of the invention, including immunologically reactive fragments, may be administered to a subject. Administration is performed using standard effective techniques, including peripherally (i.e. not by administration into the central nervous system) or locally to the central nervous system. Peripheral administration includes but is not limited to intravenous, intraperitoneal, subcutaneous, pulmonary, transdermal, intramuscular, intranasal, buccal, sublingual, or suppository administration. Local administration, including directly into the central nervous system (CNS) includes but is not limited to via a lumbar, intraventricular or intraparenchymal catheter or using a surgically implanted controlled release formulation.
[0109] Pharmaceutical compositions for effective administration are
deliberately designed to be appropriate for the selected mode of administration, and pharmaceutically acceptable excipients such as compatible dispersing agents, buffers, surfactants, preservatives, solubilizing agents, isotonicity agents, stabilizing agents and the like are used as appropriate. Remington's Pharmaceutical Sciences, Mack
Publishing Co., Easton Pa., 16Ed ISBN: 0-912734-04-3, latest edition, incorporated herein by reference in its entirety, provides a compendium of formulation techniques as are generally known to practitioners. It may be particularly useful to alter the solubility characteristics of the antibodies useful in this discovery, making them more lipophilic, for example, by encapsulating them in liposomes or by blocking polar groups.
[01 10] Effective peripheral systemic delivery by intravenous or intraperitoneal or subcutaneous injection is a preferred method of administration to a living patient. Suitable vehicles for such injections are straightforward. In addition, however,
administration may also be effected through the mucosal membranes by means of nasal aerosols or suppositories. Suitable formulations for such modes of administration are well known and typically include surfactants that facilitate cross-membrane transfer. Such surfactants are often derived from steroids or are cationic lipids, such as N-[1 -(2,3- dioleoyl)propyl]-N,N,N-trimethyl ammonium chloride (DOTMA) or various compounds such as cholesterol hemisuccinate, phosphatidyl glycerols and the like.
[01 1 1 ] The concentration of antibody in formulations to be administered is an effective amount and ranges from as low as about 0.1 % by weight to as much as about 15 or about 20% by weight and will be selected primarily based on fluid volumes, viscosities, and so forth, in accordance with the particular mode of administration selected if desired. A typical composition for injection to a living patient could be made up to contain 1 mL sterile buffered water of phosphate buffered saline and about 1 -1000 mg of any one of or a combination of the humanized antibody of the present discovery. In a specific embodiment, the antibody composition may have 100-300 mg of antibody per administration. The formulation could be sterile filtered after making the formulation, or otherwise made microbiologically acceptable. A typical composition for intravenous infusion could have volumes between 1 -250 mL of fluid, such as sterile Ringer's solution, and 1 -100 mg per ml, or more in anti-14-3-3 episilon antibody concentration. Therapeutic agents of the discovery can be frozen or lyophilized for storage and reconstituted in a suitable sterile carrier prior to use. Lyophilization and reconstitution may lead to varying degrees of antibody activity loss (e.g. with conventional immune globulins, IgM antibodies tend to have greater activity loss than IgG antibodies).
Dosages administered are effective dosages and may have to be adjusted to
compensate. The pH of the formulations generally pharmaceutical grade quality, will be selected to balance antibody stability (chemical and physical) and comfort to the patient when administered. Generally, a pH between 4 and 8 is tolerated. Doses will vary from individual to individual based on size, weight, and other physiobiological characteristics of the individual receiving the successful administration.
[01 12] For therapeutic applications, a therapeutically effective amount of a composition of the invention is administered to a subject. A "therapeutically effective
amount" is an amount of the therapeutic composition sufficient to produce a measurable biological tumor response (e.g., an immunostimulatory, an anti-angiogenic response, a cytotoxic response, or tumor regression). Actual dosage levels of active ingredients in a therapeutic composition of the invention can be varied so as to administer an amount of the active compound(s) that is effective to achieve the desired therapeutic response for a particular subject. The selected dosage level will depend upon a variety of factors including the activity of the therapeutic composition, formulation, the route of
administration, combination with other drugs or treatments, tumor size and longevity, and the physical condition and prior medical history of the subject being treated. In some embodiments, a minimal dose is administered, and dose is escalated in the absence of dose-limiting toxicity. Determination and adjustment of a therapeutically effective dose, as well as evaluation of when and how to make such adjustments, are known to those of ordinary skill in the art of medicine. In an aspect, a typical dose contains from about 0.01 mg/kg to about 100 mg/kg of an anti-14-3-3 epsilon antibody described herein. Doses can range from about 0.05 mg/kg to about 50 mg/kg, more preferably from about 0.1 mg/kg to about 25 mg/kg.
[01 13] For diagnostic applications, a detectable amount of a composition of the invention is administered to a subject. A "detectable amount", as used herein to refer to a diagnostic composition, refers to a dose of such a composition that the presence of the composition can be determined in vivo or in vitro. A detectable amount will vary according to a variety of factors, including but not limited to chemical features of the drug being labeled, the detectable label, labeling methods, the method of imaging and parameters related thereto, metabolism of the labeled drug in the subject, the stability of the label (e.g. the half-life of a radionuclide label), the time elapsed following administration of the drug and/or labeled antibody prior to imaging, the route of drug administration, the physical condition and prior medical history of the subject, and the size and longevity of the tumor or suspected tumor. Thus, a detectable amount can vary and can be tailored to a particular application. After study of the present disclosure, and in particular the Examples, it is within the skill of one in the art to determine such a detectable amount.
[01 14] The frequency of dosing may be daily or once, twice, three times or more per week or per month, as needed as to effectively treat the symptoms. The timing of administration of the treatment relative to the disease itself and duration of treatment will be determined by the circumstances surrounding the case. Treatment could begin immediately, such as at the site of the injury as administered by emergency medical personnel. Treatment could begin in a hospital or clinic itself, or at a later time after discharge from the hospital or after being seen in an outpatient clinic. Duration of treatment could range from a single dose administered on a one-time basis to a life-long course of therapeutic treatments.
[01 15] Although the foregoing methods appear the most convenient and most appropriate and effective for administration of proteins such as antibodies, by suitable adaptation, other effective techniques for administration, such as intraventricular administration, transdermal administration and oral administration may be employed provided proper formulation is utilized herein.
[01 16] In addition, it may be desirable to employ controlled release
formulations using biodegradable films and matrices, or osmotic mini-pumps, or delivery systems based on dextran beads, alginate, or collagen.
[01 17] Typical dosage levels can be determined and optimized using standard clinical techniques and will be dependent on the mode of administration.
III. KITS
[01 18] In another aspect, a kit is provided for use in diagnostic or therapeutic embodiments of the invention. The kit includes an antibody of the invention, and a detectable label, therapeutic agent, chelating agent, and/or a linker, as described in
Section I. In an embodiment, each component of the kit (an antibody and a detectable label, therapeutic agent, chelating agent, and/or linker) is separately packaged in the kit. In another preferred embodiment, the kit includes a predetermined amount of the antibody and the detectable label, therapeutic agent, chelating agent, and/or linker (e.g., an amount sufficient for diagnosing or treating cancer in a subject). The antibody and the detectable label, therapeutic agent, chelating agent, and/or linker can be lyophilized
to enable long-term storage. The antibody and detectable label, therapeutic agent, chelating agent, and/or linker may be sealed in a sterilized container. The kit preferably includes instructions for using the kit and its contents.
TABLE B. Sequence listings
Human 14-3-3 epsilon: MVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKE isoform SV ENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKV
FYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPT
HPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYK
DSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ
EXAMPLES
[01 19] The following examples are included to demonstrate preferred
embodiments of the invention. It should be appreciated by those of skill in the art that the techniques disclosed in the examples that follow represent techniques discovered by the inventors to function well in the practice of the invention. Those of skill in the art should, however, in light of the present disclosure, appreciate that many changes can be made in the specific embodiments that are disclosed and still obtain a like or similar result without departing from the spirit and scope of the invention, therefore all matter set forth or shown in the accompanying examples and drawings is to be interpreted as illustrative and not in a limiting sense.
Example 1. Targeting of Radiation Inducible Antigen on Human Lung Cancer
Cells.
[0120] Irradiation of cancer elicits a stress response with transport of stored proteins to the surface of cancer cells. These inducible surface proteins can be
exploited as targets for antibody based immunotherapy to destroy cancer cells. In order to develop monoclonal antibodies (McAb) targeted to radiation-inducible neoantigens, subtractive immunization was employed to produce antibodies against surface proteins on irradiated lung cancer tumor model H23.
[0121 ] OGy or 3Gy x 3 irradiated H23; H460 and H520 cells were used as antigen for subtractive immunization. Cyclophosphamide was used as an immuno- suppressing reagent. The mice with high immune response to irradiated cancer cells were chosen for cell fusion. The hybridomas were screened using both cells by FMAT and Dot-blot assays.
[0122] The McAb was used to detect the induced antigen on OGy and 3Gy treated H23 cells by immunohistochemistry (IHC) and immunofluorescence (IF). ADCP
and ELISPOT assays were applied to monitor antibody activation of the immune response. Cancer cells were pre-reacted with McAb labeled with a red dye then co- culture with mouse dendritic cells (MDC). The cells were then fixed and stained with DAPI. Stained cells were counted in 50 microscopic fields. Co-culture of antibody coated tumor cells and MDC were primary injected to C57BL/6J mice in groups and boosted. Specific numbers of lymphocytes from spleens were added to the wells that were coated with anti mouse INF-γ. IFN-γ was detected by ELISPOT. The mouse model Human lung cancer, H23, was used to study cancer specific binding by McAbs. Normal mouse IgG was used as a control antibody. Affinity purified antigen from H23 cells was detected and the antigen was analyzed by proteomics.
[0123] Antibody 7D4 showed high specificity and affinity to irradiated H23 cells. The intensity of binding on tumor cells increased in response to irradiation while OGy or control antibody on irradiated H23 was negative on IHC and IF assays.
[0124] ADCP and ELISPOT indicated that the antibody binds to irradiated H23 cells co-cultured with activated MDC, the phagocytic events increased with increasing irradiation dosage while OGy or control antibody was absent. Moreover, the INF-γ levels on ELISPOT increased with the irradiation dosages and highest level at 3Gy x 3 group. This indicated that immune responses can be triggered by the antibody through ADCP and increasing of IFN-gamma from lymphocytes.
[0125] Near infrared images of mice showed that the fluorophore-conjugated antibody bound to irradiated tumors in the 3Gy x 3 group for 240 hours while the 3Gy x 1 group showed a lower level of binding. In contrast the OGy group and control antibody group showed minimal to no tumor binding.
[0126] Western immunoblot showed a specific band with molecular weight over 25 kDa using this antibody. The intensity of this band increased with the dosage of irradiation on H23 and highest intensity occurred in 3Gy x 3. Proteomics analysis revealed that the 25 kDa molecule is 14-3-3 epsilon. The commercial anti-14-3-3 epsilon antibody confirmed this radiation-inducibility.
[0127] In summary, a McAb against IR induced antigen on H23 by subtractive immunization was produced and it selectively binds to the cells with increased intensity
on treated H23 cells. Immune response to opsonized tumor cells includes ADCP and IFN-gamma induction in T-lymphocytes 14-3-3 epsilon is a radiation-inducible
neoantigen.
Example 2. 14-3-3 Protein Epsilon Epitope Mapping.
[0128] The human 14-3-3 epsilon epitope and human 14-3-3 epsilon isoform SV epitope recognized by antibody 7D4 was determined by epitope mapping using peptides from whole human 14-3-3 protein epsilon sequence (Sigma Aldrich). These peptides span the full length of human 14-3-3 epsilon isoform 1 and 14-3-3 epsilon isoform SV. Each peptide contains 18 amino acids from N-terminal to C-terminal. Two amino acids overlap in each peptide, for a total of 31 peptides.
[0129] Two batches of purified anti 14-3-3 epsilon monoclonal antibody 7D4 were used for testing all 31 peptides by ELISA. Three concentrations of each peptide had been used for coating ELISA plate at 30, 15, 10 pg/mL, 50 μΙ/each well were reacted against diluted purified antibodies at same concentration in all assay. Similar results were obtained for each peptide concentration coated on the ELISA plate.
[0130] The epitope mapping experiments showed that the monoclonal antibody reacted with high absorbance (strong binding) to a peptide comprising amino acids 177-194 of 14-3-3 epsilon isoform 1 (FIG. 1), and with light to medium absorbance (moderate binding) to a peptide comprising amino acids 145-162 of 14-3-3 epsilon SV (FIG. 2).
Example 3. Anti-14-3-3 Epsilon Antibody Displays Specificity for Irradiated Cancer Cells.
[0131 ] H23 human lung cancer cells were irradiated with 3Gyx3. Cells were treated with 4% paraformaldehyde and rehydrated. Cells were then treated with blocking buffer followed by the addition of the 7D4 mouse monoclonal antibody to 14-3- 3 epsilon. Cells were then washed and incubated with the secondary antibody conjugated to HRP. Cells were then stained with DAB and counterstained with
Hematoxylin.
[0132] Shown in FIG. 3 is the immunocytochemistry of 7D4 antibody binding to human lung cancer cell H23 following irradiation. These data show that the 7D4 mouse monoclonal antibody binds to lung cancer cells following treatment with radiation with minimal binding to cells that were not treated with radiation (lower panel). A commercial antibody to 14-3-3 was used as a positive control and shown in the center panels. This also showed that the anti-14-3-3 epsilon antibody binds following
irradiation. The negative control was secondary antibody that showed no increased binding to H23 cells without irradiation.
[0133] To determine normal tissue cross reactivity, antibody binding to normal tissues was evaluated. Antibody binding to colon, liver, lung, pancreas, kidney and tongue was examined (FIG. 4A,B) These immunohistochemistry experiments showed that the 7D4 mouse monoclonal antibody to 14-3-3 epsilon showed no binding to colon, liver, pancreas, kidney or tongue. There was minimal binding to the lung. In comparison, the isotype control on secondary antibodies showed no binding to any organ.
[0134] FIG. 5 shows flow cytometry of antibody binding to human lung cancer cell model H23. H23 cells were treated with radiation, 3Gyx3. Cells were then treated with blocking buffer followed by the addition of the anti-14-3-3 epsilon antibody. Cells were then washed and stained with the secondary antibody conjugated to the
fluorescent marker Alexa Fluor 488. Shown in FIG. 5 is the percentage of cells staining positive with the anti-14-3-3 antibodies. Cells treated with 3Gyx3 showed a 20 fold increase in the percentage of cells staining positive with the 7D4 antibody following irradiation. In comparison, only 4% of cells showed positive staining with no irradiation. The commercial antibody showed less radiation induced binding as compared to the 7D4 monoclonal. Control antibodies included isotype control and secondary antibody following irradiation which showed no increase in antibody binding.
Example 4. Anti-14-3-3 Epsilon Antibody Activates Phagocytosis by Dendritic Cells and Monocytic Cells.
[0135] FIG. 6 shows that the 7D4 antibody activates phagocytosis by dendritic cells and monocytic cells. H23 cells were treated with 3Gyx3 and incubated with the
7D4 monoclonal antibody to 14-3-3 epsilon. FIG. 6A-C shows that incubation with the antibody following irradiation activates phagocytosis of the antibody coated cancer cells. In comparison, the isotype control shows no increase in phagocytosis. The number of dendritic cells that activate phagocytosis were then quantified by use of flow cytometry. FIG. 6D shows the quantification of phagocytosis. H23 cells were labeled with the fluorescent marker Dil. Dil is contained in the cell membrane and is incorporated into phagocytic cells. The number of dendritic cells that engulf Dil from H23 cells was then quantified. FIG. 6D shows that H23 cells treated with 3Gyx3 activated phagocytosis in 32 cells. In comparison, lower dose irradiation activated phagocytosis in 18 cells. Cells treated with no radiation activated phagocytosis in 14 cells. The negative control was the isotype control IgG which activated phagocytosis in 7 dendritic cells.
[0136] FIG. 7 shows data of antigen presenting dendritic cells from FIG. 6 cocultured with T cells. Lung cancer antigen presentation to T cells by the activated dendritic cells from FIG. 6 was studied. In this experiment, dendritic cells from FIG. 6 were cocultured with CD4 and CD8 T lymphocytes. FIG. 6A-C shows the production of interferon-gamma in cells treated with dendritic cells. These ELISPOTs show that T cells treated with dendritic cells from irradiated H23 cancers coated with 7D4
monoclonal antibody to 14-3-3 showed the greatest amount of T cell activation. FIG. 7B shows the quantification of interferon production. The number of cells producing interferon-gamma were counted. Cells treated with 3Gyx3 followed by the 7D4 mouse monoclonal to 14-3-3 and the mouse dendritic cells showed the greatest number of T cell activation. In comparison, cells treated with radiation and antibody alone without dendritic cells showed a modest T cell activation. Likewise, cells treated with radiation and isotype control antibody showed modest T cell activation. Negative controls showed minimal T cell activation. These findings indicate that the 7D4 anti-14-3-3 epsilon antibody can activate phagocytosis and human lung cancer antigen presentation to T cells.
References
1 . Zhang Q, Matzke M, Schepmoes A, Moore RJ, Webb-Robertson B, Hu Z, Monroe M, Qian W-J, Smith R, Morgan W. High and Low Doses of Ionizing Radiation Induce Different Secretome Profiles in a Human Skin Model. PLOS One 9(3):
e92332 doi:10.1371 . 2014
2. Tang S, Bao H, Zhang Y, Yao J, Yang P, Chen X. 14-3-3ε Mediates the Cell Fate Decision-Making Pathways in Response of Hepatocellular Carcinoma to Bleomycin- Induced DNA Damage. PLOS One 8(3): e55268 doil 0.1371 . 2013
3. Aristizabal-Corrales D, Fontrodona L, Porta-de-la-Riva M, Guerra-Moreno A, Ceron J, Schartz S. Overexpression of proteins 14-3-3 related to chemotherapy
resistance. J Cell Sci, 125:1716-1726. 2012
4. Qu, Wenqing; Martinez, Jesse. Reduction of 14-3-3 Proteins Correlates with
Increased Sensitivity to Killing of Human Lung Cancer Cells by Ionizing Radiation. Radiation Research, 160(2): 217-223. 2003
5. Jarillo JA, Capel J, Leyva A, Martinez-Zapater JM, Salinas J. Two related low- temperature-inducible genes of Arabidopsis encode proteins showing high homology to 14-3-3 proteins, a family of putative kinase regulators. Plant Mol Biol, 25(4): 693-704. 1994
Claims
1 . A cell line, the cell line expressing an antibody comprising an amino acid sequence selected from the group consisting of SEQ ID NO:3 and SEQ ID NO:4, wherein the antibody specifically binds 14-3-3 epsilon.
2. The cell line of claim 1 , wherein the antibody is encoded by a nucleic acid
sequence comprising a nucleic acid sequence selected from the group consisting of SEQ ID NO:1 and SEQ ID NO:2.
3. An isolated antibody, wherein the antibody specifically binds 14-3-3 epsilon and comprises a heavy chain CDR3 comprising the amino acid sequence of SEQ ID NO:10 with zero to two amino acid substitutions.
4. The isolated antibody of claim 3, wherein the antibody further comprises an amino acid sequence selected from the group consisting of SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, and SEQ ID NO:9
5. The isolated antibody of claim 4, wherein the antibody is encoded by a nucleic acid sequence comprising a nucleic acid sequence selected from the group consisting of SEQ ID NO:1 and SEQ ID NO:2.
6. The isolated antibody of claim 3, further comprising SEQ ID NO:8 and SEQ ID NO:9, each with zero to two amino acid substitutions.
7. The isolated antibody of claim 3, wherein the antibody further comprises SEQ ID NO:7.
8. The isolated antibody of claim 3, wherein the antibody further comprises at least three amino acid sequences selected from the group consisting of SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8 and SEQ ID NO:9.
9. An isolated antibody, wherein the antibody specifically binds 14-3-3 epsilon and comprises a light chain CDR3 comprising the amino acid sequence of SEQ ID NO:7 with zero to two amino acid substitutions.
10. The isolated antibody of claim 9, further comprising the amino acid sequence of SEQ ID NO:5 with zero to two amino acid substitutions and the amino acid sequence of SEQ ID NO:6 with zero to two amino acid substituions.
1 1 . The isolated antibody of claim 10, further comprising the amino acid sequence of SEQ ID NO:8, SEQ ID NO:9 and SEQ ID NO:10, wherein each amino acid sequence has between zero and two amino acid substitutions.
12. An isolated antibody of any of the preceding claims, wherein the antibody is
selected from the group consisting of a single-chain antibody, an antibody fragment, a chimeric antibody, or a humanized antibody.
13. An isolated antibody of any of the preceding claims, wherein the antibody is
conjugated directly or indirectly to a payload selected from the group consisting of a detectable label, a therapeutic agent, or a combination thereof.
14. An isolated antibody of any of the preceding claims, wherein the antibody is
conjugated directly or indirectly to a nanoparticle or a liposome.
15. The isolated antibody of the preceding claim, wherein at least one detectable label or at least one therapeutic agent is conjugated to, embedded in, or contained within the nanoparticle or liposome.
16. The isolated antibody of claim 13 or claim 15, wherein the detectable label and/or therapeutic agent is a radionuclide.
17. A method of detecting a tumor in a subject, the method comprising:
a) exposing a target area of the subject where the presence of a tumor is suspected to ionizing radiation;
b) administering to the subject a composition to detect the presence of 14-3- 3 epsilon in the target area, wherein the composition comprises one or more targeting antibodies, wherein each targeting antibody specifically binds to 14-3-3 epsilon exposed on an irradiated cell and is conjugated to a detectable label; and
c) detecting the detectable label to detect the presence of 14-3-3 epsilon, wherein the presence of 14-3-3 epsilon indicates the presence of a tumor in the target area of the subject.
18. The method of claim 17, wherein the exposing comprises exposing the tumor to less than about 2 Gy ionizing radiation.
19. The method of claim 18, wherein the exposing comprises exposing the tumor to at least about 2 Gy ionizing radiation.
20. The method of claim 19, wherein the exposing comprises exposing the tumor to about 10 Gy to about 20 Gy ionizing radiation.
21 . The method of claim 17, wherein the administering comprises administering the antibody subsequent to radiation exposure.
22. The method of claim 17, wherein the administering comprises administering the antibody 0 hours to about 24 hours following radiation exposure.
23. The method of claim 22, wherein the administering comprises administering the antibody about 4 hours to about 24 hours following radiation exposure.
24. The method of claim 17, wherein the detectable label is a radionuclide.
25. The method of claim 24, wherein the detecting comprises detecting the
radionuclide label using positron emission tomography, single photon emission computed tomography, gamma camera imaging, or rectilinear scanning.
26. The method of claim 17, wherein the tumor is a lung carcinoma.
27. A method of enhancing radiotherapy in a subject, the method comprising
administering a pharmacologically effective amount of an isolated anti-14-3-3 epsilon antibody of claim 13 or claim 15 to the subject, such that radiotherapy is enhanced.
28. The method of claim 27, wherein the subject has cancer.
29. The method of claim 28, wherein the cancer is lung carcinoma.
30. A method of delivering a therapeutic agent to a cell expressing 14-3-3 epsilon in a subject, the method comprising:
a. exposing a target area of the subject where the presence of a tumor is suspected to ionizing radiation; and
b. administering an isolated anti-14-3-3 epsilon antibody of claim 13 or claim 15 to the subject.
31 . A method of detecting 14-3-3 epsilon in a sample, the method comprising (i) obtaining a sample, and (ii) detecting and/or measuring the amount of 14-3-3 epsilon in the sample using an antibody of claim 3.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US15/054,691 US10066008B2 (en) | 2013-08-28 | 2016-02-26 | Monoclonal antibodies to human 14-3-3 epsilon and human 14-3-3 epsilon sv |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201361871115P | 2013-08-28 | 2013-08-28 | |
| US61/871,115 | 2013-08-28 | ||
| US201361907677P | 2013-11-22 | 2013-11-22 | |
| US61/907,677 | 2013-11-22 |
Related Child Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US15/054,691 Continuation-In-Part US10066008B2 (en) | 2013-08-28 | 2016-02-26 | Monoclonal antibodies to human 14-3-3 epsilon and human 14-3-3 epsilon sv |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2015031645A1 true WO2015031645A1 (en) | 2015-03-05 |
Family
ID=52587337
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2014/053207 Ceased WO2015031645A1 (en) | 2013-08-28 | 2014-08-28 | Monoclonal antibodies to human 14-3-3 epsilon and human 14-3-3 epsilon sv |
Country Status (2)
| Country | Link |
|---|---|
| US (1) | US10066008B2 (en) |
| WO (1) | WO2015031645A1 (en) |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10066008B2 (en) | 2013-08-28 | 2018-09-04 | Washington University | Monoclonal antibodies to human 14-3-3 epsilon and human 14-3-3 epsilon sv |
| IT201900014541A1 (en) * | 2019-08-09 | 2021-02-09 | Humanitas Mirasole Spa | Peptides, antigens and their use |
Families Citing this family (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11421005B2 (en) | 2016-12-09 | 2022-08-23 | The Uab Research Foundation | Chimeric chlorotoxin receptors |
Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2009067820A1 (en) * | 2007-11-27 | 2009-06-04 | The University Of British Columbia | 14-3-3 antagonists for the prevention and treatment of arthritis |
| US20120093819A1 (en) * | 2008-11-03 | 2012-04-19 | National Research Council Of Canada | Antibodies that specifically block the biological activity of a tumor antigen |
Family Cites Families (14)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4394448A (en) | 1978-02-24 | 1983-07-19 | Szoka Jr Francis C | Method of inserting DNA into living cells |
| US4529561A (en) | 1978-03-24 | 1985-07-16 | The Regents Of The University Of California | Method for producing liposomes in selected size range |
| US4241046A (en) | 1978-11-30 | 1980-12-23 | Papahadjopoulos Demetrios P | Method of encapsulating biologically active materials in lipid vesicles |
| US4925661A (en) | 1984-04-19 | 1990-05-15 | Leaf Huang | Target-specific cytotoxic liposomes |
| US4957735A (en) | 1984-06-12 | 1990-09-18 | The University Of Tennessee Research Corporation | Target-sensitive immunoliposomes- preparation and characterization |
| US4755388A (en) | 1984-11-09 | 1988-07-05 | The Regents Of The University Of California | Liposome-encapsulated 5-fluoropyrimidines and methods for their use |
| DE3542773A1 (en) | 1985-12-04 | 1987-06-11 | Roehm Pharma Gmbh | SKIN-ACTIVE PHARMACA WITH LIPOSOMES AS AN ACTIVE SUBSTANCE |
| US4828837A (en) | 1987-03-30 | 1989-05-09 | Liposome Technology, Inc. | Non-crystalline minoxidil composition, its production and application |
| US5077211A (en) | 1988-07-06 | 1991-12-31 | Applied Genetics, Inc. | Purification and administration of dna repair enzymes |
| US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5043164A (en) | 1989-01-17 | 1991-08-27 | The University Of Tennessee Research Corporation | Blood-stable, cholesterol-free liposomes |
| US5064655A (en) | 1989-02-24 | 1991-11-12 | Liposome Technology, Inc. | Liposome gel composition and method |
| US5264618A (en) | 1990-04-19 | 1993-11-23 | Vical, Inc. | Cationic lipids for intracellular delivery of biologically active molecules |
| WO2015031645A1 (en) | 2013-08-28 | 2015-03-05 | Washington University | Monoclonal antibodies to human 14-3-3 epsilon and human 14-3-3 epsilon sv |
-
2014
- 2014-08-28 WO PCT/US2014/053207 patent/WO2015031645A1/en not_active Ceased
-
2016
- 2016-02-26 US US15/054,691 patent/US10066008B2/en active Active
Patent Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2009067820A1 (en) * | 2007-11-27 | 2009-06-04 | The University Of British Columbia | 14-3-3 antagonists for the prevention and treatment of arthritis |
| US20120093819A1 (en) * | 2008-11-03 | 2012-04-19 | National Research Council Of Canada | Antibodies that specifically block the biological activity of a tumor antigen |
Non-Patent Citations (3)
| Title |
|---|
| ICHIKAWA A. ET AL.: "Molecular analysis of cross-reactive human monoclonal antibody AE6F4 generated by in vitro immunization: Epitope mapping of AE6F4 antibody on 14-3-3 family proteins and cytokeratin 8.", CYTOTECHNOLOGY, vol. 36, no. 1-3, 2001, pages 101 - 107 * |
| MARTIN H. ET AL.: "Antibodies against the major brain isoforms of 14-3-3 protein: An antibody specific for the N-acetylated ammo-terminus of a protein.", FEBS LETTERS, vol. 331, no. 3, 1993, pages 296 - 303 * |
| QI W. ET AL.: "Reduction of 14-3-3 proteins correlates with increased sensitivity to killing of human lung cancer cells by ionizing radiation.", RADIATION RESEARCH, vol. 160, no. 2, 2003, pages 217 - 223 * |
Cited By (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10066008B2 (en) | 2013-08-28 | 2018-09-04 | Washington University | Monoclonal antibodies to human 14-3-3 epsilon and human 14-3-3 epsilon sv |
| IT201900014541A1 (en) * | 2019-08-09 | 2021-02-09 | Humanitas Mirasole Spa | Peptides, antigens and their use |
| WO2021028337A1 (en) * | 2019-08-09 | 2021-02-18 | Humanitas Mirasole S.P.A. | Peptide antigens and uses thereof |
| CN114729024A (en) * | 2019-08-09 | 2022-07-08 | 博爱米拉索勒股份公司 | Peptide antigens and their uses |
Also Published As
| Publication number | Publication date |
|---|---|
| US10066008B2 (en) | 2018-09-04 |
| US20160194388A1 (en) | 2016-07-07 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US11427648B2 (en) | Anti-CD146 antibodies and uses thereof | |
| US11359008B2 (en) | Compositions and methods for treating HIF-1a over-expressing cancers | |
| EP4245322A1 (en) | Treatment for mesothelioma through administration of anti-b7-h3 antibody-drug conjugate | |
| TW200825106A (en) | Tumor therapy with an anti-VEGF antibody | |
| TW200820987A (en) | Tumor therapy with a combination of anti-HER2 antibodies | |
| US20160199500A1 (en) | Compositions comprising vitamin b12 and intrinsic factor and methods of use thereof | |
| JP2019525910A (en) | Imaging and therapy aimed at granzyme B | |
| WO2013019730A1 (en) | Antibodies to tip-1 and grp78 | |
| US10066008B2 (en) | Monoclonal antibodies to human 14-3-3 epsilon and human 14-3-3 epsilon sv | |
| US11352436B2 (en) | Antibodies to TIP1 and methods of use thereof | |
| US10758612B2 (en) | Antibodies to tumor associated complex N-glycans with terminal GlcNAcβ residues and methods of use thereof | |
| JP2003520250A (en) | Use of anti-ferritin monoclonal antibodies in the treatment of some cancers | |
| US10449261B2 (en) | Compositions targeting radiation-induced molecules and methods of use thereof | |
| WO2016073647A2 (en) | COMPOSITIONS AND METHODS FOR TREATING HIF-1alpha OVER-EXPRESSING CANCERS | |
| CN117813326A (en) | Radiation-Based Detection, Companion Testing, and Treatment of Directin-1 | |
| JP2022541765A (en) | ANTI-GRP78 ANTIBODY AND METHODS OF USE THEREOF | |
| Ducharme | Strategies for HER2 Targeted Pet Imaging | |
| HK40091702A (en) | Treatment for mesothelioma through administration of anti-b7-h3 antibody-drug conjugate | |
| Whelan | Monoclonal Antibodies in the Treatment of Asthma | |
| AU2006275260A1 (en) | Cancerous disease modifying antibodies | |
| TW200936609A (en) | Cancerous disease modifying antibodies | |
| TW200938635A (en) | Cancerous disease modifying antibodies |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 14839489 Country of ref document: EP Kind code of ref document: A1 |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 14839489 Country of ref document: EP Kind code of ref document: A1 |

