WO2015024503A1 - Engineering clostridia neurotoxins with elevated catalytic activity - Google Patents
Engineering clostridia neurotoxins with elevated catalytic activity Download PDFInfo
- Publication number
- WO2015024503A1 WO2015024503A1 PCT/CN2014/084725 CN2014084725W WO2015024503A1 WO 2015024503 A1 WO2015024503 A1 WO 2015024503A1 CN 2014084725 W CN2014084725 W CN 2014084725W WO 2015024503 A1 WO2015024503 A1 WO 2015024503A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- polypeptide
- neurotoxin
- vamp2
- botulinum neurotoxin
- light chain
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
- C07K14/33—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Clostridium (G)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
Definitions
- This invention relates to modification of Clostridia Neurotoxins including Botulinum Neurotoxin and Tetanus Neurotoxin and applications of the derivatives obtained thereof.
- Clostridia Neurotoxins are among the most potent protein toxins for humans and are responsible for botulism, a flaccid paralysis elicited by the Botulinum Neurotoxins (BoNT), and spastic paralysis elicited by Tetanus Neurotoxin (TeNT).
- CNTs are 150 kDa dichain proteins with typical A-B structure-function properties, where the B (binding) domain binds to surface components on the mammalian cell and translocates the A (active) domain to an intracellular location (1).
- CNTs are organized into three functional domains: an N-terminal catalytic domain (light chain, LC), an internal translocation domain (heavy chain, HCT), and a C-terminal receptor binding domain (heavy chain, HCR) (2).
- the CNTs are zinc metalloprotease that cleave SNARE (Soluble NSF Attachment REceptor) proteins which interfere with synaptic vesicle fusion to the plasma membrane and ultimately block neurotransmitter release in nerve cells (1, 3).
- cleave SNARE Soluble NSF Attachment REceptor
- VAMP2 vesicle associated membrane protein-2
- SNAP25 Plasma membrane SNARE proteins
- BoNT serotypes B, D, F and G BoNT serotypes B, D, F and G
- TeNT cleave VAMP2 BoNT serotypes A and E cleave SNAP25
- BoNT serotype C cleaves SNAP25 and syntaxin la (3, 5-7).
- BoNTs are most widely used in protein therapy.
- BoNT serotype A (BoNT/A) was approved by the United States Food And Drug Administration (FDA) to treat strabismus, blepharospam, hemificial spasm and also for cervical dystonia, cosmetic use, glabellar facial lines and axillary hyperhidrosis as early as 1989.
- FDA United States Food And Drug Administration
- BoNT/A was approved by the United States Food And Drug Administration
- FDA United States Food And Drug Administration
- the efficacy of BoNT/ A in treating dystonia and other disorders related to involuntary skeletal muscle activity, and the satisfactory safety profile associated with BoNT/A have prompted empirical/off-label use of BoNT/A in a variety of opthalmological, gastrointestinal, urological, orthopedic, dermatological, secretory, and painful disorders (8-17).
- MYOBLOCTM Botulinum Neurotoxin serotype B product
- BoNT BoNT-like neurotoxin serotype A
- BoNT/B Botulinum Neurotoxin serotype B
- BoNTs Since therapeutic properties of BoNTs and development of BoNTs immunoresistance are interrelated, the best way to overcome the immunoresistant problem in BoNTs is to engineer more active BoNTs that could reduce the amounts of toxins required for therapy. Rummel et al have modified a ganglioside binding motif of the heavy chain (HC) domain of BoNT/B that enhances the binding and toxicity to up to three-fold relative to the wild type toxin (43).
- HC heavy chain
- BoNT/B ganglioside binding motif of the heavy chain domain of BoNT/B that enhances the binding and toxicity to up to three-fold relative to the wild type toxin (43).
- engineering of BoNT through modification(s) of its receptor binding sites may affect the selectivity of the binding event.
- modification of the binding site(s) may not increase the potency significantly enough to prevent the development of immunoresistance. Rather, altering BoNT activity by modification of the light chain (LC) may be a better way to achieve this goal.
- LC
- This invention provides methods for modulating activity of Botulinum Neurotoxin and Tetanus Neurotoxin.
- the present invention provides methods for enhancing substrate recognition of the light chain of Tetanus Neurotoxin (LC/T) and Botulinum Neurotoxin (LC/B) via elevated catalytic activity.
- LC/T Tetanus Neurotoxin
- LC/B Botulinum Neurotoxin
- the present invention provides derivatives of Botulinum Neurotoxin and Tetanus Neurotoxin and their applications thereof.
- the present invention provides derivatives of the light chain of Tetanus Neurotoxin (LC/T) or derivatives of the entire Tetanus Neurotoxin with altered activity.
- LC/T Tetanus Neurotoxin
- the present invention provides derivatives of the light chain of Botulinum Neurotoxin (LC/B) or derivatives of the entire Botulinum Neurotoxin with altered activity.
- LC/B Botulinum Neurotoxin
- the LC/B derivatives or Botulinum Neurotoxin derivatives described herein can be used in various therapies, cosmetics or other applications.
- the LC/B derivatives or Botulinum Neurotoxin derivatives described herein are used in therapy for reducing immunoresistance to Botulinum Neurotoxin.
- the present invention provides methods to improve current therapy using Botulinum Neurotoxin.
- the present invention provides method of using derivatives of Botulinum Neurotoxin or light chain of Botulinum Neurotoxin for various therapeutic or cosmetic applications.
- Figure 1 shows an illustration of the S2', S I ' and SI pockets of the light chain of Tetanus Neurotoxin (LC/T) and light chain of Botulinum Neurotoxin (LC/B), and the P sites of VAMP2. Amino acid residues at the pockets which interacts with different P sites of the VAMP2 are shown.
- Figure 1A shows the interacting residues of LC/T and the VAMP2, wherein the LC/T is represented as a surface model.
- Figure IB shows the interacting residues of LC/T and the VAMP2, wherein the LC/T is represented as a cartoon model.
- Figure 1C show the interacting residues of LC/B and VAMP2, wherein the LC/B is represented as a surface model.
- Figure ID show the interacting residues of LC/B and VAMP2, wherein the LC/B is represented as a cartoon model.
- the nomenclatures of the P site of VAMP2 and the S pockets of LC/T are as follow.
- the two residues that formed the scissile bond of VAMP2 were designated as ⁇ 1- ⁇ from C- to N-terminus.
- Residues from PI to the C-terminal direction were designated as P2, P3 etc., while residues from ⁇ to the N-terminal direction were designated as P2', P3 ' etc.
- the pockets in LC/T or LC/B that recognize the specific P sites were designated as the corresponding S pockets.
- VAMP2 recognizes the PI ' site of VAMP2 (residue F ), is composed of L and I respectively.
- Figure 2 shows catalytic activities of LC/T, LC B and their derivatives on cleaving substrate VAMP2.
- Figure 2 A shows the activities of LC/T and derivatives on cleaving VAMP2.
- Figure 2B shows the activities of LC/B and derivatives on cleaving VAMP2.
- Error bar represents standard deviation of three independent repeats for each assay.
- Figure 3 shows orientation of S I ' residue in LC/B, LC/T and the LC/T derivative [K 168 E, L 230 I].
- Figure 3 A compares the orientation of S I ' pocket residue in LC/B (I 227 ), in LC/T (L 230 )
- Figure 3B shows a relative flat surface demonstration of S I ' pocket comprising I 227 in LC/B (black), and I 230 in LC/T [K 168 E, L 230 I] (grey).
- Figure 3C shows the bulky surface of S I ' pocket of LC/T comprising L 230 with a mesh surface demonstration.
- Figure 3D shows the bulky surface of SI ' pocket of LC/T comprising L 230 with a solid surface demonstration.
- Figure 4 shows the distances between residues in the SI ' and S2' pockets of LC/T ( Figure 4A), LC/B ( Figure 4B) and LC/T [K 168 E, L 230 I] ( Figure 4C).
- the distances between the side chains of SI ' residue and S2' residues were measured using the PyMol program.
- Figure 5 shows the cleavage of endogenous VAMP2 by recombinant LC/B, LC/T and their derivatives.
- Figure 5A shows the cleavage of endogenous VAMP2 by LC/T and LC/T [K 168 E, L 230 I].
- Figure 5B shows the cleavage of endogenous VAMP2 by LC/B and LC/B [S 201 P].
- Upper panel in each figure shows cleavage of VAMP2 analyzed by western blotting using anti- VAMP2 antibody and anti-actin antibody; lower panel shows quantification of the bands obtained from the western blot analysis.
- BoNTs In order to enhance the therapeutic efficacies of BoNTs and minimize the induction of neutralizing antibody against BoNTs, it is highly desirable to engineer the BoNTs into more potent derivatives such that a lower effective therapeutic dose of BoNT can be used in various treatments and applications.
- the present invention Through studying the substrate recognition and specificity of the Botulinum Neurotoxin and Tetanus Neurotoxin, the present invention has opened up a new opportunity to engineer Botulinum Neurotoxin and Tetanus Neurotoxin into novel derivatives with enhanced activity and substrate specificity.
- the present invention provides methods for optimizing substrate recognition of the light chain of Botulinum Neurotoxin B (LC/B) or the light chain of Tetanus Neurotoxin (LC/T), and provides derivatives of these toxins with elevated catalytic activity.
- LC/B Botulinum Neurotoxin B
- LC/T Tetanus Neurotoxin
- the present invention provides methods for modulating activity of Botulinum Neurotoxin and Tetanus Neurotoxin.
- the present invention provides derivatives of the light chain of Botulinum Neurotoxin B (LC/B) or derivatives of the entire Botulinum Neurotoxin B with elevated activity.
- the Botulinum Neurotoxin described herein comprises a polypeptide of SEQ ID NO. : 1.
- derivatives of Botulinum Neurotoxin described herein comprise one or more alteration in the amino acid sequence.
- derivatives of Botulinum Neurotoxin comprise a change of amino acid at position 201 identified according to SEQ ID NO. : l from serine (S 201 ) to proline (P 201 ).
- the derivative of Botulinum Neurotoxin [S 201 P] comprises a sequence of SEQ ID NO. : 2.
- derivatives of Botulinum Neurotoxin comprise a change of amino acid alanine at position 263 identified according to SEQ ID NO. : l .
- derivatives of Botulinum Neurotoxin comprise a change of amino acid isoleucine at position 264 identified according to SEQ ID NO. : l.
- the present invention provides derivatives of the light chain of Tetanus Neurotoxin (LC/T) or derivatives of the entire Tetanus Neurotoxin.
- the Tetanus Neurotoxin described herein comprises a polypeptide of SEQ ID NO. : 3.
- derivatives of Tetanus Neurotoxin described herein comprise one or more alteration in the amino acid sequence.
- derivatives of Tetanus Neurotoxin comprise a change of amino acid at position 230 as identified according to SEQ ID NO: 3 from
- derivatives of Tetanus Neurotoxin comprise a change of amino acid at position 168 as identified according to SEQ ID NO: 3 from lysine (K 168 ) to glutamate (E 168 ).
- derivative of Tetanus Neurotoxin [L 230 I] comprises a sequence of SEQ ID NO. : 4.
- derivatives of Tetanus Neurotoxin comprise a change from Leucine-230 (L 230 ) to Isoleucine-230 (I 230 ) and a change from Lysine- 168 (K 168 ) to Glutamate- 168 (E 168 ) identified according to SEQ ID NO: 3.
- derivative of Tetanus comprises a change from Leucine-230 (L 230 ) to Isoleucine-230 (I 230 ) and a change from Lysine- 168 (K 168 ) to Glutamate- 168 (E 168 ) identified according to SEQ ID NO: 3.
- Neurotoxin [K 168 E, L 230 I] comprises a sequence of SEQ ID NO: 5.
- the present invention provides pharmaceutical composition comprising derivatives of Botulinum Neurotoxin or Tetanus Neurotoxin.
- the Botulinum Neurotoxin, Tetanus Neurotoxin and the derivatives of Botulinum Neurotoxin are examples of Botulinum Neurotoxin and others.
- Tetanus Neurotoxin described herein are fused or coupled with one or more supplementary polypeptides, wherein the supplementary polypeptide is from Botulinum Neurotoxin, Tetanus
- the supplementary polypeptides fused or coupled with the present toxins are native or recombinant polypeptides. In another embodiment, the supplementary polypeptide fused or coupled with the present toxins are artificial polypeptides.
- the DNA of the light chain (LC) and heavy chain (HC) of Botulinum Neurotoxin or Tetanus Neurotoxin or their derivatives described herein are cloned into the same expression vector, thereby expressing a fusion protein comprising the light chain and heavy chain.
- the light chain and heavy chain are originated from the same serotype of the toxin.
- the light chain and heavy chain are originated from different serotypes of the toxin.
- the Botulinum Neurotoxin derivatives described herein are used in a pharmaceutical, clinical, or cosmetic procedure. In one embodiment, the Botulinum Neurotoxin derivatives described herein are used to treat or improve diseases or conditions in various therapies or other applications. In one embodiment, the Botulinum Neurotoxin derivatives described herein can be used in a novel therapy with a lower chance of developing immunoresistance to Botulinum Neurotoxin.
- the Botulinum Neurotoxin derivatives described herein are used to treat or improve strabismus, blepharospam, hemificial spasm, cervical dystonia, spasticity, glabellar facial lines, axillary hyperhidrosis, lower urinary tract disorders, gastrointestinal tract disorders, spasmodic dysphonia, temporomandibular disorder, sialorrhea, chronic diabetic neuropathy, wound healing, vaginism, musculoskeletal pain, disorders related to involuntary skeletal muscle activity such as involuntary muscle spasm and contractions, or any other applicable diseases or conditions.
- the present invention provides methods for improving or treating diseases or conditions by administering to the subject an effective amount of the Botulinum Neurotoxin derivatives described herein. In another embodiment, the present invention provides methods for improving current therapy using Botulinum Neurotoxin.
- the present invention provides methods of using Botulinum Neurotoxin with enhanced therapeutic efficacy or pharmaceutical properties. In another embodiment, the present invention provides methods for reducing immunoresistance to Botulinum Neurotoxin in various therapies and applications. [0041] In one embodiment, the Tetanus Neurotoxin derivatives described herein can be used as a molecular marker or an effective tool to study the mechanisms of exocytosis in central neuron.
- the present invention provides a modified light chain polypeptide of Botulinum Neurotoxin, wherein the Botulinum Neurotoxin has the amino acid sequence of SEQ ID NO. : l, and the modified light chain comprises one or more mutations at positions as identified according to SEQ ID NO. : 1.
- the modified light chain polypeptide of Botulinum Neurotoxin described herein comprises an amino acid sequence of SEQ ID NO. : 2.
- the present invention provides a composition comprising the modified light chain polypeptide of Botulinum Neurotoxin described herein, wherein the polypeptide is fused with or coupled with one or more second polypeptide, and wherein the second polypeptide is a polypeptide from Botulinum Neurotoxin or other organisms.
- the second polypeptide is native or artificial.
- the present invention provides a composition comprising the modified light chain polypeptide of Botulinum Neurotoxin described herein and a pharmaceutical acceptable carrier.
- the present invention provides a method for improving or treating diseases or conditions in a subject, comprising a step of administering to the subject an effective amount of the modified light chain polypeptide of Botulinum Neurotoxin described herein.
- the diseases or conditions are selected from the group consisting of strabismus, blepharospam, hemificial spasm, cervical dystonia, spasticity, glabellar facial lines, axillary hyperhidrosis, involuntary muscle spasm, lower urinary tract disorders, gastrointestinal tract disorders, spasmodic dysphonia, temporomandibular disorder, sialorrhea, chronic diabetic neuropathy, wound healing, vaginism, musculoskeletal pain and involuntary muscle contractions.
- the method for improving or treating diseases or conditions described herein, wherein reduced immunoresistance to Botulinum Neurotoxin in a subject is induced in the subject.
- said reduced immunoresistance to Botulinum Neurotoxin is induced in the subject as compared to treatment with wild-type Botulinum Neurotoxin.
- the present invention provides a modified light chain polypeptide of Tetanus Neurotoxin, wherein the Tetanus Neurotoxin has the amino acid sequence of SEQ ID NO. : 3, and the modified light chain comprises one or more mutations at positions as identified according to SEQ ID NO. : 3.
- the modified light chain polypeptide of Tetanus Neurotoxin described herein comprises an amino acid sequence of SEQ ID NO. : 4 or 5.
- the present invention provides a composition comprising the modified light chain polypeptide of Tetanus Neurotoxin described herein, wherein the polypeptide is fused with or coupled with one or more second polypeptide, and wherein the second polypeptide is a polypeptide from Tetanus Neurotoxin or other organisms.
- the second polypeptide is native or artificial.
- composition comprising the modified light chain polypeptide of Tetanus Neurotoxin described herein is used as a molecular marker to study exocytosis in the neuron.
- the present invention provides a composition comprising the modified light chain polypeptide of Tetanus Neurotoxin described herein and a pharmaceutical acceptable carrier.
- the present invention provides a method for improving or treating diseases or conditions in a subject, comprising a step of administering to the subject an effective amount of the modified light chain polypeptide of Tetanus Neurotoxin described herein.
- Plasmids for the expression of LC/T (1-436) (accession no. of the Tetanus Neurotoxin: X06214.1), LC/B (1-440) (accession no. of the Botulinum Neurotoxin: AB084152.1) and VAMP2 (1-97) and subsequent protein expression and purification were performed as previously described (30-32).
- Site directed mutagenesis of pLC/T, pLC/B and pVAMP2 were performed using QuickChange (Stratagene) protocols as previously described (30, 31). Plasmids were sequenced to confirm the mutation and that additional mutations were not present within the ORFs. Mutated proteins were produced and purified as described (30-33). Linear Velocity And Kinetic Constant Determinations For VAMP2 Cleavage By LC/B And LC/T
- LC/T derivative [K E, L I] was crystallized by hanging drop vapor diffusion method.
- LC/T [K 168 E, L 230 I] was stored in a buffer of 10 mM Tris, 20 mM NaCl (pH 7.9) at a concentration of 7.5 mg/ml.
- Each of the handing drop contained ⁇ ⁇ protein solution and 1 ⁇ mother liquor (250 mM Mg(N0 3 ) 2 and 15% PEG 3350). Crystals were grown at 16°C for 4-5 days until maturation. For data collection, crystals were harvested and cryoprotected in the mother liquor supplemented with 20% glycerol.
- Neuro-2A cells were cultured in minimum essential medium supplemented with 10% newborn calf serum, 1.4% sodium bicarbonate, and 0.5% penicillin- streptomycin at 37 °C in 5% C0 2 .
- Confluent cells were harvested and lysed by passing through a 25 gauge needle for 20-30 times on ice. Nuclei and unbroken cells were spun down by centrifuging the lysed product for 5 min at 2500 rpm and the supernatant was collected for assay. After incubating the cell lysate with different amount of LCs at 37°C for 10 min in a reaction volume of 10 ⁇ , the reaction was stopped by adding equal amount of SDS-PAGE sample buffer and boiling the reaction mixture at 100°C for 10 min. Cleavage of VAMP was analyzed by western blotting using anti-VAMP2 and anti-actin antibody.
- BoNT/B and TeNT were found to cleave substrate VAMP2 at the same scissile bond, while their efficiencies of substrate hydrolysis were different, with LC/B being more active than LC/T by about 20-folds.
- LC/B and LC/T showed that the active site of the two LCs displayed a similar arrangement for VAMP2 recognition. The major difference between the two systems was found to be at the P2'-S2' substrate recognition site (33, 38).
- Figure 1 illustrates the active site of LC/B and LC/T for interacting with the substrate VAMP2. Comparison of the structures of LC/B and LC/T revealed that the S2' pocket of the two
- LCs are similar and comprise an arginine residue (R in LC/B and R in LC/T), while their SI ' pockets were different.
- the SI ' pocket of LC/B is composed of F 95 , V 200 , S 201 , L 226 and I 227
- the SI ' pocket of LC/T is composed of F 199 , V 204 , P 205 , L 229 , L 230 and L 231 .
- Mutation of these SI ' pocket residues to alanine showed no effect on LC/B substrate hydrolysis except for I 227 A, which showed ⁇ 80-fold reduction of k cat , but not K m (38).
- the different composition of SI ' pocket of LC/B and LC/T may contribute not only to the different recognition of PI ', but also the P2' site of VAMP, which may further affect the different catalytic activity of LC/B and LC/T.
- SI ' and S2' pockets are in close proximity, the different composition of SI ' pocket of LC/B and LC/T may be correlated to the different properties observed in the S2' pockets of LC/B and LC/T.
- both S2' pockets of LC/B and LC/T comprise an arginine
- LC/T [L 230 I], which was engineered for an optimal SI ' pocket, was tested for its activity on cleaving VAMP2 E 78 R. As shown in Table 2, the amount of LC/T required to cleave 50% of VAMP2 was about 120 nM (EC 50 ). LC/T showed no cleavage on VAMP2 E 78 R even at a concentration as high as 36,000 nM.
- EC 50 refers to the concentration of LC proteins resulting in 50% cleavage of VAMP2 or VAMP2 E'3 ⁇ 4.
- LC/T (K E, L I) was found to be ⁇ 100-fold more active than Wt-LC/T on cleaving VAMP2, as indicated by the elevated & caf value, but not K m value (Table 1, Figure 2a).
- One possible explanation for the abolished activity is the combination of three mutations at the active site of LC/T may impair the correct conformation of LC/T (Table 1).
- Both isoleucine and leucine are hydrophobic residue that are likely to interact with F 77 of VAMP2 through hydrophobic interaction.
- the isoleucine in the SI ' pocket of LC/B and LC/T was found to be more significant in the interaction. It could be due to different orientation of the isoleucine residue in the pocket that favors interaction with F 77 of VAMP2. Structural analysis of the S I ' pockets of LC/B and LC/T
- I in LC/B resides at a flatter position than L in LC/T.
- the bulky leucine in LC/T may push the interacting residue F 77 of VAMP2 outward, thereby restraining the interaction between R 374 and E 78 of VAMP2.
- the flatter position of isoleucine in LC/B may provide an optimal position for fitting F 77 and E 78 of VAMP2 to the active site of LC/B, hence favors the interactions of I 227 -F 77 and R 370 -E 78 .
- FIG. 3A illustrates the F 0 -F c electron density of L 230 I mutations in the LC/T (K 168 E, L 230 I) structure.
- LC/T [K 168 E, L 230 I] can perfectly aligned to Wt LC/T with a Root Mean Square Deviation (RMSD) of 0.150 (370 to 370 atoms with 421 atoms aligned), suggesting that the overall conformation of LC/T [K 168 E, L 230 I] is comparable to that of Wt-LC/T.
- RMSD Root Mean Square Deviation
- the present invention found that SI pocket mutation of LC/T from Lysine (K 168 ) to Glutamate 168 (E 168 ) [K 168 E] can increase the rate of cleaving VAMP2 to a level comparable to the rate of LC/B.
- the side chain of Leucine (L ) of LC/T is more
- LC/T [K E, L I] attained a higher activity on cleaving native VAMP2 in Neuro2A cell than the wildtype toxin ( Figure 5A).
- the highly active LC/T derivatives described in the present invention can be used as more effective tools to study the mechanisms of exocytosis in central neuron.
- LC/B [S 201 P] has a higher activity on cleaving recombinant VAMP2 than the wildtype toxin by more than 10-fold (Table 1) and on cleaving native VAMP2 in Neuro2A cell ( Figure 5B).
- the LC/B derivative described herein can be used to replace LC/B protein currently used in various therapeutic, cosmetic or other applications, or be developed into novel therapy that may minimize immunoresistance to BoNT.
- Botulinum G neurotoxin cleaves VAMP/synaptobrevin at a single Ala-Ala peptide bond, J Biol Chem 269, 20213-20216.
- Tetanus and botulinum neurotoxins are zinc proteases specific for components of the neuroexocytosis apparatus, Ann N Y Acad Sci 710, 65-75.
Landscapes
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Health & Medical Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Life Sciences & Earth Sciences (AREA)
- Genetics & Genomics (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Gastroenterology & Hepatology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
Abstract
This invention provides methods of modulating activity of Botulinum Neurotoxin and Tetanus Neurotoxin. In one embodiment, the present invention provides active derivatives of the light chain of Tetanus Neurotoxin (LC/T) and Botulinum Neurotoxin (LC/B) or derivatives of the entire Tetanus Neurotoxin and Botulinum Neurotoxin. In another embodiment, the present invention provides methods to improve current therapy using Botulinum Neurotoxin. In another embodiment, the present invention provides novel methods to use Botulinum Neurotoxin or light chain of Botulinum Neurotoxin for therapeutic or cosmetic purposes. In one embodiment, the present invention provides method for reducing immunoresistance to Botulinum Neurotoxin in various applications of the toxin.
Description
ENGINEERING CLOSTRIDIA NEUROTOXINS WITH ELEVATED CATALYTIC
ACTIVITY
CROSS-REFERENCE TO RELATED APPLICATION
[0001] This application claims the benefit of U.S. Serial No. 61/868,560, filed August 21, 2013. The entire contents and disclosures of this prior application are incorporated herein by reference into this application. [0002] Throughout this application, various references or publications are cited. Disclosures of these references or publications in their entireties are hereby incorporated by reference into this application in order to more fully describe the state of the art to which this invention pertains.
FIELD OF THE INVENTION
[0003] This invention relates to modification of Clostridia Neurotoxins including Botulinum Neurotoxin and Tetanus Neurotoxin and applications of the derivatives obtained thereof.
BACKGROUND OF THE INVENTION
[0004] The Clostridia Neurotoxins (CNTs) are among the most potent protein toxins for humans and are responsible for botulism, a flaccid paralysis elicited by the Botulinum Neurotoxins (BoNT), and spastic paralysis elicited by Tetanus Neurotoxin (TeNT). CNTs are 150 kDa dichain proteins with typical A-B structure-function properties, where the B (binding) domain binds to surface components on the mammalian cell and translocates the A (active) domain to an intracellular location (1). CNTs are organized into three functional domains: an N-terminal catalytic domain (light chain, LC), an internal translocation domain (heavy chain, HCT), and a C-terminal receptor binding domain (heavy chain, HCR) (2). The CNTs are zinc metalloprotease that cleave SNARE (Soluble NSF Attachment REceptor) proteins which interfere with synaptic vesicle fusion to the plasma membrane and ultimately block neurotransmitter release in nerve cells (1, 3). Mammalian neuronal exocytosis is driven by the formation of protein complexes between a vesicle SNARE protein called vesicle associated membrane protein-2 (VAMP2), and two plasma membrane SNARE proteins SNAP25 (Synaptosome- Associated Protein of 25 kDa) and syntaxin la (4). There are seven BoNT serotypes (termed A-G) that cleave specific residues on one of the three SNARE proteins: BoNT serotypes B, D, F and G, and TeNT cleave VAMP2, BoNT serotypes A and E cleave SNAP25, and BoNT serotype C cleaves SNAP25 and syntaxin la (3, 5-7).
[0005] BoNTs are most widely used in protein therapy. BoNT serotype A (BoNT/A) was approved by the United States Food And Drug Administration (FDA) to treat strabismus, blepharospam, hemificial spasm and also for cervical dystonia, cosmetic use, glabellar facial lines and axillary hyperhidrosis as early as 1989. The efficacy of BoNT/ A in treating dystonia and other disorders related to involuntary skeletal muscle activity, and the satisfactory safety profile associated with BoNT/A have prompted empirical/off-label use of BoNT/A in a variety of opthalmological, gastrointestinal, urological, orthopedic, dermatological, secretory, and painful disorders (8-17). On December 11, 2000, a Botulinum Neurotoxin serotype B product (MYOBLOC™) was approved by the FDA in the United States as a treatment for patients with cervical dystonia to reduce the severity of abnormal head position and neck pain associated with cervical dystonia (18, 19).
[0006] The therapeutic benefits of BoNT for conditions associated with involuntary muscle spasm and contractions, cosmetic use, or other applications are transient and repeated injections of BoNT are necessary. In some patients, BoNT could elicit neutralizing antibodies against the corresponding toxin, thus reducing the availability of BoNT. The resulted immunoresistance limits the beneficial effects of BoNT and may render the patient completely unresponsive to further treatment (9, 10, 20-26). The exact percentage of patients who may develop immunoresistance to BoNT treatment is unknown, but it is commonly believed that there are fewer patients who develop blocking antibodies when treated with Botulinum Neurotoxin serotype A (BoNT/ A) than with serotype B (BoNT/B) (9, 26). This is probably due to the use of lower doses of the BoNT/A complex than the BoNT/B complex (27). The development of blocking antibodies is also more common in patients who receive treatment for cervical dystonia or spasticity, which requires larger doses and periodic administration of the toxin, while it is less common in patients who are treated for laryngeal dystonia, blepharospasm or for cosmetic use, all of which require smaller doses for treatments (9, 28, 29). Apparently, lowering the treatment dose may help to reduce the development of immunoresistance to BoNT treatment.
[0007] To date, there is no effective solution for handling the BoNT immunoresistance issue. Attempt has been made to block the epitopes on the BoNTs that are involved in the induction of neutralizing antibody. By reacting neutralizing antibodies from resistant patients to different domains of BoNT/ A and BoNT/B, a series of immunogenic regions that may be involved in the induction of neutralizing antibody have been identified (39-41). It has been reported that conjugating peptides with monomethoxypolyethylene glycol (mPEG) could suppress the immune response against the peptides. Regions on the heavy chain of serotype A (HC/A) which showed strong immune response were conjugated to mPEG and the resulting derivatives were
used to pre-immunize mice before the administration of BoNT/A. It was shown that some of the mPEG-conjugated peptides could actually reduce the production of the neutralizing antibody (42), indicating that the tolerization procedure might be potentially useful for clinical applications to immunoresistant patients.
[0008] Since therapeutic properties of BoNTs and development of BoNTs immunoresistance are interrelated, the best way to overcome the immunoresistant problem in BoNTs is to engineer more active BoNTs that could reduce the amounts of toxins required for therapy. Rummel et al have modified a ganglioside binding motif of the heavy chain (HC) domain of BoNT/B that enhances the binding and toxicity to up to three-fold relative to the wild type toxin (43). However, engineering of BoNT through modification(s) of its receptor binding sites may affect the selectivity of the binding event. In addition, modification of the binding site(s) may not increase the potency significantly enough to prevent the development of immunoresistance. Rather, altering BoNT activity by modification of the light chain (LC) may be a better way to achieve this goal. Hence, there is a need to modify Clostridia Neurotoxins such as Botulinum Neurotoxins to enhance therapeutic efficacies.
SUMMARY OF THE INVENTION
[0009] This invention provides methods for modulating activity of Botulinum Neurotoxin and Tetanus Neurotoxin.
[0010] In one embodiment, the present invention provides methods for enhancing substrate recognition of the light chain of Tetanus Neurotoxin (LC/T) and Botulinum Neurotoxin (LC/B) via elevated catalytic activity.
[0011] In one embodiment, the present invention provides derivatives of Botulinum Neurotoxin and Tetanus Neurotoxin and their applications thereof.
[0012] In one embodiment, the present invention provides derivatives of the light chain of Tetanus Neurotoxin (LC/T) or derivatives of the entire Tetanus Neurotoxin with altered activity.
[0013] In another embodiment, the present invention provides derivatives of the light chain of Botulinum Neurotoxin (LC/B) or derivatives of the entire Botulinum Neurotoxin with altered activity.
[0014] In one embodiment, the LC/B derivatives or Botulinum Neurotoxin derivatives described herein can be used in various therapies, cosmetics or other applications. In another embodiment, the LC/B derivatives or Botulinum Neurotoxin derivatives described herein are used in therapy for reducing immunoresistance to Botulinum Neurotoxin.
[0015] In another embodiment, the present invention provides methods to improve current therapy using Botulinum Neurotoxin. In another embodiment, the present invention provides method of using derivatives of Botulinum Neurotoxin or light chain of Botulinum Neurotoxin for various therapeutic or cosmetic applications.
BRIEF DESCRIPTION OF THE DRAWINGS
[0016] Figure 1 shows an illustration of the S2', S I ' and SI pockets of the light chain of Tetanus Neurotoxin (LC/T) and light chain of Botulinum Neurotoxin (LC/B), and the P sites of VAMP2. Amino acid residues at the pockets which interacts with different P sites of the VAMP2 are shown. Figure 1A shows the interacting residues of LC/T and the VAMP2, wherein the LC/T is represented as a surface model. Figure IB shows the interacting residues of LC/T and the VAMP2, wherein the LC/T is represented as a cartoon model. Figure 1C show the interacting residues of LC/B and VAMP2, wherein the LC/B is represented as a surface model. Figure ID show the interacting residues of LC/B and VAMP2, wherein the LC/B is represented as a cartoon model. The nomenclatures of the P site of VAMP2 and the S pockets of LC/T are as follow. The two residues that formed the scissile bond of VAMP2 were designated as Ρ1-Ρ from C- to N-terminus. Residues from PI to the C-terminal direction were designated as P2, P3 etc., while residues from Ρ to the N-terminal direction were designated as P2', P3 ' etc. The pockets in LC/T or LC/B that recognize the specific P sites were designated as the corresponding S pockets. The S2' pocket of LC/T and LC/B, which recognize the P2' site of VAMP2 (residue
78 374 370
E ), is composed of R and R respectively. The S I ' pocket of LC/T and LC/B, which
77 230 227
recognizes the PI ' site of VAMP2 (residue F ), is composed of L and I respectively. The S I pocket of LC/T and LC/B, which recognizes the PI site of VAMP2 (residue Q76), is composed of K168NE170 and E168NE170 respectively.
[0017] Figure 2 shows catalytic activities of LC/T, LC B and their derivatives on cleaving substrate VAMP2. Figure 2 A shows the activities of LC/T and derivatives on cleaving VAMP2. Figure 2B shows the activities of LC/B and derivatives on cleaving VAMP2. Error bar represents standard deviation of three independent repeats for each assay.
[0018] Figure 3 shows orientation of S I ' residue in LC/B, LC/T and the LC/T derivative [K168E, L230I]. Figure 3 A compares the orientation of S I ' pocket residue in LC/B (I227 ), in LC/T (L230 )
168 230 230
and in LC/T [K E, L I] (I ) as labeled. Line refers to the peptide backbone, while stick refers to residues. Figure 3B shows a relative flat surface demonstration of S I ' pocket comprising I227 in LC/B (black), and I230 in LC/T [K168E, L230I] (grey). Figure 3C shows the bulky surface of S I ' pocket of LC/T comprising L230 with a mesh surface demonstration. Figure
3D shows the bulky surface of SI ' pocket of LC/T comprising L230 with a solid surface demonstration.
[0019] Figure 4 shows the distances between residues in the SI ' and S2' pockets of LC/T (Figure 4A), LC/B (Figure 4B) and LC/T [K168E, L230I] (Figure 4C). The distances between the side chains of SI ' residue and S2' residues were measured using the PyMol program. The
370 230 S 370 227 distance between R and L in LC/T is about 7.2 A, the distance between R and I in LC/B is 7.9 A and the distance between R374 and I230 in LC/T [K168E, L230I] is about 8.3 A.
[0020] Figure 5 shows the cleavage of endogenous VAMP2 by recombinant LC/B, LC/T and their derivatives. Figure 5A shows the cleavage of endogenous VAMP2 by LC/T and LC/T [K168E, L230I]. Figure 5B shows the cleavage of endogenous VAMP2 by LC/B and LC/B [S201P]. Upper panel in each figure shows cleavage of VAMP2 analyzed by western blotting using anti- VAMP2 antibody and anti-actin antibody; lower panel shows quantification of the bands obtained from the western blot analysis. DETAILED DESCRIPTION OF THE INVENTION
[0021] In order to enhance the therapeutic efficacies of BoNTs and minimize the induction of neutralizing antibody against BoNTs, it is highly desirable to engineer the BoNTs into more potent derivatives such that a lower effective therapeutic dose of BoNT can be used in various treatments and applications.
[0022] Through studying the substrate recognition and specificity of the Botulinum Neurotoxin and Tetanus Neurotoxin, the present invention has opened up a new opportunity to engineer Botulinum Neurotoxin and Tetanus Neurotoxin into novel derivatives with enhanced activity and substrate specificity.
[0023] In the present invention, comparative characterization of the substrate recognition pockets in the active sites of the light chain of Botulinum Neurotoxin (LC/B) and the light chain of Tetanus Neurotoxin (LC/T) was performed.
[0024] In one embodiment, the present invention provides methods for optimizing substrate recognition of the light chain of Botulinum Neurotoxin B (LC/B) or the light chain of Tetanus Neurotoxin (LC/T), and provides derivatives of these toxins with elevated catalytic activity.
[0025] In one embodiment, the present invention provides methods for modulating activity of Botulinum Neurotoxin and Tetanus Neurotoxin.
[0026] In one embodiment, the present invention provides derivatives of the light chain of Botulinum Neurotoxin B (LC/B) or derivatives of the entire Botulinum Neurotoxin B with elevated activity. In one embodiment, the Botulinum Neurotoxin described herein comprises a polypeptide of SEQ ID NO. : 1. In another embodiment, derivatives of Botulinum Neurotoxin
described herein comprise one or more alteration in the amino acid sequence. In one embodiment, derivatives of Botulinum Neurotoxin comprise a change of amino acid at position 201 identified according to SEQ ID NO. : l from serine (S 201 ) to proline (P 201 ). In another embodiment, the derivative of Botulinum Neurotoxin [S201P] comprises a sequence of SEQ ID NO. : 2.
[0027] In one embodiment, derivatives of Botulinum Neurotoxin comprise a change of amino acid alanine at position 263 identified according to SEQ ID NO. : l . In another embodiment, derivatives of Botulinum Neurotoxin comprise a change of amino acid isoleucine at position 264 identified according to SEQ ID NO. : l.
[0028] In one embodiment, the present invention provides derivatives of the light chain of Tetanus Neurotoxin (LC/T) or derivatives of the entire Tetanus Neurotoxin. In one embodiment, the Tetanus Neurotoxin described herein comprises a polypeptide of SEQ ID NO. : 3. In another embodiment, derivatives of Tetanus Neurotoxin described herein comprise one or more alteration in the amino acid sequence. In one embodiment, derivatives of Tetanus Neurotoxin comprise a change of amino acid at position 230 as identified according to SEQ ID NO: 3 from
230 230
leucine (L ) to isoleucine (I ). In another embodiment, derivatives of Tetanus Neurotoxin comprise a change of amino acid at position 168 as identified according to SEQ ID NO: 3 from lysine (K168) to glutamate (E168). In one embodiment, derivative of Tetanus Neurotoxin [L230I] comprises a sequence of SEQ ID NO. : 4.
[0029] In another embodiment, derivatives of Tetanus Neurotoxin comprise a change from Leucine-230 (L230) to Isoleucine-230 (I230) and a change from Lysine- 168 (K168) to Glutamate- 168 (E168) identified according to SEQ ID NO: 3. In one embodiment, derivative of Tetanus
Neurotoxin [K 168 E, L 230 I] comprises a sequence of SEQ ID NO: 5.
[0030] Wildtype of the light chain of Botulinum Neurotoxin B (LC/B) (SEQ ID NO. 1):
MPVTINNFNYNDPIDNNNIIMMEPPFARGTGRYYKAFKITDRIWIIPERYTFGYKPEDFNK SSGIFNRDVCEYYDPDYLNTNDKKNIFLQTMIKLFNRIKSKPLGEKLLEMIINGIPYLGDR RWLEEFNTNIASVTWKLISNPGEVERKKGIFANLIIFGPGPVLNENETIDIGIQNHFASRE GFGGIMQMKFCPEYVSVFNNVQENKGASIFNRRGYFSDPALILMHELIHVLHGLYGIKV DDLPIVPNEKKFFMQSTDAIQAEELYTFGGQDPSIITPSTDKSIYDKVLQNFRGIVDRLNK VLVCISDPNININIYKNKFKDKYKFVEDSEGKYSIDVESFDKLYKSLMFGFTETNIAENYK IKTRASYFSDSLPPVKIKNLLDNEIYTIEEGFNISDKDMEKEYRGQNKAINKQAYEEISKE HLAVYKIQMCKSV
[0031] Derivative of the light chain of Botulinum Neurotoxin B (LC/B) (SEQ ID NO. 2):
MPVTINNFNYNDPIDNNNIIMMEPPFARGTGRYYKAFKITDRIWIIPERYTFGYKPEDFNK S SGIFNRD VCEYYDPD YLNTNDKKNIFLQTMIKLFNRIKSKPLGEKLLEMIINGIP YLGDR
RWLEEFNTNIASVTWKLISNPGEVERKKGIFANLIIFGPGPVLNENETIDIGIQNHFASRE
GFGGIMQMKFCPEYVPVFNNVQENKGASIFNRRGYFSDPALILMHELIHVLHGLYGIKV
DDLPIVPNEKKFFMQSTDAIQAEELYTFGGQDPSIITPSTDKSIYDKVLQNFRGIVDRLNK
VLVCISDPNININIYKNKFKDKYKFVEDSEGKYSIDVESFDKLYKSLMFGFTETNIAENYK IKTRASYFSDSLPPVKIKNLLDNEIYTIEEGFNISDKDMEKEYRGQNKAINKQAYEEISKE
HLAVYKIQMCKSV
[0032] Wildtype of the light chain of Tetanus Neurotoxin (LC/T) (SEQ ID NO. 3):
MPITmNFRYSDPVNNDTIIMMEPPYCKGLDIYYKAFKITDRIWIVPERYEFGTKPEDFNP P S SLIEGASE YYDPNYLRTD SDKDRFLQTM VKLFNRIKNNV AGE ALLDKIIN AIP YLGNS YSLLDKFDTNSNS VSFNLLEQDPSGATTKS AMLTNLIIFGPGPVLNKNEVRGIVLRVDNK NYFPCRDGFGSIMQMAFCPEYVPTFDNVIENITSLTIGKSKYFQDPALLLMHELIHVLHG LYGMQVSSHEIIPSKQEIYMQHTYPISAEELFTFGGQDANLISIDIKNDLYEKTLNDYKAI ANKLSQVTSCNDPNIDIDSYKQIYQQKYQFDKDSNGQYIVNEDKFQILYNSIMYGFTEIE LGKKFNIKTRLSYFSMNHDPVKIPNLLDDTIYNDTEGFNIESKDLKSEYKGQNMRVNTN AFRNVDGSGLVSKLI
[0033] Derivative of the light chain of Tetanus Neurotoxin (LC/T) (SEQ ID NO. 4):
MPITmNFRYSDPVNNDTIIMMEPPYCKGLDIYYKAFKITDRIWIVPERYEFGTKPEDFNP P S SLIEGASE YYDPNYLRTD SDKDRFLQTM VKLFNRIKNNV AGE ALLDKIIN AIP YLGNS YSLLDKFDTNSNSVSFNLLEQDPSGATTKS AMLTNLIIFGPGPVLNKNEVRGIVLRVDNK NYFPCRDGFGSIMQMAFCPEYVPTFDNVIENITSLTIGKSKYFQDPALILMHELIHVLHGL YGMQVSSHEIIPSKQEIYMQHTYPISAEELFTFGGQDANLISIDIKNDLYEKTLNDYKAIA NKLSQVTSCNDPNIDIDSYKQIYQQKYQFDKDSNGQYIVNEDKFQILYNSIMYGFTEIEL GKKFNIKTRLSYFSMNHDPVKIPNLLDDTIYNDTEGFNIESKDLKSEYKGQNMRVNTNA FRNVDGSGLVSKLI
[0034] Derivative of the light chain of Tetanus Neurotoxin (LC/T) (SEQ ID NO. 5):
MPITmNFRYSDPVNNDTIIMMEPPYCKGLDIYYKAFKITDRIWIVPERYEFGTKPEDFNP P S SLIEGASE YYDPNYLRTD SDKDRFLQTM VKLFNRIKNNV AGE ALLDKIIN AIP YLGNS YSLLDKFDTNSNSVSFNLLEQDPSGATTKS AMLTNLIIFGPGPVLNENEVRGIVLRVDNK NYFPCRDGFGSIMQMAFCPEYVPTFDNVIENITSLTIGKSKYFQDPALILMHELIHVLHGL YGMQVSSHEIIPSKQEIYMQHTYPISAEELFTFGGQDANLISIDIKNDLYEKTLNDYKAIA NKLSQVTSCNDPNIDIDSYKQIYQQKYQFDKDSNGQYIVNEDKFQILYNSIMYGFTEIEL GKKFNIKTRLSYFSMNHDPVKIPNLLDDTIYNDTEGFNIESKDLKSEYKGQNMRVNTNA FRNVDGSGLVSKLI
[0035] In one embodiment, the present invention provides pharmaceutical composition comprising derivatives of Botulinum Neurotoxin or Tetanus Neurotoxin. In one embodiment, the
Botulinum Neurotoxin, Tetanus Neurotoxin and the derivatives of Botulinum Neurotoxin and
Tetanus Neurotoxin described herein are fused or coupled with one or more supplementary polypeptides, wherein the supplementary polypeptide is from Botulinum Neurotoxin, Tetanus
Neurotoxin or other organisms. In one embodiment, the supplementary polypeptides fused or coupled with the present toxins are native or recombinant polypeptides. In another embodiment, the supplementary polypeptide fused or coupled with the present toxins are artificial polypeptides.
[0036] In one embodiment, the DNA of the light chain (LC) and heavy chain (HC) of Botulinum Neurotoxin or Tetanus Neurotoxin or their derivatives described herein are cloned into the same expression vector, thereby expressing a fusion protein comprising the light chain and heavy chain. In one embodiment, the light chain and heavy chain are originated from the same serotype of the toxin. In another embodiment, the light chain and heavy chain are originated from different serotypes of the toxin.
[0037] In one embodiment, the Botulinum Neurotoxin derivatives described herein are used in a pharmaceutical, clinical, or cosmetic procedure. In one embodiment, the Botulinum Neurotoxin derivatives described herein are used to treat or improve diseases or conditions in various therapies or other applications. In one embodiment, the Botulinum Neurotoxin derivatives described herein can be used in a novel therapy with a lower chance of developing immunoresistance to Botulinum Neurotoxin.
[0038] In one embodiment, the Botulinum Neurotoxin derivatives described herein are used to treat or improve strabismus, blepharospam, hemificial spasm, cervical dystonia, spasticity, glabellar facial lines, axillary hyperhidrosis, lower urinary tract disorders, gastrointestinal tract disorders, spasmodic dysphonia, temporomandibular disorder, sialorrhea, chronic diabetic neuropathy, wound healing, vaginism, musculoskeletal pain, disorders related to involuntary skeletal muscle activity such as involuntary muscle spasm and contractions, or any other applicable diseases or conditions.
[0039] In one embodiment, the present invention provides methods for improving or treating diseases or conditions by administering to the subject an effective amount of the Botulinum Neurotoxin derivatives described herein. In another embodiment, the present invention provides methods for improving current therapy using Botulinum Neurotoxin.
[0040] In one embodiment, the present invention provides methods of using Botulinum Neurotoxin with enhanced therapeutic efficacy or pharmaceutical properties. In another embodiment, the present invention provides methods for reducing immunoresistance to Botulinum Neurotoxin in various therapies and applications.
[0041] In one embodiment, the Tetanus Neurotoxin derivatives described herein can be used as a molecular marker or an effective tool to study the mechanisms of exocytosis in central neuron.
[0042] The present invention provides a modified light chain polypeptide of Botulinum Neurotoxin, wherein the Botulinum Neurotoxin has the amino acid sequence of SEQ ID NO. : l, and the modified light chain comprises one or more mutations at positions as identified according to SEQ ID NO. : 1.
[0043] In one embodiment, the modified light chain polypeptide of Botulinum Neurotoxin described herein, wherein the mutations occur at amino acid residues selected from the group consisting of Serine201, Alanine263 and Isoleucine264.
[0044] In one embodiment, the modified light chain polypeptide of Botulinum Neurotoxin described herein comprises an amino acid sequence of SEQ ID NO. : 2.
[0045] The present invention provides a composition comprising the modified light chain polypeptide of Botulinum Neurotoxin described herein, wherein the polypeptide is fused with or coupled with one or more second polypeptide, and wherein the second polypeptide is a polypeptide from Botulinum Neurotoxin or other organisms.
[0046] In one embodiment, the second polypeptide is native or artificial.
[0047] The present invention provides a composition comprising the modified light chain polypeptide of Botulinum Neurotoxin described herein and a pharmaceutical acceptable carrier.
[0048] The present invention provides a method for improving or treating diseases or conditions in a subject, comprising a step of administering to the subject an effective amount of the modified light chain polypeptide of Botulinum Neurotoxin described herein.
[0049] In one embodiment, the diseases or conditions are selected from the group consisting of strabismus, blepharospam, hemificial spasm, cervical dystonia, spasticity, glabellar facial lines, axillary hyperhidrosis, involuntary muscle spasm, lower urinary tract disorders, gastrointestinal tract disorders, spasmodic dysphonia, temporomandibular disorder, sialorrhea, chronic diabetic neuropathy, wound healing, vaginism, musculoskeletal pain and involuntary muscle contractions.
[0050] In one embodiment, the method for improving or treating diseases or conditions described herein, wherein reduced immunoresistance to Botulinum Neurotoxin in a subject is induced in the subject. In another embodiment, said reduced immunoresistance to Botulinum Neurotoxin is induced in the subject as compared to treatment with wild-type Botulinum Neurotoxin.
[0051] The present invention provides a modified light chain polypeptide of Tetanus Neurotoxin, wherein the Tetanus Neurotoxin has the amino acid sequence of SEQ ID NO. : 3, and the
modified light chain comprises one or more mutations at positions as identified according to SEQ ID NO. : 3.
[0052] In one embodiment, the modified light chain polypeptide of Tetanus Neurotoxin described herein, wherein the mutations occur at amino acid residues selected from the group consisting of Lysine168 and Leucine230.
[0053] In one embodiment, the modified light chain polypeptide of Tetanus Neurotoxin described herein comprises an amino acid sequence of SEQ ID NO. : 4 or 5.
[0054] The present invention provides a composition comprising the modified light chain polypeptide of Tetanus Neurotoxin described herein, wherein the polypeptide is fused with or coupled with one or more second polypeptide, and wherein the second polypeptide is a polypeptide from Tetanus Neurotoxin or other organisms.
[0055] In one embodiment, the second polypeptide is native or artificial.
[0056] In one embodiment, the composition comprising the modified light chain polypeptide of Tetanus Neurotoxin described herein is used as a molecular marker to study exocytosis in the neuron.
[0057] The present invention provides a composition comprising the modified light chain polypeptide of Tetanus Neurotoxin described herein and a pharmaceutical acceptable carrier.
[0058] The present invention provides a method for improving or treating diseases or conditions in a subject, comprising a step of administering to the subject an effective amount of the modified light chain polypeptide of Tetanus Neurotoxin described herein.
[0059] This invention will be better understood by reference to the examples which follow. However, one skilled in the art will readily appreciate that the examples provided are merely for illustrative purposes and are not meant to limit the scope of the invention which is defined by the claims following thereafter.
[0060] Throughout this application, it is to be noted that the transitional term "comprising", which is synonymous with "including", "containing" or "characterized by", is inclusive or open- ended, and does not exclude additional, un-recited elements or method steps.
EXAMPLE 1
Modification of Botulinum Neurotoxin and Tetanus Neurotoxin
Plasmid Construction For Protein Expression
[0061] Plasmids for the expression of LC/T (1-436) (accession no. of the Tetanus Neurotoxin: X06214.1), LC/B (1-440) (accession no. of the Botulinum Neurotoxin: AB084152.1) and VAMP2 (1-97) and subsequent protein expression and purification were performed as previously described (30-32). Site directed mutagenesis of pLC/T, pLC/B and pVAMP2 were performed
using QuickChange (Stratagene) protocols as previously described (30, 31). Plasmids were sequenced to confirm the mutation and that additional mutations were not present within the ORFs. Mutated proteins were produced and purified as described (30-33). Linear Velocity And Kinetic Constant Determinations For VAMP2 Cleavage By LC/B And LC/T
[0062] Linear velocity reactions (10 μΐ) were performed as previously described (30, 31, 33). VAMP2 proteins (5 μΜ) were incubated with varying concentrations of LC/T, LC/B or derivatives in 10 mM Tris-HCl (pH 7.6) with 20 mM NaCl at 37°C for 10 min. Reactions were stopped by adding SDS-PAGE buffer, and VAMP2 and cleavage product were resolved by SDS- PAGE. The amount of VAMP2 cleaved was determined by densitometry. Km and kcat were determined using the same assay where VAMP2 concentrations were adjusted to 1-300 μΜ to achieve -10% cleavage by LC/T and derivatives. Data were fit into the Michaelis-Menten equation (reaction velocity versus substrate concentration) and kinetic constants were derived using the GraphPad Program (San Diego, CA). At least five independent assays were performed to determine the kinetic constants for each protein.
Compensatory Assay
[0063] Effect of compensatory mutations within LC/T on the cleavage of VAMP2 and VAMP2 mutant [F77D] was determined as previously described with modification (31). Briefly, 5μΜ VAMP2 or VAMP2 mutant were incubated with LC/T or derivatives. Uncleaved and cleaved VAMP2 were then resolved by SDS-PAGE and quantified. The amount of wild type LC/T or derivatives in the reaction were plotted verses % cleavage of VAMP2. The amount of LC required to cleave 50% of VAMP2 or VAMP2 mutant was then calculated (EC50).
LC Crystallization And Structure Determination
168 230
[0064] LC/T derivative [K E, L I] was crystallized by hanging drop vapor diffusion method. LC/T [K168E, L230I] was stored in a buffer of 10 mM Tris, 20 mM NaCl (pH 7.9) at a concentration of 7.5 mg/ml. Each of the handing drop contained Ι μΐ protein solution and 1 μΐ mother liquor (250 mM Mg(N03)2 and 15% PEG 3350). Crystals were grown at 16°C for 4-5 days until maturation. For data collection, crystals were harvested and cryoprotected in the mother liquor supplemented with 20% glycerol. Data was collected at 100K on Rigaku MicroMaxTM-007F£F x-ray machine and processed using iMOSFLM (34). The crystals were found to have a space group of monoclinic group C222 with a cell parameter of a = 105.38 A, b = 176.83 A, c = 57.36 A and were diffracted to 2.6 A. There was one molecule per asymmetric
unit. The structure of LC/T [K168E, L230I] was solved by molecular replacement using the PHASER module in the CCP4i suite of programs with LC/T (PDB ID: 1Z7H) as the homology model (35). Subsequent structural refinement was conducted using REFMAC module in CCP4 (36). Manual structure rebuilding was done using WINCOOT (37). The final structure has been deposited to the protein data bank (PDB) with the PDB ID: 4J1L.
Cleavage of Endogenous VAMP of Neuro2A Cell By Recombinant LC/T. LC/B And Their Derivatives
[0065] Neuro-2A cells were cultured in minimum essential medium supplemented with 10% newborn calf serum, 1.4% sodium bicarbonate, and 0.5% penicillin- streptomycin at 37 °C in 5% C02. Confluent cells were harvested and lysed by passing through a 25 gauge needle for 20-30 times on ice. Nuclei and unbroken cells were spun down by centrifuging the lysed product for 5 min at 2500 rpm and the supernatant was collected for assay. After incubating the cell lysate with different amount of LCs at 37°C for 10 min in a reaction volume of 10 μΐ, the reaction was stopped by adding equal amount of SDS-PAGE sample buffer and boiling the reaction mixture at 100°C for 10 min. Cleavage of VAMP was analyzed by western blotting using anti-VAMP2 and anti-actin antibody.
Results
[0066] BoNT/B and TeNT were found to cleave substrate VAMP2 at the same scissile bond, while their efficiencies of substrate hydrolysis were different, with LC/B being more active than LC/T by about 20-folds. Earlier characterization of VAMP2 recognition by LC/B and LC/T showed that the active site of the two LCs displayed a similar arrangement for VAMP2 recognition. The major difference between the two systems was found to be at the P2'-S2' substrate recognition site (33, 38). Mutation at the P2' site of VAMP2 (E78 to alanine, [E78A]) reduced LC/B cleavage by ~8-fold but reduced LC/T cleavage by ~240-fold, suggesting different role of VAMP2 E78 on LC/B and LC/T substrate cleavage (33).
[0067] Further biochemical characterization of the S2' pocket of LC/B and LC/T showed that the S2' pocket of LC/B and LC/T is formed by R370 and R374 respectively (Figure 1).
370 78 Compensatory mutational assay suggested that R of LC/B directly interacts with E of VAMP2, while the interaction of R374 of LC/T with E78 of VAMP was not evidenced (38). These data prompted current study to examine the different mechanism of substrate recognition at the P2' site of VAMP (E78) by LC/B and LC/T.
Optimization of LC/T and LC/B ST Pockets Enhanced Their Catalytic Activities
[0068] Figure 1 illustrates the active site of LC/B and LC/T for interacting with the substrate VAMP2. Comparison of the structures of LC/B and LC/T revealed that the S2' pocket of the two
370 374
LCs are similar and comprise an arginine residue (R in LC/B and R in LC/T), while their SI ' pockets were different. The SI ' pocket of LC/B is composed of F95, V200, S201, L226 and I227, whereas the SI ' pocket of LC/T is composed of F199, V204, P205, L229, L230 and L231. Mutation of these SI ' pocket residues to alanine showed no effect on LC/B substrate hydrolysis except for I227A, which showed ~80-fold reduction of kcat, but not Km (38). For LC/T, mutation of the SI ' pocket residues did not affect substrate hydrolysis except mutations LC/T [L230A] or LC/T [P205A] that reduced kcat by ~30-fold without affecting Km (38). Within these SI ' pocket residues, P205 of LC/T is found to be structurally aligned well with S201 of LC/B while L230 of LC/T is aligned well with I227 of LC/B (Figure 1). The different composition of SI ' pocket of LC/B and LC/T may contribute not only to the different recognition of PI ', but also the P2' site of VAMP, which may further affect the different catalytic activity of LC/B and LC/T.
[0069] Mutations were then performed to swap the residues between the SI ' pocket of LC/B and LC/T. Mutation of LC/T [P205S] showed a ~80-fold reduction in kcal, while retained the same Km. Mutation of LC/T [L230I] showed a ~20-fold elevated kcat and similar Km (Table 1, Figure 2a). These data suggested that proline and isoleucine are the optimal residues to form the SI ' pocket of LC/T for interacting with the PI ' site residue F77 of VAMP.
[0070] To check this hypothesis, residues swapping was then performed in the SI ' pocket of LC/B. Mutation of LC/B [I227L] showed a ~590-fold reduction in kcat, but no change in Km. Mutation of LC/B [S201P] showed a ~10-fold increase in kca and no change in the Km (Table 1, Figure 2b). These data further confirmed that proline and isoleucine constitute the most optimal SI ' pocket for LC/B and LC/T, and indicate that the current substrate recognition pockets of LC/B and LC/T are not optimal. Optimization of these pockets could improve the catalytic activity of the toxins. To verify that changing the SI ' pocket of LC/B and LC/T did not alter their substrate specificity, the above four mutants' cleavage activities on VAMP2 F77D were examined. F77 of VAMP2 is an important residue for the scissile action by both LC/B and LC/T and mutation of this residue likely affects the cleavage activity of the LC/B and LC/T. Since none of the above mutants of LC/B and LC/T could cleave F77D, suggesting that the substrate specificity for VAMP2 of these LC/B and LC/T mutants remained the same regardless of the mutations (Figures 2A-B).
TABLE 1
Kinetic constants of LC/B, LC/T and their derivatives on cleaving VAMP2
ND: Not Determined, as the enzyme is too inactive to determine the kinetic constants.
Optimization of LC/T SI ' Pocket Regained Optimal Recognition of P2' Site
[0071] Since the SI ' and S2' pockets are in close proximity, the different composition of SI ' pocket of LC/B and LC/T may be correlated to the different properties observed in the S2' pockets of LC/B and LC/T. Although both S2' pockets of LC/B and LC/T comprise an arginine
370 78
residue, previous study showed that R of LC/B directly interacts with E of VAMP, whereas R374 of LC/T does not directly interact with E78 of VAMP (38). In addition, mutating E78 to alanine (E78A) at the P2' site of VAMP was found to have less impact on cleavage by LC/B as compared to the impact on cleavage by LC/T (38).
[0072] In the present study, LC/T [L230I], which was engineered for an optimal SI ' pocket, was tested for its activity on cleaving VAMP2 E78R. As shown in Table 2, the amount of LC/T required to cleave 50% of VAMP2 was about 120 nM (EC50). LC/T showed no cleavage on VAMP2 E78R even at a concentration as high as 36,000 nM. LC/T [L230I] cleaved VAMP2 about -24 fold more efficient than Wt-LC/T, while LC/T [L230I] cleaved VAMP E78R at a similar efficiency as Wt-LC/T, but is 360-fold more efficient than LC/T on cleaving VAMP E78R (Table 2). These data suggested that optimization of SI ' pocket of LC/T enhanced the tolerance towards the P2' site mutation from E78 to R78. The less optimal LC/T ST pocket may also explain why mutation of E78 at the P2' site would have a greater effect on LC/T substrate cleavage than on LC/B substrate cleavage. Previous study also showed that the S2' pocket residue of LC/B, R370, interacts and forms salt bridge with E78 at the P2' site of VAMP2, while the S2' pocket residue of LC/T, R374, does not (38). To test whether different S2'-P2' interaction between LC/B and LC/T was due to the less optimal composition of the SI ' pocket, the
efficiency of LC/T [L230I, R374E] on cleaving VAMP2 E78R was examined. LC/T [L230I, R374E] showed no cleavage on VAMP2, while LC/T [L230I, R374E] was able to cleave VAMP2 at an efficiency higher than LC/T (Table 2). These data suggested that the less optimal organization of SI ' pocket in LC/T is less favorable for direct interaction between R374 of LC/T and E78 of VAMP2.
TABLE 2
Results of Compensatory Mutational Assay On Cleaving VAMP2 and VAMP2 E'*R By LC/T
EC50 refers to the concentration of LC proteins resulting in 50% cleavage of VAMP2 or VAMP2 E'¾.
Optimization of ST And SI Substrate Recognition Pockets Further Enhanced LC/T Activity
[0073] Previous study identified two residues that contributed to elevated activity of LC/T (38). Mutation of SI pocket residue, LC/T [K168E], and S3 pocket residue, LC/T [R188M], were found to increase the catalytic activity of LC/T (38). These mutations were incorporated into LC/T together with the [L230I] mutation to test their combined effect on LC/T activity. Double-
168 230
mutation mutants, LC/T (K E, L I) was found to be ~ 100-fold more active than Wt-LC/T on cleaving VAMP2, as indicated by the elevated &caf value, but not Km value (Table 1, Figure 2a). The triple-mutation mutant, LC/T [K168E, L230I, R188M] showed no activity on cleaving VAMP2. One possible explanation for the abolished activity is the combination of three mutations at the active site of LC/T may impair the correct conformation of LC/T (Table 1).
Orientation of Side Chain of L230 of LC/T Affects Its Optimal Recognition of Both PI 'and P2' Sites
[0074] Both isoleucine and leucine are hydrophobic residue that are likely to interact with F77 of VAMP2 through hydrophobic interaction. However, in the case of LC/B and LC/T, the isoleucine in the SI ' pocket of LC/B and LC/T was found to be more significant in the
interaction. It could be due to different orientation of the isoleucine residue in the pocket that favors interaction with F77 of VAMP2. Structural analysis of the S I ' pockets of LC/B and LC/T
227 230
revealed that I in LC/B resides at a flatter position than L in LC/T. The bulky leucine in LC/T may push the interacting residue F77 of VAMP2 outward, thereby restraining the interaction between R374 and E78 of VAMP2. The flatter position of isoleucine in LC/B may provide an optimal position for fitting F77 and E78 of VAMP2 to the active site of LC/B, hence favors the interactions of I227-F77 and R370-E78.
[0075] Crystal structure of LC/T [K168E, L230I] was determined and compared with Wt-LC/T. Figure 3A illustrates the F0-Fc electron density of L230I mutations in the LC/T (K168E, L230I) structure. LC/T [K168E, L230I] can perfectly aligned to Wt LC/T with a Root Mean Square Deviation (RMSD) of 0.150 (370 to 370 atoms with 421 atoms aligned), suggesting that the overall conformation of LC/T [K168E, L230I] is comparable to that of Wt-LC/T. LC/T [K168E, L230I) also aligned well with Wt LC/B with a RMSD of 0.750 (341 to 341 atoms with 421 atoms aligned). The analysis showed that mutation of leucine to isoleucine flattens the S I ' pocket to a similar level as in LC/B (Figure 3). Most importantly, distance between the side chains of L230 and R374 of LC/T was estimated to be 7.2 A (Figure 4A) and the distance between the side chains of I227 and R370 was 7.9A in LC/B (Figure 4B). When L230 was mutated to isoleucine, [L230I], the distance between the side chain of I230 and R374 of LC/T was 8.3 A (Figure 4C), which is larger than the distance 7.2 A between L230 and R374 of Wt-LC/T (Figure 4A). These data further supported that distance between the S I ' and S2' pockets in LC/B and LC/T determines their efficiency of recognizing the Ρ and P2' sites of VAMP2. The wider space between the S I ' and S2' pockets favors accommodating the Ρ site residue F77 and the P2' site resiude E78 of VAMP2 into these two pockets.
TABLE 3
Crvstallographic Statistics of LC/T ΓΚ168Ε. L230I1
Activities of LC/B, LC/T And Their Derivatives On Cleaving Endogenous VAMP2
[0076] To check the activities of LC/T derivatives on cleaving natural substrate VAMP2 in neuronal cells, various LC/T derivatives were incubated with Neuro2A lysate. As illustrated in Figure 5A, LC/T [K168E, L230I] was more active than Wt-LC/T on cleaving endogenous VAMP2 in Neuro 2A cells. Similarly, as presented in Figure 5B, LC/B [S201P] also appeared to be more active than Wt-LC/B on cleaving endogenous VAMP2.
[0077] As seen in the histograms in Figures 5 A and 5B, LC/T and LC/T [K168E, L230I] showed a much lower activity on cleaving endogenous VAMP2 substrate than LC/B and LC/B [S201P], even though the activities of LC/T [K168E, L230I] was slightly higher than Wt-LC/B on cleaving recombinant VAMP2. These observations maybe accounted for by the more complicated mechanism of VAMP2 recognition in neurons, wherein VAMP2 exists as a SNARE complex in association with SNAP25 and Syntaxin l a. Hence, other factors other than accessibility of VAMP2 to LC/B and LC/T may also affect the efficiency of the toxins on cleaving native VAMP2. Previous study on LC/A found that in addition to the substrate recognition region, LC/A also interacts with SNAP25 at an additional site outside the SNARE complex to gain initial access to SNAP25 (45). Further research will be needed to figure out the different accessibility of LC/B and LC/T to VAMP2 in the SNARE complex.
[0078] In summary, these data suggest that LC/B is more active on cleaving natural substrate VAMP2 than LC/T, and imply that LC/B may be a more desirable candidate than LC/T to be used in human therapy. Discussion
[0079] Mutation of an active site residue of the light chain of serotype A (LC/A), [K165L], resulted in a 4-fold increase in substrate hydrolysis (44). In addition, [R188M], a S4 pocket mutation, was found to increase LC/T substrate hydrolysis by ~5 fold (38). The present invention provides a comparative study on LC/B and LC/T and demonstrates the possibility to engineer the light chain of CNTs for elevated activities.
[0080] The present invention found that SI pocket mutation of LC/T from Lysine (K168) to Glutamate168 (E168) [K168E] can increase the rate of cleaving VAMP2 to a level comparable to the rate of LC/B.
Optimization of Substrate Recognition Pockets in LC/T
[0081] The present invention found that SI ' pockets of both LC/B and LC/T are most significant
230 230
to the catalytic activity of the two toxins. The side chain of Leucine (L ) of LC/T is more
227 227
bulky in comparison to the Isoleucine (I ) of LC/B, which is less favorable for accommodating Ρ and P2' site residues of VAMP2 and dramatically affects its catalytic activity (Figures 3-4). Mutant LC/T [L230I] was found to have a higher catalytic activity than the Wt-LC/T by ~25-folds (Table 2).
[0082] The findings herein also suggested that VAMP2 recognition by different pockets in Botulinum Neurotoxin is closely related. For instance, the less optimized SI ' pocket could affect the recognition of VAMP2 by the S2' pocket. Mutant LC/T [L230I] was found to have its
168 230 catalytic activity increased by ~25-folds while the double mutant LC/T [K E, L I] has its catalytic activity increased by ~100-folds (Table 2).
Optimization of SI ' and SI Substrate Recognition Pockets in LC/B
227 227
[0083] In the case of LC/B, the native residue Isoleucine (I ) is favorable for cleaving VAMP2. However, the native Serine201 (S201) in the SI pocket of LC/B seemed to be less optimal than the corresponding proline residue (P205) in LC/T. The present study found that mutation of LC/B [S201P] could increase LC/B activity by more than 10-folds (Table 1).
Comparison of LC/B and LC/T Activity on Recombinant And Native VAMP2
[0084] The present study showed that LC/T [L230I] and LC/T [K168E, L230I] have a higher activity on cleaving recombinant VAMP2 than the wildtype toxin (Table 2). The present study
168 230
also showed that LC/T [K E, L I] attained a higher activity on cleaving native VAMP2 in Neuro2A cell than the wildtype toxin (Figure 5A). The highly active LC/T derivatives described in the present invention can be used as more effective tools to study the mechanisms of exocytosis in central neuron.
[0085] The present study showed that LC/B [S201P] has a higher activity on cleaving recombinant VAMP2 than the wildtype toxin by more than 10-fold (Table 1) and on cleaving native VAMP2 in Neuro2A cell (Figure 5B). The LC/B derivative described herein can be used to replace LC/B protein currently used in various therapeutic, cosmetic or other applications, or be developed into novel therapy that may minimize immunoresistance to BoNT.
References:
1. Montecucco, C, and Schiavo, G. (1994) Mechanism of action of tetanus and botulinum neurotoxins, Mol Microbiol 13, 1-8.
2. Davletov, B., Bajohrs, M., and Binz, T. (2005) Beyond BOTOX: advantages and limitations of individual botulinum neurotoxins, Trends Neurosci 28, 446-452.
3. Montecucco, C, and Schiavo, G. (1993) Tetanus and botulism neurotoxins: a new group of zinc proteases, Trends Biochem Sci 18, 324-327.
4. Brunger, A. T. (2005) Structure and function of SNARE and SNARE-interacting proteins, Q Rev Biophys 38, 1-47.
5. Schiavo, G., Benfenati, F., Poulain, B., Rossetto, O., Polverino de Laureto, P., DasGupta, B.
R., and Montecucco, C. (1992) Tetanus and botulinum-B neurotoxins block neurotransmitter release by proteolytic cleavage of synaptobrevin, Nature 359, 832-835.
6. Schiavo, G, Malizio, C, Trimble, W. S., Polverino de Laureto, P., Milan, G., Sugiyama, H., Johnson, E. A., and Montecucco, C. (1994) Botulinum G neurotoxin cleaves VAMP/synaptobrevin at a single Ala-Ala peptide bond, J Biol Chem 269, 20213-20216.
7. Schiavo, G, Rossetto, O., Benfenati, F., Poulain, B., and Montecucco, C. (1994) Tetanus and botulinum neurotoxins are zinc proteases specific for components of the neuroexocytosis apparatus, Ann N Y Acad Sci 710, 65-75.
8. Glogau, R. G. (2002) Review of the use of botulinum toxin for hyperhidrosis and cosmetic purposes, Clin J Pain 18, S191-197.
9. Atassi, M. Z. (2004) Basic immunological aspects of botulinum toxin therapy, Mov Disord 19 Suppl 8, S68-84.
10. Atassi, M. Z., and Oshima, M. (1999) Structure, activity, and immune (T and B cell) recognition of botulinum neurotoxins, Crit Rev Immunol 19, 219-260.
11. Cheng, C. M., Chen, J. S., and Patel, R. P. (2006) Unlabeled uses of botulinum toxins: a review, part 2, Am J Health Syst Pharm 63, 225-232.
12. Ascher, B., and Rossi, B. (2004) [Botulinum toxin and wrinkles: few side effects and effective combining procedures with other treatments], Ann Chir Plast Esthet 49, 537-552.
13. Bell, K. R., and Williams, F. (2003) Use of botulinum toxin type A and type B for spasticity in upper and lower limbs, Phys Med Rehabil Clin N Am 14, 821-835.
14. Benedetto, A. V. (2004) Commentary: Botulinum toxin in clinical medicine: part II, Clin Dermatol 22, 1-2.
15. Mahajan, S. T., and Brubaker, L. (2007) Botulinum toxin: from life-threatening disease to novel medical therapy, Am J Obstet Gynecol 196, 7-15.
16. Mahant, N., Clouston, P. D., and Lorentz, I. T. (2000) The current use of botulinum toxin, J Clin Neurosci 7, 389-394.
17. Thant, Z. S., and Tan, E. K. (2003) Emerging therapeutic applications of botulinum toxin, Med Sci Monit 9, RA40-48.
18. Figgitt, D. P., and Noble, S. (2002) Botulinum toxin B: a review of its therapeutic potential in the management of cervical dystonia, Drugs 62, 705-722.
19. Brashear, A. (2001) Botulinum toxin type B: a new injectable treatment for cervical dystonia, Expert Opin Investig Drugs 10, 2191-2199.
20. Goschel, H., Wohlfarth, K., Frevert, J., Dengler, R., and Bigalke, H. (1997) Botulinum A toxin therapy: neutralizing and nonneutralizing antibodies— therapeutic consequences, Exp Neurol 147, 96-102.
21. Dolimbek, B. Z., Jankovic, J., and Atassi, M. Z. (2002) Cross reaction of tetanus and botulinum neurotoxins A and B and the boosting effect of botulinum neurotoxins A and B on a primary anti-tetanus antibody response, Immunol Invest 31, 247-262.
22. Jankovic, J., Vuong, K. D., and Ahsan, J. (2003) Comparison of efficacy and immunogenicity of original versus current botulinum toxin in cervical dystonia, Neurology
60, 1 186-1 188.
23. Atassi, M. Z., and Dolimbek, B. Z. (2004) Mapping of the antibody-binding regions on the UN-domain (residues 449-859) of botulinum neurotoxin A with antitoxin antibodies from four host species. Full profile of the continuous antigenic regions of the H-chain of botulinum neurotoxin A, Protein J 23, 39-52.
24. Jankovic, J. (2004) Botulinum toxin in clinical practice, J Neurol Neurosurg Psychiatry 75, 951-957.
25. Jankovic, J. (2004) Treatment of cervical dystonia with botulinum toxin, Mov Disord Suppl 8, S 109-1 15.
26. Jankovic, J. (2006) Botulinum toxin therapy for cervical dystonia, Neurotox Res 9, 145-148. 27. Brashear, A., Lew, M. F., Dykstra, D. D., Cornelia, C. L., Factor, S. A., Rodnitzky, R. L.,
Trosch, R., Singer, C, Brin, M. F., Murray, J. J., Wallace, J. D., Willmer-Hulme, A., and
Koller, M. (1999) Safety and efficacy of NeuroBloc (botulinum toxin type B) in type A- responsive cervical dystonia, Neurology 53, 1439-1446.
28. Swope, D., and Barbano, R. (2008) Treatment recommendations and practical applications of botulinum toxin treatment of cervical dystonia, Neurol Clin 26 Suppl 1, 54-65.
29. Cornelia, C. L. (2008) The treatment of cervical dystonia with botulinum toxins, J Neural Transm 1 15, 579-583.
30. Chen, S., and Barbieri, J. T. (2007) Multiple pocket recognition of SNAP25 by botulinum neurotoxin serotype E, J Biol Chem 282, 25540-25547.
31. Chen, S., Kim, J. J., and Barbieri, J. T. (2007) Mechanism of substrate recognition by botulinum neurotoxin serotype A, J Biol Chem 282, 9621-9627.
32. Chen, S., and Wan, H. Y. Molecular mechanisms of substrate recognition and specificity of botulinum neurotoxin serotype F, Biochem J 433, 277-284.
33. Chen, S., Hall, C, and Barbieri, J. T. (2008) Substrate recognition of VAMP-2 by botulinum neurotoxin B and tetanus neurotoxin, J Biol Chem 283, 21 153-21 159.
34. Powell, H. R. (1999) The Rossmann Fourier autoindexing algorithm in MOSFLM, Acta Crystallogr D Biol Crystallogr 55, 1690-1695.
35. (2008) Molecular replacement. Proceedings of the CCP4 study weekend, University of Reading, United Kingdom, Acta Crystallogr D Biol Crystallogr 64, 1-140.
36. Potterton, E., Briggs, P., Turkenburg, M., and Dodson, E. (2003) A graphical user interface to the CCP4 program suite, Acta Crystallogr D Biol Crystallogr 59, 1 131-1 137.
37. Emsley, P., and Cowtan, K. (2004) Coot: model-building tools for molecular graphics, Acta Crystallogr D Biol Crystallogr 60, 2126-2132.
38. Chen, S., Karalewitz, A. P., and Barbieri, J. T. (2012) Insights into the different catalytic activities of Clostridium neurotoxins, Biochemistry 51, 3941-3947.
39. Dolimbek, B. Z., Aoki, K. R., Steward, L. E., Jankovic, J., and Atassi, M. Z. (2007) Mapping of the regions on the heavy chain of botulinum neurotoxin A (BoNT/A) recognized by antibodies of cervical dystonia patients with immunoresi stance to BoNT/A, Mol Immunol 44,
1029-1041.
40. Atassi, M. Z., Dolimbek, B. Z., Jankovic, J., Steward, L. E., and Aoki, K. R. (2008) Molecular recognition of botulinum neurotoxin B heavy chain by human antibodies from cervical dystonia patients that develop immunoresistance to toxin treatment, Mol Immunol 45, 3878-3888.
41. Atassi, M. Z., Jankovic, J., Steward, L. E., Aoki, K. R., and Dolimbek, B. Z. (2012) Molecular immune recognition of botulinum neurotoxin B. The light chain regions that bind human blocking antibodies from toxin-treated cervical dystonia patients. Antigenic structure of the entire BoNT/B molecule, Immunobiology 217, 17-27.
42. Dolimbek, B. Z., Aoki, K. R., and Atassi, M. Z. (201 1) Reduction of antibody response against botulinum neurotoxin A by synthetic monomethoxypolyethylene glycol-peptide conjugates, Immunol Lett 137, 46-52.
43. Foster, K. A. (2009) Engineered toxins: new therapeutics, Toxicon 54, 587-592.
44. Ahmed, S. A, Olson, M. A, Ludivico, M. L., Gilsdorf, J., and Smith, L. A. (2008) Identification of residues surrounding the active site of type A botulinum neurotoxin important for substrate recognition and catalytic activity, Protein J 27, 151-162.
45. Chen, S., and Barbieri, J. T. (201 1) Association of botulinum neurotoxin serotype A light chain with plasma membrane-bound SNAP-25, J Biol Chem 286, 15067-15072.
Claims
1. A modified light chain polypeptide of Botulinum Neurotoxin, wherein the Botulinum Neurotoxin has the amino acid sequence of SEQ ID NO. : l, and the modified light chain comprises one or more mutations at positions as identified according to SEQ ID NO. : 1.
2. The polypeptide of claim 1, wherein the mutations occur at amino acid residues selected
201 263 264
from the group consisting of Serine , Alanine and Isoleucine 3. The polypeptide of claim 1, wherein the modified light chain polypeptide comprises an amino acid sequence of SEQ ID NO. : 2.
4. A composition comprising the polypeptide of claim 1, wherein the polypeptide is fused with or coupled with one or more second polypeptide, and wherein the second polypeptide is a polypeptide from Botulinum Neurotoxin or other organisms.
5. The composition of claim 4, wherein the second polypeptide is native or artificial.
6. A composition comprising the polypeptide of claim 1 and a pharmaceutical acceptable carrier.
7. A method for improving or treating diseases or conditions in a subject, comprising a step of administering to the subject an effective amount of the polypeptide of claim 1.
8. The method of claim 7, wherein the diseases or conditions are selected from the group consisting of strabismus, blepharospam, hemificial spasm, cervical dystonia, spasticity, glabellar facial lines, axillary hyperhidrosis, involuntary muscle spasm, lower urinary tract disorders, gastrointestinal tract disorders, spasmodic dysphonia, temporomandibular disorder, sialorrhea, chronic diabetic neuropathy, wound healing, vaginism, musculoskeletal pain and involuntary muscle contractions.
9. The method of claim 7, wherein reduced immunoresistance to Botulinum Neurotoxin is induced in the subject as compared to treatment with wild-type Botulinum Neurotoxin.
10. A modified light chain polypeptide of Tetanus Neurotoxin, wherein the Tetanus Neurotoxin has the amino acid sequence of SEQ ID NO. : 3, and the modified light chain comprises one or more mutations at positions as identified according to SEQ ID NO. : 3.
11. The polypeptide of claim 10, wherein the mutations occur at amino acid residues selected from the group consisting of Lysine168 and Leucine230.
12. The polypeptide of claim 10, wherein the modified light chain polypeptide comprises an amino acid sequence of SEQ ID NO. : 4 or 5.
13. A composition comprising the polypeptide of claim 10, wherein the polypeptide is fused with or coupled with one or more second polypeptide, and wherein the second polypeptide is a polypeptide from Tetanus Neurotoxin or other organisms.
14. The composition of claim 13, wherein the second polypeptide is native or artificial.
15. The composition of claim 13, wherein the composition is used as a molecular marker to study exocytosis in the neuron.
16. A composition comprising the polypeptide of claim 10 and a pharmaceutical acceptable carrier.
17. A method for improving or treating diseases or conditions in a subject, comprising a step of administering to the subject an effective amount of the polypeptide of claim 10.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201480045998.5A CN105683212B (en) | 2013-08-21 | 2014-08-19 | Genetically modified clostridial neurotoxins with high catalytic activity |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201361868560P | 2013-08-21 | 2013-08-21 | |
| US61/868,560 | 2013-08-21 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2015024503A1 true WO2015024503A1 (en) | 2015-02-26 |
Family
ID=52483082
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/CN2014/084725 Ceased WO2015024503A1 (en) | 2013-08-21 | 2014-08-19 | Engineering clostridia neurotoxins with elevated catalytic activity |
Country Status (2)
| Country | Link |
|---|---|
| CN (1) | CN105683212B (en) |
| WO (1) | WO2015024503A1 (en) |
Families Citing this family (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| KR20170026624A (en) * | 2014-07-07 | 2017-03-08 | 알러간, 인코포레이티드 | Method of detecting cleaved snap25 in tissue samples |
| BR112019025402A2 (en) * | 2017-05-31 | 2020-06-23 | Allergan, Inc. | BOTULINIC NEUROTOXIN FOR TREATING DISORDERS ASSOCIATED WITH HYPERACTIVITY OF MELANOCYTE AND / OR EXCESS MELANINE |
Family Cites Families (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6903187B1 (en) * | 2000-07-21 | 2005-06-07 | Allergan, Inc. | Leucine-based motif and clostridial neurotoxins |
| EP2266599B1 (en) * | 2004-07-26 | 2014-04-16 | Merz Pharma GmbH & Co. KGaA | Therapeutic composition with a botulinum neurotoxin |
-
2014
- 2014-08-19 CN CN201480045998.5A patent/CN105683212B/en active Active
- 2014-08-19 WO PCT/CN2014/084725 patent/WO2015024503A1/en not_active Ceased
Non-Patent Citations (3)
| Title |
|---|
| NEIL F. FAIRWEATHER ET AL.: "Botulinum and tetanus neurotoxins: structure, function and therapeutic utility", «TRENDS IN BIOCHEMICAL SCIENCE », vol. 27, no. 11, 26 September 2002 (2002-09-26) * |
| NEIL F. FAIRWEATHER ET AL.: "Production of biologically active light chain of tetanus toxin in Escherichia coli Evidence for the importance of the C-terminal 16 amino acids for full biological activity", «FEBS», vol. 323, no. 3, 3 June 1993 (1993-06-03) * |
| SONG, FUYANG ET AL.: "Construction, Expression and Analysis of the Activity of Mutation of Recombinant Light Chain of Botulinum Neurotoxin Serotype A (BoNT/A LC", «LIFE SCIENCE RESEARCH», vol. 15, no. 3, 30 June 2011 (2011-06-30) * |
Also Published As
| Publication number | Publication date |
|---|---|
| CN105683212A (en) | 2016-06-15 |
| CN105683212B (en) | 2020-03-17 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| JP7434263B2 (en) | Cationic neurotoxin | |
| US10844362B2 (en) | Engineered botulinum neurotoxin | |
| JP5746624B2 (en) | Clostridial neurotoxins with altered persistence | |
| AU2010236613B2 (en) | Engineered botulinum neurotoxin | |
| CA2657460A1 (en) | Modified clostridial toxins with enhanced translocation capability and enhanced targeting activity | |
| Guo et al. | Engineering Clostridia Neurotoxins with elevated catalytic activity | |
| Scheps et al. | Design of modified botulinum neurotoxin A1 variants with a shorter persistence of paralysis and duration of action | |
| WO2015024503A1 (en) | Engineering clostridia neurotoxins with elevated catalytic activity | |
| Chen et al. | Solubility of the catalytic domains of Botulinum neurotoxin serotype E subtypes | |
| HK1155176A (en) | Clostridial neurotoxins with altered persistency |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 14838016 Country of ref document: EP Kind code of ref document: A1 |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 14838016 Country of ref document: EP Kind code of ref document: A1 |



