WO2015028537A1 - Method for the isolation of recombinant prion protein and the use thereof - Google Patents
Method for the isolation of recombinant prion protein and the use thereof Download PDFInfo
- Publication number
- WO2015028537A1 WO2015028537A1 PCT/EP2014/068226 EP2014068226W WO2015028537A1 WO 2015028537 A1 WO2015028537 A1 WO 2015028537A1 EP 2014068226 W EP2014068226 W EP 2014068226W WO 2015028537 A1 WO2015028537 A1 WO 2015028537A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- rprp
- protein
- seq
- imidazole
- qulc
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K1/00—General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length
- C07K1/14—Extraction; Separation; Purification
- C07K1/16—Extraction; Separation; Purification by chromatography
- C07K1/22—Affinity chromatography or related techniques based upon selective absorption processes
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
- G01N33/6893—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids related to diseases not provided for elsewhere
- G01N33/6896—Neurological disorders, e.g. Alzheimer's disease
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/28—Neurological disorders
- G01N2800/2814—Dementia; Cognitive disorders
- G01N2800/2828—Prion diseases
Definitions
- the present invention is concerned with Imidazole-cascade elution (ICE), which is a method for isolating distinct fractions from a source of self-aggregating protein. Specifically, it is concerned with the isolation of a highly purified recombinant prion protein (rPrP), the use of the recombinant protein in detecting scrapie prion protein (PrP Sc ) in food samples or in samples obtained from mammals, such as humans, and a kit comprising highly purified rPrP for use for detecting PrP Sc .
- ICE Imidazole-cascade elution
- TSEs Transmissible spongiform encephalopathies
- CNS central nervous system
- TSEs of humans include sporadic and genetic Creutzfeldt-Jakob disease, variant Creutzfeldt-Jakob disease (vCJD), a human disorder caused by the infectious agent of bovine spongiform encephalopathy (BSE), Gerstmann-Straussler-Scheinker syndrome, fatal familial insomnia and kuru.
- TSEs of other mammals include BSE of cattle, scrapie of sheep and goats, feline spongiform encephalopathy (FSE) of cats, transmissible mink encephalopathy (TME) of minks, exotic ungulate encephalopathy (EUE) of Nyala and Greater Kudu, as well as chronic wasting disease (CWD) of deer and elk.
- FSE feline spongiform encephalopathy
- TSE transmissible mink encephalopathy
- EUE exotic ungulate encephalopathy
- CWD chronic wasting disease
- the infectious agent of TSEs is called "prion", which is derived from “proteinaceous” and "infectious".
- a prion is the infectious agent causing prion diseases.
- the only known constituent of the prion is the prion protein in a misfolded protein state (PrP Sc ) compared to the properly folded common protein (PrP c ).
- the protein that prions are made of (PrP) is found throughout the body, even in healthy people and animals.
- PrP found in infectious material has a different structure and one part of it is partially resistant to proteases, the enzymes in the body that can normally break down proteins.
- PrP c the infectious form
- PrP Sc the C refers to 'cellular' PrP
- the Sc refers to 'scrapie', a prion disease occurring in sheep.
- Prions propagate by transmitting a misfolded protein state.
- a prion enters a healthy organism, it induces existing, properly folded proteins to convert into the disease-associated, prion form; prion acts as a template to guide the misfolding of more proteins into prion form.
- These newly formed prions can then go on to convert more proteins themselves; this triggers a chain reaction that produces large amounts of the prion form.
- All known prions induce the formation of an amyloid fold, in which the protein polymerises into an aggregate consisting of tightly packed beta sheets. Amyloid aggregates are fibrils, growing at their ends, and replicating when breakage causes two growing ends to become four growing ends. This altered structure is extremely stable and accumulates in infected tissue.
- Misfolding and aggregation of cellular proteins underlies a number of human neurodegenerative diseases in addition to TSEs, such as Alzheimer's, Parkinson's, and AA amyloidosis.
- Type 2 diabetes is yet another disease whose pathogenesis involves ordered protein aggregation.
- the propagation theory described for PrP may also apply to amyloid formation in other protein misfolding disorders (PMDs).
- TSEs are unique and lethal diseases in that their aetiology may be genetic, sporadic or infectious via ingestion of infected foodstuffs and/or via iatrogenic means (e.g. blood transfusion).
- TSEs are sporadic and occur in an animal with no prion protein mutation. Inherited TSE occurs in humans carrying a rare mutant prion allele, which expresses prion proteins that eventually lead to the disease-causing conformation. Transmission occurs when healthy animals consume contaminated tissues from others with the disease. Thus, TSEs carry risks for both human medicine and agriculture, as well as in the related industries. It is important to provide a rapid and reliable diagnostic method to detect the infectious agent, the prion.
- PrP Sc can propagate autocatalytically in vitro by converting cellular prion protein (PrP c ) and recombinant prion protein (rPrP) to pathogenic forms. Based on this property, a novel amplification system, termed quaking-induced conversion (QuIC), was reported in 2008 (Atarashi R, Wilham JM, Christensen L et al., Nat Methods 2008;5:21 1-212; [1 ]). By mixing samples containing PrP Sc with rPrP in solution, PrP Sc could induce misfolding of rPrP and thus multiply efficiently in vitro.
- PrP c cellular prion protein
- rPrP recombinant prion protein
- the diagnostic method is a rPrP that is converted in the presence of infectious PrP in a sample, i.e. a form of rPrP that is "misfolded" if PrP sc is present.
- the diagnostic agent currently used in conventional methods is recombinant rPrP c , which is very expensive. It was therefore a further objective of the present invention, to provide a novel rPrP, which is more active compared to the currently used rPrP, and therefore allows a more cost-efficient and rapid diagnostic method.
- the ICE-prepared rPrP is stable and reliable, it can also be used as the substrate for other detection techniques for prion diagnosis and drug screening, including protein misfolding cyclic amplification (PMCA), amyloid seeding assay (ASA) and scanning for intensely fluorescent targets (SIFT) assay.
- PMCA protein misfolding cyclic amplification
- ASA amyloid seeding assay
- SIFT scanning for intensely fluorescent targets
- an rPrP preparation used in known detection methods comprised a mixture of similar, slightly different proteins or protein variants, respectively, with slightly differing characteristics and that a method for detecting PrP sc in a sample in a reliable and fast manner can be provided by using an isolated variant of rPrP as diagnostic agent in a RT-QulC test.
- Known rPrP preparations comprise a rPrP mixture which might be the reason for the unreliable results obtained with those preparations.
- the method of the present invention using ICE to separate this rPrP mixture into fractions comprising differing rPrP variants allows obtaining a novel, purified, isolated rPrP.
- This novel rPrP also called rPrP 0X in the following, has much higher purity and activity and, therefore, can be used to diagnose prion disease in a short time.
- This novel rPrP variant of the present invention can be used in diagnostic methods, such as RT-QulC, and yields more reliable results. To prove the reliability of the diagnostic method using the novel rPrP variant two independent batches of blindly prepared human cerebrospinal fluid (CSF) samples were tested.
- CSF human cerebrospinal fluid
- NCJDRSU National CJD Research & Surveillance Unit, University of Edinburgh, UK
- NCJDRSU National CJD Research & Surveillance Unit, University of Edinburgh, UK
- the results and the diagnostic conclusions were sent back to NCJDRSU and found to be 100% reliable (see Example 8).
- These results of blind tests indicate that RT-QulC as a reliable technique for prion diagnosis is feasible.
- human rPrP obtained according to the methods of the present invention superior results were achieved when compared to hamster rPrP as used in the prior art (see Example 8 as well). Fewer random false-negative and false-positive results are obtained compared to conventional diagnostic methods.
- the new rPrP variant, rPrP 0X due to its higher purity has higher activity.
- the method of the present invention using this new rPrP is also more efficient, as less rPrP is needed, due to the improved activity of the rPrP of the present invention.
- the infectious agent causing CJD and other prion diseases can be detected even in blood of the patient.
- the rPrP 0X variant of the present invention can be used in high-throughput methods.
- a diagnostic method for detecting prion diseases based on the known RT-QulC technique in a short time is provided. This method provides reliable results much faster, within hours, whereas known methods required some days until the results were obtained. As shown by blind testing of patient samples (see Example 8), using the ICE-purified human rPrP of the present invention as a substrate for RT- QuIC reactions leads to a significant reduction in reaction duration and facilitates the interpretation of the results.
- kits for a diagnostic method which can be used in diagnostic methods for detecting prion diseases, such as RT-QulC and high- throughput applications of the method. This allows for routine-checks of foodstuffs and medical equipment, such as surgical instruments or blood products used for transfusion.
- a second rPrP variant also named rPrP a " in the following, can be isolated as a protein fraction from a known rPrP preparation.
- This second protein variant is eluted with high concentrations of imidazole after elution of the novel purified rPrP ox protein used for detection.
- This protein rPrP 3 " is characterized by its high purity and high affinity to self-aggregate. This protein can be used as positive control to assess test validity and to ensure that the correct experimental procedure has been followed. It has been surprisingly found, that this specific rPrP variant is not infectious and, therefore, can be safely used in a diagnostic test.
- the present invention also provides a safe protein that is superior to the infectious PrP Sc protein currently used as positive control, as shipping and handling of infectious material is expensive and requires specific safety measures.
- the method of the present invention not only provides a highly improved diagnostic agent - rPrP 0X - and a diagnostic method with higher efficiency and cost-effectiveness, but in addition provides an improved protein to be used as positive control.
- the isolation method of the present invention using specific selection steps is rather selective and is not limited to isolate fractions of recombinant prion proteins, but can also be used to isolate fractions of other self-aggregating proteins, which cause other PMDs, such as Parkinson's, or Alzheimer's disease.
- Figures 1A-C show that detection of human sporadic CJD (sCJD) PrP Sc in cerebrospinal fluid (CSF) by RT-QulC using conventionally purified rPrP showed both false-positive and false-negative results.
- CSF samples are obtained from four definite sCJD and four non-CJD patients. The readout is shown by Mars analysis software (BMG). Arrows represent the false-negatives, low activity and false-positive reactions. Reactions were tested at 37°C (A), 42°C (B) and 55°C (C), respectively. Increase of temperature not only increases protein activity, but also decreases the reliability of RT-QulC reactions.
- Figure 2 shows protein contamination in conventionally purified rPrP solution detected by liquid chromatography mass spectroscopy (LC-MS).
- the contaminating proteins are mainly bacterially expressed, including ATPase, GTPase and DNA polymerase, etc..
- Two independent LC-MS tests indicated that the current purification method causes contamination, which may affect reliability of RT-QulC. Both figures are direct output of the MASCOT software for LC-MS.
- Figure 3 shows that rPrP of three independent peaks A, B, and C, is obtained by ICE. Imidazole concentrations of 100 mM, 300 mM, 500mM are used. The conventional elution profile showing a single peak obtained from I MAC using an imidazole gradient is shown as a small profile with gray background.
- Figure 4 shows a comparison of the reliabilities of rPrPs in the different peaks obtained by the ICE as shown in Fig. 3 by using RT-QulC.
- the rPrPs in peaks A, B and C were subjected to RT-QulC for 90 hours at 55°C.
- the results show that rPrP in peak B is the reliable protein which can be applied in RT-QulC for diagnostics.
- rPrP in peaks A and C should be excluded due to false negatives and false positives.
- rPrP in peak C can however be used as positive control in the test kit.
- the ascendant curve indicates the positive results.
- Figures 5A-C show the comparison of the performance of RT-QulC for 90 h at 37°C and 55°C using rPrP in peak B as the substrate.
- RT-QulC preparations were seeded with human sCJD, vCJD and non-CJD brain (e-7 represents the seed of 10 "7 diluted brain) as shown in Fig. 5A.
- RT-QulC preparations were seeded with human sCJD and non-CJD CSF (three cases for each, represented as 1 , 2 and 3), as shown in Fig. 5B.
- RT-QulC preparations were seeded with cattle classic BSE (C-BSE) and low-type BSE (L-BSE), as shown in Fig. 5C.
- the seeds used in the 37°C tests are identical to those in 55°C ones.
- Figure 6 shows the detection of prions in CJD blood by using rPrP of peak B.
- the blood samples from both sCJD and vCJD patients (four per type) were precipitated and seeded into RT-QulC for 55°C tests. Prions in vCJD blood can be detected on day 1 and those in sCJD blood are detectable on day 3 and 4, suggesting the application of peak B rPrP in high-throughput screening of blood samples.
- Figure 7 shows that an oxidized methionine is found in peak B rPrP, but not in the rPrP of peaks A and C. This oxidized methionine is the methionine at residue 191 of SEQ ID NO:2.
- FIG. 9 shows the visible differences of the rPrP solutions before and after dialysis.
- the eluted rPrPs were sterilized by 0.22 ⁇ filters first; then they were adjusted to 0.5 mg/ml with 10 KDa centrifugal filters before being loaded into 6 KDa dialysis tubing. Successive dialysis was done in 3 rounds (2 hours, 4 hours and 12 hours). Every dialysis was in 100 times volume of sterilized 10 mM NaH 2 P0 4 (pH 5.6 at 4°C).
- the components in the eluted solution smaller than 6 KDa were diluted to 1 x10 6 folds.
- the turbid solutions can be observed in peak A and C while peak B is still clean.
- the loaded dialysis tubing was compressed by multiple clamps to reach the maximum pressure before being immersed in dialysis buffer.
- Figure 10 shows that mixed solutions are turbid after dialysis.
- ICE eluted rPrP of peak B is p re-mixed with A and C, respectively. Both mixed solutions are clean before dialysis.
- the dialyzed solutions become muddy, indicating aggregates are formed in both mixes. Protein concentration is controlled to be 0.5 mg/ml.
- Figure 11 shows that a concentration of 40 mM of imidazole does not result in elution of recombinant prion protein in a peak, but in a constant plateau at a low level.
- Figure 12 shows that the elution of recombinant prion protein with 50 mM to 350 mM imidazole concentration harvested 6 peaks.
- Figure 13 shows the elution profile of protein with 3 cascades of imidazole concentrations.
- Figure 14 shows that the length of the chromatography column used in the selection method affects the required eluting duration to observe the peaks.
- Figure 15 shows the 1 st batch of blind tests (100% reliability). The shown curves represent fluorescence in RFU vs time of the QuIC reaction.
- Figure 16 shows the 2nd batch of blind tests using hamster rPrP as substrate. The shown curves represent fluorescence in RFU vs time of the QuIC reaction.
- Figure 17 shows the 2nd batch of blind tests using ICE-purified human rPrP as substrate. The shown curves represent fluorescence in RFU vs time of the QuIC reaction.
- Figure 18 shows zoom-ins into the profiles of RT-QulC reaction results to compare diagnostic efficiency of reactions using hamster rPrP and ICE-purifed human rPOrP respectively. These results indicate that by using ICE-purified human rPrP as a substrate for the RT-QulC reaction, the duration of the reaction is reduced, and the interpretation of the results is facilitated.
- prion protein and "PrP” are used as a general term for any type of prion protein and encompass recombinant PrP as well as naturally occurring PrP, mixtures of different variants of PrP as well as isolated forms.
- the term comprises human PrP and PrP from other animals like cattle, sheep, goat, and deer.
- PrPrP refers to recombinant PrP, i.e. PrP that has been obtained by genetic engineering methods and shall comprise pure proteins as well as a mixture of rPrP protein variants. This term refers to full-length proteins and fragments of PrP that are active in the present analytical methods.
- full-length protein in the prion field refers to the mature human rPrP, which is a protein consisting of the amino acids at positions 23-230 as defined in SEQ ID NO:4, which corresponds to the GenBank entry AAA60182.1 for the human PrP.
- This GenBank entry is the protein, which is translated from the CDS of the PRNP gene, which is defined in SEQ ID NO:3 (GenBank entry M13899.1 ).
- the protein as defined in SEQ ID NO:4 is not the final form of cellular PrP.
- the part of the protein comprised of aa 1 -22 which is a signal peptide of PrP, is cleaved first.
- this signal peptide affects the folding characteristics of the rPrP, and, therefore, should be absent from the mature rPrP of the present invention.
- part of the protein comprised of aa 231-253 is replaced by a glycosylphosphatidylinositol (GPI) anchor, which helps PrP c to locate on the cellular membrane. Therefore, only the protein consisting of amino acids at positions 23-230 is left and termed mature or full-length PrP. This protein is defined in SEQ ID NO:2.
- This full-length protein is encoded by the polynucleotide of SEQ ID NO:1 , which corresponds to the nucleotides at positions 67-690 of the polynucleotide as defined in SEQ ID NO:3.
- the full-length rPrP is suitable to be the substrate for amplifying both human and cattle prions, and the yield of purified full-length rPrP is ideal. Furthermore, it has been shown that up to about 90 amino acids starting from the N-terminal methionine at position 1 of SEQ ID NO:4 can be digested by proteases without effecting the folding characteristics of the rPrP.
- a protein of the present invention is any full-length protein as defined in SEQ ID NO:2 as well as any protein that comprises the essential part but wherein some or all of the amino acids at positions 23-91 at the N-terminal part of the protein are missing and it comprises variants wherein some or all of the amino acids at positions 23-91 are varied by mutations, e.g. by deletions, insertion, and/or substitutions with other amino acids, e.g. with conservative substitutions.
- Conservative substitution tables are well known in the art, useful substitutions can be found by the skilled person by using such tables or by using routine experimentation.
- conservative substitutions are those wherein amino acids which originate from the same class are exchanged for one another, like amino acids having aliphatic side chains, positively or negatively charged side chains, aromatic groups in the side chains or amino acids, the side chains of which can enter into hydrogen bridges, e.g. side chains which have a hydroxy I function. Insertions, deletions and substitutions are possible as long as the folding characteristics of the rPrP are not essentially changed.
- the N-terminal region of PrP comprises an array of five almost identical octapeptide sequences, also termed octarepeats. This region is found at amino acid positions 51-91 of SEQ ID NO:4.
- octarepeats can be consisting of amino acids Gin Pro His Gly Gly Gly Trp Gly (SEQ ID NO:5).
- SEQ ID NO:5 amino acids Gin Pro His Gly Gly Gly Trp Gly
- variants of the rPrP of the present invention can comprise those peptides, which contain 2-9 octarepeats in their N-terminal region.
- rPrP 0X refers to a recombinant PrP wherein methionine 213 is in oxidized form (wherein the numbering refers to the full length protein).
- rPrP 3 refers to a new form of recombinant PrP that can be obtained with the method of the present invention as last fraction after elution of rPrP ox and differs from rPrP ox in that it self-aggregates without being infectious. It is assumed that this is a highly pure form of unoxidized rPrP that has self-aggregating properties.
- prion disease is used for all conditions, disorders or diseases that are caused by formation of prions, i.e. proteins that misfold and induce misfolding of other protein molecules.
- Examples for prion diseases are different types of Creutzfeldt-Jacob disease, BSE, FSE, TME, EUE, and CWD.
- Imidazole cascade elution and “ICE” refer to a method according to the present invention, wherein at least two imidazole fractions with different imidazole concentration are used for elution, wherein the at least two fractions have discrete concentrations.
- the rPrP of the present invention can be used in detection methods for assaying the presence of PrP Sc in a sample.
- Useful detection techniques for prion diagnosis and drug screening include protein misfolding cyclic amplification (PMCA), amyloid seeding assay (ASA), scanning for intensely fluorescent targets (SIFT) assay, and RT-QulC.
- the positive reaction in RT-QulC is defined as showing an ascendant curve on the screening window of the RT-QulC reaction within 96 hours.
- the positive reaction is defined as showing an ascendant curve within 48 hours.
- the flat line without ascendant curve in these time-spans is defined as a negative reaction.
- therapeutic effects including the tracking of prion progression after treating a subject with anti-prion therapy and possible side effects of treatments which may trigger spontaneous prion diseases while treating other diseases, can be estimated.
- an early diagnosis in a subject with a possible mutation of the PRNP gene, who may suffer from genetic prion diseases, and an early diagnosis for people who reach the age with high risk of getting prion diseases can be carried out within the context of a routine physical examination of the subject.
- the present invention provides a novel and inventive purification and isolation method, here also referred to as "Imidazole-cascade elution” (ICE), that allows to purify recombinant prion protein or other recombinant aggregating proteins and to obtain a highly pure and active protein that can be used as substrate in a detection method such as RT-QulC. Furthermore, using the highly pure fraction obtained with this method, a sensitive diagnostic system for prion diseases is provided. Surprisingly, by using ICE, the inventors found a novel type of rPrP that has superior properties and is particularly useful in diagnostic methods.
- ICE Imidazole-cascade elution
- the elution method of the present invention uses a chromatographic technique of protein purification based on the principle of immobilized metal ion affinity chromatography (IMAC).
- IMAC immobilized metal ion affinity chromatography
- a further surprising finding of the present invention is the identification of the source of the problems of the conventional methods for diagnosis of prion diseases and the provision of the solution of said problems. These problems are the low reliability of the conventional diagnostic methods due to the prevalence of false negatives and false positives. A further problem was the low sensitivity and activity of the conventionally used detection agent leading to long detection times and the need for an increased amount of source material.
- purification via IMAC is a preferred technique when high yields of pure and active protein are required.
- Conventional IMAC is based on a high affinity binding of an immobilized metal ion by chelating a part of the target protein. Said part of the protein can be a histidine-rich sequence. Conventionally, target proteins are therefore tagged with an artificial histidine-rich sequence.
- the rPrP conventionally used in research is histidine-tagged as well (Colombo et al, PLoS one 2009; 4:e4296, [6]; Meli et al., PLoS one 201 1 , 6:e19093 [7]).
- His- tagged rPrP may not be useful in a method for detecting prion diseases, it was not advantageous to tag rPrP to be purified.
- rPrP can be used with the native amino acid sequence as defined in SEQ ID NO:2 encoded by the genetic nucleotide sequence as defined in SEQ ID NO:1 or variants or fragments thereof as defined above and in the following.
- Variants of the rPrP of the present invention are in particular those peptides that comprise some or all amino acids 23-230 of SEQ ID NO:4, wherein amino acids 23-91 can be substituted by other amino acids, can be deleted or wherein in the part outside aa 92-230 insertions have been made, in other words wherein amino acids 92-230 of SEQ ID NO:4 are conserved.
- the substitutions preferably are conservative substitutions.
- the rPrP of the present invention comprises at least the amino acids at positions 92-230 of SEQ ID NO:4 and can comprise further amino acids of SEQ ID NO:4.
- the rPrP of the present invention can also consist of a peptide consisting of amino acids at positions 92-230 of SEQ ID NO:4.
- the rPrP of the present invention can comprise the peptide consisting of amino acids at positions 92-230 of SEQ ID NO:4, and an N-terminal region comprising from 2 to 9 octarepeats as defined in SEQ ID NO:5.
- the rPrP used in the present invention can be obtained by recombinant expression in bacteria, followed by digestion, denaturation, and renaturation steps as are known to the person skilled in the art.
- a method for obtaining the rPrP used in the methods of the present invention is described in brief, such methods are well- known in the art.
- the recombinant protein expressed by bacteria can be harvested by disrupting the bacteria cells by repeated freezing with liquid nitrogen followed by thawing. To harvest the recombinant protein said protein can be extracted from inclusion bodies by lysis, as is well-known in the art. In this lysis step a universal and efficient nuclease (e.g.
- Benzonase can be used as well to digest total DNA and RNA to avoid the unspecific binding of nucleic acids to the solid support, such as a resin in a chromatography column.
- Nucleic acids comprise huge hydrophilic surfaces, which could cover the whole resin, and thus can block the binding sites (e.g., Ni 2+ on the resin) for the protein to be purified. Therefore, it is recommended to digest nucleic acids with Benzonase, or with a combination of multiple types of DNase and RNase, before denaturing proteins with guanidine hydrochloride.
- the following denaturation can be critical to give all rPrP in the inclusion body an identically denatured and nonstructural starting state before refolding.
- the key of this step is to use 8 M or higher concentration of guanidine hydrochloride which is efficient for denaturation.
- a concentration of 8 M guanidine hydrochloride in 50 mM Tris buffer (pH 8.5) was found preferable for dissolving the inclusion body and denaturing the recombinant PrP.
- Using a concentration of 6 M Guanidine hydrochloride was found to be insufficient.
- the following purification step can preferably be done at 2-8°C (normally 4°C) to keep protein activity. Therefore, urea, which is also a commonly used denaturant, is not useful, since low temperature (2-8°C) causes crystallization of dissolved urea.
- the proteins are renaturated by allowing the proteins to refold.
- Refolding is carried out to obtain proteins having regained their native conformation/structure after denaturation.
- Refolding is carried out by decreasing denaturant concentration (e.g. guanidine hydrochloride) in the flowing aqueous phase.
- denaturant concentration e.g. guanidine hydrochloride
- the refolding should be done on the chromatography column.
- the refolding step preferably uses another denaturation buffer containing 6 M guanidine hydrochloride and sodium phosphates (for buffering pH value at 8.0), which are different from the solution of 8 M guanidine hydrochloride (pH 8.5) described above for the denaturation step.
- This protein which is without an artificial His-tag, can nevertheless be purified using an I MAC method, as negative charged amino acids in the sequence provide for sufficient binding to the bivalent cations on the chromatographic support used in the method of the present invention.
- the cations bind to a native domain of the protein, namely the copper binding domain, which can bind bivalent cations such as Zn 2+ , Ca 2+ , Cd 2+ , Cu 2+ , Co 2+ and Ni 2+ . Binding strength of PrP to the I MAC column depends on the cations used and follows the order Cu 2+ > Ni 2+ > Zn 2+ > Co 2+ .
- Cu 2+ ions are not useful for the methods of the present invention, as the affinity of the copper ions is too high to efficiently elute the rPrP after binding to the metal ions.
- the cations used to bind proteins are selected from Zn 2+ , Co 2+ , Ca 2+ , Cd 2+ , and Ni 2+ , most preferably Ni + .
- the preparation comprising the recombinant prion protein obtained in conventional manner, preferably as outlined above, is subjected to a chromatographic separation step, such that the protein of interest can bind to a chromatography material comprising immobilized bivalent cations.
- a chromatographic separation step such that the protein of interest can bind to a chromatography material comprising immobilized bivalent cations.
- chromatographic methods are known to the skilled person and chromatographic materials are available having metal ions immobilized on a solid support. Any such chromatographic material with immobilized bivalent cations can be used.
- a chromatography column with immobilized Ni 2+ ions is used to bind recombinant proteins by utilizing the affinity of Ni 2+ to histidines in the protein sequence.
- Ni-IDA is a dry silica- based resin precharged with Ni + ions.
- the chelating group of Ni-IDA is based on iminodiacetic acid (IDA), which enables strong and efficient binding of a target protein onto the IMAC matrix.
- IDA iminodiacetic acid
- the bivalent cations can also be immobilized on microbeads, microspheres, and planar support structures, etc. as is known to the skilled person.
- the method of the present invention can be used to obtain an isolated, purified recombinant prion protein (rPrP) using immobilized metal ion affinity chromatography (IMAC).
- IMAC immobilized metal ion affinity chromatography
- This method comprises immobilizing an rPrP preparation encoded by a nucleotide sequence comprising the nucleotide sequence as defined in SEQ ID NO:1 on a solid support coated with metal ions, such as Zn 2+ , Co 2+ , or Ni 2+ .
- the essential part of the method of the present invention is the elution of the protein of interest.
- the conditions of the elution are important to get rid of contaminants and to isolate the desirable protein.
- the proteins can be displaced from the column by using an agent competing for the binding to bivalent cations such as EDTA or imidazole.
- proteins are e luted with imidazole, which competitively binds to the metal ions, such as Ni 2+ ions.
- the recombinant prion protein can be eluted while washing the column with imidazole solution.
- the present invention uses imidazole cascade elution - ICE, wherein cascades of increasing imidazole concentrations are used in sequence to elute fractions of the bound protein. At least two different eluent concentrations are applied. The appropriate concentrations of imidazole in the different eluents are critical and the desired fractions are only obtained in the concentration window outlined in detail below.
- the eluent used for the present isolation method is an aqueous solution of imidazole that was found to displace the desired proteins most efficiently.
- the aqueous phase can be water, or a buffered solution, more preferred a phosphate buffered solution, phosphate buffered isotonic saline, having a pH in the range of 6.5 to 7.5, preferably about 7.0, or a TRIS-HCI buffer having a pH at about 8.0.
- Imidazole is added to the aqueous phase in amounts as outlined in detail below. If necessary a minor amount of a tenside or other excipients can be added, as is known to the skilled person.
- Imidazole cascade elution is the novel method of the present invention, therefore, at least two different eluents are necessary and at least two elution steps are carried out.
- contaminants are removed, thus the concentration of imidazole has to be selected such that the contaminants are eluted but not or only in a very minor amount of the desired prion protein.
- the target protein rPrP 0X shall be eluted as exhaustively as possible but without eluting proteins of peak C.
- the protein rPrP a " of peak C can be eluted.
- the imidazole concentration should not be below 40 mM, as below 40 mM the contaminants are not eluted sufficiently. It was found that 40 mM imidazole elutes the protein to a constant plateau thus to cause a very low yield (see Fig. 11 , and Example 1). Therefore, for the first elution step, the imidazole concentration shall be in the range of about 50 mM to about 150 mM. As shown above the lower threshold determines the minimal concentration necessary to elute a protein fraction in a peak.
- the fraction eluted in this elution step comprises mainly bacterial and environmental protein contaminations, which are thought to be responsible for false negatives when used in the detection method, and for lowering the activity of the detecting agent.
- the fraction obtained in the first elution step comprising contaminants is to be discarded.
- an elution buffer with an increased imidazole concentration is used. This concentration is from about 150 mM to about 350 mM imidazole. It was shown that the fraction eluted with an aqueous solution, preferably a buffer solution like phosphate buffer, and an imidazole concentration in a range of about 150 mM to about 350 mM, preferably 175 mM to 300 mM contains the desired novel and inventive rPrP variant - rPrP 0X , which is a very active, safe and reliable detecting agent. This fraction can be used for a detection method or the rPrP 0X can be recovered from the solution in well-known manner. The protein obtained is very stable and can be stored until it is used. Preferably, the protein is in aqueous solution and is frozen at -80°C until it is used.
- rPrP protein still bound to the chromatography matrix can be optionally eluted. It has been found that this remaining protein, in peak C, is a protein with valuable properties. Therefore, optionally a third elution step can be carried out to recover this protein, as well.
- an elution buffer with a further increased imidazole concentration is used.
- a concentration of higher than 350 mM imidazole is used, preferably the imidazole concentration is from about 400 mM to about 500 mM imidazole.
- the upper limit is not critical, but a concentration of more than about 500 mM imidazole does not yield more protein and therefore is not useful.
- a very pure rPrP variant is found - rPrP 3 ", which is characterized by its high tendency to self-aggregate. It is assumed that it is this protein variant that causes false positives when the previously used rPrP preparation is applied.
- this protein can be beneficial to use this protein as positive control for the detection method of the present invention or generally for detection methods for detecting prion diseases to assess test validity and to ensure that the correct experimental procedure has been followed when carrying out the detection method. For this reason it is useful to separate the protein to be used as positive control from the fraction, which can be eluted with a buffer containing at least 350, preferably about 500 mM concentration of imidazole.
- the duration of elution steps can be determined by a person carrying out the method of the present invention in usual manner.
- the steps should have a sufficient length to elute the appropriate fraction.
- the time period depends on parameters like the size of the column, flow rate, temperature of the system, the chromatography system used, etc. For example, there are different sizes of containers for loading a chromatography column; for one size of container, different lengths of the column are available (see Fig. 14).
- the flow rate of the elution buffer can be adjusted by the operator using the provided function of the chromatography system, affecting the duration of elution. These issues influence the required duration for elution buffer to pass through the entire column. Since the monitor for detecting proteins is at the downstream position of the chromatography system, the time point of the appearance of the peak is variable. A person of skill in the art easily can determine the optimal elution time needed to obtain the desired fractions of protein.
- rPrP can be transferred into a dialysis buffer. Dialysis steps are carried out as known to the person skilled in the art (see also Example 7). After dialysis, the concentration of rPrP is usually greater than 0.5 mg/ml. The concentration can then be adjusted to be 0.3 mg/ml to 0.5 mg/ml for long-term storage at -80°C or for direct use in a detection method. Further concentration steps, such as centrifugal filtration and lyophilization, are not necessary, and can be even detrimental. Centrifugal filtration causes loss of protein and increases the number of processing steps as well as the price of purification. Furthermore, the necessary low speed centrifugation for about 5 hours would expose the proteins to an enhanced risk of contamination.
- Lyophilization would also require additional steps like the exchange of dialysis buffer to ddH 2 0 and the removal of water.
- the isolation method of the present invention a novel and inventive recombinant protein is provided.
- the recombinant prion protein used in the ICE is encoded by the nucleotide sequence as defined in SEQ ID NO:1 or a fragment or variant thereof that encodes a fragment or variant as described above.
- the translated amino acid sequence of the rPrP is defined in SEQ ID NO:2.
- An rPrP preparation as known and as used as starting material for the isolation method of the present invention can be obtained by bacterial expression, wherein the bacteria are transformed with a vector comprising an expression cassette for the rPrP.
- the purified protein can be distinguished from the recombinant protein before purification.
- the purified rPrP of the invention has a distinctive oxidation pattern of the methionines in the amino acid sequence. Only one methionine is oxidized.
- This residue number of the oxidized methionine corresponds to the residue number 213 of the whole peptide sequence as defined in SEQ ID NO:4 (see also GenBank entry AAA60182.1 : http://www.ncbi.nlm.nih.gOv/protein/190468).
- the peptide sequence as defined in SEQ ID NO:4 includes a signal peptide at amino acid positions 1-22, and a peptide sequence at amino acid positions 231-253, which are cleaved from the peptide to obtain the full- length PrP as defined in SEQ ID NO:2.
- This PrP consists of 208 amino acids.
- the oxidized methionine is at residue 191 , which corresponds to residue 213 of the complete peptide as defined in SEQD ID NO:4.
- Whole peptide sequence consisting of the full-length rPrP as defined in SEQ ID NO:2 (shown underlined) and the peptide sequences (shown in italics), which are cleaved.
- the oxidized methionine is shown in bold:
- Oxidation on methionines has been reported to affect the conformational stabilization of the prion protein (Wolschner et al., Proc Natl Acad Sci U S A.2009; 106:7756-7761 [8]).
- Met213, corresponding to Met191 of the novel and inventive rPrP, which is on a- helix 3 of PrP, is thought to be a crucial amino acid to control the conformational stability. It has been hypothesized that oxidation of this methionine may function as a switch to trigger the pathogenic conversion of PrP [6].
- the research as reported in [6,8] was done in computer simulations.
- rPrP human rPrP
- rPrP of other animals has different types on the column while being purified with I MAC.
- full-length (mature) mouse rPrP (aa 23-231 ) purified with the methods of the present invention was composed of different subtypes of rPrP with independent oxidation and converting activity features.
- a further recombinant protein can be provided, which can be separated from the rPrP mixture in a further elution step subsequently to the elution of rPrP 0X
- the further elution step uses a high concentration of imidazole, which should be at least 450 mM, preferably at least 500 mM.
- the rPrP eluted with this high concentration of imidazole is characterized by its very high purity, and its high affinity to self-aggregate.
- This protein, rPrP a " differs from rPrP 0X by the missing oxidation at methionine 213.
- This protein can be used in the test as a positive control. This is superior to the infectious PrP Sc protein currently used as positive control, as shipping and handling of infectious material is expensive and requires specific safety measures. These were not necessary if the protein of the present invention were used as positive control.
- a kit for isolating rPrP 0X comprising the following reagents: a rPrP preparation; a first eluent comprising 50 mM to up to 150 mM imidazole in aqueous solution; a second eluent comprising from about 150 mM to up to about 350 mM imidazole in aqueous solution; optionally a third eluent comprising from about 350 mM to about 500 mM imidazole.
- an inclusion body extracting buffer e.g.
- a first denaturation buffer 1 for denaturing rPrP in inclusion bodies e.g. 8 M Guanidine hydrochloride, 50 mM Tris, pH 8.5
- a second denaturation buffer 2 for refolding e.g.
- a further object of the present invention is a method for detecting a prion disease in a sample using a RT-QulC test.
- a kit for detecting PrP Sc in a sample using the rPrP 0X of the present invention comprising the following reagents:
- 5 x RT-QulC reaction buffer e.g. 2 M NaCI, 25 mM Na 2 HP0 4 , 25 mM Na 2 HP0 4 , 5 mM EDTA); 1 mM Thioflavin T; the human rPrP ox of the present invention; and, optionally the rPrP a " of the present invention for use as a positive control.
- the buffer specifications for the isolation/purification and detection kits are intended to be exemplary.
- the person skilled in the art is capable of adjusting or employing buffers with differing specifications, which nevertheless are encompassed by the scope of the present invention. Examples
- Table 1 The turbidity (A340) of protein solutions in peak 1 to 6 absorption peak 1 peak 2 peak 3 peak 4 peak 5 peak 6
- A280 indicates protein concentration.
- the protein is 0.5 mg/ml when A280 is 1.3.
- A340 indicates turbidity of protein solution.
- Example 2 Using ICE-prepared rPrP in RT-QulC to detect prions in human CJD and cattle BSE
- rPrPs prepared by ICE were subjected to RT-QulC reactions including non-seeded and sCJD-seeded preparations (see Fig. 4). Each reaction had six repeats and was performed at 55°C for 90 hours.
- RT-QulC proteins contained in peaks A, B, and in a mixture of both peaks A and B (A+B mix) were observed to be stable, showing flat signals.
- the proteins contained in both peaks C and C+B mix cause false-positives.
- peak A showed a false-negative result while other preparations were active.
- peak B contains the most reliable rPrP for RT-QulC
- peak A and C cause false-negativity and false- positivity, respectively, should be excluded from harvested rPrP to be used as detection agent in a diagnostic method.
- RT-QulC preparations using peak B rPrP were seeded with serially diluted human sCJD and variant CJD (vCJD) brain, human sCJD CSF, classic cattle BSE (C-BSE) and low type cattle BSE (L-BSE) brain, respectively.
- vCJD human sCJD and variant CJD
- C-BSE classic cattle BSE
- L-BSE low type cattle BSE
- RT-QulC using peak B rPrP has higher efficiency at 55°C than 37°C, which can dramatically shorten diagnosis duration, i.e. half days shorter for detecting prions in human CSF and L- BSE. This ability of reliably reacting at high temperature gives RT-QulC the highest efficiency compared to other studies (Peden et al., J. Gen.
- rPrP in peaks A, B and C was subjected to LC-MS. Interestingly, it was found that the methionine at amino acid position 191 (corresponding to the methionine at amino acid position 213 of the peptide as defined in SEQ ID NO:4) but no other methionine of the amino acid sequence of peak B rPrP had been oxidized. No oxidation of any methionine could be found in the amino acid sequences of the rPrP contained in either peak A or peak C. Oxidation on methionines has been reported to affect the conformational stabilization of the prion protein [8].
- Met213, corresponding to Met191 of the novel and inventive rPrP, which is on ct-helix 3 of PrP, is thought to be a crucial amino acid to control the conformational stability. It has been hypothesized that oxidation of this methionine may function as a switch to trigger the pathogenic conversion of PrP [6]. Hence, it was concluded that oxidation of et191/213 accounts for the activity difference between peak B rPrP to rPrPs in other peaks. Active oxidation of a specific methionine is however not possible in vitro.
- Example 5 Protein contamination
- I MAC is thought to be specific for purifying protein, the protein contamination from cultured bacterial and environment can hardly be avoided.
- some unexpected proteins which are not rPrP are always detected by LC-MS.
- ICE-prepared rPrP it was surprisingly found that the main protein contamination was only shown in peak A but not in B and C (see Fig. 8).
- ICE can produce much purer rPrP not only for RT-QulC, but also for other prion studies with biochemical and biophysical methods requiring low background and weak interference coming from other proteins. It also suggested that ICE is an ideal method to increase purity while purifying other proteins from Ni 2+ resin.
- Example 6 ICE-prepared protein of peak B has a low risk to form self- aggregates
- the last step of protein purification is usually dialysis or centrifugal filtration for buffer- exchanging and harvesting large amounts of protein. It is quite common that proteins form visible aggregates, especially while purifying rPrP. However, these aggregates can cause substantial loss of protein if 0.22 pm filtrating sterilization is required. For RT-QulC, 0.22 pm filtration is essential since measuring thioflavin T fluorescence requires a clean solution for better transmittance. Meanwhile, sterilization can avoid the growth of microorganisms during the warm incubation. Moreover, these rPrP aggregates should be removed since they may induce spontaneous conversion to cause false-positive results.
- Dialyzed rPrPs were kept at 0.5 mg/ml to compare their turbidities.
- the rPrPs in peaks A and C show more than 10 times higher turbidity than that in peak B.
- the yields in peaks A and C are quite low (40% and 32%, respectively), comparing to 89% yield of peak B, suggesting most of rPrP aggregates in A and C are excluded by filtration. Absorption is shown with mean ⁇ SD from three independent batches of rPrP.
- BL21 (DE3) E.coli. and pET41 a system were used to express rPrP.
- Bacteria were cultured in TB medium at 37°C with 200 to 220 rpm shaking till OD reached 1 .5 to 2.0.
- 1 mM of IPTG (final concentration) were added into medium for induction at 37°C for 10 to 16 h with 220 to 300 rpm shaking.
- the cell pellet was harvested by 10,000 g centrifugation at 4°C for 10 min and the wet weight (gram) was measured. Then the cells were frozen with liquid nitrogen followed by thawing at 25°C. This step was repeated twice to thoroughly break the cell.
- lysis buffer For each one gram of cell (wet), 10 ml of lysis buffer (pH 7.4) was added for dissolving.
- the lysis buffer contained 150 mM NaCI, 50 mM Tris, 1 % Triton X-100, 1 % sodium deoxycholate, 0.5% Sarkosyl, 2 mM Mg 2+ , 2.5 U/ml of Benzonase and 1 ,000 kU/ml lysozyme followed by shaking at 25 to 30°C for 1 h to dissolve the bacteria. Thereafter, this solution was centrifuged with 16,000 g at 4°C for 20 min to harvest pellet. The pellet was resuspended by 10 ml of lysis buffer to repeat the dissolving and centrifugation twice.
- the pellet was firstly resuspended by 10 ml of lysis buffer followed by adding 40 ml of ddH 2 0 and mixing. This solution was precipitated by 10,000 g centrifugation at 4°C for 10 min.
- the harvested pellet was resuspended by 0.1 ⁇ lysis buffer followed by 16,000 g centrifugation at 4°C for 20 min.
- the final inclusion body pellet (from 1 g of wet cell) was denatured with 10 ml of denaturation buffer (50 mM Tris, 8 M Guanidine hydrochloride, pH 8.5) at 25°C for 1 to 3 h. The denatured protein solution was centrifuged at 16,000 g at 4°C for 30 min to remove the debris.
- Ni 2+ -IDA column (resin) was chosen for protein purification. Following buffers were required for this purification: Regeneration buffer: 6 M Guanidine hydrochloride, 200 mM Acetic acid, pH 4.0
- Denaturation buffer 6 Guanidine hydrochloride, 95 mM Na 2 HP0 4 , 5 mM NaH 2 P0 4 , pH 8.0
- Refolding buffer 95 mM Na 2 HP0 4 , 5 mM NaH 2 P0 4l pH 8.0
- Elution buffer 5 mM Na 2 HP0 4 , 95 mM NaH 2 P0 4 , 500 mM imidazole, pH 5.8
- Dialysis buffer 0.5 mM Na 2 HP0 4l 9.5 mM NaH 2 P0 4 , pH 5.8
- IDA resin was firstly regenerated by 2 volumes of regeneration buffer followed by washing with 3 volumes of denaturation buffer at 25°C (room temperature). Thereafter, denatured protein solution was mixed with treated IDA resin for protein binding at 25°C for 1 h with gently shaking. After removing the solution, IDA resin was loaded onto the AKTAprime chromatography system for refolding and harvesting the recombinant prion protein at 4°C (see below).
- a gradient of buffer exchange was used for refolding step.
- the denaturation buffer was set from 100% to 0%, and refolding buffer was from 0% to 100%.
- Buffer exchange went through the resin at 4°C for 15 h with flow rate 0.3 ml/min. Then the resin was washed by 10 volumes of refolding buffer at 4°C for 1 h with flow rate 0.5 ml/min.
- the imidazole cascade elution was done at 4°C with constant flow rate 2 ml/min. First, the elution buffer was injected from 0% to 20% (containing 100 mM imidazole), and the refolding buffer decreased from 100% to 80%.
- Buffers ran through the IDA column by keeping these ratios till reaching the end of the first eluting peak (peak A). Then the elution buffer was adjusted to 60% (300 mM imidazole) and refolding buffer was 40%. This step was finished when the second peak (peak B) was at the end. Then the elution buffer was adjusted to 100% for eluting the rest protein (peak C).
- the eluted protein solutions (peak A, B and C) were loaded into dialysis tubing (MWCO 6000 to 8000) individually after 0.22 pm filtration.
- the loaded tubing was immersed in 100 volumes of pre-chilled dialysis buffer for three times of dialysis. The durations of dialysis were 2 h, 4 h and 15 h, respectively.
- the dialyzed proteins were harvested on ice after 0.22 pm filtration.
- the protein solutions were measured with 280 nm (A280) absorption followed by calculating the protein concentrations with the formula below:
- A280 2.67 x protein cone, (mg/ml) ⁇ cuvette length (1 cm) At last, the protein solutions were divided into aliquots and frozen with liquid nitrogen followed by transferring to -80°C for long-term storage.
- Example 8 Blind tests show both high reliability and high efficiency of ICE- purified human rPrP in the QuIC-based diagnosis of human CJD
- CSF human cerebrospinal fluid
- a first step the reactions were carried out using hamster rPrP as a substrate. 15 ⁇ of each CSF sample of the first batch were spiked into one RT-QulC reaction. 30 ⁇ of each CSF sample of the second batch were spiked into one RT-QulC reaction. When using ICE-purified human rPRP as a substrate, only 10 ⁇ of each CSF sample were spiked into one RT-QulC reaction.
- the RT-QulC reactions using ICE-purified human rPrP were found to have much shorter lag-phases of amplification compared to the RT-QulC reactions using the hamster rPrP. More importantly, reactions using human rPrP had better reproducibility than those using hamster rPrP. In summary, the use of human rPrP results in fast diagnosis with high reliability. Furthermore, a much higher relative fluorescence unit (RFU) was observed in reactions using ICE-purified human rPrP compared to reactions using hamster rPrP. This facilitates to immediately distinguish CJD CSF case from non-CJD cases.
- ROU relative fluorescence unit
- Fig. 16 The results of blind testing the second batch using NCJDRSU prepared hamster rPrP and blindly prepared human CSF (the 2nd batch of CSF from NCJDSU, UK) is shown in Fig. 16.
- Tests of CSF samples were performed twice with two independent RT-QulC reactions (plate 1 and 2, 96-well plate). Each sample was done in triplicates within one plate. As can be clearly seen in Fig. 16, the results of the two runs are not fully comparable with each other. E.g., A2 is positive in plate 1 but negative in plate 2, A7 and A8 are negative in plate 1 but positive in plate 2.
- Each well was seeded with 30 ⁇ of CSF into 70 pi of substrate preparation containing 100 pg/ml hamster rPrP (final concentration). The summary is shown in Table 5 below.
- test 1 test 2 diagnosis test 3 test 4 diagnosis
Landscapes
- Chemical & Material Sciences (AREA)
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Engineering & Computer Science (AREA)
- Biomedical Technology (AREA)
- Molecular Biology (AREA)
- General Health & Medical Sciences (AREA)
- Hematology (AREA)
- Medicinal Chemistry (AREA)
- Urology & Nephrology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Organic Chemistry (AREA)
- Biochemistry (AREA)
- Analytical Chemistry (AREA)
- Immunology (AREA)
- Cell Biology (AREA)
- Biotechnology (AREA)
- Genetics & Genomics (AREA)
- Neurosurgery (AREA)
- Neurology (AREA)
- Microbiology (AREA)
- Biophysics (AREA)
- Food Science & Technology (AREA)
- Physics & Mathematics (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
- Peptides Or Proteins (AREA)
Abstract
The present invention is concerned with imidazole-cascade elution (ICE), which is a method for isolating distinct fractions from a source of protein. Specifically, it is concerned with the isolation of a specific fraction (rPrPOX) from purified recombinant prion protein (rPrP), the use of the novel protein (rPrPOX) in detecting scrapie prion protein (PrPSc) in food samples or in samples obtained from mammals, such as humans, and a kit comprising the rPrP for use for detecting PrPSc.
Description
Method for the isolation of recombinant prion protein and the use thereof
Field of the invention
The present invention is concerned with Imidazole-cascade elution (ICE), which is a method for isolating distinct fractions from a source of self-aggregating protein. Specifically, it is concerned with the isolation of a highly purified recombinant prion protein (rPrP), the use of the recombinant protein in detecting scrapie prion protein (PrPSc) in food samples or in samples obtained from mammals, such as humans, and a kit comprising highly purified rPrP for use for detecting PrPSc. Background
Transmissible spongiform encephalopathies (TSEs), also known as "prion diseases" are a group of transmissible neurodegenerative diseases affecting primarily the central nervous system (CNS) of many animals, including humans. TSEs of humans include sporadic and genetic Creutzfeldt-Jakob disease, variant Creutzfeldt-Jakob disease (vCJD), a human disorder caused by the infectious agent of bovine spongiform encephalopathy (BSE), Gerstmann-Straussler-Scheinker syndrome, fatal familial insomnia and kuru. TSEs of other mammals include BSE of cattle, scrapie of sheep and goats, feline spongiform encephalopathy (FSE) of cats, transmissible mink encephalopathy (TME) of minks, exotic ungulate encephalopathy
(EUE) of Nyala and Greater Kudu, as well as chronic wasting disease (CWD) of deer and elk.
The infectious agent of TSEs is called "prion", which is derived from "proteinaceous" and "infectious". A prion is the infectious agent causing prion diseases. The only known constituent of the prion is the prion protein in a misfolded protein state (PrPSc) compared to the properly folded common protein (PrPc). The protein that prions are made of (PrP) is found throughout the body, even in healthy people and animals. However, PrP found in infectious material has a different structure and one part of it is partially resistant to proteases, the enzymes in the body that can normally break down proteins. The normal form of the protein is called PrPc, while the infectious form is called PrPSc— the C refers to 'cellular' PrP, while the Sc refers to 'scrapie', a prion disease occurring in sheep.
Prions propagate by transmitting a misfolded protein state. When a prion enters a healthy organism, it induces existing, properly folded proteins to convert into the disease-associated, prion form; prion acts as a template to guide the misfolding of more proteins into prion form. These newly formed prions can then go on to convert more proteins themselves; this triggers a chain reaction that produces large amounts of the prion form. All known prions induce the formation of an amyloid fold, in which the protein polymerises into an aggregate consisting of tightly packed beta sheets. Amyloid aggregates are fibrils, growing at their ends, and replicating when breakage causes two growing ends to become four growing ends. This altered structure is extremely stable and accumulates in infected tissue.
Misfolding and aggregation of cellular proteins underlies a number of human neurodegenerative diseases in addition to TSEs, such as Alzheimer's, Parkinson's, and AA amyloidosis. Type 2 diabetes is yet another disease whose pathogenesis involves ordered protein aggregation. The propagation theory described for PrP may also apply to amyloid formation in other protein misfolding disorders (PMDs).
In fact, protein conformation changes associated with the pathogenesis of most PMDs result in the formation of abnormal proteins that are rich in β-sheet structure, partially resistant to proteolysis, and have a high tendency to form larger-order aggregates, similar to PrPSc. Amyloid formation depends on the slow interaction of misfolded protein monomers to form oligomeric nuclei, around which a faster phase
of elongation takes place. The ability of oligomeric species to seed their own growth is analogous to the self-propagating activity of prions.
From a molecular standpoint, all PMDs can be considered "infectious" (self- propagating) in the sense that misfolded and aggregated proteins act as templates for the recruitment of native proteins. To stop the propagation of the misfolded protein, it is beneficial to carry out a rapid and reliable test of detecting the misfolded protein in a very early stage of the disease before the symptoms caused by the aggregations are manifest. Upon detection, a successful therapeutic approach may be designed. TSEs, however, are unique and lethal diseases in that their aetiology may be genetic, sporadic or infectious via ingestion of infected foodstuffs and/or via iatrogenic means (e.g. blood transfusion). Most TSEs are sporadic and occur in an animal with no prion protein mutation. Inherited TSE occurs in humans carrying a rare mutant prion allele, which expresses prion proteins that eventually lead to the disease-causing conformation. Transmission occurs when healthy animals consume contaminated tissues from others with the disease. Thus, TSEs carry risks for both human medicine and agriculture, as well as in the related industries. It is important to provide a rapid and reliable diagnostic method to detect the infectious agent, the prion.
There continues to be a very practical problem with the detection of misfolded proteins and thus the diagnosis of PMD. This is specifically the case with prion diseases, including BSE and CJD, as they have an incubation period of months to decades during which there are no symptoms, even though the pathway of converting the normal brain PrP protein into the toxic, disease-related PrPSc form has started. At present, there is virtually no way to detect PrPSc reliably except by examining brain tissue from either biopsy (e.g. from neurosurgery) or autopsy (after death) using neuropathological and immunohistochemical methods. Accumulation of the abnormally folded PrPSc form of the PrPc is a characteristic of the disease, but in accessible body fluids like blood or urine it is present at very low levels. Researchers have tried to develop methods to detect/measure PrPSc, but there are still no fully accepted methods for use in materials such as blood.
It is well known that PrPSc can propagate autocatalytically in vitro by converting cellular prion protein (PrPc) and recombinant prion protein (rPrP) to pathogenic
forms. Based on this property, a novel amplification system, termed quaking-induced conversion (QuIC), was reported in 2008 (Atarashi R, Wilham JM, Christensen L et al., Nat Methods 2008;5:21 1-212; [1 ]). By mixing samples containing PrPScwith rPrP in solution, PrPSc could induce misfolding of rPrP and thus multiply efficiently in vitro. Thus small amounts of PrPSc, which were undetectable by using conventional methods, could propagate to reach detectable levels in a reasonable time period. The novel real-time QuIC (RT-QulC) was developed by using an auto-read set-up to monitor the prion propagating procedure with fluorescence so that it allows testing multiple samples on one 96-well plate (Wilham JM et al.; PLoS 2010;6(12) [2]; Atarashi R et al.; Nature Medicine 201 1 ; 17(1 ) [3]; Atarashi et al.; Prion 201 1 ; 5: 150- 153 [4]; Orru et al; Protein Eng Des Sel. 2009; 22: 515-521 ; [5]).
It is very important for the diagnostic method to be very reliable. However, it was found by the inventors that diagnostic methods using RT-QulC are prone to false negatives, and false positives. A false-positive result in a sample obtained from a domestic animal will most probably lead to the culling of a whole herd to control and/or prevent the outbreak of the infection. This is ethically and economically disastrous. A false-negative result will leave the disease undetected and lead to an uncontrolled propagation of the disease. Thus, it was an objective to provide a diagnostic agent and a method to reliably detect PrPSc in a sample. Following the conventional methods of purification of rPrP [2,3] and applying said "purified" rPrP in RT-QulC for detecting PrPSc in cerebrospinal fluid (CSF) from human sporadic CJD (sCJD) patients, however, led to several reactions with false negativity and low activity (see Fig. 1A and B). Increasing the reaction temperature was thought to increase the protein activity, but this caused false positives (see Fig. 1C), which are not acceptable for the diagnosis of lethal diseases.
It is furthermore important for the diagnostic method to be efficient, as reliable results need to be obtained within a short time, i.e. within hours rather than days or weeks. As the number of samples obtained from sources such as foodstuff, humans or animals, or medical equipment, which will need to be checked routinely for presence of misfolded protein is high, the diagnostic method also needs to be applicable in high-throughput scale and therefore needs to be rapid, safe and cost-efficient. To allow for a rapid and cost-effective test result a diagnostic agent that is very active is
necessary as well. The diagnostic agent is a rPrP that is converted in the presence of infectious PrP in a sample, i.e. a form of rPrP that is "misfolded" if PrPsc is present. The diagnostic agent currently used in conventional methods is recombinant rPrPc, which is very expensive. It was therefore a further objective of the present invention, to provide a novel rPrP, which is more active compared to the currently used rPrP, and therefore allows a more cost-efficient and rapid diagnostic method.
The above mentioned problems had never been taken into consideration for the methodology of the RT-QulC system. Thus, it was an objective of the present invention to establish a method for diagnosing TSEs, which is more reliable and more efficient than conventional methods. It was further surprisingly found that the current protocols used for RT-QulC provided unreliable results because of the nature of the rPrP solution used. Thus it was a further objective for the present invention to provide an improved rPrP, which can be used in RT-QulC and allows for a more reliable and effective diagnosis of the infectious agent, PrPSc, in samples. Thus, it was a further objective of the present invention to establish a method for providing an improved and more active form of rPrP for stabilizing the RT-QulC system. Since the ICE-prepared rPrP is stable and reliable, it can also be used as the substrate for other detection techniques for prion diagnosis and drug screening, including protein misfolding cyclic amplification (PMCA), amyloid seeding assay (ASA) and scanning for intensely fluorescent targets (SIFT) assay.
It was a further objective to provide a protein useful as a positive control, which is not biohazardous, and therefore does not require expensive safety measures when being handled and shipped.
Summary of the present invention These problems were solved by the method of the present invention, which is termed imidazole cascade elution (ICE). It was surprisingly found that an rPrP preparation used in known detection methods comprised a mixture of similar, slightly different proteins or protein variants, respectively, with slightly differing characteristics and that a method for detecting PrPsc in a sample in a reliable and fast manner can be provided by using an isolated variant of rPrP as diagnostic agent in a RT-QulC test. Known rPrP preparations comprise a rPrP mixture which might be the reason for the
unreliable results obtained with those preparations. The method of the present invention using ICE to separate this rPrP mixture into fractions comprising differing rPrP variants, allows obtaining a novel, purified, isolated rPrP. This novel rPrP, also called rPrP0X in the following, has much higher purity and activity and, therefore, can be used to diagnose prion disease in a short time. This novel rPrP variant of the present invention can be used in diagnostic methods, such as RT-QulC, and yields more reliable results. To prove the reliability of the diagnostic method using the novel rPrP variant two independent batches of blindly prepared human cerebrospinal fluid (CSF) samples were tested. The samples were received from NCJDRSU (National CJD Research & Surveillance Unit, University of Edinburgh, UK) and used as seeds for performing RT-QulC reactions. The results and the diagnostic conclusions were sent back to NCJDRSU and found to be 100% reliable (see Example 8). These results of blind tests indicate that RT-QulC as a reliable technique for prion diagnosis is feasible. Furthermore, it was found that by using human rPrP obtained according to the methods of the present invention superior results were achieved when compared to hamster rPrP as used in the prior art (see Example 8 as well). Fewer random false-negative and false-positive results are obtained compared to conventional diagnostic methods. The new rPrP variant, rPrP0X, due to its higher purity has higher activity. Thus, the method of the present invention using this new rPrP is also more efficient, as less rPrP is needed, due to the improved activity of the rPrP of the present invention. When using rPrP0X the infectious agent causing CJD and other prion diseases can be detected even in blood of the patient. Moreover, the rPrP0X variant of the present invention can be used in high-throughput methods.
Furthermore, a diagnostic method for detecting prion diseases based on the known RT-QulC technique in a short time is provided. This method provides reliable results much faster, within hours, whereas known methods required some days until the results were obtained. As shown by blind testing of patient samples (see Example 8), using the ICE-purified human rPrP of the present invention as a substrate for RT- QuIC reactions leads to a significant reduction in reaction duration and facilitates the interpretation of the results.
Furthermore, a kit for a diagnostic method is provided, which can be used in diagnostic methods for detecting prion diseases, such as RT-QulC and high- throughput applications of the method. This allows for routine-checks of foodstuffs
and medical equipment, such as surgical instruments or blood products used for transfusion.
With the method of the present invention a second rPrP variant, also named rPrPa" in the following, can be isolated as a protein fraction from a known rPrP preparation. This second protein variant is eluted with high concentrations of imidazole after elution of the novel purified rPrPox protein used for detection. This protein rPrP3" is characterized by its high purity and high affinity to self-aggregate. This protein can be used as positive control to assess test validity and to ensure that the correct experimental procedure has been followed. It has been surprisingly found, that this specific rPrP variant is not infectious and, therefore, can be safely used in a diagnostic test. Thus, the present invention also provides a safe protein that is superior to the infectious PrPSc protein currently used as positive control, as shipping and handling of infectious material is expensive and requires specific safety measures. Thus, the method of the present invention not only provides a highly improved diagnostic agent - rPrP0X - and a diagnostic method with higher efficiency and cost-effectiveness, but in addition provides an improved protein to be used as positive control.
The isolation method of the present invention using specific selection steps, is rather selective and is not limited to isolate fractions of recombinant prion proteins, but can also be used to isolate fractions of other self-aggregating proteins, which cause other PMDs, such as Parkinson's, or Alzheimer's disease.
Description of drawings
The invention is also explained with reference to the following figures.
Figures 1A-C show that detection of human sporadic CJD (sCJD) PrPSc in cerebrospinal fluid (CSF) by RT-QulC using conventionally purified rPrP showed both false-positive and false-negative results. CSF samples are obtained from four definite sCJD and four non-CJD patients. The readout is shown by Mars analysis software (BMG). Arrows represent the false-negatives, low activity and false-positive reactions. Reactions were tested at 37°C (A), 42°C (B) and 55°C (C), respectively. Increase of temperature not only increases protein activity, but also decreases the reliability of RT-QulC reactions.
Figure 2 shows protein contamination in conventionally purified rPrP solution detected by liquid chromatography mass spectroscopy (LC-MS). The contaminating proteins are mainly bacterially expressed, including ATPase, GTPase and DNA polymerase, etc.. Two independent LC-MS tests indicated that the current purification method causes contamination, which may affect reliability of RT-QulC. Both figures are direct output of the MASCOT software for LC-MS.
Figure 3 shows that rPrP of three independent peaks A, B, and C, is obtained by ICE. Imidazole concentrations of 100 mM, 300 mM, 500mM are used. The conventional elution profile showing a single peak obtained from I MAC using an imidazole gradient is shown as a small profile with gray background.
Figure 4 shows a comparison of the reliabilities of rPrPs in the different peaks obtained by the ICE as shown in Fig. 3 by using RT-QulC. The rPrPs in peaks A, B and C were subjected to RT-QulC for 90 hours at 55°C. The results show that rPrP in peak B is the reliable protein which can be applied in RT-QulC for diagnostics. rPrP in peaks A and C should be excluded due to false negatives and false positives. rPrP in peak C can however be used as positive control in the test kit. The ascendant curve indicates the positive results. These data are obtained from Mars analysis software.
Figures 5A-C show the comparison of the performance of RT-QulC for 90 h at 37°C and 55°C using rPrP in peak B as the substrate. RT-QulC preparations were seeded with human sCJD, vCJD and non-CJD brain (e-7 represents the seed of 10"7 diluted brain) as shown in Fig. 5A. RT-QulC preparations were seeded with human sCJD and non-CJD CSF (three cases for each, represented as 1 , 2 and 3), as shown in Fig. 5B. RT-QulC preparations were seeded with cattle classic BSE (C-BSE) and low-type BSE (L-BSE), as shown in Fig. 5C. The seeds used in the 37°C tests are identical to those in 55°C ones.
Figure 6 shows the detection of prions in CJD blood by using rPrP of peak B. The blood samples from both sCJD and vCJD patients (four per type) were precipitated and seeded into RT-QulC for 55°C tests. Prions in vCJD blood can be detected on day 1 and those in sCJD blood are detectable on day 3 and 4, suggesting the application of peak B rPrP in high-throughput screening of blood samples.
Figure 7 shows that an oxidized methionine is found in peak B rPrP, but not in the rPrP of peaks A and C. This oxidized methionine is the methionine at residue 191 of SEQ ID NO:2. it corresponds to the methionine at residue 213 of the complete rPrP as defined in SEQ ID NO:4 (GenBank entry AAA60182.1) and encoded by the nucleotide sequence as defined in SEQ ID NO:3 (GenBank entry M13899.1). rPrPs were digested by trypsin and loaded on the C18 reversed phase column for LC-MS analysis. The oxidation of excess molecular weight of 64 Dalton is indicated by arrow in the diagram showing peak B. These figures are direct output of the MASCOT software for LC-MS. Figure 8 shows that protein contamination is dramatically reduced in ICE prepared peaks B and C. Contaminating proteins from bacteria and the environment are mainly eluted in peak A. The solutions of peaks B and C are much clearer; therefore the purified rPrPs are much better suited for diagnostic methods like RT-QulC or other prion tests. Figure 9 shows the visible differences of the rPrP solutions before and after dialysis. The eluted rPrPs were sterilized by 0.22 μιη filters first; then they were adjusted to 0.5 mg/ml with 10 KDa centrifugal filters before being loaded into 6 KDa dialysis tubing. Successive dialysis was done in 3 rounds (2 hours, 4 hours and 12 hours). Every dialysis was in 100 times volume of sterilized 10 mM NaH2P04 (pH 5.6 at 4°C). Thus, the components in the eluted solution smaller than 6 KDa were diluted to 1 x106 folds. After dialysis, the turbid solutions can be observed in peak A and C while peak B is still clean. For keeping similar volume of solution before and after dialysis, the loaded dialysis tubing was compressed by multiple clamps to reach the maximum pressure before being immersed in dialysis buffer. Figure 10 shows that mixed solutions are turbid after dialysis. ICE eluted rPrP of peak B is p re-mixed with A and C, respectively. Both mixed solutions are clean before dialysis. However, the dialyzed solutions become muddy, indicating aggregates are formed in both mixes. Protein concentration is controlled to be 0.5 mg/ml. Figure 11 shows that a concentration of 40 mM of imidazole does not result in elution of recombinant prion protein in a peak, but in a constant plateau at a low level.
Figure 12 shows that the elution of recombinant prion protein with 50 mM to 350 mM imidazole concentration harvested 6 peaks.
Figure 13 shows the elution profile of protein with 3 cascades of imidazole concentrations. Figure 14 shows that the length of the chromatography column used in the selection method affects the required eluting duration to observe the peaks.
Figure 15 shows the 1 st batch of blind tests (100% reliability). The shown curves represent fluorescence in RFU vs time of the QuIC reaction.
Figure 16 shows the 2nd batch of blind tests using hamster rPrP as substrate. The shown curves represent fluorescence in RFU vs time of the QuIC reaction.
Figure 17 shows the 2nd batch of blind tests using ICE-purified human rPrP as substrate. The shown curves represent fluorescence in RFU vs time of the QuIC reaction.
Figure 18 shows zoom-ins into the profiles of RT-QulC reaction results to compare diagnostic efficiency of reactions using hamster rPrP and ICE-purifed human rPOrP respectively. These results indicate that by using ICE-purified human rPrP as a substrate for the RT-QulC reaction, the duration of the reaction is reduced, and the interpretation of the results is facilitated.
Definitions In this description and the claims, reference will be made to a number of terms which shall be defined to have the following meanings:
The terms "prion protein" and "PrP" are used as a general term for any type of prion protein and encompass recombinant PrP as well as naturally occurring PrP, mixtures of different variants of PrP as well as isolated forms. The term comprises human PrP and PrP from other animals like cattle, sheep, goat, and deer.
The term "rPrP" refers to recombinant PrP, i.e. PrP that has been obtained by genetic engineering methods and shall comprise pure proteins as well as a mixture of rPrP
protein variants. This term refers to full-length proteins and fragments of PrP that are active in the present analytical methods.
The term "full-length protein" in the prion field refers to the mature human rPrP, which is a protein consisting of the amino acids at positions 23-230 as defined in SEQ ID NO:4, which corresponds to the GenBank entry AAA60182.1 for the human PrP. This GenBank entry is the protein, which is translated from the CDS of the PRNP gene, which is defined in SEQ ID NO:3 (GenBank entry M13899.1 ). However, the protein as defined in SEQ ID NO:4 is not the final form of cellular PrP. In the endoplasmic reticulum (ER), the part of the protein comprised of aa 1 -22, which is a signal peptide of PrP, is cleaved first. It has been shown that this signal peptide affects the folding characteristics of the rPrP, and, therefore, should be absent from the mature rPrP of the present invention. Furthermore, part of the protein comprised of aa 231-253 is replaced by a glycosylphosphatidylinositol (GPI) anchor, which helps PrPc to locate on the cellular membrane. Therefore, only the protein consisting of amino acids at positions 23-230 is left and termed mature or full-length PrP. This protein is defined in SEQ ID NO:2. This full-length protein is encoded by the polynucleotide of SEQ ID NO:1 , which corresponds to the nucleotides at positions 67-690 of the polynucleotide as defined in SEQ ID NO:3. The full-length rPrP is suitable to be the substrate for amplifying both human and cattle prions, and the yield of purified full-length rPrP is ideal. Furthermore, it has been shown that up to about 90 amino acids starting from the N-terminal methionine at position 1 of SEQ ID NO:4 can be digested by proteases without effecting the folding characteristics of the rPrP. Therefore it has been concluded that the essential part of the rPrP is consisting of the amino acids at positions 92-230 of SEQ ID NO:4. A protein of the present invention, therefore, is any full-length protein as defined in SEQ ID NO:2 as well as any protein that comprises the essential part but wherein some or all of the amino acids at positions 23-91 at the N-terminal part of the protein are missing and it comprises variants wherein some or all of the amino acids at positions 23-91 are varied by mutations, e.g. by deletions, insertion, and/or substitutions with other amino acids, e.g. with conservative substitutions. Conservative substitution tables are well known in the art, useful substitutions can be found by the skilled person by using such tables or by using routine experimentation. Examples for conservative substitutions are those wherein amino acids which originate from the same class are exchanged for one another, like
amino acids having aliphatic side chains, positively or negatively charged side chains, aromatic groups in the side chains or amino acids, the side chains of which can enter into hydrogen bridges, e.g. side chains which have a hydroxy I function. Insertions, deletions and substitutions are possible as long as the folding characteristics of the rPrP are not essentially changed.
It has also been shown that the N-terminal region of PrP comprises an array of five almost identical octapeptide sequences, also termed octarepeats. This region is found at amino acid positions 51-91 of SEQ ID NO:4. One of these octarepeats can be consisting of amino acids Gin Pro His Gly Gly Gly Trp Gly (SEQ ID NO:5). These octarepeats have been shown to play a role in copper binding and homeostasis, as well as in protection from oxidative stress. Importantly, mutations that result in expansion of the octarepeats have been linked to familial Creutzfeldt-Jakob disease (CJD). Documented cases of familial CJD report insertions of 2-9 octapeptide sequences. Therefore, variants of the rPrP of the present invention can comprise those peptides, which contain 2-9 octarepeats in their N-terminal region.
The term "rPrP0X" refers to a recombinant PrP wherein methionine 213 is in oxidized form (wherein the numbering refers to the full length protein).
The term "rPrP3"" refers to a new form of recombinant PrP that can be obtained with the method of the present invention as last fraction after elution of rPrPox and differs from rPrPox in that it self-aggregates without being infectious. It is assumed that this is a highly pure form of unoxidized rPrP that has self-aggregating properties.
The term "Prion disease" is used for all conditions, disorders or diseases that are caused by formation of prions, i.e. proteins that misfold and induce misfolding of other protein molecules. Examples for prion diseases are different types of Creutzfeldt-Jacob disease, BSE, FSE, TME, EUE, and CWD.
The terms "Imidazole cascade elution" and "ICE" refer to a method according to the present invention, wherein at least two imidazole fractions with different imidazole concentration are used for elution, wherein the at least two fractions have discrete concentrations.
The rPrP of the present invention can be used in detection methods for assaying the presence of PrPSc in a sample. Useful detection techniques for prion diagnosis and drug screening include protein misfolding cyclic amplification (PMCA), amyloid seeding assay (ASA), scanning for intensely fluorescent targets (SIFT) assay, and RT-QulC. The positive reaction in RT-QulC is defined as showing an ascendant curve on the screening window of the RT-QulC reaction within 96 hours. In particular, for RT-QulC reaction seeded by cerebrospinal fluid (CSF), the positive reaction is defined as showing an ascendant curve within 48 hours. The flat line without ascendant curve in these time-spans is defined as a negative reaction. By using the rPrP of the present invention in a detection method such as RT-QulC prion diseases can be diagnosed and distinguished from other neurodegenerative disorders. Furthermore, samples, such as animal products, human blood, transplant tissues and surgery equipment, suspected to be contaminated with prions, can be tested for contamination. Moreover, therapeutic effects, including the tracking of prion progression after treating a subject with anti-prion therapy and possible side effects of treatments which may trigger spontaneous prion diseases while treating other diseases, can be estimated. Furthermore, an early diagnosis in a subject with a possible mutation of the PRNP gene, who may suffer from genetic prion diseases, and an early diagnosis for people who reach the age with high risk of getting prion diseases, can be carried out within the context of a routine physical examination of the subject.
Detailed Description of the invention
The present invention provides a novel and inventive purification and isolation method, here also referred to as "Imidazole-cascade elution" (ICE), that allows to purify recombinant prion protein or other recombinant aggregating proteins and to obtain a highly pure and active protein that can be used as substrate in a detection method such as RT-QulC. Furthermore, using the highly pure fraction obtained with this method, a sensitive diagnostic system for prion diseases is provided. Surprisingly, by using ICE, the inventors found a novel type of rPrP that has superior properties and is particularly useful in diagnostic methods.
The elution method of the present invention uses a chromatographic technique of protein purification based on the principle of immobilized metal ion affinity
chromatography (IMAC). The bound recombinant proteins are etuted from the column using cascade concentrations of imidazole and at least two fractions can be obtained, one of which comprises the desired protein in highly pure form.
It was the surprising finding of the inventors that the rPrP used in the known testing methods was not as pure as assumed. Available rPrP, which had been purified in conventional form and had shown only one peak when checked for purity, was used by the inventors and they identified that the problem with known tests was the presence of protein variants that caused false-negative and false-positive results.
By analyzing the known protein with liquid chromatography mass spectroscopy (LC- MS) (see Fig. 2) existence of protein contamination in rPrP solutions was identified. Thus, it was found that following current chromatographic technique was inefficient to produce a reliable substrate for RT-QulC. The inventors developed a new strategy to prepare highly pure rPrP with a much lower contamination and a higher activity for the RT-QulC system. It was found that conventionally prepared rPrP that was used in testing methods is a mixture of bacterial contaminants and of protein variants. This mixture can now be used as starting point for isolation of the protein of interest.
It was surprisingly found that by varying the concentration of imidazole used for elution by using cascade elution, an apparently homogenous protein source of self- aggregating protein can be differentiated into different fractions with different characteristics. The key innovation of imidazole cascade elution is to turn the common one-step (constant concentration of imidazole) and gradient elution (linear increased concentration of imidazole) into several separated cascades concentrations of imidazole for protein elution. These characteristics can be assessed, and the fraction containing the protein with the most beneficial characteristics for the intended use can be isolated with high purity and quality. This is shown with the example of the recombinant prion protein, which can be used for the diagnosis of TSEs. With ICE, not only protein with high activity, purity and reliability can be harvested, but the unspecific protein contamination and those proteins causing false-negative and false-positive results in RT-QulC reactions can be excluded. In the present invention two, and an optional third, cascades were
chosen, because it was found that rPrP on the chromatography column was composed of three subtypes with different chemical and biological features.
A further surprising finding of the present invention is the identification of the source of the problems of the conventional methods for diagnosis of prion diseases and the provision of the solution of said problems. These problems are the low reliability of the conventional diagnostic methods due to the prevalence of false negatives and false positives. A further problem was the low sensitivity and activity of the conventionally used detection agent leading to long detection times and the need for an increased amount of source material. In general, purification via IMAC is a preferred technique when high yields of pure and active protein are required. Conventional IMAC is based on a high affinity binding of an immobilized metal ion by chelating a part of the target protein. Said part of the protein can be a histidine-rich sequence. Conventionally, target proteins are therefore tagged with an artificial histidine-rich sequence. The rPrP conventionally used in research is histidine-tagged as well (Colombo et al, PLoS one 2009; 4:e4296, [6]; Meli et al., PLoS one 201 1 , 6:e19093 [7]). This, however, obviously changes the nature of the protein, as its sequence is differing from the native sequence. As His- tagged rPrP may not be useful in a method for detecting prion diseases, it was not advantageous to tag rPrP to be purified. In the method of the present invention, rPrP can be used with the native amino acid sequence as defined in SEQ ID NO:2 encoded by the genetic nucleotide sequence as defined in SEQ ID NO:1 or variants or fragments thereof as defined above and in the following. Variants of the rPrP of the present invention are in particular those peptides that comprise some or all amino acids 23-230 of SEQ ID NO:4, wherein amino acids 23-91 can be substituted by other amino acids, can be deleted or wherein in the part outside aa 92-230 insertions have been made, in other words wherein amino acids 92-230 of SEQ ID NO:4 are conserved. The substitutions preferably are conservative substitutions. Thus, the rPrP of the present invention comprises at least the amino acids at positions 92-230 of SEQ ID NO:4 and can comprise further amino acids of SEQ ID NO:4. The rPrP of the present invention can also consist of a peptide consisting of amino acids at positions 92-230 of SEQ ID NO:4. Furthermore, the rPrP of the present invention can comprise the peptide consisting of amino acids at positions 92-230 of SEQ ID NO:4,
and an N-terminal region comprising from 2 to 9 octarepeats as defined in SEQ ID NO:5.
The rPrP used in the present invention can be obtained by recombinant expression in bacteria, followed by digestion, denaturation, and renaturation steps as are known to the person skilled in the art. As an example a method for obtaining the rPrP used in the methods of the present invention is described in brief, such methods are well- known in the art. The recombinant protein expressed by bacteria can be harvested by disrupting the bacteria cells by repeated freezing with liquid nitrogen followed by thawing. To harvest the recombinant protein said protein can be extracted from inclusion bodies by lysis, as is well-known in the art. In this lysis step a universal and efficient nuclease (e.g. Benzonase) can be used as well to digest total DNA and RNA to avoid the unspecific binding of nucleic acids to the solid support, such as a resin in a chromatography column. Nucleic acids comprise huge hydrophilic surfaces, which could cover the whole resin, and thus can block the binding sites (e.g., Ni2+ on the resin) for the protein to be purified. Therefore, it is recommended to digest nucleic acids with Benzonase, or with a combination of multiple types of DNase and RNase, before denaturing proteins with guanidine hydrochloride. The following denaturation can be critical to give all rPrP in the inclusion body an identically denatured and nonstructural starting state before refolding. The key of this step is to use 8 M or higher concentration of guanidine hydrochloride which is efficient for denaturation. In the preparation for rPrP used in the method of the present invention a concentration of 8 M guanidine hydrochloride in 50 mM Tris buffer (pH 8.5) was found preferable for dissolving the inclusion body and denaturing the recombinant PrP. Using a concentration of 6 M Guanidine hydrochloride was found to be insufficient. The following purification step can preferably be done at 2-8°C (normally 4°C) to keep protein activity. Therefore, urea, which is also a commonly used denaturant, is not useful, since low temperature (2-8°C) causes crystallization of dissolved urea. In the following the proteins are renaturated by allowing the proteins to refold. Refolding is carried out to obtain proteins having regained their native conformation/structure after denaturation. Refolding is carried out by decreasing denaturant concentration (e.g. guanidine hydrochloride) in the flowing aqueous phase. For refolding the rPrP of the present invention, the refolding should be done on the chromatography column. Furthermore, the refolding step preferably uses another denaturation buffer
containing 6 M guanidine hydrochloride and sodium phosphates (for buffering pH value at 8.0), which are different from the solution of 8 M guanidine hydrochloride (pH 8.5) described above for the denaturation step. The reason is that > 6 M of Guanidine is not soluble at pH 8.0 with sodium phosphates at 4°C. Furthermore, the ingredients of the refolding buffer are the same as in the denaturation buffer except for guanidine hydrochloride, which is not present in the refolding buffer. Further details can be found in Example 7.
This protein, which is without an artificial His-tag, can nevertheless be purified using an I MAC method, as negative charged amino acids in the sequence provide for sufficient binding to the bivalent cations on the chromatographic support used in the method of the present invention. The cations bind to a native domain of the protein, namely the copper binding domain, which can bind bivalent cations such as Zn2+, Ca2+, Cd2+, Cu2+, Co2+ and Ni2+. Binding strength of PrP to the I MAC column depends on the cations used and follows the order Cu2+ > Ni2+ > Zn2+ > Co2+. Cu2+ ions, however, are not useful for the methods of the present invention, as the affinity of the copper ions is too high to efficiently elute the rPrP after binding to the metal ions. Preferably, the cations used to bind proteins are selected from Zn2+, Co2+, Ca2+, Cd2+, and Ni2+, most preferably Ni +.
In a first step, the preparation comprising the recombinant prion protein obtained in conventional manner, preferably as outlined above, is subjected to a chromatographic separation step, such that the protein of interest can bind to a chromatography material comprising immobilized bivalent cations. Such chromatographic methods are known to the skilled person and chromatographic materials are available having metal ions immobilized on a solid support. Any such chromatographic material with immobilized bivalent cations can be used. Preferably, a chromatography column with immobilized Ni2+ ions is used to bind recombinant proteins by utilizing the affinity of Ni2+ to histidines in the protein sequence. One example for a material that is suitable for the chromatographic separation is a Ni-IDA resin as shown in the examples of the present application. Ni-IDA is a dry silica- based resin precharged with Ni + ions. The chelating group of Ni-IDA is based on iminodiacetic acid (IDA), which enables strong and efficient binding of a target protein onto the IMAC matrix. The bivalent cations can also be immobilized on microbeads, microspheres, and planar support structures, etc. as is known to the skilled person.
Thus, the method of the present invention can be used to obtain an isolated, purified recombinant prion protein (rPrP) using immobilized metal ion affinity chromatography (IMAC). This method comprises immobilizing an rPrP preparation encoded by a nucleotide sequence comprising the nucleotide sequence as defined in SEQ ID NO:1 on a solid support coated with metal ions, such as Zn2+, Co2+, or Ni2+.
The essential part of the method of the present invention is the elution of the protein of interest. As not only the protein of interest but further proteins are bound by the bivalent cations, the conditions of the elution are important to get rid of contaminants and to isolate the desirable protein. The proteins can be displaced from the column by using an agent competing for the binding to bivalent cations such as EDTA or imidazole. Conventionally, proteins are e luted with imidazole, which competitively binds to the metal ions, such as Ni2+ ions. Thus, the recombinant prion protein can be eluted while washing the column with imidazole solution.
Currently, two elution methods are applied conventionally in IMAC for harvesting protein binding to a Ni2+ column - isocratic or gradient elution. Isocratic elution using a constant concentration of imidazole is usually chosen in commercial kits. Gradient elution is reported for isolating rPrP for RT-QulC [2,3]. It has been found that both approaches yield protein preparations that seem to be homogenous but by further analysis were found to comprise a mixture of protein variants and contaminants. In an analysis three peaks were found for a protein deemed to be pure: peak A comprising bacterial contaminants, peak B comprising the target protein rPrP0X and peak C comprising a self-aggregating protein variant rPrP3".
In contrast to the known elution techniques the present invention uses imidazole cascade elution - ICE, wherein cascades of increasing imidazole concentrations are used in sequence to elute fractions of the bound protein. At least two different eluent concentrations are applied. The appropriate concentrations of imidazole in the different eluents are critical and the desired fractions are only obtained in the concentration window outlined in detail below.
Generally, the eluent used for the present isolation method is an aqueous solution of imidazole that was found to displace the desired proteins most efficiently. The aqueous phase can be water, or a buffered solution, more preferred a phosphate buffered solution, phosphate buffered isotonic saline, having a pH in the range of 6.5
to 7.5, preferably about 7.0, or a TRIS-HCI buffer having a pH at about 8.0. The skilled person is aware of other aqueous buffer solutions useful for eluting proteins and those can be used as the aqueous phase in the method of the present invention, too. Imidazole is added to the aqueous phase in amounts as outlined in detail below. If necessary a minor amount of a tenside or other excipients can be added, as is known to the skilled person.
Imidazole cascade elution is the novel method of the present invention, therefore, at least two different eluents are necessary and at least two elution steps are carried out. In a first step contaminants are removed, thus the concentration of imidazole has to be selected such that the contaminants are eluted but not or only in a very minor amount of the desired prion protein. In a second step the target protein rPrP0X shall be eluted as exhaustively as possible but without eluting proteins of peak C. In an optional third elution step the protein rPrPa" of peak C can be eluted.
In the first elution step a low concentration of imidazole is used, that elutes contaminants but does not efficiently elute the recombinant prion protein. For the first step in the cascade the imidazole concentration should not be below 40 mM, as below 40 mM the contaminants are not eluted sufficiently. It was found that 40 mM imidazole elutes the protein to a constant plateau thus to cause a very low yield (see Fig. 11 , and Example 1). Therefore, for the first elution step, the imidazole concentration shall be in the range of about 50 mM to about 150 mM. As shown above the lower threshold determines the minimal concentration necessary to elute a protein fraction in a peak. If the concentration is higher than 150 mM there is a risk that rPrP protein is eluted together with the contaminants, which lowers the yield of the desired fraction. The fraction eluted in this elution step comprises mainly bacterial and environmental protein contaminations, which are thought to be responsible for false negatives when used in the detection method, and for lowering the activity of the detecting agent. The fraction obtained in the first elution step comprising contaminants is to be discarded.
In a second elution step, an elution buffer with an increased imidazole concentration is used. This concentration is from about 150 mM to about 350 mM imidazole. It was shown that the fraction eluted with an aqueous solution, preferably a buffer solution like phosphate buffer, and an imidazole concentration in a range of about 150 mM to
about 350 mM, preferably 175 mM to 300 mM contains the desired novel and inventive rPrP variant - rPrP0X, which is a very active, safe and reliable detecting agent. This fraction can be used for a detection method or the rPrP0X can be recovered from the solution in well-known manner. The protein obtained is very stable and can be stored until it is used. Preferably, the protein is in aqueous solution and is frozen at -80°C until it is used.
After the second elution step remaining rPrP protein still bound to the chromatography matrix can be optionally eluted. It has been found that this remaining protein, in peak C, is a protein with valuable properties. Therefore, optionally a third elution step can be carried out to recover this protein, as well.
In the third elution step an elution buffer with a further increased imidazole concentration is used. A concentration of higher than 350 mM imidazole is used, preferably the imidazole concentration is from about 400 mM to about 500 mM imidazole. The upper limit is not critical, but a concentration of more than about 500 mM imidazole does not yield more protein and therefore is not useful. In the eluate of the third step a very pure rPrP variant is found - rPrP3", which is characterized by its high tendency to self-aggregate. It is assumed that it is this protein variant that causes false positives when the previously used rPrP preparation is applied. It can be beneficial to use this protein as positive control for the detection method of the present invention or generally for detection methods for detecting prion diseases to assess test validity and to ensure that the correct experimental procedure has been followed when carrying out the detection method. For this reason it is useful to separate the protein to be used as positive control from the fraction, which can be eluted with a buffer containing at least 350, preferably about 500 mM concentration of imidazole.
Further conditions of the elution method can be determined by a skilled person based on the following information, optionally by using routine experimentation.
The duration of elution steps can be determined by a person carrying out the method of the present invention in usual manner. The steps should have a sufficient length to elute the appropriate fraction. The time period depends on parameters like the size of the column, flow rate, temperature of the system, the chromatography system used, etc. For example, there are different sizes of containers for loading a chromatography
column; for one size of container, different lengths of the column are available (see Fig. 14). Furthermore, the flow rate of the elution buffer can be adjusted by the operator using the provided function of the chromatography system, affecting the duration of elution. These issues influence the required duration for elution buffer to pass through the entire column. Since the monitor for detecting proteins is at the downstream position of the chromatography system, the time point of the appearance of the peak is variable. A person of skill in the art easily can determine the optimal elution time needed to obtain the desired fractions of protein.
Directly after elution rPrP can be transferred into a dialysis buffer. Dialysis steps are carried out as known to the person skilled in the art (see also Example 7). After dialysis, the concentration of rPrP is usually greater than 0.5 mg/ml. The concentration can then be adjusted to be 0.3 mg/ml to 0.5 mg/ml for long-term storage at -80°C or for direct use in a detection method. Further concentration steps, such as centrifugal filtration and lyophilization, are not necessary, and can be even detrimental. Centrifugal filtration causes loss of protein and increases the number of processing steps as well as the price of purification. Furthermore, the necessary low speed centrifugation for about 5 hours would expose the proteins to an enhanced risk of contamination. Lyophilization would also require additional steps like the exchange of dialysis buffer to ddH20 and the removal of water. By using the isolation method of the present invention a novel and inventive recombinant protein is provided. The recombinant prion protein used in the ICE is encoded by the nucleotide sequence as defined in SEQ ID NO:1 or a fragment or variant thereof that encodes a fragment or variant as described above.. The translated amino acid sequence of the rPrP is defined in SEQ ID NO:2. An rPrP preparation as known and as used as starting material for the isolation method of the present invention can be obtained by bacterial expression, wherein the bacteria are transformed with a vector comprising an expression cassette for the rPrP. It is important that the sequence of the rPrP is not deviating from the native sequence of the PrPc, because the folding mechanism is depending on the sequence and conformation of the protein. For this reason, no artificial tags are included in the protein sequence. Specifically, no His-tag is included. It is assumed that a deviating sequence might not or not in the same amount be induced to misfold by PrPSc that is being tested.
The purified protein can be distinguished from the recombinant protein before purification. The purified rPrP of the invention has a distinctive oxidation pattern of the methionines in the amino acid sequence. Only one methionine is oxidized. This is the methionine at residue 213 of the full sequence, corresponding to residue 191 of SEQ ID NO:2 (..WEQMCITQYER..; aa 187-198, see also Fig. 7). This residue number of the oxidized methionine corresponds to the residue number 213 of the whole peptide sequence as defined in SEQ ID NO:4 (see also GenBank entry AAA60182.1 : http://www.ncbi.nlm.nih.gOv/protein/190468).
As shown above and below, the peptide sequence as defined in SEQ ID NO:4 includes a signal peptide at amino acid positions 1-22, and a peptide sequence at amino acid positions 231-253, which are cleaved from the peptide to obtain the full- length PrP as defined in SEQ ID NO:2. This PrP consists of 208 amino acids. The oxidized methionine is at residue 191 , which corresponds to residue 213 of the complete peptide as defined in SEQD ID NO:4. Whole peptide sequence (SEQ ID NO:4) consisting of the full-length rPrP as defined in SEQ ID NO:2 (shown underlined) and the peptide sequences (shown in italics), which are cleaved. The oxidized methionine is shown in bold:
MANLGCWML VLFVA TWSDL GLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQG GGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNK PSKPKTNMKHMAGAAAAGAWGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMH RYPNQVYYRPMDEYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERWE QMC\JQYERESQAYYQRGSSMVLFSSPPVILLISFLIFLIVG
Oxidation on methionines has been reported to affect the conformational stabilization of the prion protein (Wolschner et al., Proc Natl Acad Sci U S A.2009; 106:7756-7761 [8]). Met213, corresponding to Met191 of the novel and inventive rPrP, which is on a- helix 3 of PrP, is thought to be a crucial amino acid to control the conformational stability. It has been hypothesized that oxidation of this methionine may function as a switch to trigger the pathogenic conversion of PrP [6]. The research as reported in [6,8] was done in computer simulations. As, however, targeted oxidation of a specific methionine is not possible in vitro, it was previously not possible to provide a rPrP with the oxidation pattern as claimed. With the novel separation method of the present invention it was possible to provide said rPrP0X with the claimed oxidation
pattern. Without being bound by theory it is concluded that it is the oxidation of Met191/213 that accounts for the activity difference between rPrP0X, the protein in peak B, of the present invention and an rPrP preparation known in the prior art or rPrPs in other peaks and thus provides the reliability necessary for the detection method.
Furthermore, it was found that not only human rPrP, but also rPrP of other animals has different types on the column while being purified with I MAC. For example, it was found that full-length (mature) mouse rPrP (aa 23-231 ) purified with the methods of the present invention was composed of different subtypes of rPrP with independent oxidation and converting activity features.
With the ICE a further recombinant protein can be provided, which can be separated from the rPrP mixture in a further elution step subsequently to the elution of rPrP0X The further elution step uses a high concentration of imidazole, which should be at least 450 mM, preferably at least 500 mM. The rPrP eluted with this high concentration of imidazole is characterized by its very high purity, and its high affinity to self-aggregate. This protein, rPrPa", differs from rPrP0X by the missing oxidation at methionine 213. This protein can be used in the test as a positive control. This is superior to the infectious PrPSc protein currently used as positive control, as shipping and handling of infectious material is expensive and requires specific safety measures. These were not necessary if the protein of the present invention were used as positive control.
Furthermore, a kit for isolating rPrP0X is provided comprising the following reagents: a rPrP preparation; a first eluent comprising 50 mM to up to 150 mM imidazole in aqueous solution; a second eluent comprising from about 150 mM to up to about 350 mM imidazole in aqueous solution; optionally a third eluent comprising from about 350 mM to about 500 mM imidazole. Additionally, an inclusion body extracting buffer (e.g. 150 mM NaCI, 50 mM Tris, 1% Triton X-100, 1 % sodium deoxycholate, 0.5% Sarkosyl, 2 mM Mg2+, 2.5 U/ml of benzonase and 1 ,000 kU/ml lysozyme, pH 7.4); a first denaturation buffer 1 for denaturing rPrP in inclusion bodies (e.g. 8 M Guanidine hydrochloride, 50 mM Tris, pH 8.5); a second denaturation buffer 2 for refolding (e.g. 6 M Guanidine hydrochloride, 95 mM Na2HP04, 5 mM Na2HP04, pH 8.0); a refolding buffer (e.g. 95 mM Na2HP0 , 5 mM Na2HP04, pH 8.0); an elution buffer (e.g. 5 mM
Na2HP04, 95 mM Na2HP04, 500 mM imidazole, pH 5.8); and a dialysis buffer (e.g. 0.5 mM Na2HP04, 9.5 mM Na2HP04, pH 5.8) can be included.
The new proteins rPrPox and rPrPa" can be used in a detection method such as RT- QuIC. Thus, a further object of the present invention is a method for detecting a prion disease in a sample using a RT-QulC test. For this purpose, a kit for detecting PrPSc in a sample using the rPrP0X of the present invention is provided comprising the following reagents:
5 x RT-QulC reaction buffer (e.g. 2 M NaCI, 25 mM Na2HP04, 25 mM Na2HP04, 5 mM EDTA); 1 mM Thioflavin T; the human rPrPox of the present invention; and, optionally the rPrPa" of the present invention for use as a positive control.
The buffer specifications for the isolation/purification and detection kits are intended to be exemplary. The person skilled in the art is capable of adjusting or employing buffers with differing specifications, which nevertheless are encompassed by the scope of the present invention. Examples
Preferred embodiments of the invention are outlined in the following examples which should not be interpreted as restricting the scope or spirit of the invention.
Example 1 : Determination of elution profile
The appropriate concentration of imidazole for elution was tested since low concentrations of imidazole do not efficiently elute the recombinant prion protein. It was shown that e.g., 40 mM imidazole elutes the protein to a constant plateau and, thus, causes a very low yield (see Fig. 1 1 ).
In order to find a better starting concentration of imidazole for ICE, 7 concentration cascades (50 mM to 350 mM) were used to elute protein from the column (see Fig. 12). Each concentration was performed 60 min. A total of 6 peaks were observed, the first peak (peak 1 ) appeared while using 50 mM imidazole. Then almost every concentration cascade of imidazole generated one peak (peak 2 to 6) but 250 mM. After dialysis the eluted proteins in these peaks, protein concentrations were adjusted to 0.5 mg/ml followed by measuring their turbidities with 340 nm (A340)
absorption (see Table 1). The result showed that proteins in peak 1 , 2 and 6 had higher turbidities than those in peak 3 to 5, indicating that peak 1 , 2 and 6 contain proteins which are easily forming aggregates. Protein aggregates are harmful to either production or using as substrate in diagnosis, since (i) aggregated protein having large size can hardly pass through the next 0.22 pm sterilizing filter, (ii) spontaneously formed protein aggregates cause false-positivity in diagnosis. Therefore, peak 1 , 2 and 6 should be discarded from the yield. It can conclude that, imidazole concentrations range from 150 mM to 300 mM can elute appropriate protein for RT-QulC based prion diagnosis; lower or higher concentrations elute proteins forming spontaneous aggregates.
Table 1 : The turbidity (A340) of protein solutions in peak 1 to 6 absorption peak 1 peak 2 peak 3 peak 4 peak 5 peak 6
1 .28 1.36 1.31 1.33 1.35 1.27
A280
±0.019 ±0.072 ±0.068 ±0.029 ±0.056 ±0.17
0.96 1.12 0.004 0.006 0.007 0.99
A340
±0.026 ±0.17 ±0.001 ±0.003 ±0.001 ±0.13
A280 indicates protein concentration. The protein is 0.5 mg/ml when A280 is 1.3.
A340 indicates turbidity of protein solution.
To optimize the elution procedure, the 7 cascades of imidazole concentrations were decreased to 3. Concentrations of 100 mM, 300 mM and 500 mM imidazole for elution were chosen (see Fig. 3 and Fig. 13). Thus, the previous peak 1 and 2 were eluted with peak A, peak 3 to 5 were in peak B, and peak 6 and the remaining proteins were in peak C. This elution profile is unexpected and quite different from known single peaks obtained from IMAC (represented as a small profile with gray background in Fig. 3), since the base of IMAC is to purify homogenized protein. However, these elution peaks indicate that rPrP is separated into three fractions, suggesting that the protonization level of the protein given by imidazole in each peak is different from one to another. Therefore, it was concluded that rPrP in three peaks were chemically different.
Example 2: Using ICE-prepared rPrP in RT-QulC to detect prions in human CJD and cattle BSE
To estimate the reliability of rPrPs prepared by ICE, the proteins were subjected to RT-QulC reactions including non-seeded and sCJD-seeded preparations (see Fig. 4). Each reaction had six repeats and was performed at 55°C for 90 hours. For non-seeded RT-QulC, proteins contained in peaks A, B, and in a mixture of both peaks A and B (A+B mix) were observed to be stable, showing flat signals. However, the proteins contained in both peaks C and C+B mix cause false-positives. For sCJD- seeded (10" ° diluted sCJD MM1 brain), peak A showed a false-negative result while other preparations were active. These results indicate that peak B contains the most reliable rPrP for RT-QulC, and peak A and C cause false-negativity and false- positivity, respectively, should be excluded from harvested rPrP to be used as detection agent in a diagnostic method.
Example 3: Influence of reaction temperature
Two temperature points were chosen (37°C and 55°C) to further assess the activity of rPrP in peak B (see Fig. 5). RT-QulC preparations using peak B rPrP were seeded with serially diluted human sCJD and variant CJD (vCJD) brain, human sCJD CSF, classic cattle BSE (C-BSE) and low type cattle BSE (L-BSE) brain, respectively. These results show that rPrP of peak B can work for detecting sCJD, vCJD, C-BSE and L-BSE prions without causing false-positives in either species, indicating the suitability for RT-QulC based prion diagnosis. Meanwhile, both 55°C and 37°C can work for RT-QulC, indicating rPrP in peak B has a wide range of working temperature with high stability, suggesting the peak B rPrP can be applied not only to prion diagnosis, but also to investigate prion propagation. Moreover, RT-QulC using peak B rPrP has higher efficiency at 55°C than 37°C, which can dramatically shorten diagnosis duration, i.e. half days shorter for detecting prions in human CSF and L- BSE. This ability of reliably reacting at high temperature gives RT-QulC the highest efficiency compared to other studies (Peden et al., J. Gen. Virol 2012; 93:438-449 [9]; McGuire et al., Prion 201 1 ;5:18 [10]). Since the stability and higher efficiency of RT-QulC at 55°C had been confirmed, it was concluded that the peak B of rPrP could be applied to detect prions in human CJD blood. To address this, whole blood extract was spiked into RT-QulC
preparations and was subjected to 55°C RT-QulC for 90 h (see Fig. 6). Four reactions seeded by vCJD blood samples showed positive results on day 1 . Surprisingly, the sCJD blood-seeded RT-QulC also showed positive results on day 3 and day 4. Detection of PrPSc in sCJD blood samples has never been reported before. All eight non-CJD blood samples were negative after 90 h. These results indicate that the rPrP contained in peak B with high stability at high temperature is efficient to detect prions in human sCJD and vCJD samples, suggesting that this rPrP has a very high sensitivity in RT-QulC for high-throughput screening of blood samples. Example 4: Analysis of protein and protein solution
To characterize the chemical properties of ICE-prepared rPrP, rPrP in peaks A, B and C was subjected to LC-MS. Interestingly, it was found that the methionine at amino acid position 191 (corresponding to the methionine at amino acid position 213 of the peptide as defined in SEQ ID NO:4) but no other methionine of the amino acid sequence of peak B rPrP had been oxidized. No oxidation of any methionine could be found in the amino acid sequences of the rPrP contained in either peak A or peak C. Oxidation on methionines has been reported to affect the conformational stabilization of the prion protein [8]. Met213, corresponding to Met191 of the novel and inventive rPrP, which is on ct-helix 3 of PrP, is thought to be a crucial amino acid to control the conformational stability. It has been hypothesized that oxidation of this methionine may function as a switch to trigger the pathogenic conversion of PrP [6]. Hence, it was concluded that oxidation of et191/213 accounts for the activity difference between peak B rPrP to rPrPs in other peaks. Active oxidation of a specific methionine is however not possible in vitro. Example 5: Protein contamination
Although I MAC is thought to be specific for purifying protein, the protein contamination from cultured bacterial and environment can hardly be avoided. As shown in Fig. 2, some unexpected proteins which are not rPrP are always detected by LC-MS. By testing ICE-prepared rPrP, it was surprisingly found that the main protein contamination was only shown in peak A but not in B and C (see Fig. 8). These data suggest that ICE can produce much purer rPrP not only for RT-QulC, but also for other prion studies with biochemical and biophysical methods requiring low
background and weak interference coming from other proteins. It also suggested that ICE is an ideal method to increase purity while purifying other proteins from Ni2+ resin.
Example 6: ICE-prepared protein of peak B has a low risk to form self- aggregates
The last step of protein purification is usually dialysis or centrifugal filtration for buffer- exchanging and harvesting large amounts of protein. It is quite common that proteins form visible aggregates, especially while purifying rPrP. However, these aggregates can cause substantial loss of protein if 0.22 pm filtrating sterilization is required. For RT-QulC, 0.22 pm filtration is essential since measuring thioflavin T fluorescence requires a clean solution for better transmittance. Meanwhile, sterilization can avoid the growth of microorganisms during the warm incubation. Moreover, these rPrP aggregates should be removed since they may induce spontaneous conversion to cause false-positive results. The fractions containing the peaks obtained by ICE were dialyzed and it was found that although all three solutions were clean before dialysis, peaks A and peak C, but not peak B, showed visible turbidity after dialysis, indicating that rPrP in peaks A and peak C can form aggregates automatically, which are different from transparent rPrP solution in peak B (see Fig. 9). After filtrating the dialyzed solutions with a 0.22 pm filter, substantial losses of rPrP in peaks A and C were determined, but not in peak B (see Table 2). Similarly, pre-mixing the peaks before dialysis led to muddy solutions (see Fig. 10), which induced protein loss after filtration (see Table 3). These data indicate that, (1 ) rPrP in peaks A and C can form aggregates, they may also trigger aggregation of peak B rPrP; (2) these aggregates reduce the yield of rPrP for RT-QulC; (3) self-aggregation of peak C rPrP may be the reason for causing false-positives in RT-QulC; (4) ICE can help to exclude rPrP, which forms aggregates, and to increase the yield of protein; this also suggests a commercial value of producing proteins with ICE.
Table 2: The absorptions of dialyzed rPrP in peaks at 280 nm (for protein concentration) and 340 nm (for solution turbidity)
Dialyzed rPrPs were kept at 0.5 mg/ml to compare their turbidities. The rPrPs in peaks A and C show more than 10 times higher turbidity than that in peak B. Although the turbidity of these solutions is decreased after 0.22 pm filtration, the yields in peaks A and C are quite low (40% and 32%, respectively), comparing to 89% yield of peak B, suggesting most of rPrP aggregates in A and C are excluded by filtration. Absorption is shown with mean±SD from three independent batches of rPrP.
Table 3: The absorptions of dialyzed peak mix
Both mixes of peaks A+B and peaks C+B cause high turbidity, suggesting rPrPs in peak A and C assemble rPrP of peak B thus causing aggregation. The yields are only 53% and 45%, respectively, after 0.22 pm filtration, indicating the loss of half the rPrP due to aggregation. The ratio of rPrP amount of peak B: peak A or C is 10: 1. Absorption is shown with mean±SD from three independent batches of rPrP.
Example 7: Protocol for Imidazole cascade elution (ICE)
Gene sequence of recombinant prion protein (SEQ ID NO: 1 ) aagaagcgcccgaagcctggaggatggaacactgggggcagccgatacccggggcagggcagccctggaggc aaccgctacccacctcagggcggtggtggctgggggcagcctcatggtggtggctgggggcagcctcatggtggtg gctgggggcagccccatggtggtggctggggacagcctcatggtggtggctggggtcaaggaggtggcacccaca gtcagtggaacaagccgagtaagccaaaaaccaacatgaagcacatggctggtgctgcagcagctggggcagtg gtggggggccttggcggctacatgctgggaagtgccatgagcaggcccatcatacatttcggcagtgactatgagga ccgttactatcgtgaaaacatgcaccgttaccccaaccaagtgtactacaggcccatggatgagtacagcaaccaga acaactttgtgcacgactgcgtcaatatcacaatcaagcagcacacggtcaccacaaccaccaagggggagaactt caccgagaccgacgttaagatgatggagcgcgtggttgagcagatgtgtatcacccagtacgagagggaatctcag gcctattaccagagaggatcg
Amino acid sequence of recombinant priori protein (SEQ ID NO: 2) kkrpkpggwntggsrypgqgspggnryppqggggwgqphgggwgqphgggwgqphgggwgqphgggwg qgggthsqwnkpskpktnmkhmagaaaagavvgglggymlgsamsrpiihfgsdyedryyrenmhrypnqvy yrpmdeysnqnnfvhdcvnitikqhtvttttkgenftetdvkmmervveqmcitqyeresqayyqrgs rPrP expression
BL21 (DE3) E.coli. and pET41 a system were used to express rPrP. Bacteria were cultured in TB medium at 37°C with 200 to 220 rpm shaking till OD reached 1 .5 to 2.0. Next, 1 mM of IPTG (final concentration) were added into medium for induction at 37°C for 10 to 16 h with 220 to 300 rpm shaking. The cell pellet was harvested by 10,000 g centrifugation at 4°C for 10 min and the wet weight (gram) was measured. Then the cells were frozen with liquid nitrogen followed by thawing at 25°C. This step was repeated twice to thoroughly break the cell.
Inclusion body extraction
For each one gram of cell (wet), 10 ml of lysis buffer (pH 7.4) was added for dissolving. The lysis buffer contained 150 mM NaCI, 50 mM Tris, 1 % Triton X-100, 1 % sodium deoxycholate, 0.5% Sarkosyl, 2 mM Mg2+, 2.5 U/ml of Benzonase and 1 ,000 kU/ml lysozyme followed by shaking at 25 to 30°C for 1 h to dissolve the bacteria. Thereafter, this solution was centrifuged with 16,000 g at 4°C for 20 min to harvest pellet. The pellet was resuspended by 10 ml of lysis buffer to repeat the dissolving and centrifugation twice. Then the pellet was firstly resuspended by 10 ml of lysis buffer followed by adding 40 ml of ddH20 and mixing. This solution was precipitated by 10,000 g centrifugation at 4°C for 10 min. The harvested pellet was resuspended by 0.1 χ lysis buffer followed by 16,000 g centrifugation at 4°C for 20 min. The final inclusion body pellet (from 1 g of wet cell) was denatured with 10 ml of denaturation buffer (50 mM Tris, 8 M Guanidine hydrochloride, pH 8.5) at 25°C for 1 to 3 h. The denatured protein solution was centrifuged at 16,000 g at 4°C for 30 min to remove the debris.
Protein purification
Ni2+-IDA column (resin) was chosen for protein purification. Following buffers were required for this purification:
Regeneration buffer: 6 M Guanidine hydrochloride, 200 mM Acetic acid, pH 4.0
Denaturation buffer: 6 Guanidine hydrochloride, 95 mM Na2HP04, 5 mM NaH2P04, pH 8.0
Refolding buffer: 95 mM Na2HP04, 5 mM NaH2P04l pH 8.0 Elution buffer: 5 mM Na2HP04, 95 mM NaH2P04, 500 mM imidazole, pH 5.8
Dialysis buffer: 0.5 mM Na2HP04l 9.5 mM NaH2P04, pH 5.8
These buffers were sterilized by 0.22 pm filtration and chilled at 4°C till use.
IDA resin was firstly regenerated by 2 volumes of regeneration buffer followed by washing with 3 volumes of denaturation buffer at 25°C (room temperature). Thereafter, denatured protein solution was mixed with treated IDA resin for protein binding at 25°C for 1 h with gently shaking. After removing the solution, IDA resin was loaded onto the AKTAprime chromatography system for refolding and harvesting the recombinant prion protein at 4°C (see below).
A gradient of buffer exchange was used for refolding step. The denaturation buffer was set from 100% to 0%, and refolding buffer was from 0% to 100%. Buffer exchange went through the resin at 4°C for 15 h with flow rate 0.3 ml/min. Then the resin was washed by 10 volumes of refolding buffer at 4°C for 1 h with flow rate 0.5 ml/min. The imidazole cascade elution was done at 4°C with constant flow rate 2 ml/min. First, the elution buffer was injected from 0% to 20% (containing 100 mM imidazole), and the refolding buffer decreased from 100% to 80%. Buffers ran through the IDA column by keeping these ratios till reaching the end of the first eluting peak (peak A). Then the elution buffer was adjusted to 60% (300 mM imidazole) and refolding buffer was 40%. This step was finished when the second peak (peak B) was at the end. Then the elution buffer was adjusted to 100% for eluting the rest protein (peak C).
The eluted protein solutions (peak A, B and C) were loaded into dialysis tubing (MWCO 6000 to 8000) individually after 0.22 pm filtration. The loaded tubing was immersed in 100 volumes of pre-chilled dialysis buffer for three times of dialysis. The durations of dialysis were 2 h, 4 h and 15 h, respectively. The dialyzed proteins were
harvested on ice after 0.22 pm filtration. The protein solutions were measured with 280 nm (A280) absorption followed by calculating the protein concentrations with the formula below:
A280 = 2.67 x protein cone, (mg/ml) χ cuvette length (1 cm) At last, the protein solutions were divided into aliquots and frozen with liquid nitrogen followed by transferring to -80°C for long-term storage.
Example 8: Blind tests show both high reliability and high efficiency of ICE- purified human rPrP in the QuIC-based diagnosis of human CJD
To further test the reliability of ICE-purified rPrP, two independent batches of blindly prepared human cerebrospinal fluid (CSF) samples were used to compare ICE- purified rPrP as a substrate with hamster rPrP as a substrate, which has been used as substrate by National CJD Research & Surveillance Unit, University of Edinburgh, UK (NCJDRSU) and NIH ([2], [9], [10]).
In a first step, the reactions were carried out using hamster rPrP as a substrate. 15 μΙ of each CSF sample of the first batch were spiked into one RT-QulC reaction. 30 μΙ of each CSF sample of the second batch were spiked into one RT-QulC reaction. When using ICE-purified human rPRP as a substrate, only 10 μΙ of each CSF sample were spiked into one RT-QulC reaction.
The RT-QulC reactions using ICE-purified human rPrP were found to have much shorter lag-phases of amplification compared to the RT-QulC reactions using the hamster rPrP. More importantly, reactions using human rPrP had better reproducibility than those using hamster rPrP. In summary, the use of human rPrP results in fast diagnosis with high reliability. Furthermore, a much higher relative fluorescence unit (RFU) was observed in reactions using ICE-purified human rPrP compared to reactions using hamster rPrP. This facilitates to immediately distinguish CJD CSF case from non-CJD cases.
Details of blind tests are provided in Figures 15, 16, 17, 18 and in Tables 4 and 5.
For the first batch, reactions using hamster rPrP (NCJDRSU) and ICE-purified human rPrP (ZNP) substrates were seeded with blind CSF samples from the UK to test the
reliability of RT-QulC. Each sample was done in triplicates. Results showed that reactions using ICE-purified human rPrP (lower panel of Fig. 15) produce comparable conclusions with those using hamster rPrP (upper panel of Fig. 15). However, fluorescence of hamster rPrP is much lower than that of human rPrP. For example, positive reactions performed in B1 to B3 and B7 to B9 of using hamster rPrP show weak ascendant curves of fluorescence whose positivity may be only recognized by the experienced RT-QulC operator. However, much more obvious positivity can be observed in those reactions using ICE-purified human rPrP substrate. For those reactions using hamster rPrP, each well was seeded with 15 μΙ of CSF into 85 μΙ of substrate preparation containing 100 pg/ml rPrP (final concentration). For those using ICE human rPrP, each well was seeded with 10 μΙ of CSF into 90 pi of substrate preparation containing 100 pg/ml rPrP (final concentration). The summary is shown in Table 4.
4: Summary of the first batch of blind test for diagnosing CJD in CSF
RT-QulC RT-QulC
CSF No. well conclusion
(hamster rPrP) (human rPrP)
1818 A1-A3 O of 3 O of 3 non-CJD
4531 A4-A6 3 of 3 3 of 3 CJD
4379 A7-A9 0 of 3 O of 3 non-CJD
4426 A10-A12 O of 3 O of 3 non-CJD
4444 B1-B3 3 of 3 3 of 3 CJD
4453 B4-B6 O of 3 O of 3 non-CJD
4466 B7-B9 3 of 3 3 of 3 CJD
4510 B10-B12 O of 3 O of 3 non-CJD
no rPrP Ctrl. C10-C12 O of 3 O of 3 no background
These results were confirmed by NCJDRSU with 100% sensitivity and 100% specificity.
The results of blind testing the second batch using NCJDRSU prepared hamster rPrP and blindly prepared human CSF (the 2nd batch of CSF from NCJDSU, UK) is
shown in Fig. 16. Tests of CSF samples were performed twice with two independent RT-QulC reactions (plate 1 and 2, 96-well plate). Each sample was done in triplicates within one plate. As can be clearly seen in Fig. 16, the results of the two runs are not fully comparable with each other. E.g., A2 is positive in plate 1 but negative in plate 2, A7 and A8 are negative in plate 1 but positive in plate 2. Each well was seeded with 30 μΙ of CSF into 70 pi of substrate preparation containing 100 pg/ml hamster rPrP (final concentration). The summary is shown in Table 5 below.
The results of blind testing the second batch using ICE-purified human rPrP and blindly prepared human CSF (the 2nd batch of CSF from NCJDSU, UK) is shown in Fig 17. Throughout the results, the fluorescence of reactions using ICE-purified human rPrP shows higher performance than that of reactions using hamster rPrP shown in Figure 16. It is noteworthy that results of this figure are from 72 h while those in Figure 16 are from 120 h, suggesting that ICE human rPrP substrate is more sensitive to detect human PrPSc in RT-QulC. Each well was seeded with 10 μΙ of CSF into 90 pi of substrate preparation containing 100 pg/ml human rPrP (final concentration). The summary is shown in Table 5 below.
A comparison of zoom-in profiles of RT-QulC results for comparing diagnostic efficiency of reactions using hamster rPrP substrate and ICE human rPrP, respectively is shown in Figure 18. Well C3 (seeded with case 1445, classified as CJD-positve, and C4 (seeded with case 1496, classified as CJD-negative) in each plate is shown in Figure 16 and 17. Positive reactions using hamster rPrP show lag- phases from 30 to 40 h and fluorescence intensities (RFU) from 20.000 to 40.000 which are caused by amplification of PrPSc in 30 μΙ of human CJD CSF. Reactions using ICE-purified human rPrP provide < 24 h of lag-phases and 50.000 to above 60.000 RFU which are caused by only 10 μΙ of human CJD CSF. Due to the high performance of human rPrP substrate, it was not essential to run these reactions for a longer duration than 72 h. These results indicate that by using ICE-purified human rPrP as a substrate, not only the duration of RT-QulC reactions can be reduced, but the interpretation of results is facilitated as well.
Table 5. Summary of the second batch of collaborated blind test (NCJDRSU confirmed results)
well No. UK-rSHaPrP (positive/3 parallel) De-ICE rHuPrP (positive/3 parallel)
CSF No.
(96-wel!
(30 cases)
plate) test 1 test 2 diagnosis test 3 test 4 diagnosis
1180 A1-A3 1/3 * 0/3 * CJD 2/3 # 3/3 a CJD
1187 A4-A6 0/3 0/3 no 0/3 0/3 no
1215 A7-A9 0/3 * 2/3 * CJD 3/3 # 3/3 # CJD
1247 A10-A12 1/3 2/3 CJD 2/3 2/3 CJD
1293 B1-B3 2/3 3/3 CJD 2/3 3/3 CJD
1337 B4-B6 2/3 1/3 CJD 2/3 3/3 CJD
1356 B7-B9 2/3 2/3 CJD 3f3 3/3 CJD
1416 B10-B12 3/3 3/3 CJD 3/3 3/3 CJD
1445 C1-C3 3/3 2/3 CJD 3/3 3/3 CJD
1496 C4-C6 0/3 0/3 no 0/3 0/3 no
1577 C7-C9 0/3 0/3 no 0/3 0/3 no
1929 C10-C12 1/3 3/3 CJD 3/3 3/3 CJD
1974 D1-D3 0/3 0/3 no 0/3 0/3 no
2091 D4-D6 0/3 0/3 no 0/3 0/3 no
2158 D7-D9 0/3 0/3 no 0/3 0/3 no
4051 D10-D12 1/3 2/3 CJD 3/3 3/3 CJD
4060 E1-E3 2/3 3/3 CJD 3/3 3/3 CJD
4384 E4-E6 0/3 0/3 no 0/3 0/3 no
4396 E7-E9 2/3 3/3 CJD 3/3 3/3 CJD
4397 E10-E12 0/3 0/3 no 0/3 0/3 no
4404 F1-F3 1/3 3/3 CJD 3/3 3/3 CJD
4407 F4-F6 3/3 * 0/3 * CJD 3/3 # 3/3 # CJD
4410 F7-F9 0/3 0/3 no 0/3 0/3 no
4412 F10-F12 0/3 0/3 no 0/3 0/3 no
4432 G1-G3 0/3 0/3 no 0/3 0/3 no
4437 G4-G6 0/3 0/3 no 0/3 0/3 no
4454 G7-G9 1/3 3/3 CJD 3/3 3/3 CJD
4545 G10-G12 0/3 0/3 no 0/3 0/3 no
4563 H1-H3 0/3 0/3 no 0/3 0/3 no
4604 H4-H6 0/3 0/3 no 0/3 0/3 no
For those using hamster rPrP from NCJDRSU (marked with an asterisk *)
• case 1 108 (A1-A3), positive in test 1 , negative in test 2, diagnose as probable CJD;
• case 1215 (A7-A9), negative in test 1 , positive in test 2, diagnose as probable CJD;
• case 4407 (F4-F6), positive in test 1 , negative in test 2, diagnose as probable CJD;
For those using ZNP ICE-purified human rPrP (marked #).
• cases above are all positive in test 1 and 2, diagnose as definite CJD.
References
[1 ] Atarashi R, Wilham JM, Christensen L et al. Simplified ultrasensitive detection of recombinant PrP conversion with shaking. Nat Methods 2008;5:21 1 -212.
[2] Wilham JM, Orru CD, Bessen RA, et al. Rapid end-point quantitation of prion seeding activity with sensitivity comparable to bioassays. PLoS 2010;6(12).
[3] Atarashi R, Satoh K, Sano K et al. Ultrasensitive human prion detection in cerebrospinal fluid by real-time quaking induced conversion. Nature Medicine 2011 ; 17(1 ).
[4] Atarashi R, Sano K, Satoh K et al. Real-time quaking-induced conversion: a highly sensitive assay for prion detection. Prion 201 1 ; 5:150-153.
[5] Orru CD, Wilham JM, Hughson AG, et al. Human variant Creutzfeldt-Jakob disease and sheep scrapie PrP(res) detection using seeded conversion of recombinant prion protein. Protein Eng Des Sel. 2009; 22: 515-521.
[6] Colombo G, Meli M, Morra G, Gabizon R, Gasset M. Methionine sulfoxides on prion protein Helix-3 switch on the alpha-fold destabilization required for conversion. PLoS one 2009; 4:e4296
[7] Meli M, Gasset M, Colombo G. Dynamic Diagnosis of Familial Prion Disease Supports the β2-α2 Loop as a Universal Interference Target. PLoS one 2011 , 6:e19093 [8] Wolschner C, Giese A, Kretzschmar HA, et al. Design of anti- and pro- aggregation variants to assess the effects of methionine oxidation in human prion protein. Proc Natl Acad Sci U S A.2009; 106:7756-7761.
[9] Peden AH, McGuire LI, Appleford NE et al. Sensitive and specific detection of sporadic Creutzfeldt-Jakob disease brain prion protein using real-time quaking- induced conversion. J. Gen. Virol 2012; 93:438-449.
[10] McGuire L, Peden A, Appleford N et al. Prion seeding activity in cerebrospinal fluid from sporadic Creutzfeldt-Jakob disease patients using real-time QuIC analysis: a potential new diagnostic test? Prion 20 1 ;5:18.
Claims
1 . A method of obtaining an isolated, purified recombinant prion protein (rPrP0X) using immobilized metal ion affinity chromatography (IMAC), wherein the method comprises
a) immobilizing a prion protein preparation on a solid support carrying bivalent cations,
b) eluting a first fraction of proteins from the solid support with an aqueous phase containing from about 50 mM to up to about 150 mM imidazole, c) eluting a second fraction of rPrP0X from the solid support with a buffer containing from 150 mM to about 350 mM imidazole,
d) collecting the second fraction, containing the isolated purified rPrP0X.
2. The method of claim 1 , wherein the prion protein preparation comprises rPrP or a fragment or variant thereof.
3. The method of claim 2, wherein the rPrP comprises a peptide sequence as defined by the amino acids at positions 92-230 of SEQ ID NO:4, or wherein the rPrP comprises at least amino acids at positions 92-230 of SEQ ID NO:4 wherein the rPrP consists of a peptide sequence as defined by the amino acids at positions 92-230 of SEQ ID NO:4, or wherein the rPrP consists of a peptide sequence as defined in SEQ ID NO:2, or wherein the rPrP comprises a peptide sequence as defined by the amino acids at positions 92-230 of SEQ ID NO:4 and an N-terminal region comprising a fragment of the peptide sequence as defined by the amino acids at positions 23-92 of SEQ ID NO:4, wherein the fragment can comprise mutations such as deletions, insertion, and/or substitutions, such as conservative substitutions, or wherein the rPrP comprises a peptide sequence as defined by the amino acids at positions 92-230 of SEQ ID NO:4 and a N-terminal region, wherein the N-terminal region comprises from 2 to 9 octarepeats as defined by SEQ ID NO:5; or wherein the rPrP is an rPrP variant comprising amino acids 92-230 of SEQ ID NO:4 and additionally at least part of the sequence of amino acids 23-91 , wherein some of amino acids 23-91 are substituted by other amino acids, are deleted or wherein insertions have been made.
4. The method of any one of the preceding claims, wherein the cations are selected from Zn2+, Co2+, or Ni2+, preferably wherein the cations are Ni2+.
5. Method of any one of the preceding claims, wherein the solid support is selected from the group consisting of a resin, microbeads, microspheres, and planar supports.
6. Method of any one of the preceding claims, wherein the solid support is a Ni- IDA resin.
7. Isolated purified rPrP obtained with the method of any one of claims 1 to 6.
8. Isolated purified rPrP of claim 7, wheren the rPrP is human rPrP.
9. Isolated purified rPrP comprising or consisting of an amino acid sequence as defined in claim 2 or 3, wherein the only oxidized methionine in the sequence is the methionine corresponding to the methionine at position 191/213 of SEQ ID NO:2/4, and wherein the isolated purified rPrP does not comprise an artificial his-tag.
10. Use of the isolated rPrP of any one of claims 7 to 9 in a method for detecting scrapie prion protein PrPSc in a sample, wherein the detection of aggregates of the rPrP indicates the presence of PrPSc in the sample.
1 1. Use of claim 10, wherein the detection method is selected from the group comprising protein misfolding cyclic amplification (PMCA), amyloid seeding assay (ASA), scanning for intensely fluorescent targets (SIFT) assay, and realtime quaking-induced conversion (RT-QulC), preferably wherein the detection method is RT-QulC.
12. Use according to claim 1 1 , wherein the detection method, preferably RT-QulC, is carried out at a temperature from about 37°C to about 55°C.
13. Method according to claim 1 , further comprising a further elution step e) after step c) of claim 1 , wherein a third fraction of rPrPagg is eluted from the solid support with a buffer containing at least about 350 mM and up to 500 mM imidazole, and a further step f) of collecting said third fraction.
14. Use of rPrPa", contained in the third fraction obtained by the method of claim 13, as a positive control in a method for detecting scrapie prion protein PrPSc in a sample using a detection method selected from the group comprising PMCA, ASA, SIFT assay, and RT-QulC, preferably RT-QulC.
15. Use of any one of claims 10 to 1 1 , or 14, wherein the sample is obtained from foodstuff, a liquid such as blood of a human, or an animal such as cow, sheep, deer, cat etc., medical equipment such as surgical instruments.
16. Kit for isolating rPrP0X comprising the following reagents: a rPrP preparation; a first eluent comprising 50 mM to up to 150 mM imidazole in aqueous solution; a second eluent comprising from about 150 mM to up to about 350 mM imidazole in aqueous solution; optionally a third eluent comprising from about 350 mM to about 500 mM imidazole; an inclusion body extracting buffer; a first denaturation buffer 1 for denaturing rPrP in inclusion bodies; a second denaturation buffer 2 for refolding; a refolding buffer; an elution buffer; and a dialysis buffer.
17. Kit for detecting prion diseases comprising: rPrPox as obtained with a method of one of claims 1 to 5 or as defined in any one of claims 7 to 9 as detecting agent; a reaction buffer; 1 mM Thioflavin T; and, optionally, the rPrP3" for use as a positive control.
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP13182421.1 | 2013-08-30 | ||
| EP13182421.1A EP2842962A1 (en) | 2013-08-30 | 2013-08-30 | Method for the isolation of recombinant prion protein and the use thereof |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2015028537A1 true WO2015028537A1 (en) | 2015-03-05 |
Family
ID=49111009
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2014/068226 Ceased WO2015028537A1 (en) | 2013-08-30 | 2014-08-28 | Method for the isolation of recombinant prion protein and the use thereof |
Country Status (2)
| Country | Link |
|---|---|
| EP (1) | EP2842962A1 (en) |
| WO (1) | WO2015028537A1 (en) |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| KR20200043305A (en) * | 2018-10-17 | 2020-04-27 | 한양대학교 에리카산학협력단 | Mass Production Method for Recombinant Prion Protein with High Purity |
| US20200229407A1 (en) * | 2017-10-13 | 2020-07-23 | Amira Medical Technologies Inc. | Products and methods associated with multiple sclerosis as a transmissible protein misfolding disorder |
| WO2023192985A1 (en) * | 2022-03-31 | 2023-10-05 | Henderson Davin | Purification of prion protein substrate for real-time quaking induced conversion (rt-quic) |
Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20060030007A1 (en) * | 2003-05-30 | 2006-02-09 | Byrd Devon R | Peptides for metal ion affinity chromatography |
| US20060121507A1 (en) * | 2004-11-15 | 2006-06-08 | Walter Eberle | High throughput prion assays |
| WO2008083972A2 (en) * | 2007-01-12 | 2008-07-17 | Alicon Ag | Method for removing prion protein |
| CN102887949A (en) * | 2012-09-29 | 2013-01-23 | 中国农业大学 | Recombinant human prion protein (hPrP), and preparation method and application thereof |
-
2013
- 2013-08-30 EP EP13182421.1A patent/EP2842962A1/en not_active Withdrawn
-
2014
- 2014-08-28 WO PCT/EP2014/068226 patent/WO2015028537A1/en not_active Ceased
Patent Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20060030007A1 (en) * | 2003-05-30 | 2006-02-09 | Byrd Devon R | Peptides for metal ion affinity chromatography |
| US20060121507A1 (en) * | 2004-11-15 | 2006-06-08 | Walter Eberle | High throughput prion assays |
| EP1674870A2 (en) * | 2004-11-15 | 2006-06-28 | Roche Diagnostics GmbH | High-throughput prion assays |
| WO2008083972A2 (en) * | 2007-01-12 | 2008-07-17 | Alicon Ag | Method for removing prion protein |
| CN102887949A (en) * | 2012-09-29 | 2013-01-23 | 中国农业大学 | Recombinant human prion protein (hPrP), and preparation method and application thereof |
Non-Patent Citations (1)
| Title |
|---|
| ATARASHI R ET AL: "Simplified ultrasensitive prion detection by recombinant PrP conversion with shaking", NATURE METHODS, NATURE PUBLISHING GROUP, GB, vol. 5, no. 3, 1 March 2008 (2008-03-01), pages 211 - 212, XP002656329, ISSN: 1548-7091 * |
Cited By (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20200229407A1 (en) * | 2017-10-13 | 2020-07-23 | Amira Medical Technologies Inc. | Products and methods associated with multiple sclerosis as a transmissible protein misfolding disorder |
| KR20200043305A (en) * | 2018-10-17 | 2020-04-27 | 한양대학교 에리카산학협력단 | Mass Production Method for Recombinant Prion Protein with High Purity |
| KR102298635B1 (en) * | 2018-10-17 | 2021-09-07 | 한양대학교 에리카산학협력단 | Mass Production Method for Recombinant Prion Protein with High Purity |
| WO2023192985A1 (en) * | 2022-03-31 | 2023-10-05 | Henderson Davin | Purification of prion protein substrate for real-time quaking induced conversion (rt-quic) |
Also Published As
| Publication number | Publication date |
|---|---|
| EP2842962A1 (en) | 2015-03-04 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| JP4790966B2 (en) | Structural disease detection method, structural disease marker assay, diagnostic kit, structural change regulatory compound identification method, prion protein pathogenic form detection method, and β-amyloid protein pathogenic form detection method | |
| AU2015314783B2 (en) | Detection of misfolded proteins | |
| AU2001264089A1 (en) | Early diagnosis of conformational diseases | |
| US20220137073A1 (en) | Detection of misfolded tau protein | |
| US6451541B1 (en) | Chaperones capable of binding to prion proteins and distinguishing the isoforms PrPc and PrPsc | |
| WO2009015091A1 (en) | Detection of infectious prion protein by seeded conversion of recombinant prion protein | |
| Wang et al. | Staphylococcus epidermidis small basic protein (Sbp) forms amyloid fibrils, consistent with its function as a scaffolding protein in biofilms | |
| Cheng et al. | Real-time quaking-induced conversion assay for detection of CWD prions in fecal material | |
| Hashida et al. | Proteome analysis of hemofilter adsorbates to identify novel substances of sepsis: a pilot study | |
| WO2015028537A1 (en) | Method for the isolation of recombinant prion protein and the use thereof | |
| Campbell et al. | The PrPC C1 fragment derived from the ovine A136R154R171 PRNP allele is highly abundant in sheep brain and inhibits fibrillisation of full-length PrPC protein in vitro | |
| WO2016123401A1 (en) | Detection of disease-associated tau protein conformations and applications thereof | |
| Liu et al. | Co-analysis of serum and urine differentially expressed proteins in mucopolysaccharidosis type I | |
| Roseman et al. | Intrinsic toxicity of the cellular prion protein is regulated by its conserved central region | |
| Priola et al. | Molecular aspects of disease pathogenesis in the transmissible spongiform encephalopathies | |
| Liu et al. | Aβ∗ 56 is a stable oligomer that impairs memory function in mice | |
| CN101248355B (en) | Methods used to detect encephalopathy | |
| Riesner | Molecular basis of prion diseases | |
| JP5191028B2 (en) | RNA aptamer that binds to fibrils derived from abnormal prion protein | |
| Gorski et al. | Design and application of a Tau seed amplification assay for screening inhibitors of Tau seeding | |
| US20120301457A1 (en) | LIPID COFACTORS FOR FACILITATING PROPOGATION OF PRPsc | |
| WO2005026740A1 (en) | Methods and kits for the detection of prion diseases | |
| Jones | Conformational Properties of-PrP | |
| US7754865B2 (en) | Compositions and methods for enhancing the identification of prion protein PrPSc | |
| Kuliyev et al. | Structural defects caused by Acrodermatitis Enteropathica mutations in the extracellular domain account for mistrafficking and malfunction of ZIP4 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 14755833 Country of ref document: EP Kind code of ref document: A1 |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 14755833 Country of ref document: EP Kind code of ref document: A1 |


