WO2015022192A1 - Methods of modulating seed and organ size in plants - Google Patents
Methods of modulating seed and organ size in plants Download PDFInfo
- Publication number
- WO2015022192A1 WO2015022192A1 PCT/EP2014/066427 EP2014066427W WO2015022192A1 WO 2015022192 A1 WO2015022192 A1 WO 2015022192A1 EP 2014066427 W EP2014066427 W EP 2014066427W WO 2015022192 A1 WO2015022192 A1 WO 2015022192A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- pro
- plant
- polypeptide
- expression
- dai
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/82—Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
- C12N15/8241—Phenotypically and genetically modified plants via recombinant DNA technology
- C12N15/8261—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/415—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from plants
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/93—Ligases (6)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y603/00—Ligases forming carbon-nitrogen bonds (6.3)
- C12Y603/02—Acid—amino-acid ligases (peptide synthases)(6.3.2)
- C12Y603/02019—Ubiquitin-protein ligase (6.3.2.19), i.e. ubiquitin-conjugating enzyme
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A40/00—Adaptation technologies in agriculture, forestry, livestock or agroalimentary production
- Y02A40/10—Adaptation technologies in agriculture, forestry, livestock or agroalimentary production in agriculture
- Y02A40/146—Genetically Modified [GMO] plants, e.g. transgenic plants
Definitions
- This invention relates to methods of altering the size of the seeds and organs of plants, for example to improve plant yield.
- a growth-restricting factor, DAI is a ubiquitin receptor and contains two ubiquitin interaction motifs (UIMs) that bind ubiquitin in vitro, and dal-l mutant forms large seeds by influencing the maternal integuments of ovules (Li et al . , 2008) . Mutations in an enhancer of dal-l (EOD1) , which encodes the
- E3 ubiquitin ligase BIG BROTHER (BB) (Disch et al . , 2006; Li et al . , 2008), synergistically enhance the seed size phenotype of dal-l, indicating that DAI acts synergistically with EODl/BB to control seed size.
- BB E3 ubiquitin ligase
- QTL quantitative trait locus
- GW2 GRAIN WIDTH AND WEIGHT2
- a GW2 homologue in wheat has been identifed (Ta-GW2; Bednarek et al 2012) .
- DA2 E3 ubiquitin ligase
- Another aspect of the invention provides a method of increasing the yield of a plant comprising;
- Another aspect of the invention provides a method of increasing the yield of a plant comprising;
- Another aspect of the invention provides a method of increasing the yield of a plant comprising;
- Another aspect of the invention provides a method of producing a plant with an increased yield comprising:
- a heterologous nucleic acid which abolishes or suppresses the expression or activity of a DA2 polypeptide into the plant cell by means of transformation, and;
- Figure 1 shows seed and organ size in the da2-l mutant.
- 1A shows the projective area of Col-0, da2-l and 35S: :DA2#1 seeds.
- the seeds were classified into three groups (>0.13, 0.12-0.13 and ⁇ 0.12 mm2) .
- IB shows the seed number per silique for Col- 0, da2-l and 35S::DA2#1.
- Siliques from the fourth silique to the tenth silique) on main stem were used to measure seed number per silique.
- 1C shows seed weight per plant for Col-0, da2-l and
- ID shows seed number per plant for Col-0, da2-l and 35S: :DA2#1.
- IE shows the height of Col-0, da2-l and 35S::DA2#1 plants.
- Values (B-E) are given as mean ⁇ SE relative to the wild- type value, set at 100%. **, P ⁇ 0.01 and *, P ⁇ 0.05 compared with the wild type (Student's t-test) . Bars: F, 1cm; G, 1mm
- Figure 2 shows 4-d-old plants (F) of Col-0 (left) , da2-l (middle) and 35S::DA2#1 (right) and flowers (G) of Col-0 (top), da2-l
- Figure 3 shows that DAI and DA2 act synergistically to control seed size.
- 3A shows dry seeds of Col-0, dal-1, da2-l and dal-1 da2-l.
- 3B shows 10-day-old seedlings of Col-0, da2-l, dal-1 and dal-1 da2-l (from left to right) .
- 3C shows Seed weight of Col-0, dal-1, da2-l and dal-1 da2 ⁇ l.
- 3D shows seed weight of Col-0, dal-kol , da2-l and dal-kol da2-l. Values are given as mean ⁇ SE relative to the respective wild-type values, set at 100%. **, P ⁇ 0.01 and *, P ⁇ 0.05 compared with the wild type (Student's t-test) . Bars: A, 0.1mm; B, lm
- Figure 4 shows that DAI and DA2 act synergistically to control seed size.
- Upper left panel shows cotyledon area of 10-day-old Col-0, dal-1, da2-l and dal-1 da2-l seedlings.
- Upper right panel shows cotyledon area of 10-day-old Col-0, dal-kol, da2-l and dal-kol da2-l seedlings.
- Lower left panel shows the average area of palisade cells in cotyledons of Col-0, dal-1, da2-l and dal-1 da2-l embryos.
- Lower right panel shows projective area of Col-0, dal-1, dal-1 da2-l, dal- kol da2-l, dal-kol darl-1 and dal-kol darl-1 da2-l seeds. Values are given as mean ⁇ SE relative to the respective wild-type values, set at 100%. **, P ⁇ 0.01 and *, P ⁇ 0.05 compared with the wild type (Student's t-test) . Bars: A, 0.1mm; B, lm Figure 5 shows that DAl and DA2 act synergistically to control cell proliferation in maternal integuments of developing seeds. (5A-5D) show mature Ovules of Col-0, dal-1, da2-l and dal-1 da2-l respectively. The da2 ⁇ l mutation synergistically enhances the ovule size of dal-1.
- Figure 6 shows (left panel) the projective area of Col-0 ⁇ Col-0 (c/c) Fl, da2-l*da2-l (cI2/d2) Fl, Col-0xda2-2 (c/d2) Fl, and da2- 2xCol-0 (d2/c) Fl seeds and (middle panel) the projective area of Col-OxCol-0 (c/c) Fl, dal-kol da2-l dal-kol da2-l (dd/dd) Fl, Col-
- genotyped for dal-kol and da2-l mutations The data shows that dal- kol and da2-l mutations are not associated with variation in the size of these seeds (P > 0.05, Student's t-test) . Values are given as mean ⁇ SE relative to the respective wild-type values, set at 100%. **, P ⁇ 0.01 compared with the wild type (Student's t-test) . Bars: A-D, 0.5 mm.
- Figure 7 shows (left panel) the projective area of Col-0, dal-1, da2-l and dal-1 da2-l mature ovules; (middle panel) the number of cells in the outer integuments of Col-0, dal-1, da2-l and dal-1 da2-
- Figure 8A shows the DA2 gene structure.
- the start codon (ATG) and the stop codon (TAA) are indicated. Closed boxes indicate the coding sequence, open boxes indicate the 5' and 3' untranslated regions, and lines between boxes indicate introns.
- the T-DNA insertion site [da2-l) in the DA2 gene is shown.
- Figure 8B shows that the DA2 protein contains a predicted RING domain.
- FIG. 9 shows E3 ubiquitin ligase activity of DA2.
- MBP-DA2 and mutated DA2 (MBP-DA2C59S and MBP-DA2N91L) fusion proteins were assayed for E3 ubiquitin ligase activity in the presence of El, E2 and His-ubiquitin (His-Ub) .
- Ubiquitinated proteins were detected by immunoblotting (IB) with anti-His antibody (Anti-His) and anti-MBP antibody (Anti-MBP) , respectively.
- the lower arrow indicates MBP-DA2 proteins, and the upper arrow shows ubiquitinated MBP-DA2 proteins.
- Figure 10 shows the projective area of Col-0, da2-l, COM#6, COM#8, and COMilO seeds (upper panel) , where COM is da2-l transformed with the DA2 coding sequence driven by its own promoter; petal area of Col-0, da2-l, COM#6 r COM#8 , and COMilO plants (middle panel) and quantitative real-time RT-PCR analysis of the DA2 gene expression in Col-0, da2-l, COMi6, COM#8, and COMilO seedlings (lower panel) .
- FIG. 11 shows expression patterns of DA2.
- 11A shows quantitative real-time RT-PCR analysis of the DA2 gene expression. Total RNA was isolated from roots (R) , stems (S) , leaves (L) , seedlings (Se) and inflorescences (In) .
- 11B-11N show DA2 expression activity monitored by pDA2:GUS transgene expression. Four GUS-expressing lines were observed, and all showed a similar pattern, although they differed slightly in the intensity of the staining.
- Figure 12 shows that DAI directly interacts with DA2 in vitro.
- GST- DAI, GST-DA1R358K, GST-DAl-UIM, GST-DA1-LIM, GST-DA1-LIM+C and GST- DA1-C were pulled down (PD) by MBP-DA2 immobilized on amylose resin and analyzed by immunoblotting (IB) using an anti-GST antibody.
- Figure 13 shows a schematic diagram of DAI and its derivatives containing specific protein domains.
- the predicted DAI protein contains two UIM motifs, a single LIM domain and the C-terminal region.
- FIG 14 shows that DAI interacts with DA2 in vivo. Nicotiana benthamiana leaves were transformed by injection of Agrobacterium tumefaciens GV3101 cells harbouring 35S:Myc ⁇ DAl and 35S:GFP-DA2 plasmids. Total proteins were immunoprecipitated with GFP-Trap-A, and the immunoblot was probed with anti-GFP and anti-Myc antibodies, respectively. Myc-DAl was detected in the immunoprecipitated GFP-DA2 complex, indicating that there is a physical association between DAI and DA2 in planta.
- Figure 15 shows that da2-l mutants display increased organ size.
- 15A shows petal length (PL) , petal width (PW) , petal area (PA) , sepal area (SA) , carpel length (CL) , long stamen length (LSL) and short stamen length (SSL) of Col-0, da2-l and 35S:DA2#1 plants.
- 15B shows fifth leaf area of Col-0, da2-l and 35S:DA2#1 plants.
- 15C shows weight of Col-0, da2-l and 35S:DA2#1 flowers.
- 15D shows the size of adaxial epidermal cells in the maximal width region of Col-0 and da2-l petals.
- 15E shows the size of palisade cells in the fifth leaves of Col-0 and da2-l.
- the opened flowers were used to measure the size of petals (15A), flower weight (C) and the size of epidermal cells (15D) .
- Values (A-E) are given as mean ⁇ SE relative to the respective wild-type values, set at 100%. **, P ⁇ 0.01 compared with the wild type (Student's t-test) .
- Figure 16 shows that DAl and DA2 act synergistically to control seed size.
- 16D shows the petal area of Col-0, dal-kol, da2-l and dal- kolda2-l flowers.
- 16E shows the size of adaxial epidermal cells in the maximal width region of Col-0, dal-kol, da2-l and dal-kolda2-l petals.
- 16F shows seed weight of Col-0, eodl-2, da2-l and eodl-2 da2-l.
- 16G shows petal area of Col-0, eodl-2, da2-l and eodl-2 da2- 1.
- the opened flowers (stage 14) were used to measure the size of petals (16D and 16G) and the size of epidermal cells (16E) .
- Values (16D-G) are given as mean ⁇ SE relative to the respective wild-type values, set at 100%. **, P ⁇ 0.01 and *, P ⁇ 0.05 compared with the wild type (Student's t-test) . Bar: 0.1mm.
- Figure 17 shows that overexpression of DA2 restricts organ growth.
- 17A shows that petal area of Col-0, 35S:DA2#2 and 35S:DA2#4.
- 17B shows expression levels of DA2 in Col-0, 35S:DA2#2 and 35S:DA2#4 seedlings.
- Values (A and B) are given as mean ⁇ SE relative to Col-0 values, set at 100%. **, P ⁇ 0.01 compared with the wild type
- Figure 18 shows that overexpression of DA2L restricts organ growth.
- 18A shows 20-day-old plants of Col-0, 35S:DA2L#1, 35S:DA2L#3,
- 18B shows 30 -day-old plants of Col-0, 35S:DA2L#1, 35S:DA2L#3, 35S:DA2L#4 , 35S:DA2L#5, and
- 35S:DA2L#6 shows RT-PCR analysis of DA2L expression in Col-0, 35S:DA2L#1, 35S:DA2L#3, 35S:DA2L#4, 35S:DA2 #5 and 35S:DA2L#6 seedlings.
- RT-PCR was performed on first-strand cDNA prepared from 2-week-old seedlings.
- cDNA was standardized by reference to an ACTIN2 standard. Bars: A, 1cm, B, 1cm
- Figure 19 shows that overexpression of GW2 restricts seed and organ growth.
- 19A shows 30 -day-old plants of Col-0, 35S:GW2#1, 35S:GW2#2, 35S:GW2#3, 35S:GW2#6 and 35S:GW2L#7.
- 19B shows projective area of Col-0, 35S:GW2#1, 35S:GW2#2, 35S:GW2#3, 35S:GW2#6 and 35S:GW2L#7 seeds.
- 19C shows quantitat 1 8 ⁇ 3.1""time RT — PCR 3.n3.1ysis of the GW2 gene expression in Col-0, 35S:GW2#1, 35S:GW2#2, 35S:GW2#3, 35S:GW2#6 and 35S:GW2L#7 seedlings.
- Values (B) are given as mean ⁇ SE relative to Col-0 values, set at 100%. **, P ⁇ 0.01 compared with the wild type (Student's t-test) . Bar: A, 1cm
- This invention relates to methods of altering plant traits which affect yield, such as seed and organ size, by altering the
- E3 ubiquitin ligase DA2 in combination with the alterations in the expression or activity of DAI and/or EOD1.
- the expression or activity of DA2 and DAI is altered in the plant.
- the expression or activity DA2 expression may be altered before, at the same time, or after alteration of DAI and/or EOD1 expression or activity.
- the expression or activity of a DA2 polypeptide may be altered in one or more plant cells which already have one of; altered DAI expression or activity, altered E0D1 expression or activity, or altered DAI and EOD1 expression or activity.
- Provided herein are methods of increasing the yield of plant, for example by increasing organ or seed size, that comprise providing a plant that is deficient in DAI and/or EOD1 expression or activity and reducing the expression of DA2 in one or more cells of the plant.
- the expression or activity of DAI and/or EOD1 may be reduced in one or more plant cells which have reduced expression or activity of a DA2 polypeptide.
- Other methods may comprise reducing the expression of DA2 in one or more cells of the plant and reducing the expression or activity of DAI, E0D1 or both DAI and EOD1 in one or more cells.
- Also provided herein are methods of producing a plant with increased yield relative to wild-type plant that comprise; (a) incorporating into a plant cell by means of transformation
- polypeptide and optionally,
- a heterologous nucleic acid which reduces the activity or expression of a DA2 polypeptide into the plant cell by means of transformation, and;
- a plant with reduced activity or expression of a DA2 polypeptide and reduced activity or expression of DAI and/or EOD1 relative to the wild type plant may be selected.
- the combination of reduced DA2 expression and reduced DAI and/or EOD1 expression synergistically increase the size of the seeds and/or organs of the plant, thereby increasing the plant yield.
- One or more yield-related traits in the plant may be improved by the combination of reduced DA2 expression or activity and reduced DAI and/or EODl expression or activity.
- one or more of life-span, organ size and seed size may be increased in the plant relative to control or wild-type plants in which expression of the DA2 polypeptide has not been reduced.
- Expression or activity of DA2, DAI or EODl may be reduced in the methods described herein by at least 50% relative to the wild-type plant, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% or at least 98%. In some preferred embodiments, expression or activity is reduced to zero or substantially zero (i.e.
- Methods of the invention comprise altering the expression or activity of a DA2 polypeptide in one or more cells of a plant.
- DA2 polypeptides are E3 ubiquitin ligases found in plants.
- DA2 polypeptides whose expression or activity is reduced as described herein may comprise a RING domain (Stone, S.L. et al . (2005)), preferably a C5HC2, C5NC2 or C5TC2 RING domain.
- a suitable RING domain may consist of the amino acid sequence of SEQ ID NO: 1;
- a suitable RING domain may consist of the amino acid sequence of SEQ ID NO: 2; CPICFL (Y/F) YPSLNRS (K/R) CC (S/M/T/A) K (G/S) ICTECFL (Q/R) MK ( P/
- the H/N/T residue at position 33 in the RING domain of SEQ ID NO: 2 may be T or N.
- a DA2 polypeptide may comprise a RING domain having an amino acid sequence shown in Table 1 (SEQ ID NOS : 3-19), for example Arabidopsis DA2 (SEQ ID NO: 11), Arabidopsis DAL2 (SEQ ID NO: 13) or Rice GW2 (SEQ ID NO: 7) or a variant thereof.
- a RING domain may have the amino acid sequence of residues 59 to 101 of SEQ ID NO: 20 (Pt_GI-224061326.pro) , residues 59 to 101 of SEQ ID NO: 21 (Rc_GI-255578534.pro) , residues 59 to 101 of SEQ ID NO: 22 (Vv_GI-147817790.pro) , residues 59 to 101 of SEQ ID NO: 23 (Gm_GI-356549538.pro) , residues 59 to 101 of SEQ ID NO: 24
- RING domain sequences may be identified using standard sequence analysis techniques as described herein (e.g.
- DA2 polypeptides may further comprise a first consensus domain.
- the first consensus domain may be located upstream (i.e. on the N terminal side) of the RING domain.
- a suitable first consensus domain may consist of the amino acid sequence of SEQ ID NO: 36.
- a DA2 polypeptide may comprise a first consensus domain of a DA2 amino acid sequence shown in Table 2, for example residues 20 to 45 of SEQ ID NO: 20, residues 20 to 45 of SEQ ID NO: 21, residues 20 to 45 of SEQ ID NO: 22, residues 20 to 45 of SEQ ID NO: 23, residues 20 to 45 of SEQ ID NO: 24, residues 21 to 46 of SEQ ID NO: 25, residues 21 to 46 of SEQ ID NO: 26, residues 21 to 46 of SEQ ID NO: 27, residues 21 to 46 of SEQ ID NO: 28, residues 21 to 46 of SEQ ID NO:
- a DA2 polypeptide may further comprise a second consensus domain.
- the second consensus domain may be located downstream (i.e. on the terminal side) of the RING domain.
- the second consensus domain may consist of the amino acid sequence of SEQ ID NO: 37.
- N/S YAVEYRG (V/G) K (T/S) KEE (K/R) (G/S) (V/T/I/F/L/M) EQ (L/I/V /F) EEQ (R/L/K) VIEA (Q/K) ( I /M) RMR (H/Q) (K/Q) (E/A) (SEQ ID NO: 37) .
- a DA2 polypeptide may comprise a second consensus domain of an DA2 amino acid sequence shown in Table 2, for example residues 106 to 141 of SEQ ID NO: 20, residues 106 to 141 of SEQ ID NO: 21, residues 106 to 141 of SEQ ID NO: 22, residues 106 to 141 of SEQ ID NO: 23, residues 106 to 141 of SEQ ID NO: 24, residues 107 to 143 of SEQ ID NO: 25, residues 107 to 143 of SEQ ID NO: 26, residues 107 to 143 of SEQ ID NO: 27, residues 108 to 144 of SEQ ID NO: 28, residues 109 to 145 of SEQ ID NO: 29, residues 111 to 90 to 125 of SEQ ID NO: 32, residues 108 to 143 of SEQ ID NO: 33, residues 108 to 143 of SEQ ID NO: 34 or residues 108 to 143 of SEQ ID NO: 35.
- first and second domain sequences may be identified using standard sequence analysis techniques as described herein (e.g. Simple Modular Architecture Research Tool (SMART) ; EMBL Heidelberg, DE) .
- SMART Simple Modular Architecture Research Tool
- EMBL Heidelberg, DE EMBL Heidelberg, DE
- a DA2 polypeptide whose expression or activity is reduced as described herein may comprise a RING Domain of SEQ ID NO: 2, first consensus domain of SEQ ID NO: 36 and a second consensus domain of SEQ ID NO: 37.
- a DA2 polypeptide may comprise any combination of RING domain sequence, first consensus domain sequence and second
- a suitable DA2 polypeptide may comprise an amino acid sequence of any one of SEQ ID NOS 20 to 35 as set out in Table 2 or may be variant of one of these sequences.
- a DA2 polypeptide may comprise the amino acid sequence of SEQ ID NO: 28 or 33 (OsGW2) , SEQ ID NO: 24 (AtDA2), SEQ ID NO: 25 or SEQ ID NO: 31 (TaGW2) or may be a variant of any one of these sequences which has E3 ubiquitin ligase activity.
- a DA2 polypeptide which is a variant of any one of SEQ ID NOS: 20 to 35 or other reference DA2 sequence may comprise an amino acid sequence having at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or at least 98% sequence identity to the reference DA2 sequence .
- a DA2 polypeptide which is a variant of any one of SEQ ID NOS: 20 to 35 may further comprise a RING domain having the sequence of SEQ ID NO: 2 a first consensus domain having the sequence of SEQ ID NO: 36 and a second consensus domain having the sequence of SEQ ID NO: 37. Examples of suitable sequences are set out above.
- a DA2 polypeptide may comprise the RING domain, first consensus domain and second consensus domain of any one of SEQ ID NOS: 20 to 35.
- a nucleic acid encoding a DA2 polypeptide may comprise a nucleotide sequence set out in a database entry selected from the group consisting of JN896622.1 GI:408743658 (TaGW2-A) ; and JN896623.1 GI : 408743660 (TaGW2-B) or may be variant of one of these sequences.
- a nucleic acid encoding a DA2 polypeptide may comprise the nucleotide sequence encoding AtDA2, AtDAL2 , OsGW2, TaGW2-A or TaGW2-B or may be a variant of any one of these DA2 sequences which encodes a polypeptide which has DA2 activity.
- DA2 polypeptides and encoding nucleic acids may be identified in any plant species of interest, in particular a crop plant, such as wheat, barley, maize, rice, soybean, and another agricultural plants, using routine sequence analysis techniques.
- Reduction in DA2 expression or activity in a plant is shown herein to synergistically enhance the effect on yield-associated traits in plants of mutations that reduce the activity or expression of DAI.
- methods described herein may comprise reducing DA2 expression in a plant that is deficient in DAI
- DAI polypeptides are ubiquitin receptors found in plants and are described in detail in Li et al (2008), Wang, et al (2012) and WO2009/047525. DAI polypeptides whose expression or activity is reduced as described herein may comprise a LIM domain, a conserved C terminal domain and one or more UIM domains.
- a LIM domain comprises two Zn finger motifs and may have the amino acid sequence (SEQ ID NO: 38);
- the Zn coordinating residues in the LIM domain may be C, H, D or E, preferably C.
- a LIM domain may comprise CXXC, HXXCXXCXXC and HxxC motifs, where X is any amino acid.
- a LIM domaim may comprise the amino acid sequence (SEQ ID NO:39) ; C (X) 2 C(X) (H) (X) 2 (C) ;X) 2 C(X) 2 C(X) i 4 -2iH(X CX where X is any amino acid and Zn coordinating residues are underlined
- a LIM domain may comprise the amino acid sequence of the AtDAI LIM domain;
- LIM domains include the LIM domain of an DAI amino acid sequence shown in Table 3, for example residues 141 to 193 of SEQ ID NO: 41 (Si_GI-514815267.pro) , residues 123 to 175 of SEQ ID NO: 42 (Bd_GI-357157184.pro ) , residues 155 to 207 of SEQ ID NO:
- LIM domain sequences may be identified using standard sequence analysis techniques (e.g. Simple Modular Architecture Research Tool (SMART); EMBL Heidelberg, DE) .
- a DAl protein may further comprise a carboxyl terminal region having an amino acid sequence at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or at least 98% amino acid identity to the sequence of residues 198 to 504 of SEQ ID NO: 41, residues 180 to 487 of SEQ ID NO: 42, residues 212 to 514 of SEQ ID NO: 43, residues 229 to 532 of SEQ ID NO: 44, residues 229 to 532 of SEQ ID NO: 45, residues 174 to 478 of SEQ ID NO: 46, residues 174 to 474 of SEQ ID NO: 47, residues 178 to 478 of SEQ ID NO: 48, residues 176 to 462 of SEQ ID NO: 49, residues 179
- the carboxyl terminal region of the DAl protein may comprise the metallopeptidase motif HEMMH (SEQ ID NO: 65) .
- the carboxyl terminal region may further comprise a EK (X) 3R (X) 4 SEEQ (SEQ ID NO: 66) or EK (X) gR (X) 4 SEQ (SEQ ID NO: 67) motif positioned between the LIM domain and HEMMH motif.
- a DAl protein may comprise a UIMl domain and a UIM2 domain.
- the UIMl and UIM2 domains may be located between the N terminal and the LIM domain of the DAl protein.
- a UIMl domain may consist of the sequence of SEQ ID NO: 68 and a UIM2 domain may consist of the sequence of SEQ ID NO: 69.
- p pLpbAl pb.Sbp-.pp p (SEQ ID NO: 68)
- p pLpbAl pb.Sbp-spp p (SEQ ID NO: 69) wherein;
- p is a polar amino acid residue, for example, C, D, E, H, K, N, Q, R, S or T;
- b is a big amino acid residue, for example, E, F, H, I, K, L, M, Q, R, W or Y;
- s is a small amino acid residue, for example, ⁇ , C, D, G, N, P, S, T or V;
- 1 is an aliphatic amino acid residue, for example, I, L or V;
- . is absent or is any amino acid
- - is any amino acid.
- UIMl and UIM2 domain sequences may be identified using standard sequence analysis techniques as described herein (e.g. Simple Modular Architecture Research Tool (SMART); EMBL
- a DAI polypeptide may comprise;
- a DAI protein may comprise an amino acid sequence of a plant DAI protein shown in Table 3 (SEQ ID NOS: 41 to 64) or may be a
- a DAI polypeptide may comprise an amino acid sequence shown in Table 3 (SEQ ID NOS: 41 to 64) or may be variant of one of these sequences which has DAI activity.
- a DAI polypeptide may comprise an amino acid sequence of AtDAI, AtDARl, AtDAR2, AtDAR3, AtDAR4, AtDAR5, AtDAR6, AtDAR7, BrDAla, BrDAlb, BrDARl, BrDAR2, BrDAR3-7, BrDAL1 , BrDAL2, BrDAL3, OsDAl, OsDAR2, OsDAL3, 0sDAL5, PpDALl, PpDAL2, PpDAL3, PpDAL4, PpDAL5, PpDAL6, PpDAL7, PpDAL8, SmDALl, SmDAL2 or ZmDAl, preferably AtDAI , AtDARl BrDAla, BrDAlb, OsDAl or ZmDAl or a homologue or variant of one of these sequences.
- a DAI polypeptide may comprise the amino acid sequence of AtDAl (AT1G19270; NP_173361.1 GI : 15221983) or may be variant of this sequence which has DAI activity.
- Other DAI protein sequences which include the characteristic features set out above may be identified using standard sequence analysis tools. A skilled person is readily able to identify nucleic acid sequences encoding DAI proteins in any plant species of interest .
- a DAI protein in a plant species of interest may have an amino acid sequence which is a variant of a DAI protein reference amino acid sequence set out herein.
- a DAI polypeptide which is a variant of a reference DAI sequence may comprise an amino acid sequence having at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or at least 98% sequence identity to the reference sequence .
- amino acid sequence variants that occur in a plant species may differ from a reference sequence set out herein by insertion, addition, substitution or deletion of 1 amino acid, 2, 3, 4, 5-10, 10-20 20-30, 30-50, or more than 50 amino acids.
- a DAI polypeptide which is a variant of the AtDAI sequence of SEQ ID NO: 45 may comprise a UIM1 domain having the sequence QENEDIDRAIALSLLEENQE (SEQ ID NO: 70) and a UIM2 domain having the sequence DEDEQI RALQESMVVGNSP (SEQ ID NO: 71) .
- a DAI polypeptide which is a variant of AtDAI sequence of SEQ ID NO: 45 may comprise a LIM domain having the sequence:
- a nucleic acid encoding a DAI polypeptide may comprise a nucleotide sequence set out in a database entry selected from the group consisting of NM__101785.3 GI:42562170 (AtDAI ) ; NM_001057237.1 GI:115454202 (OsDAl); BT085014.1 GI : 238008663 (ZmDAl) or may be variant of one of these sequences which encodes an active DAI polypeptide.
- a nucleic acid encoding a DAI polypeptide may comprise the nucleotide sequence of AtDAl (NM_101785.3 GI : 42562170), ZmDAl (BT085014.1 GI : 238008663) , OsDAl (NM_001057237.1 GI : 115454202 ) or may be a variant of any one of these sequences which encodes a polypeptide which retains DAl activity .
- DAl polypeptides and encoding nucleic acids may be identified in plant species, in particular crop plants, such as wheat, barley, maize, rice, and another agricultural plants, using routine sequence analysis techniques.
- DAl activity in one or more cells of a plant may be reduced by expression of a dominant-negative DAl polypeptide in the one or more cells (see for example Li et al (2008); WO2009/047525; Wang et al 2012) .
- a plant expressing a dominant-negative DAl polypeptide may have a dal-1 phenotype .
- a dominant negative allele of a DAl polypeptide may comprise a DAl polypeptide having a mutation, e.g. a substitution or deletion, at a a conserved R residue that is located at position 358 of the A.
- thaliana DAl amino acid sequence, position 333 of the Z. mays DAl amino acid sequence or the equivalent position in another DAl amino acid sequence.
- a dominant negative allele of a DAl polypeptide may comprise a mutation of the conserved R residue at a position equivalent to position 358 of the A. thaliana DAl amino acid sequence or position 333 of the Z. mays DAl amino acid
- the conserved R residue may be substituted for .
- the conserved R residue that is located at a position in a DAl amino acid sequence which is equivalent to position 358 of SEQ ID NO: 45 of A. thaliana DAl or position 333 of the Z. mays DAl of SEQ ID NO: 57 is located at the position within the DAl amino acid sequence which corresponds to R333 of SEQ ID NO: 57 and R358 of SEQ ID NO: 45 i.e. it is in the same position relative to to the other motifs and domains of the DAl protein.
- the conserved R residue is located between the LIM domain and the HEMMH peptidase motif of the C terminal region and is completely conserved in the same sequence context in DAl proteins.
- the conserved R residue may be contained in a EK (X) 3 R (X) 4 SEEQ (SEQ ID NO: 66) or EK (X) 8 R (X) 4 SEQ (SEQ ID NO: 67) motif within the C terminal region.
- the conserved R residue may be identified by aligning these conserved C terminal regions using standard sequence analysis and alignment tools and is identified with an arrow in the sequences of Table 3.
- Nucleic acid which encodes a dominant negative allele of a DA protein may be produced by any convenient technique.
- site directed mutagenesis may be employed on a nucleic acid encoding a DAI polypeptide to alter the conserved R residue at the equivalent position to R358 of A. thaliana DAI or R333 of the Zea mays DAI, for example to K. Reagents and kits for in vitro mutagenesis are commercially available.
- a nucleic acid encoding a dominant-negative DAI polypeptide as described herein may be operably linked to a
- the nucleic acid encoding the dominant-negative DAI polypeptide may be comprised in one or more vectors.
- the mutated nucleic acid encoding the dominant-negative allele of a DAI protein may be further cloned into an expression vector and expressed in plant cells as described below to alter the plant phenotype .
- a mutation may be introduced into an
- polypeptide encoded by the mutant DAI nucleic acid has dominant- negative activity.
- Nucleic acid encoding a dominant-negative DAI polypeptide may be expressed in the same plant species or variety from which it was originally isolated or in a different plant species or variety (i.e. a heterologous plant) .
- Reduction or abolition of DA2 expression in a plant is also shown herein to enhance the effect of mutations that reduce the expression or activity of EOD1 on yield-associated traits in plants.
- Methods described herein may comprise reducing DA2 expression or activity in a plant that is deficient in EODl expression or activity or reducing both DA2 and EODl expression or activity in a plant.
- the plant may also be deficient in DAI activity or the method may additionally comprise reducing or abolishing DAI expression in the plant EOD1 polypeptides are E3 ubiquitin ligases found in plants and are described in detail in Disch et al. (2006), Li et al (2008) and WO2009/047525.
- EODl polypeptide whose expression or activity is reduced as described herein may comprise an EOD domain.
- a suitable EOD domain may consist of the amino acid sequence of SEQ ID NO: 73;
- an EODl polypeptide may comprise a EOD domain having an amino acid sequence of residues 195 to 237 of SEQ ID NO: 74 ( Zm_GI-223973923. pro) , residues 195 to 237 of SEQ ID NO: 74 ( Zm_GI-223973923. pro) , residues 195 to 237 of SEQ ID NO: 74 ( Zm_GI-223973923. pro) , residues 195 to 237 of SEQ ID NO: 74 ( Zm_GI-223973923. pro) , residues 195 to 237 of SEQ ID NO: 74 ( Zm_GI-223973923. pro) , residues 195 to 237 of SEQ ID NO: 74 ( Zm_GI-223973923. pro) , residues 195 to 237 of SEQ ID NO: 74 ( Zm_GI-223973923. pro) , residues 195 to 237 of SEQ ID NO: 74 ( Zm_GI-223973923. pro) , residues
- EOD domain sequences may be identified using standard sequence analysis techniques as described herein (e.g.,
- a EODl polypeptide whose expression or activity is reduced as described herein may comprise an amino acid sequence of any one of SEQ ID NOS 74 to 90 as set out in Table 4.
- a EODl polypeptide may comprise the amino acid sequence of SEQ ID NO: 89 (AtEODl) or SEQ ID NOS: 77 or 78 (OsEODl) or may be a variant of this sequence which retains E3 ubiquitin ligase activity .
- a EODl polypeptide which is a variant of any one of SEQ ID NOS: 74 to 90 or other reference EODl sequence may comprise an amino acid sequence having at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or at least 98% sequence identity to the reference EODl sequence .
- a EOD polypeptide which is a variant of any one of SEQ ID NOS: 74 to 90 may further comprise a EOD domain having the sequence of SEQ ID NO: 73. Examples of suitable sequences are set out above.
- a nucleic acid encoding a EODl polypeptide may comprise a nucleotide sequence set out in a database entry selected from the group consisting of XM_002299911.1 GI:224059639 (PtEODl); XMJJ 02531864.1 01:255582235 (RcEODl); XM_002279758.2 GI:359487285 (VvEODl);
- At3g63530 may be variant of one of these sequences.
- a nucleic acid encoding a EODl polypeptide may comprise the nucleotide sequence encoding AtEODl or OsEODl or may be a variant of any one of these sequences which encodes a polypeptide which has EODl activity.
- EODl polypeptides and encoding nucleic acids whose expression or activity is reduced as described herein may be readily identified in any plant species of interest, in particular a crop plant, such as wheat, barley, maize, rice, and another agricultural plants, using routine sequence analysis techniques.
- DA2 mutation in plants is also shown herein to synergistically enhance the effect of combinations of DAI and EODl mutations on yield-associated traits in plants.
- An DAI, DA2 or EOD1 polypeptide in a plant species of interest may have an amino acid sequence which is a variant of a respective DAI, DA2 or EODl reference amino acid sequence set out herein.
- a DAI, DA2 or EODl polypeptide which is a variant of a reference sequence set out herein may comprise an amino acid sequence having at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or at least 98% sequence identity to the reference sequence.
- Particular amino acid sequence variants that occur in a plant species may differ from a reference sequence set out herein by insertion, addition, substitution or deletion of 1 amino acid, 2, 3, 4, 5-10, 10-20 20-30, 30-50, or more than 50 amino acids.
- a DAI, DA2 or EODl nucleic acid in a plant species of interest may have a nucleotide sequence which is a variant of a respective DAI, DA2 or EODl reference nucleotide sequence set out herein.
- variant nucleotide sequence may be a homologue, or allele of a reference DAI, DA2 or EODl sequence set out herein, and may differ from the reference DAI, DA2 or EODl nucleotide sequence by one or more of addition, insertion, deletion or substitution of one or more nucleotides in the nucleic acid, for example 2, 3, 4, 5-10, 10-20 20-30, 30-50, or more than 50, leading to the addition, insertion, deletion or substitution of one or more amino acids in the encoded polypeptide.
- changes to the nucleic acid that make no difference to the encoded amino acid sequence are included.
- a DAI, DA2 or EODl encoding nucleic acid may comprise a sequence having at least 20% or at least 30% sequence identity with the reference nucleic acid sequence, preferably at least 40%, at least 50%, at least 60%, at least 65%, at least 70%, at least 80%, at least 90%, at least 95% or at least 98%. Sequence identity is described above.
- GAP Garnier et al. (1990) J. Mol. Biol. 215: 405- 410), FASTA (which uses the method of Pearson and Lipman (1988) PNAS USA 85: 2444-2448), or the Smith-Waterman algorithm (Smith and Waterman (1981) J. Mol Biol.
- Suitable variant amino acid and nucleotide sequences can be
- a DAI, DA2 or EOD1 nucleotide sequence which is a variant of a reference DAI, DA2 or EOD1 nucleic acid sequence set out herein, may selectively hybridise under stringent conditions with this nucleic acid sequence or the complement thereof.
- Stringent conditions include, e.g. for hybridization of sequences that are about 80-90% identical, hybridization overnight at 42°C in 0.25M Na 2 HP0 4 , pH 7.2, 6.5% SDS, 10% dextran sulfate and a final wash at 55°C in 0. IX SSC, 0.1% SDS.
- suitable conditions include hybridization overnight at 65°C in 0.25M Na 2 HP0 4 , pH 7.2, 6.5% SDS, 10% dextran sulfate and a final wash at 60°C in 0. IX SSC, 0.1% SDS.
- An alternative, which may be particularly appropriate with plant nucleic acid preparations, is a solution of 5x SSPE (final 0.9 M NaCl, 0.05M sodium phosphate, 0.005M EDTA pH 7.7), 5X Denhardt' s solution, 0.5% SDS, at 50°C or 65°C overnight. Washes may be performed in 0.2x SSC/0.1% SDS at 65°C or at 50-60°C in lx SSC/0.1% SDS, as required.
- Nucleic acids as described herein may be wholly or partially synthetic. In particular, they may be recombinant in that nucleic acid sequences which are not found together in nature (do not run contiguously) have been ligated or otherwise combined artificially. Alternatively, they may have been synthesised directly e.g. using an automated synthesiser. The expression of a DA2 nucleic acid and a DAI and/or EOD1 nucleic acid may reduced or abolished in one or more cells of a plant by any convenient technique. Methods for reducing the expression or activity of a DA2 polypeptide and a DAI and/or EOD1 polypeptide in a plant are well-known in the art and are described in more detail below.
- the expression of active DA2 , DAI and/or EOD1 polypeptide may be reduced, preferably abolished, by introducing a mutation into the nucleic acid sequence in a plant cell which encodes the polypeptide or which regulate the expression of such a nucleic acid sequence.
- the mutation may disrupt the expression or function of the DA2, DAI and/or EODl polypeptide.
- Suitable mutations include knock-out and knock-down mutations.
- a mutation may produce a dominant-negative allele of DAI.
- a plant may then be regenerated from the mutated cell.
- the nucleic acids may be mutated by insertion or deletion of one or more nucleotides.
- mutations may be introduced into a target EODl, DA2 or DAI gene by genome editing techniques, for example RNA guided nuclease techniques such as CRISPR, Zinc-finger nucleases (ZFNs) and transactivator-like effector nucleases (TALENs) (Urnov, F.D. et al Nature reviews. Genetics 11, 636-646 (2010) ;
- Sequence mutations which reduce the expression or activity may include a deletion, insertion or substitution of one or more nucleotides, relative to the wild-type nucleotide sequence, a gene amplification or an increase or decrease in methylation, for example hypermethylation .
- the one or more mutations may be in a coding or non-coding region of the nucleic acid sequence. Mutations in the coding region of the gene encoding the component may prevent the translation of full-length active protein i.e. truncating mutations, or allow the translation of full-length but inactive or impaired function protein i.e. mis-sense mutations.
- a nucleic acid comprising one or more sequence mutations may encode a variant polypeptide which has reduced or abolished activity or may encode a wild-type polypeptide which has little or no expression within the cell, for example through the altered activity of a regulatory element.
- a nucleic acid comprising one or more sequence mutations may have one, two, three, four or more mutations relative to the unmutated sequence.
- the activity of EODl may be reduced, preferably abolished, by introducing a mutation, such as a deletion, insertion or substitution, at a position corresponding to position 44 of SEQ ID NO: 89, for example, an A to T substitution.
- a mutation such as a deletion, insertion or substitution
- a position in a EODl polypeptide sequence which is equivalent to position 44 of SEQ ID NO: 89 may be identified using standard sequence analysis and alignment tools, as shown in Table 4.
- DA2 , DAI and EODl coding sequences may be identified in any plant species of interest using standard sequence analysis techniques, for example by comparison with the reference sequences set out herein.
- a mutation that reduces or abolishes DA2 expression or activity may be introduced into a plant cell that expresses a dominant negative DAI polypeptide and optionally comprises either i) a heterologous nucleic acid that encodes an EODl suppressor nucleic acid or ii) a mutation that reduces EODl
- the expression of a DAI, DA2 and/or EODl polypeptide may be reduced in a plant cell by expressing a
- heterologous nucleic acid which encodes or transcribes a suppressor nucleic acid, for example a suppressor RNA or RNAi molecule, within cells of said plant.
- the suppressor RNA suppresses the expression of its target polypeptide (i.e. DAI, DA2 or EODl) in the plant cells.
- Nucleic acids as described herein may be wholly or partially synthetic. In particular, they may be recombinant in that nucleic acid sequences which are not found together in nature (do not run contiguously) have been ligated or otherwise combined artificially. Alternatively, they may have been synthesised directly e.g. using an automated synthesiser.
- the nucleic acid may of course be double- or single-stranded, cDNA or genomic DNA, or RNA.
- the nucleic acid may be wholly or partially synthetic, depending on design.
- the skilled person will understand that where the nucleic acid includes RNA, reference to the sequence shown should be construed as reference to the RNA equivalent, with U substituted for T.
- Heterologous indicates that the gene/sequence of nucleotides in question or a sequence regulating the gene/sequence in question, has been introduced into said cells of the plant or an ancestor thereof, using genetic engineering or recombinant means, i.e. by human intervention.
- Nucleotide sequences which are heterologous to a plant cell may be non-naturally occurring in cells of that type, variety or species (i.e. exogenous or foreign) or may be sequences which are non-naturally occurring in that sub-cellular or genomic environment of the cells or may be sequences which are non-naturally regulated in the cells i.e. operably linked to a non-natural regulatory element .
- a suitable suppressor nucleic acid may be a copy of all or part of the target DAI, DA2 and/or EOD1 gene inserted in antisense or sense orientation or both relative to the DAI, DA2 and/or EOD1 gene, to achieve reduction in expression of the target gene.
- van der Krol et al. (1990) The Plant Cell 2, 291-299; Napoli et al . , (1990) The Plant Cell 2, 279- 289; Zhang et al., (1992) The Plant Cell 4, 1575-1588, and US-A- 5,231,020.
- the suppressor nucleic acid may be a sense suppressor of expression of the DAI, DA2 and/or EOD1 polypeptide.
- a suitable sense suppressor nucleic acid may be a double stranded RNA (Fire A. et al Nature, Vol 391, (1998)) .
- dsRNA mediated silencing is gene specific and is often termed RNA interference
- RNAi is a two-step process. First, dsRNA is cleaved within the cell to yield short interfering RNAs (siRNAs) of about 21-23nt length with 5' terminal phosphate and 3' short overhangs ( ⁇ 2nt) . The siRNAs target the corresponding mRNA sequence specifically for destruction (Zamore P.D. Nature Structural Biology, 8, 9, 746-750,
- siRNAs (sometimes called microRNAs) down-regulate gene expression by binding to complementary RNAs and either triggering mRNA elimination (RNAi) or arresting mRNA translation into protein.
- siRNA may be derived by processing of long double stranded RNAs and when found in nature are typically of exogenous origin.
- Micro-interfering RNAs (miRNA) are endogenously encoded small non-coding RNAs, derived by processing of short hairpins. Both siRNA and miRNA can inhibit the translation of mRNAs bearing partially complementary target
- RNAi RNAi
- RNAi sequence may correspond to a fragment of a reference DA2, DAI or EODl nucleotide sequence set out herein or may be a variant thereof.
- siRNA molecules are typically double stranded and, in order to optimise the effectiveness of RNA mediated down-regulation of the function of a target gene, it is preferred that the length and sequence of the siRNA molecule is chosen to ensure correct
- miRNA ligands are typically single stranded and have regions that are partially complementary enabling the ligands to form a hairpin.
- miRNAs are RNA sequences which are transcribed from DNA, but are not translated into protein. A DNA sequence that codes for a miRNA is longer than the miRNA. This DNA sequence includes the miRNA sequence and an approximate reverse complement. When this DNA sequence is transcribed into a single-stranded RNA molecule, the miRNA sequence and its reverse-complement base pair to form a partially double stranded RNA segment.
- the design of microRNA sequences is discussed on John et al, PLoS Biology, 11(2), 1862- 1879, 2004.
- RNA molecules intended to mimic the effects of siRNA or miRNA have between 10 and 40 ribonucleotides (or synthetic analogues thereof) , more preferably between 17 and 30
- the molecule may have symmetric 3' overhangs, e.g. of one or two (ribo) nucleotides, typically a UU of dTdT 3' overhang.
- ribo ribo nucleotides
- the skilled person can readily design suitable siRNA and miRNA sequences, for example using resources such as siRNA finder (Ambion) .
- siRNA and miRNA sequences can be
- the siRNA is synthesized synthetically.
- RNAs Longer double stranded RNAs may be processed in the cell to produce siRNAs (see for example Myers (2003) Nature Biotechnology 21:324- 328) .
- the longer dsRNA molecule may have symmetric 3' or 5'
- the longer dsRNA molecules may be 25 nucleotides or longer. Preferably, the longer dsRNA molecules are between 25 and 30 nucleotides long. More preferably, the longer dsRNA molecules are between 25 and 27 nucleotides long. Most preferably, the longer dsRNA molecules are 27 nucleotides in length. dsRNAs 30 nucleotides or more in length may be expressed using the vector pDECAP
- shRNAs are more stable than synthetic siRNAs.
- a shRNA consists of short inverted repeats separated by a small loop sequence. One inverted repeat is complementary to the gene target.
- the shRNA is processed by DICER into a siRNA which degrades the target gene mRNA and suppresses expression.
- the shRNA is produced endogenously (within a cell) by transcription from a vector.
- shRNAs may be produced within a cell by transfecting the cell with a vector encoding the shRNA sequence under control of a RNA polymerase III promoter such as the human HI or 7SK promoter or a RNA polymerase II promoter.
- the shRNA may be synthesised exogenously (in vitro) by transcription from a vector.
- the shRNA may then be introduced directly into the cell.
- the shRNA molecule comprises a partial sequence of DAI, DA2 and/or EODl.
- the shRNA sequence is between 40 and 100 bases in length, more preferably between 40 and 70 bases in length.
- the stem of the hairpin is preferably between 19 and 30 base pairs in length. The stem may contain G-U pairings to stabilise the hairpin, structure.
- siRNA molecules, longer dsRNA molecules or miRNA molecules may be made recombinantly by transcription of a nucleic acid sequence, preferably contained within a vector.
- the siRNA molecule, longer dsRNA molecule or miRNA molecule comprises a partial sequence of a reference DA2, DAI or EOD1 nucleotide sequence set out herein or a variant thereof.
- the suppressor nucleic acid may be an anti- sense suppressor of expression of the DAI, DA2 and/or EOD1
- RNA which is complementary to normal mRNA transcribed from the
- An anti-sense suppressor nucleic acid may comprise an anti-sense sequence of at least 10 nucleotides from a nucleotide sequence is a fragment of a reference DA2, DAI or EODl nucleotide sequence set out herein or a variant thereof.
- a sequence employed in a down-regulation of gene expression in accordance with the present invention may be a wild-type sequence (e.g. gene) selected from those available, or a variant of such a sequence .
- the sequence need not include an open reading frame or specify an RNA that would be translatable. It may be preferred for there to be sufficient homology for the respective anti-sense and sense RNA molecules to hybridise. There may be down regulation of gene expression even where there is about 5%, 10%, 15% or 20% or more mis-match between the sequence used and the target gene.
- a suppressor RNA molecule may comprise 10-40 nucleotides of the sense or anti-sense strand of a nucleic acid sequence which encodes DA2, DAI and/or EODl polypeptide.
- Suppressor nucleic acids may be operably linked to heterologous promoters, for example tissue-specific or inducible promoters.
- tissue-specific or inducible promoters for example, integument and seed specific promoters can be used to specifically down-regulate two or more DAI, DA2 and/or EODl nucleic acids in developing ovules and seeds to increase final seed size.
- DA2 suppressor nucleic acid may be expressed in a plant cell with a nucleic acid encoding a dominant negative DAI polypeptide and optionally an EODl suppressor nucleic acid .
- Nucleic acid encoding the suppressor nucleic acid and/or a dominant- negative DAI polypeptide may be comprised in one or more vectors.
- Nucleic acid encoding the suppressor nucleic acid(s) as described herein and/or dominant-negative DAI polypeptide may be operably linked to a heterologous regulatory sequence, such as a promoter, for example a constitutive, inducible, tissue-specific or
- Nucleic acid encoding suppressor nucleic acid(s) as described herein and/or dominant negative DAI polypeptides may be contained on a nucleic acid construct or vector.
- the construct or vector is preferably suitable for transformation into and/or expression within a plant cell.
- a vector is, inter alia, any plasmid, cosmid, phage or Agrobacterium binary vector in double or single stranded linear or circular form, which may or may not be self-transmissible or mobilizable, and which can transform prokaryotic or eukaryotic host, in particular a plant host, either by integration into the cellular genome or exist extrachromasomally (e.g. autonomous replicating plasmid with an origin of replication) .
- shuttle vectors by which is meant a DNA vehicle capable, naturally or by design, of replication in two different organisms, which may be selected from Actinomyces and related species, bacteria and eukaryotic (e.g. higher plant, mammalia, yeast or fungal) cells.
- a construct or vector comprising nucleic acid as described above need not include a promoter or other regulatory sequence,
- the vector is to be used to introduce the nucleic acid into cells for recombination into the genome.
- Constructs and vectors may further comprise selectable genetic markers consisting of genes that confer selectable phenotypes such as resistance to antibiotics such as kanamycin, hygromycin,
- Suitable vectors can be chosen or constructed, containing appropriate regulatory sequences, including promoter sequences, terminator fragments, polyadenylation sequences, enhancer sequences, marker genes and other sequences as appropriate.
- appropriate regulatory sequences including promoter sequences, terminator fragments, polyadenylation sequences, enhancer sequences, marker genes and other sequences as appropriate.
- nucleic acid to be inserted should be assembled within a construct that contains effective regulatory elements that will drive transcription. There must be available a method of transporting the construct into the cell. Once the construct is within the cell membrane, integration into the
- the target cell type is preferably such that cells can be regenerated into whole plants.
- Agrobacterium transformation is one method widely used by those skilled in the art to transform plant species. Production of stable, fertile transgenic plants is now routine in the art (see for example Toriyama, et al. (1988) Bio/Technology 6, 1072-1074; Zhang, et al. (1988) Plant Cell Rep. 7, 379-384; Zhang, et al . (1988) Theor Appl Genet 76, 835-840; Shimamoto, et al. (1989) Nature 338, 274-276; Datta, et al . (1990) Bio/Technology 8, 736-740; Christou, et al . (1991) Bio/Technology 9, 957-962; Peng, et al.
- micropro j ectile or particle bombardment US 5100792, EP-A-444882, EP-A-434616
- electroporation EP 290395, WO 8706614
- microinjection WO 92/09696, WO 94/00583, EP 331083, EP 175966, Green et al. (1987) Plant Tissue and Cell Culture, Academic Press
- direct DNA uptake DE 4005152, WO 9012096, US 4684611
- liposome mediated DNA uptake e.g. Freeman et al. Plant Cell
- a plant may be regenerated, e.g. from single cells, callus tissue or leaf discs, as is standard in the art. Almost any plant can be entirely regenerated from cells, tissues and organs of the plant. Available techniques are reviewed in Vasil et al., Cell Culture and Somatic Cell Genetics of Plants, Vol I, II and III, Laboratory Procedures and Their Applications, Academic Press, 1984, and Weissbach and Weissbach, Methods for Plant Molecular Biology, Academic Press, 1989.
- a transformation technology will be determined by its efficiency to transform certain plant species as well as the experience and preference of the person practising the invention with a particular methodology of choice. It will be apparent to the skilled person that the particular choice of a transformation system to introduce nucleic acid into plant cells is not essential to or a limitation of the invention, nor is the choice of technique for plant regeneration. Following transformation, a plant cell with reduced DA2 expression and reduced DAI and/or EOD1 expression or activity may be identified and/or selected. A plant may be regenerated from the plant cell.
- a plant with reduced DA2 activity or expression that is also deficient in the expression or activity of DAI, EODl or both DAI and E0D1, as described above may be sexually or asexually propagated or grown to produce off-spring or descendants.
- descendants of the plant regenerated from the one or more cells may be sexually or asexually propagated or grown.
- the plant or its off- spring or descendents may be crossed with other plants or with itself .
- the DAI, DA2 and/or EODl amino acid or nucleic acid sequence may be employed as a molecular marker to determine the expression or activity of one or more of the DAI, DA2 and/or EODl polypeptides in a plant before, during or after growing or sexually or asexually propagated as set out above.
- a method may comprise:
- the population of plants may be produced as described above.
- a method may comprise:
- One or both of the first and second plants may be produced as described above.
- a progeny plant in which expression of the DA2 and DAI and/or EODl polypeptide is reduced relative to controls may display increased seed and/or organ size relative to the controls and may have higher plant yields.
- DAI and EODl amino acid or nucleic acid sequences may be employed as a molecular marker to determine the expression or activity of one or more of the DAI and/or EODl polypeptides in a plant in order to identify a plant or plant cell deficient in DAI and/or EODl in which expression or activity of a DA2 polypeptide may be reduced as described above.
- a method may comprise :
- a plant or progeny plant may be identified by i) measuring the amount of DAI, DA2 and/or E0D1 polypeptide in one or more cells of the plant ii) measuring the amount of DAI, DA2 and/or EOD1 mRNA in one or more cells of the plant or iii) sequencing the nucleic acid encoding the DAI, DA2 and/or EODl polypeptide in one or more cells of the plant and identifying the presence of one or more mutations.
- the identified plants may be further propagated or crossed, for example, with other plants having reduced DAI, DA2 and/or EODl expression or self-crossed to produce inbred lines.
- the expression or activity of a DAI, DA2 and/or EODl polypeptide in populations of progeny plants may be determined and one or more progeny plants with reduced expression or activity of DAI, DA2 and/or EODl identified.
- EODl may be determined at the protein level.
- a method may comprise:
- immunological techniques such as Western blotting, may be employed, using antibodies which bind to the DAI, DA2 or EODl polypeptide and show little or no binding to other antigens in the plant.
- the amount of an DAI, DA2 and/or EODl may be employed, using antibodies which bind to the DAI, DA2 or EODl polypeptide and show little or no binding to other antigens in the plant.
- the amount of an DAI, DA2 and/or EODl may be employed, using antibodies which bind to the DAI, DA2 or EODl polypeptide and show little or no binding to other antigens in the plant.
- the amount of an DAI, DA2 and/or EODl may be employed, using antibodies which bind to the DAI, DA2 or EODl polypeptide and show little or no binding to other antigens in the plant.
- the amount of an DAI, DA2 and/or EODl may be employed, using antibodies which bind to the DAI, DA
- polypeptide in a plant cell may be determined by contacting a sample comprising the plant cell with an antibody or other specific binding member directed against the DAI, DA2 or EODl polypeptide, and determining binding of the DAI, DA2 or EODl polypeptide to the sample.
- the amount of binding of the specific binding member is indicative of the amount of DAI, DA2 or EODl polypeptide which is expressed in the cell.
- the amount of DAI, DA2 and/or EODl polypeptide may be determined in one or more cells of the plant, preferably cells from an above- ground portion or tissue of the plant, such as the vasculature and primary and secondary meristems in the shoot.
- the expression of the DAI, DA2 or EODl polypeptide may be determined at the nucleic acid level.
- the amount of nucleic acid encoding a DAI , DA2 or EODl polypeptide may be determined.
- a method of producing a plant having increased yield related traits may comprise:
- nucleic acid for example mRNA, encoding the DAI, DA2 or EOD1 polypeptide in a cell of one or more plants of said population, and,
- the level or amount of encoding nucleic acid in a plant cell may be determined for example by detecting the amount of transcribed encoding nucleic acid in the cell. This may be performed using standard techniques such as Northern blotting or RT-PCR.
- Another method of producing a plant having increased growth and/or biomass may comprise:
- sequence variations for example, polymorphisms, mutations or regions of
- DAI, DA2 and/or EOD1 polypeptides and encoding nucleic acid are described in more detail above.
- the presence of one or more sequence variations in a nucleic acid may be determined by detecting the presence of the variant nucleic acid sequence in one or more plant cells or by detecting the presence of the variant polypeptide which is encoded by the nucleic acid sequence.
- Preferred nucleic acid sequence variation detection techniques include ARMSTM-allele specific amplification, OLA, ALEXTM, COPS, Taqman, Molecular Beacons, RFLP, and restriction site based PCR and FRET techniques.
- Preferred polypeptide sequence variation techniques include
- nucleic acid or an amplified region thereof may be sequenced to identify or determine the presence of polymorphism or mutation therein.
- a polymorphism or mutation may be identified by comparing the sequence obtained with the known sequence of DAI, DA2 or EODl, for example as set out in sequence databases.
- Sequencing may be performed using any one of a range of standard techniques. Sequencing of an amplified product may, for example, involve precipitation with isopropanol, resuspension and sequencing using a TaqFS+ Dye terminator sequencing kit (e.g. from GE
- Extension products may be electrophoresed on an ABI 377 DNA sequencer and data analysed using Sequence Navigator software .
- a progeny plant identified as having reduced DAI, DA2 and/or EOD1 expression may be tested for increased or enhanced yield related traits, such as increased seed or organ size, relative to controls.
- the identified progeny plant may be further propagated or crossed, for example with the first or second plant (i.e. backcrossing) or self-crossed to produce inbred lines.
- the identified progeny plant may be tested for seed size, organ size and/or plant yield relative to controls.
- a plant produced as described herein may be deficient in DA2 expression or activity and may be further deficient in DAI
- EODl expression or activity EODl expression or activity or both DAI and EODl expression or activity.
- the expression or activity of DA2 , DAI and EODl may be reduced or abolished in the plant by mutation or one or more nucleotides in the plant coding sequence and/or by the expression of a heterologous nucleic acid encoding a suppressor nucleic acid.
- the activity of DAI may be reduced or abolished in the plant by expression of a heterologous nucleic acid encoding a dominant-negative DAI polypeptide.
- a plant may thus comprise heterologous nucleic acid which encodes a suppressor nucleic acid, such as an siRNA or shRNA, which reduces the expression of one or more of DAI, DA2 and EODl or which encodes a dominant negative DAI polypeptide.
- a plant may comprise i) a mutation which reduces DA2 activity or expression, a heterologous nucleic acid encoding a suppressor nucleic acid which reduces EODl expression and a heterologous nucleic acid encoding a nucleic acid which encodes a dominant-negative DAI polypeptide; ii) a heterologous nucleic acid encoding a suppressor nucleic acid which reduces DA2 expression or expression, a mutation which reduces EODl expression and a heterologous nucleic acid encoding a nucleic acid which encodes a dominant-negative DAI polypeptide iii) heterologous nucleic acids encoding suppressor nucleic acids which reduce EODl and DA2 expression and a heterologous nucleic acid encoding a nucleic acid which encodes a dominant-negative DAI polypeptide, or iv) mutation which
- a plant may comprise i) a mutation which reduces DA2 activity or expression, a heterologous nucleic acid encoding a suppressor nucleic acid which reduces DAI expression ii) a heterologous nucleic acid encoding a suppressor nucleic acid which reduces DA2 expression or expression, a mutation which reduces DAI expression iii) heterologous nucleic acids encoding suppressor nucleic acids which reduce DAI and DA2 expression, iv) mutations which reduce DAI and DA2 activity or expression or v) a mutation which reduces DA2 activity or expression or a heterologous nucleic acid encoding a suppressor nucleic acid which reduces DA2 expression and a heterologous nucleic acid encoding a nucleic acid which encodes a dominant negative DAI polypeptide.
- Heterologous nucleic acids encoding the dominant-negative DAI polypeptide and/or suppressor nucleic acids may be on the same or different expression vectors and may be incorporated into the plant cell by conventional techniques.
- Examples of suitable plants for use in accordance with any aspect of the invention described herein include monocotyledonous and
- dicotelydonous higher plant for example an agricultural or crop plant, such as a plant selected from the group consisting of
- Lithospermum erythrorhizon, Taxus spp tobacco, cucurbits, carrot, vegetable brassica, melons, capsicums, grape vines, lettuce, strawberry, oilseed brassica, sugar beet, wheat, barley, maize, rice, soyabeans, peas, sorghum, sunflower, tomato, potato, pepper, chrysanthemum, carnation, linseed, hemp and rye.
- a plant produced as described above may be sexually or asexually propagated or grown to produce off-spring or descendants.
- Off ⁇ spring or descendants of the plant regenerated from the one or more cells may be sexually or asexually propagated or grown.
- the plant or its off-spring or descendents may be crossed with other plants or with itself.
- Another aspect of the invention provides a transgenic plant having reduced or abolished expression or activity of DA2 polypeptide within one or more cells thereof, wherein the plant is deficient in the expression or activity of DAI, EODl or both DAI and E0D1.
- the plant may comprise an exogenous nucleic acid which reduces or abolishes the expression or activity of one or more of DA2, DAI and EOD1.
- the transgenic plant may express a dominant negative DAI polypeptide that reduces the activity of DAI.
- the plant may have reduced or abolished expression of DAI, DA2 and EOD1 or may have reduced or abolished expression of DA2 and EOD1 and may express a dominant negative DAI .
- the invention encompasses any clone of such a plant, seed, selfed or hybrid progeny and descendants, and any part or propagule of any of these, such as cuttings and seed, which may be used in reproduction or propagation, sexual or asexual.
- Also encompassed by the invention is a plant which is a sexually or asexually propagated off-spring, clone or descendant of such a plant, or any part or propagule of said plant, off-spring, clone or descendant.
- a suitable plant may be produced by a method described above.
- the plant may have increased yield relative to control wild-type plants (i.e. identical plants in which the expression or activity of DA2 and optionally DAI and/or EODl has not been reduced) .
- control wild-type plants i.e. identical plants in which the expression or activity of DA2 and optionally DAI and/or EODl has not been reduced
- the mass of seeds (e.g. grain) or other plant product per unit area may be increased relative to control plants.
- yield-related traits in the plant may be improved.
- Yield-related traits may include life-span, organ size and seed size.
- a yield related trait may be improved, increased or enhanced in the plant relative to control plants in which expression of the nucleic acid encoding the DA2 polypeptide is not abolished or reduced (i.e. identical plants in which the expression of DA2 and optionally DAI and/or EODl has not been reduced or abolished) .
- a plant according to the present invention may be one which does not breed true in one or more properties. Plant varieties may be excluded, particularly registrable plant varieties according to Plant Breeders Rights. DAI is shown herein to physically interact with DA2 in vivo.
- a method of identifying a compound that increase plant yield may comprise ;
- the DAI and DA2 polypeptides may be isolated or may be expressed recombinant or endogenously in a plant cell.
- a compound that reduces or abolises DA1/DA2 binding may be useful in the treatment of plants to increase yield.
- "and/or" where used herein is to be taken as specific disclosure of each of the two specified features or components with or without the other. For example “A and/or B” is to be taken as specific
- Arabidopsis ecotype Columbia (Col-0) was the wild type line used. All mutants were in the Col-0 background. da2 l (SALK_150003) was obtained from Arabidopsis Stock Centre NASC and ABRC collections. The T-DNA insertion was confirmed by PCR and sequencing. Seeds were surface-sterilized with 100% isopropanol for lmin and 10% (v/v) household bleach for lOmin, washed at least three times with sterile water, stratified at 4°C for 3d in the dark, dispersed on GM medium with 0.9%agar and 1% glucose, and then grown at 22°C. Plants were grown under long-day condition (16h light/8h dark) at 22°C.
- the pDA2 : DA2 construct was made by using a PCR-basedGateway system.
- the 1960bp promoter sequence of DA2 was amplified using the primers DA2proGW-F and DA2proGW-R.
- PCR products were then cloned to the pCR8/GW/TOPO TA cloning vector (Invitrogen) .
- the DA2 CDS was amplified and the PCR products were then cloned to the Ascl and Kpnl sites of the Gateway vector pMDCHO to get the DA2CDS-pMDC110 plasmid.
- the DA2 promoter was then subcloned to the DA2CDS-pMDC110 by LR reaction to generate the pDA2 : DA2 construct.
- the plasmid pDA2 : DA2 was introduced into the da2-l mutant plants using
- Agrobacterium tumefaciens GV3101 and trans formants were selected on hygromycin (30 ⁇ g/ml) containing medium.
- the 35S : DA2 construct was made using a PCR-based Gateway system. PCR products were subcloned into the pCR8/GW/TOPO TA cloning vector (invitrogen) using TOPO enzyme. The DA2 gene was then subcloned into Gateway Binary Vector pMDC32 containing the 35S promoter (Curtis and Grossniklaus , 2003) . The plasmid 35S:DA2 was introduced into Col-0 plants using Agrobacterium tumefaciens GV3101 and transformants were selected on hygromycin (30 ⁇ / ⁇ 1) -containing medium.
- the 1960 bp promoter sequence of DA2 was amplified and the PCR products were cloned to the pGEM-T vector (Promaga) using T4 DNA ligase and sequenced.
- the DA2 promoter was then inserted into the Sacl and Ncol sites of the binary vector pGreen-GUS (Curtis and Grossniklaus, 2003) to generate the transformation plasmid pDA2 : GUS .
- the plasmid pDA2 : GUS was introduced into Col-0 plants using Agrobacterium tumefaciens GV3101 and trans formants were selected on kanamycin (50pg/ml) -containing medium.
- the 35S.-GW2 construct was made using a PCR-based Gateway system. PCR products were subcloned into the pCR8/GW/TOPO TA cloning vector (invitrogen) using TOPO enzyme. The GW2 gene was then subcloned into Gateway Binary Vector pMDC32 containing the 35S promoter (Curtis and Grossniklaus , 2003) . The plasmid 35S:GW2 was introduced into Col-0 plants using
- Agrobacterium tumefaciens GV3101 and trans formants were selected on hygromycin ( 30 g/ml ) -containing medium.
- Average seed weight was determined by weighing mature dry seeds in batches of 500 using an electronic analytical balance (METTLER MOLEDO AL104 CHINA) . The weights of five sample batches were measured for each seed lot. Seeds were photographed under a Leica microscope (LEICA S8APO) using a Leica CCD (DFC420) and seed size were measured by using Image J software. Area measurements of petals (stage 14), leaves, and cotyledons were made by scanning organs to produce a digital image, and then calculating area, length and width by using Image J software. Leaf, petal and embryo cell sizes were measured from DIC images. Biomass accumulation in flowers (stage 14) was measured by weighing organs.
- RNA isolation, RT-PCR, and Quantitative real-time RT-PCR analysis were stained in a solution of 1 mM X-gluc, 100 mM Na3P04 buffer, 3mM each K3Fe (CN) 6/K4Fe (CN) 6, lOmM EDTA, and 0.1% Nodidet-P40, and incubated at room temperature for 6 hours. After GUS staining chlorophyll was removed using 70% ethanol. 1.5 RNA isolation, RT-PCR, and Quantitative real-time RT-PCR analysis
- DA2C59S and DA2N91L were generated by following the
- Bacterial lysates expressing MBP-DA2 and mutated MBP-DA2 were prepared from E. coll BL21 induced with 0.4 mM IPTG for 2 hours. Bacteria were lysed in TGH lysis buffer (50 mM HEPES [pH 7.5], 150 mM NaCl, 1.5 mM MgC12, 1 mM EGTA, 1% Triton X-100, 10% glycerol, and protease inhibitor cocktail [Roche]) and sonicated. The lysates were cleared by centrifugation and incubated with amylose resin (New England Biolabs) at 4°Cfor 30 min.
- TGH lysis buffer 50 mM HEPES [pH 7.5], 150 mM NaCl, 1.5 mM MgC12, 1 mM EGTA, 1% Triton X-100, 10% glycerol, and protease inhibitor cocktail [Roche]
- DA2-MBP fusion protein was incubated in a 20 ⁇ 1 reaction buffer for 2 hours at 30°C.
- the coding sequences of DAI, dal-1, and DAI derivatives containing specific protein domains were cloned into BamH I and Not I sites of the pGEX-4T ⁇ l vector to generated GST-DAI, GST-DA1R358K, GST-DAI - UIM, and GST-DAI -LIM+C constructs, and EcoRI and Xhol sites of the pGEX-4T-l vector to generate GST-DAl-LIM and GST-DAl-C constructs.
- bacterial lysates containing approximately 15 ]ig of MBP-DA2 fusion proteins were combined with lysates containing approximately 30 ug of GST-DAl, GST-DA1R358K, GST-DA1-UIM, GST-DAl-LIM, GST-DAl-LIM+C or GST-DAl-C fusion
- transformation plasmid 35S : :Myc-DAl and 35S : :Myc-DAl-C were subcloned into the pCR8/GW/TOPO TA cloning vector (invitrogen) using TOPO enzyme.
- the DA2 gene was then subcloned into Gateway Binary Vector pMDC43 containing the 35S promoter and the GFP gene (Curtis and Grossniklaus , 2003) .
- PCR products were subcloned into the pCR8/GW/TOPO TA cloning vector (invitrogen) using TOPO enzyme.
- the PEX10 gene were then subcloned into Gateway Binary Vector pH7FWG2 containing the 35S promoter and the GFP gene.
- Nicotiana benthamiana leaves were transformed by injection of
- Incomplete protease inhibitor cocktail (Roche) and MG132 20ug/ml) and incubated with GFP-Trap-A (Chromotek) for 1 hour at 4°C. Beads were washed 3 times with wash buffer (50 mM Tris/HCl, pH 7.5, 150 mM NaCl, 0.1% Triton X-100, and 1 ⁇ complete protease inhibitor cocktail (Roche) ) . The immunoprecipitates were separated in 10% SDS- polyacryamide gel and detected by western blot analysis with anti- GFP (Beyotime) and anti-Myc (Abmart) antibodies, respectively.
- Arabidopsis Genome Initiative locus identifiers for Arabidopsis genes mentioned herein are as follows: Atlgl9270 (NP_173361.1 GI :
- Atlg78420 (NP_001185425.1 GI : 334183988 ) (DA2) , Atlgl7145
- T-DNA insertion lines of some predicted ubiquitin ligase genes that were expressed in Arabidopsis ovules and/or seeds in several microarray studies and investigated their seed growth phenotypes. From this screen, we identified several T-DNA insertion mutants with altered seed size. We designated one of these mutants da-2-1, referring to the order of discovery for large seed size mutants (DA means "large" in
- the da2-l mutant showed a weak but similar seed size phenotype to dal-1 (Li et al . , 2008), providing indication that DAI and DA2 could function in a common pathway.
- dal-1 da2-l double mutant To test for a genetic interaction between DAI and DA2, we generated a dal-1 da2-l double mutant and determined its seed size. Although the da2-l mutant had slightly larger and heavier seeds than wild type ( Figures 1A, 3C and 3D) , the da2 ⁇ l mutation synergistically enhanced the seed size and weight phenotypes of dal-1 ( Figures 3A and 3C) , revealing a synergistic genetic interaction between DAI and DA2 in seed size.
- the mutant protein encoded by the dal-1 allele has a negative activity toward DAI and a DAl-related protein (DAR1) , the most closely-related family member (Li et al., 2008) .
- Double dal-kol darl-1 T-DNA insertion mutants exhibited the dal-1 phenotypes, while dal-kol and darl-1 single mutants did not show an obvious seed size phenotype (Li et al., 2008).
- dal-1 and da2-l act synergistically to increase seed size, one would expect that the dal-kol might synergistically enhance the phenotypes of da2-l.
- the seed size and weight phenotypes of da2-l were also synergistically enhanced by the dal-kol mutation.
- endosperm genotypes for DAl and DA2 do not affect seed size, and DAl and DA2 are required in sporophytic tissue of the mother plant to control seed growth.
- DA2 acts synergistically with DAl to affect cell proliferation in the maternal integuments
- the da2-l ovules were also larger than wild-type ovules ( Figures 5, and 7) .
- the da2-l mutation synergistically enhanced the ovule size phenotype of dal-1, consistent with their synergistic interactions in seed size.
- the da2-l mutation synergistically enhanced the outer integument cell number of dal-1.
- DA2 acts synergistically with DAI to restrict cell proliferation in the maternal integuments.
- the da2-l mutation was identified with T-DNA insertion in the seventh exon of the gene Atlg78420 ( Figure 8A) .
- the T-DNA insertion site was further confirmed by PCR using T-DNA specific and flanking primers and sequencing PCR products.
- Atlg78420 could not be detected by semi-quantitative RT-PCR in da2-l mutant.
- Figure 10 To further characterize DA2 function, in particular gain of function phenotypes, we expressed the coding region of DA2 under the control of the CaMV 35S promoter in wild-type plants and isolated 77 transgenic plants. Overexpression of DA2 caused decreases in seed size, seed yield per plant and seed number per plant ( Figures 1A, 1C and ID) .
- the DA2 gene is predicted to encode a 402 -amino-acid protein containing one predicted RING domain (59-101) ( Figure 8B; Table 1) .
- DA2 has E3 ubiquitin ligase activity
- E3 ubiquitin ligase activity we expressed DA2 in Escherichia coli as a fusion protein with maltose binding protein (MBP) and purified MBP-DA2 protein from the soluble fraction.
- MBP maltose binding protein
- RING-H2 Three RING types, RING-H2, RING-HCa and RING-HCb, and five modified RING types, RING-C2 , RING-v, RING-D, RING-S/T and RING-G have been described in Arabidopsis (Stone et al., 2005) .
- the spacing of the cysteines in the predicted RING domain of DA2 was similar to that in the RING domain (C5HC2) of rice GW2
- the RING domain of DA2 lacked a conserved histidine residue that was replaced by an asparagine residue (Asn-91) (Tables 1 and
- DA2 N91L overexpressed DA2 N91L ⁇ 35S: DA2N91L) in wild-type plants and isolated 26 transgenic plants.
- the seeds of transgenic plants were smaller than wild-type seeds, suggesting that the DA2 N91L could restrict seed growth.
- DA2L DA2-like protein
- DA2L-overexpressing lines exhibited small plants and organs ( Figure 18), providing indication that DA2 and DA2L have similar functions.
- the similar proteins in other plant species show a 39.2%-84.5% amino acid sequence identity with DA2 (Table 2) .
- the homolog in Brassica napus had the highest amino acid sequence identity with DA2 (84.5%) (Table 2) .
- Rice GW2 had 43.1% amino acid sequence identities with Arabidopsis DA2 (Table 2) .
- overexpression of GW2 reduced grain width in rice (Song et al., 2007), we asked whether DA2 and GW2 performs similar function in seed size control. We therefore overexpressed GW2 in wild-type plants.
- the Arabidopsis transgenic plants overexpressing GW2 produced smaller seeds and organs than wild-type plants, indicating conserved function for Arabidopsis DA2 and rice GW2 in seed and organ growth control.
- RNAs from roots, stems, leaves, seedlings and inflorescences were analyzed by quantitative real-time RT-PCR analysis.
- DA2 mRNA was detected in all plant organs tested ( Figure 11A) .
- the tissue-specific expression patterns of DA2 were investigated using histochemical assay of GUS activity of transgenic plants containing a DA2 promoter : GUS fusion (pDA2:GUS) .
- GUS activity was detected in roots, cotyledons, leaves and
- DAI acts synergistically with DA2 to restrict seed and organ growth.
- DAI was expressed as a GST fusion protein, while DA2 was expressed as a BP fusion protein.
- Figure 12 first and second lanes from left
- GST-DAl bound to BP-DA2
- GST-DAl did not bind to a negative control (MBP) . This result indicates that DAI physically interacts with DA2 in vitro.
- DAI contains two ubiquitin interaction motifs (UIM) , a single LIM domain and the highly conserved C-terminal region ( Figure 13) (Li et al., 2008) .
- UIM ubiquitin interaction motifs
- Figure 13 the highly conserved C-terminal region
- DAI derivatives containing specific protein domains were expressed in Escherichia coli: DAI -UIM containing only the two UIM domains, DAI-LIM with only the LIM domain, DAl-LIM+C containing only the LIM domain and the C- terminal region, and DA1-C with only the C-terminal region, were expressed as GST fusion proteins ( Figure 13) .
- DA2 was expressed as an MBP fusion protein and used in pull-down experiments. As shown in Figure 12, GST-DA1-LIM+C and GST-DA1-C interacted with MBP-DA2, but the GST-DA1-UIM and GST-DA1-LIM did not bind to MB -DA2. This result indicates that the conserved C-terminal region of DAI interacts with DA2.
- Seed size in higher plants is a key determinant of evolutionary fitness, and is also an important agronomic trait in crop
- the da2-l loss-of-function mutant formed large seeds and organs, whereas plants overexpressing DA2 produced small seeds and organs ( Figure 1A) , indicating that DA2 is a negative factor of seed and organ size control.
- Arabidopsis DA2 has been recently proposed as a positive regulator of organ growth, although nothing is known about how DA2 controls seed and organ growth (Van Daele et al., 2012) . In this study, we have sufficient evidence to prove that DA2 acts as a negative factor of seed and organ growth control.
- the da2-l loss-of-function mutant formed large seeds and organs ( Figures 1 to 4) .
- the da2-l mutation synergistically enhanced the seed and organ size phenotypes of dal-1 and dal-kol ( Figures 1 to 4) .
- the da2-l mutation also enhanced the seed and organ size phenotypes of eodl-2, further indicating that the da2-l mutation promotes seed and organ growth.
- the da2-l mutant formed large ovules with more cells in the integuments, and the da2-l mutation synergistically enhanced the ovule size phenotype of dal-1 ( Figure 6) .
- most transgenic plants overexpressing DA2 and DA2L were smaller than wild-type plants ( Figure 2; Figure S9) .
- DA2 acts maternally to influence seed growth, and the embryo and endosperm genotypes for DA2 do not affect seed size ( Figures 6) .
- the integuments surrounding the ovule are maternal tissues and form the seed coat after
- plant maternal factors of seed size control e.g. KLU, ARF2 and DAI
- integument size e.g. KLU, ARF2 and DAI
- the size of the integument or seed coat is determined by cell proliferation and cell expansion, two processes that are
- DA2 encodes a protein with one predicted RING domain that is distinctive from any of the previously described plant RING domains.
- the RING domain of DA2 shared highest homology with that of rice GW2 (C5HC2), but it lacked one conserved metal ligand amino acid (a histidine residue) that was replaced by an asparagine residue (Song et al., 2007). It is still possible that the RING domain of DA2 might be a variant of that found in G 2.
- Many RING-type domains are found in E3 ubiquitin ligases that ubiquitinate substrates, often targeting them for subsequent proteasomal degradation (Smalle and Vierstra, 2004) .
- DA2 is a functional E3 ubiquitin ligase, suggesting that DA2 may target positive regulators of cell proliferation for ubiquitin-dependent degradation by the 26S proteasome.
- Proteins that share homology with DA2 outside the RING domain are found in Arabidopsis and other plant species. In Arabidopsis, the DA2-like protein (DA2L) shares
- DA2L- overexpressing lines showed small plants ( Figure 18), indicating that DA2 and DA2L may perform similar functions.
- the homolog of DA2 in rice is the RING-type (C5HC2) protein GW2 (Song et al . , 2007), which has been known to act as a negative regulator of seed size.
- C5HC2 RING-type protein GW2
- DAI a ubiquitin receptor with ubiquitin- binding activity, as a negative regulator of seed size (Li et al., 2008) .
- a modifier screen identified an enhancer of dal-1 (E0D1) (Li et al., 2008), which is allelic to the E3 ubiquitin ligase BB (Disch et al . , 2006) .
- E0D1 enhancer of dal-1
- EOD1 EOD1
- DAl may be involved in mediating the degradation of the ubiquitinated substrates of DA2 by the
- proteasome One mechanism may involve DAl interaction with DA2, which helps DAl specifically recognize the ubiquitinated
- DAl may subsequently bind polyubiquitin chains of the ubiquitinated substrate (s) through its UIM domain and mediate the degradation of the ubiquitinated substrate (s) . Improving seed yield is an important target for crop breeders worldwide, and the size of seeds is an important component of overall seed yields. We identified DA2 as an important regulator of seed size that functions synergistically with DAl to influence seed size.
- DAl also acts synergistically with EODl to affect seed growth.
- Zmdal-1 a dominant negative dal-1 mutation
- Vv_ _GI- ⁇ 147817790 pro VKTKEEKGMEQIEEQRVIEAKIRMRQKEIQDEEERMQKRQEISSSSSILAQG-EVEYSTT 171
- Vv_ _GI- -147817790 pro IWLSIQ-DNGRHR PLYGDTTT AEQYVTEEHYVLP AMAP-QVESSSSPSGG 272
- Vv_ _GI- ⁇ 147817790 pro ALPDGGLAVTKDDGEWGVDRGSEVAEAGTSYASSDATDEAGGVAA LPPTDEAEG 383
- Vv_GI -147817790 pro SFQ VGGPIVPESFEEQMMLAMAVSLAEARARTS TQGVWQ 423
- RING domain and first and second consensus domains are boxed.
- At_GI-22326876 pro FSNCYRPSSQVIAEFVEKGLVASLARAKQEELIKAPBVIICIPMDTRQRSSFRLQAGRNA 900
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Genetics & Genomics (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Wood Science & Technology (AREA)
- Zoology (AREA)
- General Engineering & Computer Science (AREA)
- Molecular Biology (AREA)
- General Health & Medical Sciences (AREA)
- Biochemistry (AREA)
- Biomedical Technology (AREA)
- Biotechnology (AREA)
- Microbiology (AREA)
- Biophysics (AREA)
- Medicinal Chemistry (AREA)
- Cell Biology (AREA)
- Plant Pathology (AREA)
- Physics & Mathematics (AREA)
- Botany (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Gastroenterology & Hepatology (AREA)
- Breeding Of Plants And Reproduction By Means Of Culturing (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Enzymes And Modification Thereof (AREA)
- Agricultural Chemicals And Associated Chemicals (AREA)
Abstract
Description
Claims
Priority Applications (18)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| PL14749749T PL3033354T3 (en) | 2013-08-14 | 2014-07-30 | Methods of modulating seed and organ size in plants |
| US14/912,045 US10329577B2 (en) | 2013-08-14 | 2014-07-30 | Methods of modulating seed and organ size in plants |
| HRP20182197TT HRP20182197T1 (en) | 2013-08-14 | 2014-07-30 | SEED AND BODY SIZE MODULATION PROCEDURES IN PLANTS |
| EP25206107.2A EP4667564A2 (en) | 2013-08-14 | 2014-07-30 | Methods of modulating seed and organ size in plants |
| EP18193786.3A EP3470420B1 (en) | 2013-08-14 | 2014-07-30 | Methods of modulating seed and organ size in plants |
| AU2014308078A AU2014308078B2 (en) | 2013-08-14 | 2014-07-30 | Methods of modulating seed and organ size in plants |
| MX2016001829A MX361453B (en) | 2013-08-14 | 2014-07-30 | Methods of modulating seed and organ size in plants. |
| UAA201600896A UA119645C2 (en) | 2013-08-14 | 2014-07-30 | Methods of modulating seed and organ size in plants |
| BR112016003152A BR112016003152A2 (en) | 2013-08-14 | 2014-07-30 | methods to modulate organ and seed size in plants |
| EP14749749.9A EP3033354B1 (en) | 2013-08-14 | 2014-07-30 | Methods of modulating seed and organ size in plants |
| CN201480045197.9A CN105612171B (en) | 2013-08-14 | 2014-07-30 | Methods of regulating seed and organ size in plants |
| ES14749749T ES2706499T3 (en) | 2013-08-14 | 2014-07-30 | Methods of modulation of the size of the seed and the organs of plants |
| DK14749749.9T DK3033354T3 (en) | 2013-08-14 | 2014-07-30 | Methods for modulating seed and organ size in plants |
| EA201690144A EA033454B1 (en) | 2013-08-14 | 2014-07-30 | METHODS FOR MODULATING THE SIZE OF SEEDS AND ORGANS IN PLANTS |
| CA2919576A CA2919576A1 (en) | 2013-08-14 | 2014-07-30 | Methods of modulating seed and organ size in plants |
| ZA2016/00915A ZA201600915B (en) | 2013-08-14 | 2016-02-10 | Methods of modulating seed and organ size in plants |
| US16/387,196 US11519001B2 (en) | 2013-08-14 | 2019-04-17 | Methods of modulating seed and organ size in plants |
| US18/050,624 US20230203519A1 (en) | 2013-08-14 | 2022-10-28 | Methods of modulating seed and organ size in plants |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN2013081457 | 2013-08-14 | ||
| CNPCT/CN2013/081457 | 2013-08-14 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US14/912,045 A-371-Of-International US10329577B2 (en) | 2013-08-14 | 2014-07-30 | Methods of modulating seed and organ size in plants |
| US16/387,196 Division US11519001B2 (en) | 2013-08-14 | 2019-04-17 | Methods of modulating seed and organ size in plants |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2015022192A1 true WO2015022192A1 (en) | 2015-02-19 |
Family
ID=51300713
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2014/066427 Ceased WO2015022192A1 (en) | 2013-08-14 | 2014-07-30 | Methods of modulating seed and organ size in plants |
Country Status (15)
| Country | Link |
|---|---|
| US (3) | US10329577B2 (en) |
| EP (3) | EP4667564A2 (en) |
| AU (1) | AU2014308078B2 (en) |
| BR (1) | BR112016003152A2 (en) |
| CA (1) | CA2919576A1 (en) |
| DK (1) | DK3033354T3 (en) |
| EA (1) | EA033454B1 (en) |
| ES (2) | ES2706499T3 (en) |
| HR (1) | HRP20182197T1 (en) |
| HU (1) | HUE042903T2 (en) |
| MX (1) | MX361453B (en) |
| PL (1) | PL3033354T3 (en) |
| TR (1) | TR201820859T4 (en) |
| UA (1) | UA119645C2 (en) |
| WO (1) | WO2015022192A1 (en) |
Cited By (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2017178368A1 (en) | 2016-04-13 | 2017-10-19 | Bayer Cropscience Nv | Seed-specific and embryo-preferential promoters and uses thereof |
| WO2017178367A1 (en) | 2016-04-13 | 2017-10-19 | Bayer Cropscience Nv | Seed- and funiculus-preferential promoters and uses thereof |
| WO2017178322A1 (en) | 2016-04-11 | 2017-10-19 | Bayer Cropscience Nv | Seed-specific and endosperm-preferential promoters and uses thereof |
| WO2017178318A1 (en) | 2016-04-11 | 2017-10-19 | Bayer Cropscience Nv | Seed-specific and endosperm-preferential promoters and uses thereof |
| AU2014345338B2 (en) * | 2013-11-11 | 2019-03-07 | Plant Bioscience Limited | Methods of modulating seed and organ size in plants |
| WO2023034731A1 (en) * | 2021-08-30 | 2023-03-09 | Pairwise Plants Services, Inc. | Modification of ubiquitin binding peptidase genes in plants for yield trait improvement |
| WO2023052561A1 (en) * | 2021-10-01 | 2023-04-06 | Basf Se | Plants with improved properties |
Families Citing this family (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| AU2014308078B2 (en) * | 2013-08-14 | 2018-04-05 | Institute Of Genetics And Developmental Biology | Methods of modulating seed and organ size in plants |
| CN116535476B (en) * | 2023-04-17 | 2025-01-28 | 西南大学 | Tumorous stem mustard BjuDA1R356K gene and its encoded protein and application |
| WO2025014824A1 (en) * | 2023-07-07 | 2025-01-16 | Regents Of The University Of Minnesota | Methods and compositions for altering seed characteristics in oilseed plants |
| WO2025178902A1 (en) * | 2024-02-22 | 2025-08-28 | Pairwise Plants Services, Inc. | Methods and compositions for improving yield characteristics in plants |
| CN119776385B (en) * | 2024-12-30 | 2025-11-11 | 河南农业大学 | Wheat E3 ubiquitin ligase gene RFEL1 and application thereof in wheat disease resistance |
Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2009047525A1 (en) * | 2007-10-11 | 2009-04-16 | Plant Bioscience Limited | Methods of controlling plant seed and organ size |
| WO2010042575A1 (en) * | 2008-10-08 | 2010-04-15 | Monsanto Technology Llc | Transgenic plants with enhanced agronomic traits |
Family Cites Families (20)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| NL8200523A (en) | 1982-02-11 | 1983-09-01 | Univ Leiden | METHOD FOR TRANSFORMING IN VITRO PLANT PROTOPLASTS WITH PLASMIDE DNA. |
| CA1280081C (en) | 1984-09-24 | 1991-02-12 | Calgene, Inc. | Plant cell microinjection technique |
| US5100792A (en) | 1984-11-13 | 1992-03-31 | Cornell Research Foundation, Inc. | Method for transporting substances into living cells and tissues |
| AU7360087A (en) | 1986-04-30 | 1987-11-24 | Boyce Thompson Institute For Plant Research Inc. | Electric field mediated dna transformation of plant cells and organelles |
| CA1328236C (en) | 1987-05-05 | 1994-04-05 | Novartis Ag | Plant tissue transformation |
| US5922602A (en) | 1988-02-26 | 1999-07-13 | Biosource Technologies, Inc. | Cytoplasmic inhibition of gene expression |
| EP0331083A3 (en) | 1988-03-02 | 1990-11-28 | Schweizerische Eidgenossenschaft Eidgenössische Technische Hochschule (Eth) | Method for the production of transgenic plants |
| US5231020A (en) | 1989-03-30 | 1993-07-27 | Dna Plant Technology Corporation | Genetic engineering of novel plant phenotypes |
| US5108921A (en) | 1989-04-03 | 1992-04-28 | Purdue Research Foundation | Method for enhanced transmembrane transport of exogenous molecules |
| ATE130371T1 (en) | 1989-12-19 | 1995-12-15 | Ciba Geigy Ag | METHOD AND DEVICE FOR THE GENETIC TRANSFORMATION OF CELLS. |
| DE4005152A1 (en) | 1990-02-17 | 1991-08-22 | Guenter Prof Dr Kahl | Transforming plant protoplast(s) with DNA-histone complex - providing high and reproducible transfer rate, and expression of foreign genes |
| CA2036935A1 (en) | 1990-02-26 | 1991-08-27 | Paul Christou | Plant transformation process with early identification of germ line transformation events |
| US5932782A (en) | 1990-11-14 | 1999-08-03 | Pioneer Hi-Bred International, Inc. | Plant transformation method using agrobacterium species adhered to microprojectiles |
| NZ239977A (en) | 1990-11-14 | 1993-08-26 | Pioneer Hi Bred Int | Transforming plants by the use of agrobacterium |
| ATE318318T1 (en) | 1990-11-23 | 2006-03-15 | Bayer Bioscience Nv | METHOD FOR TRANSFORMING MONOCOTYL PLANTS |
| WO1992014828A1 (en) | 1991-02-14 | 1992-09-03 | Svalöf Ab | Method for genetic transformation of tissue organs from monocotyledonous plants |
| AU4539593A (en) | 1992-06-23 | 1994-01-24 | South Dakota State University | Transformation of plants by direct injection of dna |
| US6846970B1 (en) | 1999-07-19 | 2005-01-25 | Plant Bioscience Limited | Transformation method and transgenic plants produced thereby |
| ATE321139T1 (en) * | 2001-07-26 | 2006-04-15 | Ecopia Biosciences Inc | GENES AND PROTEINS FOR ROSARAMICIN BIOSYNTHESIS |
| AU2014308078B2 (en) * | 2013-08-14 | 2018-04-05 | Institute Of Genetics And Developmental Biology | Methods of modulating seed and organ size in plants |
-
2014
- 2014-07-30 AU AU2014308078A patent/AU2014308078B2/en active Active
- 2014-07-30 UA UAA201600896A patent/UA119645C2/en unknown
- 2014-07-30 MX MX2016001829A patent/MX361453B/en active IP Right Grant
- 2014-07-30 HR HRP20182197TT patent/HRP20182197T1/en unknown
- 2014-07-30 DK DK14749749.9T patent/DK3033354T3/en active
- 2014-07-30 EP EP25206107.2A patent/EP4667564A2/en active Pending
- 2014-07-30 ES ES14749749T patent/ES2706499T3/en active Active
- 2014-07-30 TR TR2018/20859T patent/TR201820859T4/en unknown
- 2014-07-30 WO PCT/EP2014/066427 patent/WO2015022192A1/en not_active Ceased
- 2014-07-30 ES ES18193786T patent/ES3050666T3/en active Active
- 2014-07-30 EA EA201690144A patent/EA033454B1/en not_active IP Right Cessation
- 2014-07-30 CA CA2919576A patent/CA2919576A1/en active Pending
- 2014-07-30 EP EP18193786.3A patent/EP3470420B1/en active Active
- 2014-07-30 BR BR112016003152A patent/BR112016003152A2/en not_active Application Discontinuation
- 2014-07-30 EP EP14749749.9A patent/EP3033354B1/en active Active
- 2014-07-30 HU HUE14749749A patent/HUE042903T2/en unknown
- 2014-07-30 PL PL14749749T patent/PL3033354T3/en unknown
- 2014-07-30 US US14/912,045 patent/US10329577B2/en active Active
-
2019
- 2019-04-17 US US16/387,196 patent/US11519001B2/en active Active
-
2022
- 2022-10-28 US US18/050,624 patent/US20230203519A1/en active Pending
Patent Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2009047525A1 (en) * | 2007-10-11 | 2009-04-16 | Plant Bioscience Limited | Methods of controlling plant seed and organ size |
| WO2010042575A1 (en) * | 2008-10-08 | 2010-04-15 | Monsanto Technology Llc | Transgenic plants with enhanced agronomic traits |
Non-Patent Citations (6)
| Title |
|---|
| D. GUERRA ET AL: "Identification of a Protein Network Interacting with TdRF1, a Wheat RING Ubiquitin Ligase with a Protective Role against Cellular Dehydration", PLANT PHYSIOLOGY, vol. 158, no. 2, 1 February 2012 (2012-02-01), pages 777 - 789, XP055076400, ISSN: 0032-0889, DOI: 10.1104/pp.111.183988 * |
| DISCH S ET AL: "The E3 Ubiquitin Ligase BIG BROTHER Controls Arabidopsis Organ Size in a Dosage-Dependent Manner", CURRENT BIOLOGY, CURRENT SCIENCE, GB, vol. 16, no. 3, 7 February 2006 (2006-02-07), pages 272 - 279, XP027967450, ISSN: 0960-9822, [retrieved on 20060207] * |
| KRIZEK ET AL: "Making bigger plants: key regulators of final organ size", CURRENT OPINION IN PLANT BIOLOGY, QUADRANT SUBSCRIPTION SERVICES, GB, vol. 12, no. 1, 1 February 2009 (2009-02-01), pages 17 - 22, XP025770802, ISSN: 1369-5266, [retrieved on 20081023], DOI: 10.1016/J.PBI.2008.09.006 * |
| L. DU ET AL: "The Ubiquitin Receptor DA1 Regulates Seed and Organ Size by Modulating the Stability of the Ubiquitin-Specific Protease UBP15/SOD2 in Arabidopsis", THE PLANT CELL ONLINE, vol. 26, no. 2, 1 February 2014 (2014-02-01), pages 665 - 677, XP055146585, ISSN: 1040-4651, DOI: 10.1105/tpc.114.122663 * |
| LI YUNHAI ET AL: "Control of final seed and organ size by the DA1 gene family in Arabidopsis thaliana", GENES AND DEVELOPMENT, COLD SPRING HARBOR LABORATORY PRESS, PLAINVIEW, NY, US, vol. 22, no. 10, 1 May 2008 (2008-05-01), pages 1331 - 1336, XP002512707, ISSN: 0890-9369, DOI: 10.1101/GAD.463608 * |
| T. XIA ET AL: "The Ubiquitin Receptor DA1 Interacts with the E3 Ubiquitin Ligase DA2 to Regulate Seed and Organ Size in Arabidopsis", THE PLANT CELL ONLINE, vol. 25, no. 9, 1 September 2013 (2013-09-01), pages 3347 - 3359, XP055146588, ISSN: 1040-4651, DOI: 10.1105/tpc.113.115063 * |
Cited By (13)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| AU2014345338B2 (en) * | 2013-11-11 | 2019-03-07 | Plant Bioscience Limited | Methods of modulating seed and organ size in plants |
| EP4269600A3 (en) * | 2013-11-11 | 2024-01-24 | Plant Bioscience Limited | Methods of modulating seed and organ size in plants |
| EP3068794B1 (en) * | 2013-11-11 | 2023-09-13 | Plant Bioscience Limited | Methods of modulating seed and organ size in plants |
| WO2017178318A1 (en) | 2016-04-11 | 2017-10-19 | Bayer Cropscience Nv | Seed-specific and endosperm-preferential promoters and uses thereof |
| US10975380B2 (en) | 2016-04-11 | 2021-04-13 | Basf Agricultural Solutions Seed, Us Llc | Seed-specific and endosperm-preferental promoters and uses thereof |
| WO2017178322A1 (en) | 2016-04-11 | 2017-10-19 | Bayer Cropscience Nv | Seed-specific and endosperm-preferential promoters and uses thereof |
| WO2017178368A1 (en) | 2016-04-13 | 2017-10-19 | Bayer Cropscience Nv | Seed-specific and embryo-preferential promoters and uses thereof |
| US10900046B2 (en) | 2016-04-13 | 2021-01-26 | BASF Agricultural Solutions Seed US LLC | Seed- and funiculus-preferential promoters and uses thereof |
| WO2017178367A1 (en) | 2016-04-13 | 2017-10-19 | Bayer Cropscience Nv | Seed- and funiculus-preferential promoters and uses thereof |
| WO2023034731A1 (en) * | 2021-08-30 | 2023-03-09 | Pairwise Plants Services, Inc. | Modification of ubiquitin binding peptidase genes in plants for yield trait improvement |
| CN118265446A (en) * | 2021-08-30 | 2024-06-28 | 成对植物服务股份有限公司 | Modifying ubiquitin-binding peptidase genes in plants to improve yield traits |
| US12359215B2 (en) | 2021-08-30 | 2025-07-15 | Pairwise Plants Services, Inc. | Modification of ubiquitin binding peptidase genes in plants for yield trait improvement |
| WO2023052561A1 (en) * | 2021-10-01 | 2023-04-06 | Basf Se | Plants with improved properties |
Also Published As
| Publication number | Publication date |
|---|---|
| PL3033354T3 (en) | 2019-05-31 |
| US20230203519A1 (en) | 2023-06-29 |
| EP3033354B1 (en) | 2018-10-24 |
| MX2016001829A (en) | 2016-08-03 |
| EA201690144A1 (en) | 2016-07-29 |
| US10329577B2 (en) | 2019-06-25 |
| AU2014308078A1 (en) | 2016-03-03 |
| EP3470420B1 (en) | 2025-10-22 |
| CA2919576A1 (en) | 2015-02-19 |
| MX361453B (en) | 2018-12-06 |
| HRP20182197T1 (en) | 2019-02-22 |
| BR112016003152A2 (en) | 2017-11-21 |
| AU2014308078B2 (en) | 2018-04-05 |
| ES3050666T3 (en) | 2025-12-22 |
| EP3470420A1 (en) | 2019-04-17 |
| EP3033354A1 (en) | 2016-06-22 |
| UA119645C2 (en) | 2019-07-25 |
| US11519001B2 (en) | 2022-12-06 |
| EP4667564A2 (en) | 2025-12-24 |
| US20160194651A1 (en) | 2016-07-07 |
| HUE042903T2 (en) | 2019-07-29 |
| EA033454B1 (en) | 2019-10-31 |
| US20190300897A1 (en) | 2019-10-03 |
| ES2706499T3 (en) | 2019-03-29 |
| TR201820859T4 (en) | 2019-01-21 |
| DK3033354T3 (en) | 2019-01-14 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20230203519A1 (en) | Methods of modulating seed and organ size in plants | |
| Yang et al. | A mutation in Thermosensitive Male Sterile 1, encoding a heat shock protein with DnaJ and PDI domains, leads to thermosensitive gametophytic male sterility in Arabidopsis | |
| CN105612171B (en) | Methods of regulating seed and organ size in plants | |
| US9624502B2 (en) | Methods of controlling plant seed and organ size | |
| US20200385750A1 (en) | Methods of controlling seed size in plants | |
| Li et al. | Overexpression of TCP transcription factor OsPCF7 improves agronomic trait in rice | |
| JP5592652B2 (en) | Putative cytokinin receptor and method of use thereof | |
| CN101679968A (en) | Polypeptide capable of improving tolerance to iron deficiency in plant, and use thereof | |
| CN111154786A (en) | Gene for regulating and controlling plant seed germination and seedling growth, and coding protein and application thereof | |
| WO2021035558A1 (en) | Flowering time genes and methods of use | |
| Huang et al. | Molecular Identification and Functional Analysis of Brbri1 as Brassinosteroid Receptor Gene in Brassica rapa | |
| CN107231808B (en) | Novel gene for increasing biomass of plant and use thereof | |
| Wang et al. | Plant Physiology Preview. Published on September 23, 2015, as DOI: 10.1104/pp. 15.00858 | |
| Kim JaeYoon | Identification and functional analysis of S-AdenosylMethionine Synthetase (HvSAMS) genes in early maturing barley (Hordeum vulgare subsp. vulgare). |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 14749749 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2919576 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 201690144 Country of ref document: EA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2016/001829 Country of ref document: MX |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 14912045 Country of ref document: US |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 122021015420 Country of ref document: BR |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112016003152 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 2014308078 Country of ref document: AU Date of ref document: 20140730 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2014749749 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: A201600896 Country of ref document: UA |
|
| ENP | Entry into the national phase |
Ref document number: 112016003152 Country of ref document: BR Kind code of ref document: A2 Effective date: 20160215 |
