WO2015006747A2 - Compositions comprising synthetic polynucleotides encoding crispr related proteins and synthetic sgrnas and methods of use. - Google Patents

Compositions comprising synthetic polynucleotides encoding crispr related proteins and synthetic sgrnas and methods of use. Download PDF

Info

Publication number
WO2015006747A2
WO2015006747A2 PCT/US2014/046434 US2014046434W WO2015006747A2 WO 2015006747 A2 WO2015006747 A2 WO 2015006747A2 US 2014046434 W US2014046434 W US 2014046434W WO 2015006747 A2 WO2015006747 A2 WO 2015006747A2
Authority
WO
WIPO (PCT)
Prior art keywords
synthetic polynucleotide
sgrna
synthetic
polynucleotide
region
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2014/046434
Other languages
French (fr)
Other versions
WO2015006747A3 (en
Inventor
Stephen G. HOGE
Eric Yi-Chun Huang
Tirtha Chakraborty
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Moderna Inc
Original Assignee
Moderna Therapeutics Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Family has litigation
First worldwide family litigation filed litigation Critical https://patents.darts-ip.com/?family=52280736&utm_source=google_patent&utm_medium=platform_link&utm_campaign=public_patent_search&patent=WO2015006747(A2) "Global patent litigation dataset” by Darts-ip is licensed under a Creative Commons Attribution 4.0 International License.
Priority to ES14823392T priority Critical patent/ES2896755T3/en
Priority to DK14823392.7T priority patent/DK3019619T3/en
Priority to SI201431887T priority patent/SI3019619T1/en
Priority to HRP20211563TT priority patent/HRP20211563T1/en
Priority to AU2014287009A priority patent/AU2014287009B2/en
Priority to LTEPPCT/US2014/046434T priority patent/LT3019619T/en
Priority to PL14823392T priority patent/PL3019619T3/en
Priority to SM20210691T priority patent/SMT202100691T1/en
Priority to EP21192530.0A priority patent/EP3971287A1/en
Priority to CA2917348A priority patent/CA2917348A1/en
Priority to JP2016525829A priority patent/JP7019233B2/en
Priority to US14/903,869 priority patent/US11027025B2/en
Application filed by Moderna Therapeutics Inc filed Critical Moderna Therapeutics Inc
Priority to RS20211363A priority patent/RS62529B1/en
Priority to EP14823392.7A priority patent/EP3019619B1/en
Publication of WO2015006747A2 publication Critical patent/WO2015006747A2/en
Publication of WO2015006747A3 publication Critical patent/WO2015006747A3/en
Anticipated expiration legal-status Critical
Priority to AU2021200486A priority patent/AU2021200486B2/en
Priority to US17/329,368 priority patent/US20220111079A1/en
Priority to CY20211100957T priority patent/CY1124740T1/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/16Hydrolases (3) acting on ester bonds (3.1)
    • C12N9/22Ribonucleases [RNase]; Deoxyribonucleases [DNase]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • A61K48/005Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'active' part of the composition delivered, i.e. the nucleic acid delivered
    • A61K48/0066Manipulation of the nucleic acid to modify its expression pattern, e.g. enhance its duration of expression, achieved by the presence of particular introns in the delivered nucleic acid
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/111General methods applicable to biologically active non-coding nucleic acids
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/87Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation
    • C12N15/90Stable introduction of foreign DNA into chromosome
    • C12N15/902Stable introduction of foreign DNA into chromosome using homologous recombination
    • C12N15/907Stable introduction of foreign DNA into chromosome using homologous recombination in mammalian cells
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/16Hydrolases (3) acting on ester bonds (3.1)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00Structure or type of the nucleic acid
    • C12N2310/10Type of nucleic acid
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00Structure or type of the nucleic acid
    • C12N2310/10Type of nucleic acid
    • C12N2310/14Type of nucleic acid interfering nucleic acids [NA]
    • C12N2310/141MicroRNAs, miRNAs
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00Structure or type of the nucleic acid
    • C12N2310/10Type of nucleic acid
    • C12N2310/20Type of nucleic acid involving clustered regularly interspaced short palindromic repeats [CRISPR]
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00Structure or type of the nucleic acid
    • C12N2310/30Chemical structure
    • C12N2310/31Chemical structure of the backbone
    • C12N2310/315Phosphorothioates
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00Structure or type of the nucleic acid
    • C12N2310/30Chemical structure
    • C12N2310/34Spatial arrangement of the modifications
    • C12N2310/346Spatial arrangement of the modifications having a combination of backbone and sugar modifications

Definitions

  • compositions comprising synthetic polynucleotides encoding CRISPR related proteins and synthetic sgRNAs and methods of use.
  • the present invention is directed to compositions comprising and methods of using synthetic polynucleotides and short guide RNAs (sgRNAs).
  • the synthetic polynucleotides are, e.g., synthetic modified RNA encoding CRISPR related proteins, e.g., dCAS9 and dCAS9-effector domain fusion proteins.
  • the synthetic sgRNAs target a gene of interest.
  • the synthetic polynucleotides and synthetic sgRNAs can be used to modulate transcription, e.g., in therapeutics and/or clinical and research settings.
  • CRISPR Clustered Regularly Interspaced Short Palindromic Repeats
  • crRNAs CRISPR RNAs
  • CAS CRISPR-associated proteins
  • the pre-crRNAs are processed by trans-activating crRNA (tracrRNA) complementary to the repeat sequences in pre-crRNA which triggers processing by the double-stranded (ds) RNA-specific ribonuclease RNase III in the presence of the CAS9 protein.
  • CAS9 (formerly CSN1) is the key protein in the type II CRISPR systems and is thought to be the sole protein responsible for crRNA-guided silencing of foreign DNA (Jinek et al. Science. 2012. 337:816-821; herein incorporated by reference in its entirety).
  • the CAS9 protein is also hypothesized to be involved in both crRNA maturation and crRNA-guided DNA interference (Jinek et al. Science. 2012. 337:816-821; herein incorporated by reference in its entirety).
  • the CAS9 endonuclease family can be programmed with single RNA molecules to cleave specific DNA sites which may be used to develop a versatile RNA- directed system to generate dsDNA breaks for genome targeting and editing (Jinek et al. Science. 2012. 337:816-821; herein incorporated by reference in its entirety). This use of CAS9 could enhance the ease of genome engineering.
  • dCas9 protein fusion of CRISPR-associated catalytically inactive dCas9 protein to distinct effector domains (e.g. VP64, p65AD, KRAB, and Mxil) enables repression or activation of transcription in human and yeast cells, with the site of delivery determined solely by a co-expressed short guide RNA (sgRNA).
  • sgRNA short guide RNA
  • Coupling of dCas9 to a transcriptional repressor domain can silence expression of multiple endogenous genes, with no detectable off-targets as verified by RNA-seq analysis.
  • a catalytically inactive Cas9 protein is the mutant (D10A, H840A) Streptococcus pyogenes Cas9 protein , typically referred to as dCAS9 (Qi et al. Cell. 2013. 152: 1 173-1 183; Gilbert et al. Cell. 2013. 154: 1-10).
  • dCAS9 Streptococcus thermophiles Cas9 with 2 endonuclease domains and single amino acid substitution (D31A, H858A) has been described which also resulted in catalytically inactive Cas9 (Sapranauskas et al . Nucleic Acids Research. 201 1. 39:9275-9282).
  • FIG. 1 is a schematic of a synthetic polynucleotide of the present invention.
  • FIG. 2 shows the results of an anti-FLAG Western and Immunoprecipitation performed on the lysates of HeLa cells transfected with FLAG-tagged Cas9 constructs or controls.
  • FIG. 3 shows the results of a western analysis of HeLa cells that were transfected with HA-tagged Gilbert Cas9 mRNA using Trilink-HA-tagged Cas9 mRNA as a positive control.
  • FIG. 4 shows the results of a LC-PRM Cas9 peptide quantification in cell lysates of HeLa cells transfected with Maeder and Gilbert Cas9 constructs versus untreated HeLa cells. Each chart shows the quantification of a peptide fragment of the Cas9 construct.
  • Figure 4A represents quantification of GNELALPSK peptide (SEQ ID NO: 120).
  • Figure 4B represents quantification of the YFDTTIDR peptide (SEQ ID NO:
  • Figure 4C represents quantification of the IPYYVGPLAR peptide (SEQ ID NO:
  • FIG. 5 shows the results of an anti-FLAG Western and Immunoprecipitation performed on the lysates of mouse livers from animals dosed with Mug Cas9 LNP (MC3) or mock.
  • WCE whole cell extract.
  • IP immunoprecipitation with M2-agarose beads (Sigma).
  • Ladder See Blue Plus 2TM prestained protein marker (LifeTech).
  • the present invention is based, at least in part, on the surprising discovery that mRNAs can be expressed in the cytoplasm and translocated to the nucleus.
  • the mRNA technology of the invention is surprisingly suited for delivery of intracellular proteins.
  • the mRNA technology of the invention is also desirable suited for delivery of multiple mRNAs.
  • the methodologies of the invention avoid or circumvent problems associated with conventional gene therapy approaches, such as toxicity, integration of DNA into host genome, and the like.
  • the methodologies of the invention are particularly suited to the delivery of a plurality of mRNAs, without inducing an innate immune and without undesirable side effects associated with conventional gene therapy approaches.
  • the mRNA delivery technology of the invention facilitates the expression both the mRNA encoding CRISPR-related proteins, e.g., Cas9, dCas9 and variants thereof, in combination with one or more guide RNAs (sgRNAs) to enable gene regulation in vitro and in vivo.
  • sgRNAs guide RNAs
  • the technology provides for therapeutic applications of the CRISPR technologies that were previously unattainable
  • CRISPR-related proteins including proteins engineered to include regulatory sequence facilitating regulation of protein expression, and the corresponding mRNA targeting sequences (i.e., sgRNAs).
  • sgRNAs mRNA targeting sequences
  • compositions including pharmaceutical compositions
  • compositions including pharmaceutical compositions and methods for the design, preparation, manufacture and/or formulation of synthetic polynucleotides encoding one or more one or more CRISPR related proteins, e.g., dCAS9 and/or dCAS9-effector fusion proteins.
  • CRISPR related proteins e.g., dCAS9 and/or dCAS9-effector fusion proteins
  • sgRNAs small guide RNAs
  • Both the synthetic polynucleotides and sgRNAs are typically manufactures using in vitro transcription.
  • the synthetic polynucleotides and sgRNAs are typically manufactures using in vitro transcription.
  • the synthetic polynucleotides and sgRNAs are typically manufactures using in vitro transcription.
  • polynucleotide and sgRNA are modified, e.g., comprise at least one modified nucleotide.
  • method of modulation of expression of a gene of interest using a synthetic polynucleotide encoding a CRISPR related protein and an sgRNA targeting the gene of interest include in vitro and in vivo methods, e.g., methods of treatment of a disease state correlated with expression of the gene of interest.
  • CRISPR/Inhibition/Activation (CRISPR/I/A) systems described to date is their dependence on delivery of DNA by viral vectors to drive intracellular transcription (of the sgRNA) and transcription and translation of Cas9, dCas9 or dCas9-fusion proteins such as dCas9-VP64, and dCas9-KRAB.
  • Cas9, dCas9 or dCas9-fusion proteins such as dCas9-VP64, and dCas9-KRAB.
  • Modified synthetic polynucleotide presents an ideal platform for the clinical translation of this prokaryotic platform. Technologies are disclosed herein to safely delivery modified mRNA in vivo that encodes for CRISPR related protein, e.g., dCA9, in a time limited and - potentially cell-type - targeted fashion. Moreover, the use of modified mRNA will avoid the risk of significant innate immune activation, and diminish the risk of adaptive responses.
  • the present invention provides synthetic polynucleotides which encode one or more CRISPR related proteins, e.g., dCAS9 and dCAS9 fusion proteins.
  • CRISPR related proteins e.g., dCAS9 and dCAS9 fusion proteins.
  • polynucleotide in its broadest sense, includes any compound and/or substance that comprise a polymer of nucleotides.
  • Exemplary polynucleotides of the invention include, but are not limited to, ribonucleic acids (RNAs), deoxyribonucleic acids (DNAs), threose nucleic acids (TNAs), glycol nucleic acids (GNAs), peptide nucleic acids (PNAs), locked nucleic acids (LNAs, including LNA having a ⁇ - D-ribo configuration, a-LNA having an a-L-ribo configuration (a diastereomer of LNA), 2'-amino-LNA having a 2'-amino functionalization, and 2'-amino- a-LNA having a 2'-amino functionalization) or hybrids thereof.
  • RNAs ribonucleic acids
  • DNAs deoxyribonucleic acids
  • TAAs threose nucleic acids
  • GNAs glycol nucleic acids
  • PNAs peptide nucleic acids
  • LNAs locked nucleic
  • the synthetic polynucleotide is a synthetic messenger RNA (mRNA).
  • mRNA messenger RNA
  • polynucleotide which may be synthetic, which encodes a polypeptide, e.g., a CRISPR related protein, and which is capable of being translated to produce the encoded polypeptide in vitro, in vivo, in situ or ex vivo.
  • the mRNA encodes a CRISPR related protein, e.g., dCAS9 and dCA9-effector (activator or inhibitor) fusion proteins. Additional description of and sequences for CRISPR related proteins are below.
  • the present invention expands the scope of functionality of traditional mRNA molecules by providing synthetic polynucleotides which comprise one or more structural and/or chemical modifications or alterations which impart useful properties to the polynucleotides including, in some embodiments, the lack of a substantial induction of the innate immune response of a cell into which the polynucleotide is introduced.
  • a "structural" feature or modification is one in which two or more linked nucleotides are inserted, deleted, duplicated, inverted or randomized in a synthetic polynucleotide, primary construct or mmRNA without significant chemical modification to the nucleotides themselves.
  • the polynucleotide "ATCG” (SEQ ID NO: 123) may be chemically modified to "AT-5meC-G” (SEQ ID NO: 124).
  • the same polynucleotide may be structurally modified from "ATCG” (SEQ ID NO: 123) to "ATCCCG” (SEQ ID NO: 125).
  • the dinucleotide "CC” has been inserted, resulting in a structural modification to the polynucleotide.
  • the synthetic polynucleotides of the invention encode a CRISPR related protein.
  • CRISPR related protein includes but is not limited to CAS9, CSY4, dCAS9, and dCAS9-effector domain (activator and/or inhibitor domain) fusion proteins. Examples of CRISPR related protein polypeptide sequences and polynucleotide sequences are found in the Tables below.
  • the CRISPR related protein can be from any number of species including but not limited to Streptococcus pyogenes, Listeria innocua, and Streptococcus thermophilus.
  • the synthetic polynucleotide can encode the wild-type sequence of the CRISPR related protein or a variant CRISPR related protein. Variants are described in further details herein. As described in more detail herein, the synthetic polynucleotide can include either the wild-type codon usage or codon usage optimized for a particular application, e.g., human codon optimization for human therapeutics.
  • the synthetic polynucleotides comprise at least a first region of linked nucleosides encoding at least one CRISPR related proteins.
  • Example of CRISPR related proteins are listed in the Tables below. For any particular CRISPR related protein there may exist one or more variants or isoforms. It will be appreciated by those of skill in the art that disclosed in the Tables are potential flanking regions. These are encoded in each transcript either to the 5' (upstream) or 3'
  • flanking regions are definitively and specifically disclosed by teaching the protein sequence. Consequently, the sequences taught flanking that encoding the protein are considered flanking regions. It is also possible to further characterize the 5' and 3' flanking regions by utilizing one or more available databases or algorithms. Databases have annotated the features contained in the flanking regions of the transcripts and these are available in the art.
  • the CRISPR related protein is dCAS9. Typical sequences are included in the Tables below.
  • the CRISPR related protein is a dCAS9-effector domain fusion protein.
  • the effector domain can be an activation domain or an inhibition domain, depending on the application. Examples of effector domains are well known to one of skill in the art and include, e.g., KRAB, CSD, WRPW, VP64, or p65AD.
  • the CRISPR related protein is dCAS9-KRAB or dCAS9-VP64 fusion proteins. Examples of sequences are provided in the Tables below and the Sequence Listing.
  • SEQ ID NOs: 1-9 include those set forth as SEQ ID NOs: 1-9. These include the nucleotide sequence encoding Cas9, serotype Ml (SEQ ID NO: l); nucleotide sequence encoding FLAG-tagged (i.e., trimer- FLAG) CAS9 having a nuclear localization sequence (NLS) (SEQ ID NO:2); nucleotide sequence encoding HA -tagged Cas9 having a NLS (Cas9-HAtag/2xNLS) conjugated to GFP (SEQ ID NO:3); nucleotide sequence encoding Cas9 C-terminal fragment having a NLS (SEQ ID NO:4); nucleotide sequence encoding Cas9 N-terminal fragment (SEQ ID NO:5); nucleotide sequence encoding FLAG-tagged Cas9 having NLSs (FLAG-NLS- Cas9-NLS) (SEQ ID NO:6); as well as Cas
  • modified synthetic polynucleotides or of the present invention are distinguished from wild type mRNA in their functional and/or structural design features which serve to, as evidenced herein, overcome existing problems of effective polypeptide production using nucleic acid-based therapeutics.
  • Figure 1 shows a representative polynucleotide primary construct 100 of the present invention.
  • primary construct or “primary mRNA construct” refers to a polynucleotide transcript which encodes one or more polypeptides of interest and which retains sufficient structural and/or chemical features to allow the polypeptide of interest encoded therein to be translated.
  • Primary constructs may be polynucleotides of the invention. When structurally or chemically modified, the primary construct may be referred to as an modified synthetic polynucleotides or mmR A.
  • the primary construct 100 here contains a first region of linked nucleotides 102 that is flanked by a first flanking region 104 and a second flanking region 106.
  • the "first region” may be referred to as a "coding region” or “region encoding” or simply the “first region.”
  • This first region may include, but is not limited to, the encoded polypeptide of interest, i.e., the CRISPR related protein.
  • the polypeptide of interest may comprise at its 5' terminus one or more signal sequences encoded by a signal sequence region 103.
  • the first flanking region 104 may comprise a region of linked nucleotides comprising one or more complete or incomplete 5' UTRs sequences.
  • the first flanking region 104 may also comprise a 5' terminal capping region 108.
  • the second flanking region 106 may comprise a region of linked nucleotides comprising one or more complete or incomplete 3' UTRs.
  • the second flanking region 106 may also comprise a 3' tailing sequence 110.
  • first operational region 105 Bridging the 5' terminus of the first region 102 and the first flanking region 104 is a first operational region 105.
  • this first operational region comprises a Start codon.
  • the operational region may alternatively comprise any translation initiation sequence or signal including a Start codon.
  • this second operational region comprises a Stop codon.
  • the second operational region may alternatively comprise any translation initiation sequence or signal including a Stop codon. According to the present invention, multiple serial stop codons may also be used.
  • the synthetic polynucleotide, primary construct, or mmRNA includes from about 30 to about 100,000 nucleotides (e.g., from 30 to 50, from 30 to 100, from 30 to 250, from 30 to 500, from 30 to 1,000, from 30 to 1,500, from 30 to 3,000, from 30 to 5,000, from 30 to 7,000, from 30 to 10,000, from 30 to 25,000, from 30 to 50,000, from 30 to 70,000, from 100 to 250, from 100 to 500, from 100 to 1,000, from 100 to 1,500, from 100 to 3,000, from 100 to 5,000, from 100 to 7,000, from 100 to 10,000, from 100 to 25,000, from 100 to 50,000, from 100 to 70,000, from 100 to 100,000, from 500 to 1,000, from 500 to 1,500, from 500 to 2,000, from 500 to 3,000, from 500 to 5,000, from 500 to 7,000, from 500 to 10,000, from 500 to 25,000, from 500 to 50,000, from 500 to 70,000, from 500 to 100,000, from 1,000 to 1,500, from 1,000 to 1,500, from 500 to 2,000
  • the length of the first region encoding the polypeptide of interest, e.g., CRISPR related protein of the present invention is greater than about 30 nucleotides in length (e.g., at least or greater than about 35, 40, 45, 50, 55, 60, 70, 80, 90, 100, 120, 140, 160, 180, 200, 250, 300, 350, 400, 450, 500, 600, 700, 800, 900, 1,000, 1, 100, 1,200, 1,300, 1,400, 1,500, 1,600, 1,700, 1,800, 1,900, 2,000, 2,500, and 3,000, 4,000, 5,000, 6,000, 7,000, 8,000, 9,000, 10,000, 20,000, 30,000, 40,000, 50,000, 60,000, 70,000, 80,000, 90,000 or up to and including 100,000 nucleotides).
  • the first and second flanking regions may range independently from 15-1,000 nucleotides in length (e.g., greater than 30, 40, 45, 50, 55, 60, 70, 80, 90, 100, 120, 140, 160, 180, 200, 250, 300, 350, 400, 450, 500, 600, 700, 800, and 900 nucleotides or at least 30, 40, 45, 50, 55, 60, 70, 80, 90, 100, 120, 140, 160, 180, 200, 250, 300, 350, 400, 450, 500, 600, 700, 800, 900, and 1,000 nucleotides).
  • 15-1,000 nucleotides in length e.g., greater than 30, 40, 45, 50, 55, 60, 70, 80, 90, 100, 120, 140, 160, 180, 200, 250, 300, 350, 400, 450, 500, 600, 700, 800, 900, and 1,000 nucleotides.
  • the 3' tailing sequence may range from absent to 500 nucleotides in length (e.g., at least 60, 70, 80, 90, 120, 140, 160, 180, 200, 250, 300, 350, 400, 450, or 500 nucleotides).
  • the tailing sequence is a polyA tail
  • the length may be determined in units of or as a function of polyA Binding Protein binding.
  • the polyA tail is long enough to bind at least 4 monomers of PolyA Binding Protein.
  • PolyA Binding Protein monomers bind to stretches of approximately 38 nucleotides. As such, it has been observed that polyA tails of about 80 nucleotides and 160 nucleotides are functional.
  • the 5' terminal capping region may comprise a single cap or a series of nucleotides forming the cap.
  • the capping region may be from 1 to 10, e.g. 2-9, 3-8, 4-7, 1-5, 5-10, or at least 2, or 10 or fewer nucleotides in length.
  • the capping region is absent.
  • the first and second operational regions may range from 3 to 40, e.g., 5-30, 10-20, 15, or at least 4, or 30 or fewer nucleotides in length and may comprise, in addition to a Start and/or Stop codon, one or more signal and/or restriction sequences.
  • a synthetic polynucleotide may be cyclized, or concatemerized, to generate a translation competent molecule to assist interactions between poly-A binding proteins and 5'-end binding proteins.
  • the mechanism of cyclization or concatemerization may occur through at least 3 different routes: 1) chemical, 2) enzymatic, and 3) ribozyme catalyzed.
  • the newly formed 5 '-/3 '-linkage may be intramolecular or intermolecular.
  • the 5 '-end and the 3 '-end of the nucleic acid contain chemically reactive groups that, when close together, form a new covalent linkage between the 5 '-end and the 3 '-end of the molecule.
  • the 5 '-end may contain an NHS-ester reactive group and the 3 '-end may contain a 3 '-amino-terminated nucleotide such that in an organic solvent the 3 '-amino-terminated nucleotide on the 3 '-end of a synthetic mRNA molecule will undergo a nucleophilic attack on the 5'-NHS-ester moiety forming a new 5 '-/3 '-amide bond.
  • T4 RNA ligase may be used to enzymatically link a 5'- phosphorylated nucleic acid molecule to the 3'-hydroxyl group of a nucleic acid forming a new phosphorodiester linkage.
  • 1 ⁇ g of a nucleic acid molecule is incubated at 37°C for 1 hour with 1-10 units of T4 RNA ligase (New England Biolabs, Ipswich, MA) according to the manufacturer's protocol.
  • the ligation reaction may occur in the presence of a split oligonucleotide capable of base-pairing with both the 5'- and 3'- region in juxtaposition to assist the enzymatic ligation reaction.
  • either the 5 '-or 3 '-end of the cDNA template encodes a ligase ribozyme sequence such that during in vitro transcription, the resultant nucleic acid molecule can contain an active ribozyme sequence capable of ligating the 5'-end of a nucleic acid molecule to the 3 '-end of a nucleic acid molecule.
  • the ligase ribozyme may be derived from the Group I Intron, Group I Intron, Hepatitis Delta Virus, Hairpin ribozyme or may be selected by SELEX (systematic evolution of ligands by exponential enrichment).
  • the ribozyme ligase reaction may take 1 to 24 hours at temperatures between 0 and 37°C.
  • multiple distinct synthetic polynucleotides may be linked together through the 3 '-end using nucleotides which are modified at the 3 '- terminus.
  • Chemical conjugation may be used to control the stoichiometry of delivery into cells.
  • the glyoxylate cycle enzymes isocitrate lyase and malate synthase, may be supplied into HepG2 cells at a 1 : 1 ratio to alter cellular fatty acid metabolism.
  • This ratio may be controlled by chemically linking polynucleotides, primary constructs or mmRNA using a 3 '-azido terminated nucleotide on one polynucleotide, primary construct or mmRNA species and a C5-ethynyl or alkynyl-containing nucleotide on the opposite polynucleotide, primary construct or mmRNA species.
  • the modified nucleotide is added post-transcriptionally using terminal transferase (New England Biolabs, Ipswich, MA) according to the manufacturer's protocol.
  • the two polynucleotide, primary construct or mmRNA species may be combined in an aqueous solution, in the presence or absence of copper, to form a new covalent linkage via a click chemistry mechanism as described in the literature.
  • more than two polynucleotides may be linked together using a functionalized linker molecule.
  • a functionalized saccharide molecule may be chemically modified to contain multiple chemical reactive groups (SH-, ⁇ 2 -, N3, etc%) to react with the cognate moiety on a 3 '-functionalized mRNA molecule (i.e., a 3'-maleimide ester, 3 '-NHS-ester, alkynyl).
  • the number of reactive groups on the modified saccharide can be controlled in a stoichiometric fashion to directly control the stoichiometric ratio of conjugated polynucleotide, primary construct or mmRNA.
  • synthetic polynucleotides of the present invention can be designed to be conjugated to other polynucleotides, dyes, intercalating agents (e.g. acridines), cross-linkers (e.g. psoralene, mitomycin C), porphyrins (TPPC4, texaphyrin, Sapphyrin), polycyclic aromatic hydrocarbons (e.g., phenazine, dihydrophenazine), artificial endonucleases (e.g.
  • intercalating agents e.g. acridines
  • cross-linkers e.g. psoralene, mitomycin C
  • porphyrins TPPC4, texaphyrin, Sapphyrin
  • polycyclic aromatic hydrocarbons e.g., phenazine, dihydrophenazine
  • artificial endonucleases e.g.
  • alkylating agents phosphate, amino, mercapto, PEG (e.g., PEG-40K), MPEG, [MPEG] 2 , polyamino, alkyl, substituted alkyl, radiolabeled markers, enzymes, haptens (e.g. biotin),
  • transport/absorption facilitators e.g., aspirin, vitamin E, folic acid
  • synthetic ribonucleases proteins, e.g., glycoproteins, or peptides, e.g., molecules having a specific affinity for a co-ligand, or antibodies e.g., an antibody, that binds to a specified cell type such as a cancer cell, endothelial cell, or bone cell, hormones and hormone receptors, non-peptidic species, such as lipids, lectins, carbohydrates, vitamins, cofactors, or a drug.
  • a specified cell type such as a cancer cell, endothelial cell, or bone cell
  • hormones and hormone receptors non-peptidic species, such as lipids, lectins, carbohydrates, vitamins, cofactors, or a drug.
  • Conjugation may result in increased stability and/or half life and may be particularly useful in targeting the polynucleotides, primary constructs or mmRNA to specific sites in the cell, tissue or organism.
  • the mmRNA or primary constructs may be administered with, or further encode one or more of RNAi agents, siRNAs, shRNAs, miRNAs, miRNA binding sites, antisense RNAs, ribozymes, catalytic DNA, tRNA, RNAs that induce triple helix formation, aptamers or vectors, and the like.
  • RNAi agents siRNAs, shRNAs, miRNAs, miRNA binding sites, antisense RNAs, ribozymes, catalytic DNA, tRNA, RNAs that induce triple helix formation, aptamers or vectors, and the like.
  • bifunctional polynucleotides e.g., bifunctional primary constructs or bifunctional mmRNA.
  • bifunctional polynucleotides are those having or capable of at least two functions. These molecules may also by convention be referred to as multi-functional.
  • bifunctional polynucleotides may be encoded by the RNA (the function may not manifest until the encoded product is translated) or may be a property of the polynucleotide itself. It may be structural or chemical. Bifunctional modified polynucleotides may comprise a function that is covalently or electrostatically associated with the polynucleotides. Further, the two functions may be provided in the context of a complex of a mmRNA and another molecule.
  • Bifunctional polynucleotides may encode peptides which are anti-proliferative. These peptides may be linear, cyclic, constrained or random coil. They may function as aptamers, signaling molecules, ligands or mimics or mimetics thereof. Anti-proliferative peptides may, as translated, be from 3 to 50 amino acids in length. They may be 5-40, 10- 30, or approximately 15 amino acids long. They may be single chain, multichain or branched and may form complexes, aggregates or any multi-unit structure once translated.
  • polynucleotides and primary constructs having sequences that are partially or substantially not translatable e.g., having a noncoding region.
  • Such noncoding region may be the "first flanking region" of the primary construct.
  • the noncoding region may be a region other than the first region.
  • Such molecules are generally not translated, but can exert an effect on protein production by one or more of binding to and sequestering one or more translational machinery components such as a ribosomal protein or a transfer RNA (tRNA), thereby effectively reducing protein expression in the cell or modulating one or more pathways or cascades in a cell which in turn alters protein levels.
  • tRNA transfer RNA
  • the polynucleotide or primary construct may contain or encode one or more long noncoding RNA (IncRNA, or lincRNA) or portion thereof, a small nucleolar RNA (sno-RNA), micro RNA (miRNA), small interfering RNA (siRNA) or Piwi-interacting RNA (piRNA).
  • RNA long noncoding RNA
  • miRNA micro RNA
  • siRNA small interfering RNA
  • piRNA Piwi-interacting RNA
  • the synthetic polynucleotide is designed to encode one or more polypeptides of interest or fragments thereof.
  • the polypeptides of interest include CRISPR related proteins, e.g., CAS9, dCAS9, and dCAS9-effector domain (activator and /or inhibitor domain) fusion proteins.
  • CRISPR related proteins are described in more detail herein.
  • a polypeptide of interest may include, but is not limited to, whole
  • polypeptides a plurality of polypeptides or fragments of polypeptides, which
  • polypeptides of interest refers to any polypeptides which are selected to be encoded in the primary construct of the present invention.
  • polypeptide means a polymer of amino acid residues (natural or unnatural) linked together most often by peptide bonds.
  • the term, as used herein, refers to proteins, polypeptides, and peptides of any size, structure, or function. In some instances the polypeptide encoded is smaller than about 50 amino acids and the polypeptide is then termed a peptide.
  • polypeptides include gene products, naturally occurring polypeptides, synthetic polypeptides, homologs, orthologs, paralogs, fragments and other equivalents, variants, and analogs of the foregoing.
  • a polypeptide may be a single molecule or may be a multi- molecular complex such as a dimer, trimer or tetramer. They may also comprise single chain or multichain polypeptides such as antibodies or insulin and may be associated or linked. Most commonly disulfide linkages are found in multichain polypeptides.
  • polypeptide may also apply to amino acid polymers in which one or more amino acid residues are an artificial chemical analogue of a corresponding naturally occurring amino acid.
  • polypeptide variant refers to molecules which differ in their amino acid sequence from a native or reference sequence.
  • the amino acid sequence variants may possess substitutions, deletions, and/or insertions at certain positions within the amino acid sequence, as compared to a native or reference sequence.
  • variants will possess at least about 50% identity (homology) to a native or reference sequence, and preferably, they will be at least about 80%, more preferably at least about 90% identical (homologous) to a native or reference sequence.
  • variant mimics are provided.
  • the term “variant mimic” is one which contains one or more amino acids which would mimic an activated sequence.
  • glutamate may serve as a mimic for phosphoro- threonine and/or phosphoro-serine.
  • variant mimics may result in deactivation or in an inactivated product containing the mimic, e.g., phenylalanine may act as an inactivating substitution for tyrosine; or alanine may act as an inactivating substitution for serine.
  • homology as it applies to amino acid sequences is defined as the percentage of residues in the candidate amino acid sequence that are identical with the residues in the amino acid sequence of a second sequence after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent homology. Methods and computer programs for the alignment are well known in the art. It is understood that homology depends on a calculation of percent identity but may differ in value due to gaps and penalties introduced in the calculation.
  • homologs as it applies to polypeptide sequences means the corresponding sequence of other species having substantial identity to a second sequence of a second species.
  • Analogs is meant to include polypeptide variants which differ by one or more amino acid alterations, e.g., substitutions, additions or deletions of amino acid residues that still maintain one or more of the properties of the parent or starting polypeptide.
  • compositions which are polypeptide based including variants and derivatives. These include substitutional, insertional, deletion and covalent variants and derivatives.
  • derivative is used synonymously with the term “variant” but generally refers to a molecule that has been modified and/or changed in any way relative to a reference molecule or starting molecule.
  • mmRNA encoding polypeptides containing substitutions, insertions and/or additions, deletions and covalent modifications with respect to reference sequences, in particular the polypeptide sequences disclosed herein, are included within the scope of this invention.
  • sequence tags or amino acids can be added to the peptide sequences of the invention (e.g., at the N- terminal or C-terminal ends). Sequence tags can be used for peptide purification or localization. Lysines can be used to increase peptide solubility or to allow for biotinylation. Alternatively, amino acid residues located at the carboxy and amino terminal regions of the amino acid sequence of a peptide or protein may optionally be deleted providing for truncated sequences. Certain amino acids (e.g., C-terminal or N- terminal residues) may alternatively be deleted depending on the use of the sequence, as for example, expression of the sequence as part of a larger sequence which is soluble, or linked to a solid support.
  • amino acids e.g., C-terminal or N- terminal residues
  • substitutional variants when referring to polypeptides are those that have at least one amino acid residue in a native or starting sequence removed and a different amino acid inserted in its place at the same position.
  • the substitutions may be single, where only one amino acid in the molecule has been substituted, or they may be multiple, where two or more amino acids have been substituted in the same molecule.
  • conservative amino acid substitution refers to the substitution of an amino acid that is normally present in the sequence with a different amino acid of similar size, charge, or polarity.
  • conservative substitutions include the substitution of a non-polar (hydrophobic) residue such as isoleucine, valine and leucine for another non-polar residue.
  • conservative substitutions include the substitution of one polar (hydrophilic) residue for another such as between arginine and lysine, between glutamine and asparagine, and between glycine and serine.
  • substitution of a basic residue such as lysine, arginine or histidine for another, or the substitution of one acidic residue such as aspartic acid or glutamic acid for another acidic residue are additional examples of conservative substitutions.
  • non-conservative substitutions include the substitution of a non-polar (hydrophobic) amino acid residue such as isoleucine, valine, leucine, alanine, methionine for a polar (hydrophilic) residue such as cysteine, glutamine, glutamic acid or lysine and/or a polar residue for a non-polar residue.
  • “Insertional variants” when referring to polypeptides are those with one or more amino acids inserted immediately adjacent to an amino acid at a particular position in a native or starting sequence. "Immediately adjacent" to an amino acid means connected to either the alpha-carboxy or alpha-amino functional group of the amino acid.
  • deletional variants when referring to polypeptides are those with one or more amino acids in the native or starting amino acid sequence removed. Ordinarily, deletional variants will have one or more amino acids deleted in a particular region of the molecule.
  • Covalent derivatives when referring to polypeptides include modifications of a native or starting protein with an organic proteinaceous or non-proteinaceous derivatizing agent, and/or post-translational modifications. Covalent modifications are traditionally introduced by reacting targeted amino acid residues of the protein with an organic derivatizing agent that is capable of reacting with selected side-chains or terminal residues, or by harnessing mechanisms of post-translational modifications that function in selected recombinant host cells. The resultant covalent derivatives are useful in programs directed at identifying residues important for biological activity, for immunoassays, or for the preparation of anti-protein antibodies for immunoaffinity purification of the recombinant glycoprotein. Such modifications are within the ordinary skill in the art and are performed without undue experimentation.
  • polypeptides when referring to polypeptides are defined as distinct amino acid sequence-based components of a molecule.
  • Features of the polypeptides encoded by the mmRNA of the present invention include surface manifestations, local conformational shape, folds, loops, half-loops, domains, half-domains, sites, termini or any combination thereof.
  • surface manifestation refers to a polypeptide based component of a protein appearing on an outermost surface.
  • local conformational shape means a polypeptide based structural manifestation of a protein which is located within a definable space of the protein.
  • fold refers to the resultant conformation of an amino acid sequence upon energy minimization.
  • a fold may occur at the secondary or tertiary level of the folding process.
  • secondary level folds include beta sheets and alpha helices.
  • tertiary folds include domains and regions formed due to aggregation or separation of energetic forces. Regions formed in this way include hydrophobic and hydrophilic pockets, and the like.
  • the term "turn" as it relates to protein conformation means a bend which alters the direction of the backbone of a peptide or polypeptide and may involve one, two, three or more amino acid residues.
  • loop refers to a structural feature of a polypeptide which may serve to reverse the direction of the backbone of a peptide or polypeptide. Where the loop is found in a polypeptide and only alters the direction of the backbone, it may comprise four or more amino acid residues. Oliva et al. have identified at least 5 classes of protein loops (J. Mol Biol 266 (4): 814- 830; 1997). Loops may be open or closed. Closed loops or "cyclic" loops may comprise 2, 3, 4, 5, 6, 7, 8, 9, 10 or more amino acids between the bridging moieties.
  • Such bridging moieties may comprise a cysteine-cysteine bridge (Cys-Cys) typical in polypeptides having disulfide bridges or alternatively bridging moieties may be non-protein based such as the dibromozylyl agents used herein.
  • Cys-Cys cysteine-cysteine bridge
  • bridging moieties may be non-protein based such as the dibromozylyl agents used herein.
  • domain refers to a motif of a polypeptide having one or more identifiable structural or functional characteristics or properties (e.g., binding capacity, serving as a site for protein-protein interactions).
  • sub- domains may be identified within domains or half-domains, these subdomains possessing less than all of the structural or functional properties identified in the domains or half domains from which they were derived. It is also understood that the amino acids that comprise any of the domain types herein need not be contiguous along the backbone of the polypeptide (i.e., nonadjacent amino acids may fold structurally to produce a domain, half-domain or subdomain).
  • site As used herein when referring to polypeptides the terms "site” as it pertains to amino acid based embodiments is used synonymously with "amino acid residue” and "amino acid side chain.”
  • a site represents a position within a peptide or polypeptide that may be modified, manipulated, altered, derivatized or varied within the polypeptide based molecules of the present invention.
  • terminal refers to an extremity of a peptide or polypeptide. Such extremity is not limited only to the first or final site of the peptide or polypeptide but may include additional amino acids in the terminal regions.
  • the polypeptide based molecules of the present invention may be characterized as having both an N-terminus (terminated by an amino acid with a free amino group (NH2)) and a C-terminus (terminated by an amino acid with a free carboxyl group (COOH)).
  • Proteins of the invention are in some cases made up of multiple polypeptide chains brought together by disulfide bonds or by non- covalent forces (multimers, oligomers). These sorts of proteins will have multiple N- and C-termini.
  • the termini of the polypeptides may be modified such that they begin or end, as the case may be, with a non-polypeptide based moiety such as an organic conjugate.
  • any of the features have been identified or defined as a desired component of a polypeptide to be encoded by the primary construct or mmRNA of the invention, any of several manipulations and/or modifications of these features may be performed by moving, swapping, inverting, deleting, randomizing or duplicating.
  • manipulation of features may result in the same outcome as a modification to the molecules of the invention.
  • a manipulation which involved deleting a domain would result in the alteration of the length of a molecule just as modification of a nucleic acid to encode less than a full length molecule would.
  • Modifications and manipulations can be accomplished by methods known in the art such as, but not limited to, site directed mutagenesis.
  • the resulting modified molecules may then be tested for activity using in vitro or in vivo assays such as those described herein or any other suitable screening assay known in the art.
  • the polypeptides may comprise a consensus sequence which is discovered through rounds of experimentation.
  • a "consensus" sequence is a single sequence which represents a collective population of sequences allowing for variability at one or more sites.
  • protein fragments, functional protein domains, and homologous proteins are also considered to be within the scope of polypeptides of interest of this invention.
  • any protein fragment meaning a polypeptide sequence at least one amino acid residue shorter than a reference polypeptide sequence but otherwise identical
  • a reference protein 10 20, 30, 40, 50, 60, 70, 80, 90, 100 or greater than 100 amino acids in length.
  • any protein that includes a stretch of about 20, about 30, about 40, about 50, or about 100 amino acids which are about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, about 95%, or about 100% identical to any of the sequences described herein can be utilized in accordance with the invention.
  • a polypeptide to be utilized in accordance with the invention includes 2, 3, 4, 5, 6, 7, 8, 9, 10, or more mutations as shown in any of the sequences provided or referenced herein.
  • synthetic polypeptides of the invention may encode variant polypeptides, e.g., variant CRISPR related proteins which have a certain identity with a reference polypeptide sequence.
  • a "reference polypeptide sequence” refers to a starting polypeptide sequence. Reference sequences may be wild type sequences or any sequence to which reference is made in the design of another sequence.
  • a "reference polypeptide sequence” may be, e.g., any encoding CAS9, dCAS9, a dCAS9- activator domain fusion protein, a dCAS9-inhibitor domain fusion protein, and/or variants thereof.
  • identity refers to a relationship between the sequences of two or more peptides, as determined by comparing the sequences. In the art, identity also means the degree of sequence relatedness between peptides, as determined by the number of matches between strings of two or more amino acid residues. Identity measures the percent of identical matches between the smaller of two or more sequences with gap alignments (if any) addressed by a particular mathematical model or computer program (i.e., "algorithms"). Identity of related peptides can be readily calculated by known methods. Such methods include, but are not limited to, those described in
  • the polypeptide variant may have the same or a similar activity as the reference polypeptide.
  • the variant may have an altered activity (e.g., increased or decreased) relative to a reference polypeptide.
  • variants of a particular polynucleotide or polypeptide of the invention will have at least about 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% but less than 100% sequence identity to that particular reference polynucleotide or polypeptide as determined by sequence alignment programs and parameters described herein and known to those skilled in the art.
  • Such tools for alignment include those of the BLAST suite (Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402.) Other tools are described herein, specifically in the definition of "Identity.”
  • Default parameters in the BLAST algorithm include, for example, an expect threshold of 10, Word size of 28, Match/Mismatch Scores 1, -2, Gap costs Linear. Any filter can be applied as well as a selection for species specific repeats, e.g., Homo sapiens.
  • UTRs Untranslated Regions
  • the synthetic polynucleotides of the invention include untranslated regions.
  • Untranslated regions (UTRs) of a gene are transcribed but not translated.
  • the 5'UTR starts at the transcription start site and continues to the start codon but does not include the start codon; whereas, the 3'UTR starts immediately following the stop codon and continues until the transcriptional termination signal.
  • the regulatory features of a UTR can be incorporated into the polynucleotides, primary constructs and/or mmRNA of the present invention to enhance the stability of the molecule.
  • the specific features can also be incorporated to ensure controlled down-regulation of the transcript in case they are misdirected to undesired organs sites.
  • UTRs include but are not limited to those found in the Tables below.
  • 61/737,130 filed December 14, 2012 provide a listing of exemplary UTRs which may be utilized in the primary construct of the present invention as flanking regions. Variants of 5 ' or 3 'UTRs may be utilized wherein one or more nucleotides are added or removed to the termini, including A, T, C or G.
  • any UTR from any gene may be incorporated into the respective first or second flanking region of the primary construct.
  • multiple wild-type UTRs of any known gene may be utilized. It is also within the scope of the present invention to provide artificial UTRs which are not variants of wild type genes. These UTRs or portions thereof may be placed in the same orientation as in the transcript from which they were selected or may be altered in orientation or location. Hence a 5' or 3' UTR may be inverted, shortened, lengthened, made chimeric with one or more other 5' UTRs or 3' UTRs.
  • the term "altered" as it relates to a UTR sequence means that the UTR has been changed in some way in relation to a reference sequence.
  • a 3' or 5' UTR may be altered relative to a wild type or native UTR by the change in orientation or location as taught above or may be altered by the inclusion of additional nucleotides, deletion of nucleotides, swapping or transposition of nucleotides. Any of these changes producing an "altered" UTR (whether 3' or 5') comprise a variant UTR.
  • the UTR may be selected from the UTRs described in Lengthy Table 21 in co-pending US Provisional Application No. US 61/775,509, filed March 9, 2013, entitled Heterologous Untranslated Regions for mRNA and in Lengthy Table 21 and in Table 22 in co-pending US Provisional Application No. US 61/829,372, filed May 31, 2013, entitled Heterologous Untranslated Regions for mRNA; each of which is herein incorporated by reference in its entirety.
  • a double, triple or quadruple UTR such as a 5' or 3' UTR may be used.
  • a "double" UTR is one in which two copies of the same UTR are encoded either in series or substantially in series.
  • a double beta- globin 3' UTR may be used as described in US Patent publication 20100129877, the contents of which are incorporated herein by reference in its entirety.
  • patterned UTRs are those UTRs which reflect a repeating or alternating pattern, such as ABABAB or AABBAABBAABB or ABCABCABC or variants thereof repeated once, twice, or more than 3 times. In these patterns, each letter, A, B, or C represent a different UTR at the nucleotide level.
  • flanking regions are selected from a family of transcripts whose proteins share a common function, structure, feature of property.
  • polypeptides of interest may belong to a family of proteins which are expressed in a particular cell, tissue or at some time during development.
  • the UTRs from any of these genes may be swapped for any other UTR of the same or different family of proteins to create a new chimeric primary transcript.
  • a "family of proteins" is used in the broadest sense to refer to a group of two or more polypeptides of interest which share at least one function, structure, feature, localization, origin, or expression pattern.
  • the synthetic polynucleotides of the invention may comprise an untranslated region that is not heterologous to the encoded protein of interest.
  • the untranslated region may comprise all or a portion or fragment thereof of one or more of the untranslated regions described in co-pending US Provisional Application No. US 61/775,509, filed March 9, 2013, entitled Heterologous Untranslated Regions for mRNA and US Provisional Application No. US 61/829,372, filed March 15, 2013, entitled Heterologous Untranslated Regions for mRNA, each of which is herein incorporated by reference in its entirety.
  • the synthetic polynucleotides of the invention typically include a 5' UTR.
  • Natural 5'UTRs bear features which play roles in for translation initiation. They harbor signatures like Kozak sequences which are commonly known to be involved in the process by which the ribosome initiates translation of many genes. Kozak sequences have the consensus CCR(A/G)CCAUGG (SEQ ID NO: 126), where R is a purine (adenine or guanine) three bases upstream of the start codon (AUG), which is followed by another 'G'. 5 'UTR also have been known to form secondary structures which are involved in elongation factor binding.
  • mRNA such as albumin, serum amyloid A, Apolipoprotein A/B/E, transferrin, alpha fetoprotein, erythropoietin, or Factor VIII
  • tissue-specific mRNA to improve expression in that tissue is possible - for muscle (MyoD, Myosin, Myoglobin, Myogenin, Herculin), for endothelial cells (Tie-1, CD36), for myeloid cells (C/EBP, AML1, G-CSF, GM-CSF, CD1 lb, MSR, Fr-1, i-NOS), for leukocytes (CD45, CD18), for adipose tissue (CD36, GLUT4, ACRP30, adiponectin) and for lung epithelial cells (SP-A/B/C/D).
  • non-UTR sequences may be incorporated into the 5' (or 3' UTR) UTRs.
  • introns or portions of introns sequences may be incorporated into the flanking regions of the polynucleotides, primary constructs or mmRNA of the invention. Incorporation of intronic sequences may increase protein production as well as mRNA levels.
  • the 5 'UTR may selected for use in the present invention may be a structured UTR such as, but not limited to, 5'UTRs to control translation.
  • a structured 5 'UTR may be beneficial when using any of the terminal modifications described in copending U.S. Provisional Application No. 61/758,921 filed January 31, 2013, entitled Differential Targeting Using RNA Constructs; U.S. Provisional Application No. 61/781,139 filed March 14, 2013, entitled Differential Targeting Using RNA Constructs; U.S. Provisional Application No. 61/729,933, filed November 26, 2012 entitled Terminally Optimized RNAs; U.S. Provisional Application No 61/737,224 filed December 14, 2012 entitled Terminally Optimized RNAs and U.S. Provisional
  • the synthetic polynucleotides of the invention typically include a 3 ' UTR.
  • 3'UTRs are known to have stretches of Adenosines and Uridines embedded in them. These AU rich signatures are particularly prevalent in genes with high rates of turnover.
  • the AU rich elements (AREs) can be separated into three classes (Chen et al, 1995): Class I AREs contain several dispersed copies of an AUUUA motif within U-rich regions. C-Myc and MyoD contain class I AREs. Class II AREs possess two or more overlapping UUAUUUA(U/A)(U/A) nonamers.
  • AREs containing this type of AREs include GM-CSF and TNF-a.
  • Class III ARES are less well defined. These U rich regions do not contain an AUUUA motif, c- Jun and Myogenin are two well-studied examples of this class.
  • Most proteins binding to the AREs are known to destabilize the messenger, whereas members of the ELAV family, most notably HuR, have been documented to increase the stability of mRNA.
  • HuR binds to AREs of all the three classes. Engineering the HuR specific binding sites into the 3' UTR of nucleic acid molecules will lead to HuR binding and thus, stabilization of the message in vivo.
  • AREs 3' UTR AU rich elements
  • polynucleotides, primary constructs or mmRNA of the invention When engineering specific polynucleotides, primary constructs or mmRNA, one or more copies of an ARE can be introduced to make polynucleotides, primary constructs or mmRNA of the invention less stable and thereby curtail translation and decrease production of the resultant protein.
  • AREs can be identified and removed or mutated to increase the intracellular stability and thus increase translation and production of the resultant protein.
  • Transfection experiments can be conducted in relevant cell lines, using polynucleotides, primary constructs or mmRNA of the invention and protein production can be assayed at various time points post-transfection.
  • cells can be transfected with different ARE-engineering molecules and by using an ELISA kit to the relevant protein and assaying protein produced at 6 hr, 12 hr, 24 hr, 48 hr, and 7 days post-transfection.
  • the synthetic polynucleotides of the invention include a miRNA binding site in the 3 'UTR.
  • a microRNA or miRNA is a 19-25 nucleotide long noncoding RNA that binds to the 3 'UTR of nucleic acid molecules and down-regulate gene expression either by reducing nucleic acid molecule stability or by inhibiting translation.
  • the polynucleotides, primary constructs or mmRNA of the invention may comprise one or more microRNA target sequences, microRNA sequences, microRNA binding sites, or microRNA seeds.
  • Such sequences may correspond to any known microRNA such as those taught in US Publication US2005/0261218 and US Publication US2005/0059005, or those listed in Table 7 of co-pending application USSN 61/758,921 filed January 31, 2013 (Attorney Docket Number 2030.1039), the contents of which are incorporated herein by reference in their entirety.
  • 3'UTRs containing miRNA binding sites include but are not limited to those found in the Tables below.
  • a microRNA sequence comprises a "seed" region, i.e., a sequence in the region of positions 2-8 of the mature microRNA, which sequence has perfect Watson- Crick complementarity to the miRNA target sequence.
  • a microRNA seed may comprise positions 2-8 or 2-7 of the mature microRNA.
  • a microRNA seed may comprise 7 nucleotides (e.g., nucleotides 2-8 of the mature microRNA), wherein the seed-complementary site in the corresponding miRNA target is flanked by an adenine (A) opposed to microRNA position 1.
  • a microRNA seed may comprise 6 nucleotides (e.g., nucleotides 2-7 of the mature microRNA), wherein the seed- complementary site in the corresponding miRNA target is flanked by an adenine (A) opposed to microRNA position 1.
  • A adenine
  • the bases of the microRNA seed have complete complementarity with the target sequence.
  • nucleic acid molecule is an mRNA and is not intended to be delivered to the liver but ends up there, then miR-122, a microRNA abundant in liver, can inhibit the expression of the gene of interest if one or multiple target sites of miR-122 are engineered into the 3 'UTR of the polynucleotides, primary constructs or mmRNA.
  • Introduction of one or multiple binding sites for different microRNA can be engineered to further decrease the longevity, stability, and protein translation of a polynucleotides, primary constructs or mmRNA.
  • microRNA site refers to a microRNA target site or a microRNA recognition site, or any nucleotide sequence to which a microRNA binds or associates. It should be understood that “binding” may follow traditional Watson-Crick hybridization rules or may reflect any stable association of the microRNA with the target sequence at or adjacent to the microRNA site.
  • microRNA binding sites can be engineered out of (i.e. removed from) sequences in which they naturally occur in order to increase protein expression in specific tissues.
  • miR-122 binding sites may be removed to improve protein expression in the liver. Regulation of expression in multiple tissues can be accomplished through introduction or removal or one or several microRNA binding sites.
  • tissues where microRNA are known to regulate mRNA, and thereby protein expression include, but are not limited to, liver (miR-122), muscle (miR- 133, miR-206, miR-208), endothelial cells (miR- 17-92, miR-126), nervous system (mir- 124a, miR-9), pluripotent cells ( miR-302, miR-367, miR-290, miR-371, miR-373), pancreatic islet cells (miR-375), myeloid cells (miR-142-3p, miR-142-5p, miR- 16, miR- 21, miR-223, miR-24, miR-27), adipose tissue (let-7, miR-30c), heart (miR-ld, miR-149), kidney (miR-192, miR-194, miR-204), and lung epithelial cells (let-7, miR-133, miR- 126).
  • liver miR-122
  • muscle miR- 133,
  • MicroRNA can also regulate complex biological processes such as angiogenesis (miR-132) (Anand and Cheresh Curr Opin Hematol 2011 18: 171-176).
  • angiogenesis miR-132
  • mmRNA of the invention binding sites for microRNAs that are involved in such processes may be removed or introduced, in order to tailor the expression of the polynucleotides, primary constructs or mmRNA expression to biologically relevant cell types or to the context of relevant biological processes.
  • MicroRNAs are also known to be expressed in the immune cells (also called hematopoietic cells), for example, the antigen presenting cells (e.g. dendritic cells and macrophage).
  • Immune cell specific microRNAs are involved in immunogenicity, autoimmunity, the immune -response to infection, inflammation, as well as unwanted immune response after gene therapy and tissue/organ transplantation.
  • miR- 142 and miR-146 are exclusively expressed in the immune cells, particularly abundant in myeloid dendritic cells.
  • Introducing the miR-142 binding site into the 3 '-UTR of a polynucleotide or a gene delivery construct can selectively suppress the gene expression in the antigen presenting cells through miR-142 mediated mRNA degradation, limiting antigen presentation in professional APCs (e.g. dendritic cells) and thereby preventing antigen-mediated immune response after gene delivery (see, Annoni A et al, blood, 2009, 114, 5152-5161, the content of which is herein incorporated by reference in its entirety.).
  • binding sites for microRNAs that are involved in such processes may be introduced, in order to reduce the expression of the polynucleotides, primary constructs or mmRNA of the present invention in APCs and to subdue the antigen mediated immune response.
  • polynucleotides, primary constructs or mmRNA can be engineered for more targeted expression in specific cell types or only under specific biological conditions.
  • polynucleotides, primary constructs or mmRNA could be designed that would be optimal for protein expression in a tissue or in the context of a biological condition.
  • Transfection experiments can be conducted in relevant cell lines, using engineered polynucleotides, primary constructs or mmRNA and protein production can be assayed at various time points post-transfection.
  • cells can be transfected with different microRNA binding site-engineering polynucleotides, primary constructs or mmRNA and by using an ELISA kit to the relevant protein and assaying protein produced at 6 hr, 12 hr, 24 hr, 48 hr, 72 hr and 7 days post-transfection.
  • In vivo experiments can also be conducted using microRNA-binding site-engineered molecules to examine changes in tissue-specific expression of formulated polynucleotides, primary constructs or mmRNA.
  • Additional viral sequences such as, but not limited to, the translation enhancer sequence of the barley yellow dwarf virus (BYDV-PAV) can be engineered and inserted in the 3' UTR of the synthetic polynucleotides, polynucleotides, primary constructs or mmRNA of the invention and can stimulate the translation of the construct in vitro and in vivo.
  • Transfection experiments can be conducted in relevant cell lines at and protein production can be assayed by ELISA at 12hr, 24hr, 48hr, 72 hr and day 7 post- transfection.
  • the synthetic polynucleotides of the invention can include a 5' capping region or 5' cap.
  • the 5' cap structure of an mRNA is involved in nuclear export, increasing mRNA stability and binds the mRNA Cap Binding Protein (CBP), which is responsible for mRNA stability in the cell and translation competency through the association of CBP with poly(A) binding protein to form the mature cyclic mRNA species.
  • CBP mRNA Cap Binding Protein
  • the cap further assists the removal of 5' proximal introns removal during mRNA splicing.
  • Endogenous mRNA molecules may be 5'-end capped generating a 5'-ppp-5'- triphosphate linkage between a terminal guanosine cap residue and the 5 '-terminal transcribed sense nucleotide of the mRNA molecule.
  • This 5'-guanylate cap may then be methylated to generate an N7-methyl-guanylate residue.
  • the ribose sugars of the terminal and/or anteterminal transcribed nucleotides of the 5' end of the mRNA may optionally also be 2'-0-methylated.
  • 5'-decapping through hydrolysis and cleavage of the guanylate cap structure may target a nucleic acid molecule, such as an mRNA molecule, for degradation.
  • Modifications to the polynucleotides, primary constructs, and mmRNA of the present invention may generate a non-hydrolyzable cap structure preventing decapping and thus increasing mRNA half-life. Because cap structure hydrolysis requires cleavage of 5'-ppp-5' phosphorodiester linkages, modified nucleotides may be used during the capping reaction. For example, a Vaccinia Capping Enzyme from New England Biolabs (Ipswich, MA) may be used with a-thio-guanosine nucleotides according to the manufacturer's instructions to create a phosphorothioate linkage in the 5'-ppp-5' cap. Additional modified guanosine nucleotides may be used such as a-methyl-phosphonate and seleno-phosphate nucleotides.
  • Additional modifications include, but are not limited to, 2'-0-methylation of the ribose sugars of 5'-terminal and/or 5'-anteterminal nucleotides of the mRNA (as mentioned above) on the 2'-hydroxyl group of the sugar ring.
  • Multiple distinct 5 '-cap structures can be used to generate the 5 '-cap of a nucleic acid molecule, such as an mRNA molecule.
  • Cap analogs which herein are also referred to as synthetic cap analogs, chemical caps, chemical cap analogs, or structural or functional cap analogs, differ from natural (i.e. endogenous, wild-type or physiological) 5 '-caps in their chemical structure, while retaining cap function. Cap analogs may be chemically (i.e. non-enzymatically) or enzymatically synthesized and/linked to a nucleic acid molecule.
  • the Anti-Reverse Cap Analog (ARCA) cap contains two guanines linked by a 5 '-5 '-triphosphate group, wherein one guanine contains an N7 methyl group as well as a 3'-0-methyl group (i.e., N7,3'-0-dimethyl-guanosine-5'-triphosphate-5'- guanosine (m 7 G-3 'mppp-G; which may equivalently be designated 3' O-Me- m7G(5')ppp(5')G).
  • the 3'-0 atom of the other, unmodified, guanine becomes linked to the 5'-terminal nucleotide of the capped nucleic acid molecule (e.g. an mRNA or mmRNA).
  • the N7- and 3 '-O-methlyated guanine provides the terminal moiety of the capped nucleic acid molecule (e.g. mRNA or mmRNA).
  • mCAP Another exemplary cap is mCAP, which is similar to ARCA but has a 2'-0- methyl group on guanosine (i.e., N7,2'-0-dimethyl-guanosine-5'-triphosphate-5'- guanosine, m 7 Gm-ppp-G).
  • cap analogs allow for the concomitant capping of a nucleic acid molecule in an in vitro transcription reaction, up to 20% of transcripts remain uncapped. This, as well as the structural differences of a cap analog from an endogenous 5 '-cap structures of nucleic acids produced by the endogenous, cellular transcription machinery, may lead to reduced translational competency and reduced cellular stability.
  • Polynucleotides, primary constructs and mmRNA of the invention may also be capped post-transcriptionally, using enzymes, in order to generate more authentic 5 '-cap structures.
  • the phrase "more authentic” refers to a feature that closely mirrors or mimics, either structurally or functionally, an endogenous or wild type feature. That is, a "more authentic" feature is better representative of an endogenous, wild-type, natural or physiological cellular function and/or structure as compared to synthetic features or analogs, etc., of the prior art, or which outperforms the corresponding endogenous, wild-type, natural or physiological feature in one or more respects.
  • Non- limiting examples of more authentic 5'cap structures of the present invention are those which, among other things, have enhanced binding of cap binding proteins, increased half life, reduced susceptibility to 5' endonucleases and/or reduced 5'decapping, as compared to synthetic 5'cap structures known in the art (or to a wild-type, natural or physiological 5'cap structure).
  • recombinant Vaccinia Virus Capping Enzyme and recombinant 2'-0-methyltransferase enzyme can create a canonical 5 '-5 '-triphosphate linkage between the 5 '-terminal nucleotide of an mRNA and a guanine cap nucleotide wherein the cap guanine contains an N7 methylation and the 5 '-terminal nucleotide of the mRNA contains a 2'-0-methyl.
  • Capl structure Such a structure is termed the Capl structure.
  • Cap structures include 7mG(5')ppp(5')N,pN2p (cap 0),
  • polynucleotides, primary constructs or mmRNA may be capped post-transcriptionally, and because this process is more efficient, nearly 100% of the polynucleotides, primary constructs or mmRNA may be capped. This is in contrast to -80% when a cap analog is linked to an mRNA in the course of an in vitro transcription reaction.
  • 5' terminal caps may include endogenous caps or cap analogs.
  • a 5' terminal cap may comprise a guanine analog.
  • Useful guanine analogs include inosine, Nl-methyl-guanosine, 2'fluoro-guanosine, 7-deaza-guanosine, 8-oxo-guanosine, 2-amino-guanosine, LNA- guanosine, and 2-azido-guanosine.
  • IRES internal ribosome entry site
  • polynucleotides, primary constructs or mmRNA containing more than one functional ribosome binding site may encode several peptides or polypeptides that are translated independently by the ribosomes ("multicistronic nucleic acid molecules").
  • polynucleotides, primary constructs or mmRNA are provided with an IRES, further optionally provided is a second translatable region.
  • IRES sequences that can be used according to the invention include without limitation, those from picornaviruses (e.g.
  • FMDV pest viruses
  • CFFV pest viruses
  • PV polio viruses
  • ECMV encephalomyocarditis viruses
  • FMDV foot-and-mouth disease viruses
  • HCV hepatitis C viruses
  • CSFV classical swine fever viruses
  • MLV murine leukemia virus
  • SIV simian immune deficiency viruses
  • CrPV cricket paralysis viruses
  • the primary constructs of the present invention may include at least two stop codons before the 3' untranslated region (UTR).
  • the stop codon may be selected from TGA, TAA and TAG.
  • the primary constructs of the present invention include the stop codon TGA and one additional stop codon.
  • the addition stop codon may be TAA.
  • the primary constructs of the present invention may include three stop codons before the 3 ' untranslated region (UTR).
  • the primary constructs or mmRNA may also encode additional features which facilitate trafficking of the polypeptides to therapeutically relevant sites.
  • One such feature which aids in protein trafficking is the signal sequence.
  • a "signal sequence” or “signal peptide” is a polynucleotide or polypeptide, respectively, which is from about 9 to 200 nucleotides (3-60 amino acids) in length which is incorporated at the 5' (or N-terminus) of the coding region or polypeptide encoded, respectively. Addition of these sequences result in trafficking of the encoded polypeptide to the endoplasmic reticulum through one or more secretory pathways. Some signal peptides are cleaved from the protein by signal peptidase after the proteins are transported.
  • Signal sequences may be selected from any of those listed in co-pending patent applications: U.S. Provisional Patent Application No 61/618,862, filed April 2, 2012, entitled Modified Polynucleotides for the Production of Biologies; U.S. Provisional Patent Application No 61/681,645, filed August 10, 2012, entitled Modified
  • Protein signal sequences which may be incorporated for encoding by the polynucleotides, primary constructs or mmRNA of the invention include signal sequences from a- 1 -antitrypsin, G-CSF, Factor IX, Prolactin, Albumin, HMMSP38, ornithine carbamoyltransferase, Cytochrome C Oxidase subunit 8A, Type III, bacterial, viral, secretion signals, Vrg-6, PhoA, OmpA, STI, STII, Amylase, Alpha Factor,
  • Endoglucanase V Secretion signal
  • fungal e.g., IL12
  • fibronectin e.g., IL12
  • SS secretion signal
  • MLS mitochondrial leader signal.
  • the primary constructs or mmRNA of the present invention may be designed to encode any of the signal sequences or fragments or variants thereof. These sequences may be included at the beginning of the polypeptide coding region, in the middle or at the terminus or alternatively into a flanking region.
  • the polypeptides of the present invention may include at least one protein cleavage signal containing at least one protein cleavage site.
  • the protein cleavage site may be located at the N-terminus, the C-terminus, at any space between the N- and the C- termini such as, but not limited to, half-way between the N- and C-termini, between the N-terminus and the half way point, between the half way point and the C- terminus, and combinations thereof.
  • the polypeptides of the present invention may include, but is not limited to, a proprotein convertase (or prohormone convertase), thrombin or Factor Xa protein cleavage signal.
  • Proprotein convertases are a family of nine proteinases, comprising seven basic amino acid-specific subtilisin-like serine proteinases related to yeast kexin, known as prohormone convertase 1/3 (PC 1/3), PC2, furin, PC4, PC5/6, paired basic amino-acid cleaving enzyme 4 (PACE4) and PC7, and two other subtilases that cleave at non-basic residues, called subtilisin kexin isozyme 1 (SKI-1) and proproteinconvertase subtilisin kexin 9 (PCSK9).
  • the primary constructs and mmRNA of the present invention may be engineered such that the primary construct or mmRNA contains at least one encoded protein cleavage signal.
  • the encoded protein cleavage signal may be located before the start codon, after the start codon, before the coding region, within the coding region such as, but not limited to, half way in the coding region, between the start codon and the halfway point, between the half way point and the stop codon, after the coding region, before the stop codon, between two stop codons, after the stop codon and combinations thereof.
  • the primary constructs or mmRNA of the present invention may include at least one encoded protein cleavage signal containing at least one protein cleavage site.
  • the encoded protein cleavage signal may include, but is not limited to, a proprotein convertase (or prohormone convertase), thrombin and/or Factor Xa protein cleavage signal.
  • a proprotein convertase or prohormone convertase
  • thrombin or Factor Xa protein cleavage signal.
  • Factor Xa protein cleavage signal may be used as Table 1 below or other known methods to determine the appropriate encoded protein cleavage signal to include in the primary constructs or mmRNA of the present invention. For example, starting with a signal sequence and considering the codons of Table 1 one can design a signal for the primary construct which can produce a protein signal in the resulting polypeptide.
  • the polypeptides of the present invention include at least one protein cleavage signal and/or site.
  • the polypeptides of the present invention include at least one protein cleavage signal and/or site with the proviso that the polypeptide is not GLP-1.
  • the primary constructs or mmRNA of the present invention includes at least one encoded protein cleavage signal and/or site.
  • the primary constructs or mmRNA of the present invention includes at least one encoded protein cleavage signal and/or site with the proviso that the primary construct or mmRNA does not encode GLP- 1.
  • the primary constructs or mmRNA of the present invention may include more than one coding region. Where multiple coding regions are present in the primary construct or mmRNA of the present invention, the multiple coding regions may be separated by encoded protein cleavage sites. As a non-limiting example, the primary construct or mmRNA may be signed in an ordered pattern. On such pattern follows AXBY form where A and B are coding regions which may be the same or different coding regions and/or may encode the same or different polypeptides, and X and
  • Y are encoded protein cleavage signals which may encode the same or different protein cleavage signals.
  • a second such pattern follows the form AXYBZ where A and B are coding regions which may be the same or different coding regions and/or may encode the same or different polypeptides, and X, Y and Z are encoded protein cleavage signals which may encode the same or different protein cleavage signals.
  • a third pattern follows the form ABXCY where A, B and C are coding regions which may be the same or different coding regions and/or may encode the same or different polypeptides, and X and
  • Y are encoded protein cleavage signals which may encode the same or different protein cleavage signals.
  • the polypeptides, primary constructs and mmRNA can also contain sequences that encode protein cleavage sites so that the polypeptides, primary constructs and mmRNA can be released from a carrier region or a fusion partner by treatment with a specific protease for said protein cleavage site.
  • the synthetic polynucleotides of the invention typically include a 3 ' tailing sequences, e.g., a poly -A tail.
  • a poly -A tail may be added to a polynucleotide such as an mR A molecules in order to increase stability.
  • the 3' end of the transcript may be cleaved to free a 3' hydroxyl.
  • poly -A polymerase adds a chain of adenine nucleotides to the RNA.
  • the process, called polyadenylation adds a poly-A tail that can be between 100 and 250 residues long.
  • the length of a poly-A tail of the present invention is greater than 30 nucleotides in length.
  • the poly-A tail is greater than 35 nucleotides in length (e.g., at least or greater than about 35, 40, 45, 50, 55, 60, 70, 80, 90, 100, 120, 140, 160, 180, 200, 250, 300, 350, 400, 450, 500, 600, 700, 800, 900, 1,000, 1, 100, 1,200, 1,300, 1,400, 1,500, 1,600, 1,700, 1,800, 1,900, 2,000, 2,500, and 3,000 nucleotides).
  • the polynucleotide, primary construct, or mmRNA includes from about 30 to about 3,000 nucleotides (e.g., from 30 to 50, from 30 to 100, from 30 to 250, from 30 to 500, from 30 to 750, from 30 to 1,000, from 30 to 1,500, from 30 to 2,000, from 30 to 2,500, from 50 to 100, from 50 to 250, from 50 to 500, from 50 to 750, from 50 to 1,000, from 50 to 1,500, from 50 to 2,000, from 50 to 2,500, from 50 to 3,000, from 100 to 500, from 100 to 750, from 100 to 1,000, from 100 to 1,500, from 100 to 2,000, from 100 to 2,500, from 100 to 3,000, from 500 to 750, from 500 to 1,000, from 500 to 1,500, from 500 to 2,000, from 500 to 2,500, from 500 to 3,000, from 1,000 to 1,500, from 1,000 to 2,000, from 1,000 to 2,500, from 1,000 to 3,000, from 1,500 to 2,000, from 1,500 to 2,500, from 1,500 to 2,500,
  • the poly-A tail is designed relative to the length of the overall polynucleotides, primary constructs or mmRNA. This design may be based on the length of the coding region, the length of a particular feature or region (such as the first or flanking regions), or based on the length of the ultimate product expressed from the polynucleotides, primary constructs or mmRNA.
  • the poly-A tail may be 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100% greater in length than the polynucleotides, primary constructs or mmRNA or feature thereof.
  • the poly-A tail may also be designed as a fraction of polynucleotides, primary constructs or mmRNA to which it belongs.
  • the poly-A tail may be 10, 20, 30, 40, 50, 60, 70, 80, or 90% or more of the total length of the construct or the total length of the construct minus the poly-A tail.
  • engineered binding sites and conjugation of polynucleotides, primary constructs or mmRNA for Poly-A binding protein may enhance expression.
  • multiple distinct polynucleotides, primary constructs or mmRNA may be linked together to the PABP (Poly-A binding protein) through the 3 '-end using modified nucleotides at the 3 '-terminus of the poly-A tail.
  • Transfection experiments can be conducted in relevant cell lines at and protein production can be assayed by ELISA at 12hr, 24hr, 48hr, 72 hr and day 7 post-transfection.
  • the polynucleotide primary constructs of the present invention are designed to include a polyA-G quartet.
  • the G-quartet is a cyclic hydrogen bonded array of four guanine nucleotides that can be formed by G-rich sequences in both DNA and RNA.
  • the G-quartet is incorporated at the end of the poly- A tail.
  • the resultant mmRNA construct is assayed for stability, protein production and other parameters including half-life at various time points. It has been discovered that the polyA-G quartet results in protein production equivalent to at least 75% of that seen using a poly-A tail of 120 nucleotides alone.
  • sgRNA ynthetic small guide RNAs
  • the invention also includes synthetic small guide RNAs or sgRNAs.
  • a synthetic sgRNA targets a gene of interest, e.g., a gene where modulation of transcription is desired.
  • a synthetic sgRNA includes a sequence, typically 20-25 nucleotides long, that is complementary to one strand of the 5'UTR of the gene of interest upstream of the transcription start site.
  • the synthetic sgRNA also includes a guide scaffold sequence.
  • a typical guide scaffold sequence is as follows:
  • sgRNA sequences can be found in the Tables below.
  • the sgRNA target a gene of interest, directing the CRISPR related protein encoded by the synthetic polynucleotide to interact with the gene of interest.
  • the gene of interest is selected depending on the application. Examples genes of interest include VEGF, TPO, and/or genes apoptosis or senescence genes.
  • Synthetic polynucleotides and sgRNAs of the invention may be prepared according to any available technique including, but not limited to chemical synthesis; enzymatic synthesis, which is generally termed in vitro transcription (IVT); or enzymatic or chemical cleavage of a longer precursor, etc.
  • IVT in vitro transcription
  • Methods of synthesizing RNAs are known in the art (see, e.g., Gait, M.J. (ed.) Oligonucleotide synthesis: a practical approach, Oxford [Oxfordshire], Washington, DC: IRL Press, 1984; and Herdewijn, P. (ed.) Oligonucleotide synthesis: methods and applications, Methods in Molecular Biology, v. 288 (Clifton, N.J.) Totowa, N.J.: Humana Press, 2005; both of which are incorporated herein by reference).
  • the process of design and synthesis of the primary constructs e.g. synthetic polynucleotides encoding a CRISPR related protein or synthetic sgRNA, of the invention generally includes the steps of gene construction, synthetic mRNA production (either with or without modifications) and purification.
  • a polynucleotide sequence encoding the CRISPR related protein or sgRNA is first selected for incorporation into a vector which will be amplified to produce a cDNA template.
  • the CRISPR related protein polynucleotide sequence and/or any flanking sequences may be codon optimized.
  • the cDNA template is then used to produce mRNA or sgRNA through in vitro transcription (IVT). After production, the mRNA or sgRNA may undergo purification and clean-up processes.
  • IVTT in vitro transcription
  • the step of gene construction may include, but is not limited to gene synthesis, vector amplification, plasmid purification, plasmid linearization and clean-up, and cDNA template synthesis and clean-up.
  • a primary construct is designed.
  • a first region of linked nucleosides encoding the polypeptide of interest may be constructed using an open reading frame (ORF) of a selected nucleic acid (DNA or RNA) transcript.
  • the ORF may comprise the wild type ORF, an isoform, variant or a fragment thereof.
  • an "open reading frame” or “ORF” is meant to refer to a nucleic acid sequence (DNA or RNA) which is capable of encoding a polypeptide of interest. ORFs often begin with the start codon, ATG and end with a nonsense or termination codon or signal.
  • the nucleotide sequence of the first region may be codon optimized. Codon optimization methods are known in the art and may be useful in efforts to achieve one or more of several goals. These goals include to match codon frequencies in target and host organisms to ensure proper folding, bias GC content to increase mRNA stability or reduce secondary structures, minimize tandem repeat codons or base runs that may impair gene construction or expression, customize transcriptional and translational control regions, insert or remove protein trafficking sequences, remove/add post translation modification sites in encoded protein (e.g.
  • Codon optimization tools, algorithms and services are known in the art, non- limiting examples include services from GeneArt (Life Technologies) and/or DNA2.0 (Menlo Park CA).
  • the ORF sequence is optimized using optimization algorithms. Codon options for each amino acid are given in Table 1.
  • SECIS Selenocystein insertion element
  • a sequence After a sequence has been codon optimized it may be further evaluated for regions containing restriction sites. At least one nucleotide within the restriction site regions may be replaced with another nucleotide in order to remove the restriction site from the sequence but the replacement of nucleotides does alter the amino acid sequence which is encoded by the codon optimized nucleotide sequence.
  • a 5' UTR and/or a 3' UTR may be provided as flanking regions. Multiple 5' or 3' UTRs may be included in the flanking regions and may be the same or of different sequences. Any portion of the flanking regions, including none, may be codon optimized and any may independently contain one or more different structural or chemical modifications, before and/or after codon optimization. Combinations of features may be included in the first and second flanking regions and may be contained within other features.
  • the ORF may be flanked by a 5' UTR which may contain a strong Kozak trans lational initiation signal and/or a 3' UTR which may include an oligo(dT) sequence for templated addition of a poly-A tail.
  • the primary construct components are reconstituted and transformed into a vector such as, but not limited to, plasmids, viruses, cosmids, and artificial chromosomes.
  • a vector such as, but not limited to, plasmids, viruses, cosmids, and artificial chromosomes.
  • the optimized construct may be reconstituted and transformed into chemically competent E. coli, yeast, neurospora, maize, drosophila, etc. where high copy plasmid-like or chromosome structures occur by methods described herein.
  • the vector containing the primary construct, encoding either the synthetic polynucleotide encoding a CRISPR related protein or the sgRNA, is then amplified and the plasmid isolated and purified using methods known in the art such as, but not limited to, a maxi prep using the Invitrogen PURELI KTM HiPure Maxiprep Kit (Carlsbad, CA).
  • the plasmid may then be linearized using methods known in the art such as, but not limited to, the use of restriction enzymes and buffers.
  • the linearization reaction may be purified using methods including, for example Invitrogen's PURELINKTM PCR Micro Kit (Carlsbad, CA), and HPLC based purification methods such as, but not limited to, strong anion exchange HPLC, weak anion exchange HPLC, reverse phase HPLC (RP- HPLC), and hydrophobic interaction HPLC (HIC-HPLC) and Invitrogen's standard PURELINKTM PCR Kit (Carlsbad, CA).
  • the purification method may be modified depending on the size of the linearization reaction which was conducted.
  • the linearized plasmid is then used to generate cDNA for in vitro transcription (IVT) reactions.
  • a cDNA template may be synthesized by having a linearized plasmid undergo polymerase chain reaction (PCR).
  • PCR polymerase chain reaction
  • Table 4 of U.S. Patent Application No 13/791,922 filed March 9, 2013 provides a listing of primers and probes that may be usefully in the PCR reactions of the present invention. It should be understood that the listing is not exhaustive and that primer-probe design for any amplification is within the skill of those in the art. Probes may also contain chemically modified bases to increase base-pairing fidelity to the target molecule and base-pairing strength.
  • the cDNA may be submitted for sequencing analysis before undergoing transcription.
  • the process of synthetic polynucleotide or sgRNA production may include, but is not limited to, in vitro transcription, cDNA template removal and RNA clean-up, and RNA capping and/or tailing reactions.
  • the synthetic polynucleotide or sgRNA can be chemically synthesized.
  • the cDNA produced in the previous step may be transcribed using an in vitro transcription (IVT) system.
  • the system typically comprises a transcription buffer, nucleotide triphosphates (NTPs), an RNase inhibitor and a polymerase.
  • NTPs may be manufactured in house, may be selected from a supplier, or may be synthesized as described herein.
  • the NTPs may be selected from, but are not limited to, those described herein including natural and unnatural (modified) NTPs.
  • the polymerase may be selected from, but is not limited to, T7 RNA polymerase, T3 RNA polymerase and mutant polymerases such as, but not limited to, polymerases able to incorporate modified nucleic acids.
  • Inorganic pyrophosphatase can be included in the transcription system.
  • RNA polymerases or variants may be used in the design of the primary constructs of the present invention.
  • RNA polymerases may be modified by inserting or deleting amino acids of the RNA polymerase sequence.
  • the RNA polymerase may be modified to exhibit an increased ability to incorporate a 2 '-modified nucleotide triphosphate compared to an unmodified RNA polymerase (see International Publication WO2008078180 and U.S. Patent 8, 101,385; herein incorporated by reference in their entireties).
  • Variants may be obtained by evolving an RNA polymerase, optimizing the RNA polymerase amino acid and/or nucleic acid sequence and/or by using other methods known in the art.
  • T7 RNA polymerase variants may be evolved using the continuous directed evolution system set out by Esvelt et al.
  • T7 RNA polymerase may encode at least one mutation such as, but not limited to, lysine at position 93 substituted for threonine (K93T), I4M, A7T, E63V, V64D, A65E, D66Y, T76N, C125R, S 128R, A136T, N165S, G175R, H176L, Y178H, F 182L, L196F, G198V, D208Y, E222K, S228A, Q239R, T243N, G259D, M267I, G280C, H300R, D351A, A354S, E356D, L360P, A383V, Y385C, D388Y, S397R, M401T, N410S, K450R, P451T, G452V, E484A, H5
  • T7 RNA polymerase variants may encode at least mutation as described in U.S. Pub. Nos. 20100120024 and 200701 17112; herein incorporated by reference in their entireties.
  • Variants of RNA polymerase may also include, but are not limited to, substitutional variants, conservative amino acid substitution, insertional variants, deletional variants and/or covalent derivatives.
  • the primary construct may be designed to be recognized by the wild type or variant RNA polymerases. In doing so, the primary construct may be modified to contain sites or regions of sequence changes from the wild type or parent primary construct.
  • the primary construct may be designed to include at least one substitution and/or insertion upstream of an RNA polymerase binding or recognition site, downstream of the RNA polymerase binding or recognition site, upstream of the TATA box sequence, downstream of the TATA box sequence of the primary construct but upstream of the coding region of the primary construct, within the 5'UTR, before the 5'UTR and/or after the 5'UTR.
  • the 5'UTR of the primary construct may be replaced by the insertion of at least one region and/or string of nucleotides of the same base.
  • the region and/or string of nucleotides may include, but is not limited to, at least 3, at least 4, at least 5, at least 6, at least 7 or at least 8 nucleotides and the nucleotides may be natural and/or unnatural.
  • the group of nucleotides may include 5-8 adenine, cytosine, thymine, a string of any of the other nucleotides disclosed herein and/or combinations thereof.
  • the 5'UTR of the primary construct may be replaced by the insertion of at least two regions and/or strings of nucleotides of two different bases such as, but not limited to, adenine, cytosine, thymine, any of the other nucleotides disclosed herein and/or combinations thereof.
  • the 5'UTR may be replaced by inserting 5-8 adenine bases followed by the insertion of 5-8 cytosine bases.
  • the 5'UTR may be replaced by inserting 5-8 cytosine bases followed by the insertion of 5-8 adenine bases.
  • the primary construct may include at least one substitution and/or insertion downstream of the transcription start site which may be recognized by an RNA polymerase.
  • at least one substitution and/or insertion may occur downstream the transcription start site by substituting at least one nucleic acid in the region just downstream of the transcription start site (such as, but not limited to, +1 to +6). Changes to region of nucleotides just downstream of the transcription start site may affect initiation rates, increase apparent nucleotide triphosphate (NTP) reaction constant values, and increase the dissociation of short transcripts from the transcription complex curing initial transcription (Brieba et al, Biochemistry (2002) 41 : 5144-5149; herein incorporated by reference in its entirety).
  • the modification, substitution and/or insertion of at least one nucleic acid may cause a silent mutation of the nucleic acid sequence or may cause a mutation in the amino acid sequence.
  • the primary construct may include the substitution of at least 1, at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12 or at least 13 guanine bases downstream of the transcription start site.
  • the primary construct may include the substitution of at least 1, at least 2, at least 3, at least 4, at least 5 or at least 6 guanine bases in the region just downstream of the transcription start site.
  • the guanine bases may be substituted by at least 1, at least 2, at least 3 or at least 4 adenine nucleotides.
  • the guanine bases may be substituted by at least 1, at least 2, at least 3 or at least 4 cytosine bases.
  • the guanine bases in the region are GGGAGA (SEQ ID NO: 127)
  • the guanine bases may be substituted by at least 1, at least 2, at least 3 or at least 4 thymine, and/or any of the nucleotides described herein.
  • the primary construct may include at least one substitution and/or insertion upstream of the start codon.
  • the start codon is the first codon of the protein coding region whereas the transcription start site is the site where transcription begins.
  • the primary construct may include, but is not limited to, at least 1, at least 2, at least 3, at least 4, at least 5, at least 6, at least 7 or at least 8 substitutions and/or insertions of nucleotide bases.
  • the nucleotide bases may be inserted or substituted at 1, at least 1, at least 2, at least 3, at least 4 or at least 5 locations upstream of the start codon.
  • the nucleotides inserted and/or substituted may be the same base (e.g., all A or all C or all T or all G), two different bases (e.g., A and C, A and T, or C and T), three different bases (e.g., A, C and T or A, C and T) or at least four different bases.
  • the guanine base upstream of the coding region in the primary construct may be substituted with adenine, cytosine, thymine, or any of the nucleotides described herein.
  • the substitution of guanine bases in the primary construct may be designed so as to leave one guanine base in the region downstream of the transcription start site and before the start codon (see Esvelt et al. Nature (2011) 472(7344):499-503; herein incorporated by reference in its entirety).
  • at least 5 nucleotides may be inserted at 1 location downstream of the transcription start site but upstream of the start codon and the at least 5 nucleotides may be the same base type.
  • RNA clean-up may also include a purification method such as, but not limited to, AGENCOURT®
  • CLEANSEQ® system from Beckman Coulter (Danvers, MA), HPLC based purification methods such as, but not limited to, strong anion exchange HPLC, weak anion exchange HPLC, reverse phase HPLC (RP-HPLC), and hydrophobic interaction HPLC (HIC- HPLC) .
  • the primary construct or mmRNA may also undergo capping and/or tailing reactions.
  • a capping reaction may be performed by methods known in the art to add a 5' cap to the 5' end of the primary construct. Methods for capping include, but are not limited to, using a Vaccinia Capping enzyme (New England Biolabs, Ipswich, MA).
  • a poly-A tailing reaction may be performed by methods known in the art, such as, but not limited to, 2' O-methyltransferase and by methods as described herein. If the primary construct generated from cDNA does not include a poly-T, it may be beneficial to perform the poly-A-tailing reaction before the primary construct is cleaned.
  • Samples undergoing capping reactions may have varying amounts of 5' capped structures ranging from 0 to 100%.
  • the sample comprises 0, 5, 10, 20, 30, 40, 50, 60, 70, 80, 90, 95, 99, or 100% 5' capped RNA.
  • RNA clean-up may be performed by methods known in the arts such as, but not limited to, AGENCOURT® beads (Beckman Coulter Genomics, Danvers, MA), poly-T beads, LNATM oligo-T capture probes (EXIQON® Inc, Vedbaek, Denmark), HPLC based purification methods such as, but not limited to, strong anion exchange HPLC, weak anion exchange HPLC, reverse phase HPLC (RP-HPLC), and hydrophobic interaction HPLC (HIC-HPLC) or RNAse III treatment (a non-limiting example of treating mRNA with RNAse III is described by Meis et al.
  • RNA refers to one that is separated from at least one contaminant.
  • a "contaminant” is any substance which makes another unfit, impure or inferior.
  • a purified polynucleotide e.g., DNA and RNA
  • RNA is present in a form or setting different from that in which it is found in nature, or a form or setting different from that which existed prior to subjecting it to a treatment or purification method.
  • a quality assurance and/or quality control check may be conducted using methods such as, but not limited to, gel electrophoresis, UV absorbance, or analytical HPLC.
  • the RNA may be sequenced by methods including, but not limited to reverse-transcriptase-PCR.
  • the mRNA or mmRNA may be quantified using methods such as, but not limited to, ultraviolet visible spectroscopy (UV/Vis).
  • UV/Vis ultraviolet visible spectroscopy
  • a non-limiting example of a UV/Vis spectrometer is a NANODROP® spectrometer (ThermoFisher, Waltham, MA).
  • the quantified mRNA or mmRNA may be analyzed in order to determine if the mRNA or mmRNA may be of proper size, check that no degradation of the mRNA or mmRNA has occurred.
  • Degradation of the mRNA and/or mmRNA may be checked by methods such as, but not limited to, agarose gel electrophoresis, HPLC based purification methods such as, but not limited to, strong anion exchange HPLC, weak anion exchange HPLC, reverse phase HPLC (RP-HPLC), and hydrophobic interaction HPLC (HIC-HPLC), liquid chromatography-mass spectrometry (LCMS), capillary electrophoresis (CE) and capillary gel electrophoresis (CGE).
  • HPLC based purification methods such as, but not limited to, strong anion exchange HPLC, weak anion exchange HPLC, reverse phase HPLC (RP-HPLC), and hydrophobic interaction HPLC (HIC-HPLC), liquid chromatography-mass spectrometry (LCMS), capillary electrophoresis (CE) and capillary gel electrophoresis (CGE).
  • the synthetic polynucleotides and sgRNAs of the invention are typically modified.
  • a polynucleotide such as synthetic polynucleotide or sgRNA
  • the terms "modification” or, as appropriate, “modified” refer to modification with respect to A, G, U or C ribonucleotides.
  • these terms are not intended to refer to the ribonucleotide modifications in naturally occurring 5'-terminal mRNA cap moieties. Examples of modifications can be found in US patent application no. 13/644,072, filed 03-Oct-2012 and published as US201301 15272, .e.g, the contents of which are incorporated by reference for all purposes.
  • the modifications may be various distinct modifications. In some embodiments,
  • the coding region, the flanking regions and/or the terminal regions may contain one, two, or more (optionally different) nucleoside or nucleotide modifications.
  • a modified polynucleotide, primary construct, or mmRNA introduced to a cell may exhibit reduced degradation in the cell, as compared to an unmodified polynucleotide, primary construct, or mmRNA.
  • the polynucleotides, primary constructs, and mmRNA can include any useful modification, such as to the sugar, the nucleobase, or the intemucleoside linkage (e.g. to a linking phosphate / to a phosphodiester linkage / to the phosphodiester backbone).
  • One or more atoms of a pyrimidine nucleobase may be replaced or substituted with optionally substituted amino, optionally substituted thiol, optionally substituted alkyl (e.g., methyl or ethyl), or halo (e.g., chloro or fluoro).
  • modifications are present in each of the sugar and the intemucleoside linkage.
  • Modifications according to the present invention may be modifications of ribonucleic acids (RNAs) to deoxyribonucleic acids (DNAs), threose nucleic acids (TNAs), glycol nucleic acids (GNAs), peptide nucleic acids (PNAs), locked nucleic acids (LNAs) or hybrids thereof). Additional modifications are described herein.
  • the polynucleotides, primary constructs, and mmRNA of the invention do not substantially induce an innate immune response of a cell into which the mRNA is introduced.
  • an induced innate immune response include 1) increased expression of pro-inflammatory cytokines, 2) activation of intracellular PRRs (RIG-I, MDA5, etc, and/or 3) termination or reduction in protein translation.
  • the invention provides a modified nucleic acid molecule containing a degradation domain, which is capable of being acted on in a directed manner within a cell.
  • the polynucleotides, primary constructs, and mmRNA can optionally include other agents (e.g., RNAi-inducing agents, RNAi agents, siRNAs, shRNAs, miRNAs, antisense RNAs, ribozymes, catalytic DNA, tRNA, RNAs that induce triple helix formation, aptamers, vectors, etc.).
  • agents e.g., RNAi-inducing agents, RNAi agents, siRNAs, shRNAs, miRNAs, antisense RNAs, ribozymes, catalytic DNA, tRNA, RNAs that induce triple helix formation, aptamers, vectors, etc.
  • the polynucleotide, primary construct, or mmRNA (e.g., the first region, first flanking region, or second flanking region) includes n number of linked nucleosides having any base, sugar, backbone, building block or other structure or formula, including but not limited to those of Formulas I through IX or any substructures thereof as described in International Publication No WO2013052523 filed October 3, 2012, entitled Modified Nucleosides, Nucleotides, and Nucleic Acids, and Uses Thereof , the contents of which are incorporated herein by reference in their entirety.
  • Such structures include modifications to the sugar, nucleobase, internucleoside linkage, or combinations thereof.
  • Combinations of chemical modifications include those taught in including but not limited to those described in International Publication No WO2013052523 filed October 3, 2012, entitled Modified Nucleosides, Nucleotides, and Nucleic Acids, and Uses Thereof , the contents of which are incorporated herein by reference in their entirety.
  • the nucleobase selected from the group consisting of cytosine, guanine, adenine, and uracil.
  • the modified nucleobase is a modified uracil.
  • nucleobases and nucleosides having a modified uracil include pseudouridine ( ⁇ ), pyridin-4-one ribonucleoside, 5-aza-uridine, 6-aza-uridine, 2-thio-5-aza-uridine, 2- thio-uridine (s 2 U), 4-thio-uridine (s 4 U), 4-thio-pseudouridine, 2-thio-pseudouridine, 5- hydroxy-uridine (ho 5 U), 5-aminoallyl-uridine, 5-halo-uridine (e.g., 5-iodo-uridine or 5- bromo-uridine), 3-methyl-uridine (m 3 U), 5-carboxymethyl-uridine (cm 5 U), 1- carboxymethyl-pseudouridine, 5-carboxyhydroxymethyl-uridine (chm 5 U), 5- carboxyhydroxymethyl-uridine methyl ester (mchm 5 U), 5-methoxycarbonylmethyl- uridine (mcm 5 U), 5-me
  • the modified nucleobase is a modified cytosine.
  • nucleobases and nucleosides having a modified cytosine include 5-aza- cytidine, 6-aza-cytidine, pseudoisocytidine, 3-methyl-cytidine (m 3 C), N4-acetyl-cytidine (ac 4 C), 5-formyl-cytidine (f 5 C), N4-methyl-cytidine (m 4 C), 5-methyl-cytidine (m 5 C), 5- halo-cytidine (e.g., 5-iodo-cytidine), 5-hydroxymethyl-cytidine (hm 5 C), 1-methyl- pseudoisocytidine, pyrrolo-cytidine, pyrrolo-pseudoisocytidine, 2-thio-cytidine (s 2 C), 2- thio-5-methyl-cytidine, 4-thio-pseudoisocytidine, 4-thio-l-methyl-pseudoisocytidine
  • the modified nucleobase is a modified uracil selected from pseudouridine ( ⁇ ) and 1-methylpseudouridine.
  • the modified nucleobase is a modified uracil in combination with a modified cytosine, e.g., 5- methylcytosine.
  • a polynucleotide of the invention is fully modified with pseudouridine ( ⁇ ), optionally in combination with 5-methylcytosine.
  • a polynucleotide of the invention is fully modified with 1- methylpseudouridine (m ), optionally in combination with 5-methylcytosine.
  • the mRNA molecules are codon optimized.
  • the modified nucleobase is a modified adenine.
  • nucleobases and nucleosides having a modified adenine include 2-amino- purine, 2, 6-diaminopurine, 2-amino-6-halo-purine (e.g., 2-amino-6-chloro-purine), 6- halo-purine (e.g., 6-chloro-purine), 2-amino-6-methyl-purine, 8-azido-adenosine, 7- deaza-adenine, 7-deaza-8-aza-adenine, 7-deaza-2-amino-purine, 7-deaza-8-aza-2-amino- purine, 7-deaza-2, 6-diaminopurine, 7-deaza-8-aza-2,6-diaminopurine, 1-methyl- adenosine (rr ⁇ A), 2-methyl-adenine (m 2 A), N6-methyl-adenosine (m 6 A), 2-methylthio- N6-methyl-adenosine,
  • N6,N6,2'-0-trimethyl-adenosine m 6 2Am
  • l,2'-0-dimethyl-adenosine rr ⁇ Am
  • 2'-0- ribosyladenosine phosphate
  • 2-amino-N6-methyl-purine 1 -thio-adenosine, 8- azido-adenosine, 2'-F-ara-adenosine, 2'-F-adenosine, 2'-OH-ara-adenosine, and
  • the modified nucleobase is a modified guanine.
  • nucleobases and nucleosides having a modified guanine include inosine (I), 1- methyl-inosine (m 1 !), wyosine (imG), methylwyosine (mimG), 4-demethyl-wyosine (imG-14), isowyosine (imG2), wybutosine (yW), peroxywybutosine (o 2 yW),
  • hydroxywybutosine (OHyW), undermodified hydroxy wybutosine (OHyW*), 7-deaza- guanosine, queuosine (Q), epoxyqueuosine (oQ), galactosyl-queuosine (galQ), mannosyl- queuosine (manQ), 7-cyano-7-deaza-guanosine (preQo), 7-aminomethyl-7-deaza- guanosine (preQi), archaeosine (G + ), 7-deaza-8-aza-guanosine, 6-thio-guanosine, 6-thio- 7-deaza-guanosine, 6-thio-7-deaza-8-aza-guanosine, 7-methyl-guanosine (m 7 G), 6-thio-7- methyl-guanosine, 7-methyl-inosine, 6-methoxy-guanosine, 1 -methyl-guanosine (rr ⁇ G), N2-methyl
  • the nucleobase of the nucleotide can be independently selected from a purine, a pyrimidine, a purine or pyrimidine analog.
  • the nucleobase can each be independently selected from adenine, cytosine, guanine, uracil, or hypoxanthine.
  • the nucleobase can also include, for example, naturally-occurring and synthetic derivatives of a base, including pyrazolo[3,4-d]pyrimidines, 5- methylcytosine (5-me-C), 5-hydroxymethyl cytosine, xanthine, hypoxanthine, 2- aminoadenine, 6-methyl and other alkyl derivatives of adenine and guanine, 2-propyl and other alkyl derivatives of adenine and guanine, 2-thiouracil, 2-thiothymine and 2- thiocytosine, 5-propynyl uracil and cytosine, 6-azo uracil, cytosine and thymine, 5-uracil (pseudouracil), 4-thiouracil, 8-halo (e.g., 8-bromo), 8-amino, 8-thiol, 8-thioalkyl, 8- hydroxyl and other 8-substituted adenines
  • each letter refers to the representative base and/or derivatives thereof, e.g., A includes adenine or adenine analogs, e.g., 7-deaza adenine).
  • Modified nucleosides and nucleotides can be prepared according to the synthetic methods described in Ogata et al., J. Org. Chem. 74:2585-2588 (2009); Purmal et al, Nucl. Acids Res. 22(1): 72-78, (1994); Fukuhara et al, Biochemistry, 1(4): 563-568 (1962); and Xu et al, Tetrahedron, 48(9): 1729-1740 (1992), each of which are incorporated by reference in their entirety.
  • the polypeptides, primary constructs, and mmRNA of the invention may or may not be uniformly modified along the entire length of the molecule.
  • nucleotide e.g., purine or pyrimidine, or any one or more or all of A, G, U, C
  • nucleotide of the invention may or may not be uniformly modified in a polynucleotide of the invention, or in a given predetermined sequence region thereof (e.g. one or more of the sequence regions represented in Figure 1).
  • nucleotides X in a polynucleotide of the invention are modified, wherein X may any one of nucleotides A, G, U, C, or any one of the combinations A+G, A+U, A+C, G+U, G+C, U+C, A+G+U, A+G+C, G+U+C or A+G+C.
  • nucleotide modifications may exist at various positions in the polynucleotide, primary construct, or mmRNA.
  • nucleotide analogs or other modification(s) may be located at any position(s) of a polynucleotide, primary construct, or mmRNA such that the function of the
  • polynucleotide, primary construct, or mmRNA is not substantially decreased.
  • a modification may also be a 5' or 3' terminal modification.
  • the polynucleotide, primary construct, or mmRNA may contain from about 1% to about 100% modified nucleotides (either in relation to overall nucleotide content, or in relation to one or more types of nucleotide, i.e.
  • any one or more of A, G, U or C) or any intervening percentage e.g., from 1% to 20%, from 1% to 25%, from 1% to 50%, from 1% to 60%, from 1% to 70%, from 1% to 80%, from 1% to 90%, from 1% to 95%, from 10% to 20%, from 10% to 25%, from 10% to 50%, from 10% to 60%, from 10% to 70%, from 10% to 80%, from 10% to 90%, from 10% to 95%, from 10% to 100%, from 20% to 25%, from 20% to 50%, from 20% to 60%, from 20% to 70%, from 20% to 80%, from 20% to 90%, from 20% to 95%, from 20% to 100%, from 50% to 60%, from 50% to 70%, from 50% to 80%, from 50% to 90%, from 50% to 95%, from 50% to 100%, from 70% to 80%, from 70% to 90%, from 70% to 95%, from 70% to 100%, from 80% to 90%, from 80% to 95%, from 90% to 100%, and from 95% to 100%).
  • any intervening percentage e.g.,
  • the polynucleotide, primary construct, or mmRNA includes a modified pyrimidine (e.g., a modified uracil/uridine/U or modified cytosine/cytidine/C).
  • a modified pyrimidine e.g., a modified uracil/uridine/U or modified cytosine/cytidine/C.
  • the uracil or uridine (generally: U) in the polynucleotide, primary construct, or mmRNA molecule may be replaced with from about 1% to about 100% of a modified uracil or modified uridine (e.g., from 1% to 20%, from 1% to 25%, from 1% to 50%, from 1% to 60%, from 1% to 70%, from 1% to 80%, from 1% to 90%, from 1% to 95%, from 10% to 20%, from 10% to 25%, from 10% to 50%, from 10% to 60%, from 10% to 70%, from 10% to 80%, from 10% to 90%, from 10% to 95%, from 10% to 100%, from 20% to 25%, from 20% to 50%, from 20% to 60%, from 20% to 70%, from 20% to 80%, from 20% to 90%, from 20% to 95%, from 20% to 100%, from 50% to 60%, from 50% to 70%, from 50% to 80%, from 50% to 90%, from 50% to 95%, from 50% to 100%, from 70% to 80%, from 70% to 90%, from 70% to 95%, from 20%
  • the cytosine or cytidine (generally: C) in the polynucleotide, primary construct, or mmRNA molecule may be replaced with from about 1% to about 100% of a modified cytosine or modified cytidine (e.g., from 1% to 20%, from 1% to 25%, from 1% to 50%, from 1% to 60%, from 1% to 70%, from 1% to 80%, from 1% to 90%, from 1% to 95%, from 10% to 20%, from 10% to 25%, from 10% to 50%, from 10% to 60%, from 10% to 70%, from 10% to 80%, from 10% to 90%, from 10% to 95%, from 10% to 100%, from 20% to 25%, from 20% to 50%, from 20% to 60%, from 20% to 70%, from 20% to 80%, from 20% to 90%, from 20% to 95%, from 20% to 100%, from 50% to 60%, from 50% to 70%, from 50% to 80%, from 50% to 90%, from 50% to 95%, from 50% to 100%, from 70% to 80%, from from
  • At least 25% of the cytosines are replaced by a compound of Formula (bl0)-(bl4) (e.g., at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or about 100%).
  • a compound of Formula (bl0)-(bl4) e.g., at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or about 100%.
  • At least 25% of the uracils are replaced by a compound of Formula (bl)-(b9) (e.g., at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or about 100%).
  • a compound of Formula (bl)-(b9) e.g., at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or about 100%).
  • At least 25% of the cytosines are replaced by a compound of Formula (bl0)-(bl4), and at least 25% of the uracils are replaced by a compound of Formula (bl)-(b9) (e.g., at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or about 100%).
  • the synthetic polynucleotide and/or sgRNA includes a terminal modification.
  • the terminal modification may be a modification described in US Provisional Application No. US 61/729,933, filed November 26, 2012, entitled
  • the chemical modification may be a modification described in International Publication No. WO2013052523, herein incorporated by reference in its entirety.
  • harmaceutical Compositions Formulation, Administration, Delivery and Dosing
  • the invention includes synthetic polynucleotide and/or sgRNA compositions and complexes in combination with one or more pharmaceutically acceptable excipients.
  • Pharmaceutical compositions may optionally comprise one or more additional active substances, e.g. therapeutically and/or prophylactically active substances.
  • the synthetic polynucleotide and/or sgRNA are formulated.
  • the synthetic polynucleotides and/or synthetic sgRNAs may be formulated by the methods described in International Publication No. WO2013090648 and/or co-pending US Provisional Application No. US 61/821,406, filed March 14, 2013, entitled Formulation and Delivery of Modified Nucleoside, Nucleotide, and Nucleic Acid Compositions, US Provisional Application No. US 61/821,406, filed May 9, 2013, entitled Formulation and Delivery of Modified Nucleoside, Nucleotide, and Nucleic Acid Compositions and US Provisional Application No. US 61/840,510, filed June 28, 2013, entitled Formulation and Delivery of Modified Nucleoside, Nucleotide, and Nucleic Acid Compositions, each of which is herein incorporated by reference in its entirety.
  • compositions are principally directed to pharmaceutical compositions which are suitable for administration to humans, it will be understood by the skilled artisan that such compositions are generally suitable for administration to any other animal, e.g., to non-human animals, e.g. non-human mammals. Modification of pharmaceutical compositions suitable for administration to humans in order to render the compositions suitable for administration to various animals is well understood, and the ordinarily skilled veterinary
  • Subjects to which administration of the pharmaceutical compositions is contemplated include, but are not limited to, humans and/or other primates; mammals, including commercially relevant mammals such as cattle, pigs, horses, sheep, cats, dogs, mice, and/or rats; and/or birds, including commercially relevant birds such as poultry, chickens, ducks, geese, and/or turkeys.
  • Formulations of the pharmaceutical compositions described herein may be prepared by any method known or hereafter developed in the art of pharmacology. In general, such preparatory methods include the step of bringing the active ingredient into association with an excipient and/or one or more other accessory ingredients, and then, if necessary and/or desirable, dividing, shaping and/or packaging the product into a desired single- or multi-dose unit.
  • a pharmaceutical composition in accordance with the invention may be prepared, packaged, and/or sold in bulk, as a single unit dose, and/or as a plurality of single unit doses.
  • a "unit dose" is discrete amount of the pharmaceutical composition comprising a predetermined amount of the active ingredient.
  • the amount of the active ingredient is generally equal to the dosage of the active ingredient which would be administered to a subject and/or a convenient fraction of such a dosage such as, for example, one-half or one-third of such a dosage.
  • compositions in accordance with the invention will vary, depending upon the identity, size, and/or condition of the subject treated and further depending upon the route by which the composition is to be administered.
  • the composition may comprise between 0.1% and 100%, e.g., between .5 and 50%, between 1-30%, between 5-80%, at least 80% (w/w) active ingredient
  • the synthetic polynucleotides and/or synthetic sgR As of the invention can be formulated using one or more excipients to: (1) increase stability; (2) increase cell transfection; (3) permit the sustained or delayed release (e.g., from a depot formulation of the polynucleotide, primary construct, or mmR A); (4) alter the biodistribution (e.g., target the polynucleotide, primary construct, or mmRNA to specific tissues or cell types); (5) increase the translation of encoded protein in vivo; and/or (6) alter the release profile of encoded protein in vivo.
  • excipients to: (1) increase stability; (2) increase cell transfection; (3) permit the sustained or delayed release (e.g., from a depot formulation of the polynucleotide, primary construct, or mmR A); (4) alter the biodistribution (e.g., target the polynucleotide, primary construct, or mmRNA to specific tissues or cell types); (5) increase the translation of encode
  • excipients of the present invention can include, without limitation, lipidoids, liposomes, lipid nanoparticles, polymers, lipoplexes, core-shell nanoparticles, peptides, proteins, cells transfected with polynucleotide, primary construct, or mmRNA (e.g., for transplantation into a subject), hyaluronidase, nanoparticle mimics and combinations thereof.
  • the formulations of the invention can include one or more excipients, each in an amount that together increases the stability of the
  • polynucleotide, primary construct, or mmRNA increases cell transfection by the polynucleotide, primary construct, or mmRNA, increases the expression of
  • polynucleotide, primary construct, or mmRNA encoded protein and/or alters the release profile of polynucleotide, primary construct, or mmRNA encoded proteins.
  • the primary construct and mmRNA of the present invention may be formulated using self- assembled nucleic acid nanoparticles.
  • Formulations of the pharmaceutical compositions described herein may be prepared by any method known or hereafter developed in the art of pharmacology. In general, such preparatory methods include the step of associating the active ingredient with an excipient and/or one or more other accessory ingredients.
  • a pharmaceutical composition in accordance with the present disclosure may be prepared, packaged, and/or sold in bulk, as a single unit dose, and/or as a plurality of single unit doses.
  • a "unit dose" refers to a discrete amount of the pharmaceutical composition comprising a predetermined amount of the active ingredient.
  • the amount of the active ingredient may generally be equal to the dosage of the active ingredient which would be administered to a subject and/or a convenient fraction of such a dosage including, but not limited to, one-half or one-third of such a dosage.
  • Relative amounts of the active ingredient, the pharmaceutically acceptable excipient, and/or any additional ingredients in a pharmaceutical composition in accordance with the present disclosure may vary, depending upon the identity, size, and/or condition of the subject being treated and further depending upon the route by which the composition is to be administered.
  • the composition may comprise between 0.1% and 99% (w/w) of the active ingredient.
  • the formulations described herein may contain at least one synthetic polynucleotide.
  • the formulations may contain 1, 2, 3, 4 or 5 mmRNA.
  • the formulation may contain modified mRNA encoding proteins selected from categories such as, but not limited to, human proteins, veterinary proteins, bacterial proteins, biological proteins, antibodies, immunogenic proteins, therapeutic peptides and proteins, secreted proteins, plasma membrane proteins, cytoplasmic and cytoskeletal proteins, intracellular membrane bound proteins, nuclear proteins, proteins associated with human disease and/or proteins associated with non-human diseases.
  • the formulation contains at least three modified mRNA encoding proteins.
  • the formulation contains at least five modified mRNA encoding proteins.
  • compositions may additionally comprise a pharmaceutically acceptable excipient, which, as used herein, includes, but is not limited to, any and all solvents, dispersion media, diluents, or other liquid vehicles, dispersion or suspension aids, surface active agents, isotonic agents, thickening or emulsifying agents, preservatives, and the like, as suited to the particular dosage form desired.
  • a pharmaceutically acceptable excipient includes, but is not limited to, any and all solvents, dispersion media, diluents, or other liquid vehicles, dispersion or suspension aids, surface active agents, isotonic agents, thickening or emulsifying agents, preservatives, and the like, as suited to the particular dosage form desired.
  • excipients for formulating pharmaceutical compositions and techniques for preparing the composition are known in the art (see Remington: The Science and Practice of Pharmacy, 21 st Edition, A. R. Gennaro, Lippincott, Williams & Wilkins, Baltimore, MD,
  • conventional excipient medium may be incompatible with a substance or its derivatives, such as by producing any undesirable biological effect or otherwise interacting in a deleterious manner with any other component(s) of the pharmaceutical composition.
  • the particle size of the lipid nanoparticle may be increased and/or decreased.
  • the change in particle size may be able to help counter biological reaction such as, but not limited to, inflammation or may increase the biological effect of the modified mRNA delivered to mammals.
  • compositions include, but are not limited to, inert diluents, surface active agents and/or emulsifiers, preservatives, buffering agents, lubricating agents, and/or oils. Such excipients may optionally be included in the pharmaceutical formulations of the invention.
  • the present disclosure describes their formulation and use in delivering single stranded polynucleotides, primary constructs, or mmRNA.
  • Complexes, micelles, liposomes or particles can be prepared containing these lipidoids and therefore, can result in an effective delivery of the polynucleotide, primary construct, or mmRNA, as judged by the production of an encoded protein, following the injection of a lipidoid formulation via localized and/or systemic routes of administration.
  • Lipidoid complexes of polynucleotides, primary constructs, or mmRNA can be administered by various means including, but not limited to, intravenous, intramuscular, or subcutaneous routes.
  • nucleic acids may be affected by many parameters, including, but not limited to, the formulation composition, nature of particle PEGylation, degree of loading, oligonucleotide to lipid ratio, and biophysical parameters such as particle size (Akinc et al, Mol Ther. 2009 17:872-879; herein incorporated by reference in its entirety).
  • particle size Akinc et al, Mol Ther. 2009 17:872-879; herein incorporated by reference in its entirety.
  • small changes in the anchor chain length of poly(ethylene glycol) (PEG) lipids may result in significant effects on in vivo efficacy.
  • Formulations with the different lipidoids including, but not limited to penta[3-(l- laurylaminopropionyl)]-triethylenetetramine hydrochloride (TETA-5LAP; aka 98N12-5, see Murugaiah et al., Analytical Biochemistry, 401 :61 (2010)), CI 2-200 (including derivatives and variants), and MD1, can be tested for in vivo activity.
  • TETA-5LAP penta[3-(l- laurylaminopropionyl)]-triethylenetetramine hydrochloride
  • CI 2-200 including derivatives and variants
  • MD1 can be tested for in vivo activity.
  • the lipidoid referred to herein as "C12-200" is disclosed by Love et al, Proc Natl Acad Sci U S A. 2010 107: 1864-1869 (see Figure 2) and Liu and Huang, Molecular Therapy. 2010 669-670 (see Figure 2); both of which are herein incorporated by reference in their entirety.
  • the lipidoid formulations can include particles comprising either 3 or 4 or more components in addition to polynucleotide, primary construct, or mmRNA.
  • formulations with certain lipidoids include, but are not limited to, 98N12-5 and may contain 42% lipidoid, 48% cholesterol and 10% PEG (C14 alkyl chain length).
  • formulations with certain lipidoids include, but are not limited to, C12- 200 and may contain 50% lipidoid, 10% disteroylphosphatidyl choline, 38.5%
  • a polynucleotide, primary construct, or mmRNA formulated with a lipidoid for systemic intravenous administration can target the liver.
  • an intravenous formulation using a C12-200 may have a molar ratio of 50/10/38.5/1.5 of C12- 200/disteroylphosphatidyl choline/cholesterol/PEG-DMG, with a weight ratio of 7 to 1 total lipid to polynucleotide, primary construct, or mmRNA, and a mean particle size of 80 nm may be effective to deliver polynucleotide, primary construct, or mmRNA to hepatocytes (see, Love et al, Proc Natl Acad Sci U S A.
  • an MD1 lipidoid-containing formulation may be used to effectively deliver polynucleotide, primary construct, or mmRNA to hepatocytes in vivo.
  • the characteristics of optimized lipidoid formulations for intramuscular or subcutaneous routes may vary significantly depending on the target cell type and the ability of formulations to diffuse through the extracellular matrix into the blood stream. While a particle size of less than 150 nm may be desired for effective hepatocyte delivery due to the size of the endothelial fenestrae (see, Akinc et al, Mol Ther.
  • lipidoid-formulated polynucleotide, primary construct, or mmRNA to deliver the formulation to other cells types including, but not limited to, endothelial cells, myeloid cells, and muscle cells may not be similarly size-limited.
  • Use of lipidoid formulations to deliver siRNA in vivo to other non-hepatocyte cells such as myeloid cells and endothelium has been reported (see Akinc et al., Nat Biotechnol. 2008 26:561-569; Leuschner et al, Nat Biotechnol. 2011 29: 1005-1010; Cho et al. Adv. Funct. Mater.
  • lipidoid formulations may have a similar component molar ratio. Different ratios of lipidoids and other components including, but not limited to, disteroylphosphatidyl choline, cholesterol and PEG-DMG, may be used to optimize the formulation of the polynucleotide, primary construct, or mmRNA for delivery to different cell types including, but not limited to, hepatocytes, myeloid cells, muscle cells, etc.
  • the component molar ratio may include, but is not limited to, 50% C12-200, 10% disteroylphosphatidyl choline, 38.5% cholesterol, and %1.5 PEG-DMG (see Leuschner et al, Nat Biotechnol 2011 29: 1005-1010; herein incorporated by reference in its entirety).
  • the use of lipidoid formulations for the localized delivery of nucleic acids to cells (such as, but not limited to, adipose cells and muscle cells) via either subcutaneous or intramuscular delivery may not require all of the formulation components desired for systemic delivery, and as such may comprise only the lipidoid and the polynucleotide, primary construct, or mmRNA.
  • Combinations of different lipidoids may be used to improve the efficacy of polynucleotide, primary construct, or mmRNA directed protein production as the lipidoids may be able to increase cell transfection by the polynucleotide, primary construct, or mmRNA; and/or increase the translation of encoded protein (see Whitehead et al, Mol. Ther. 201 1, 19: 1688-1694, herein incorporated by reference in its entirety).
  • Liposomes Liposomes, Lipoplexes, and Lipid Nanoparticles
  • the polynucleotide, primary construct, and mmRNA of the invention can be formulated using one or more liposomes, lipoplexes, or lipid nanoparticles.
  • pharmaceutical compositions of polynucleotide, primary construct, or mmRNA include liposomes. Liposomes are artificially -prepared vesicles which may primarily be composed of a lipid bilayer and may be used as a delivery vehicle for the administration of nutrients and pharmaceutical formulations.
  • Liposomes can be of different sizes such as, but not limited to, a multilamellar vesicle (MLV) which may be hundreds of nanometers in diameter and may contain a series of concentric bilayers separated by narrow aqueous compartments, a small unicellular vesicle (SUV) which may be smaller than 50 nm in diameter, and a large unilamellar vesicle (LUV) which may be between 50 and 500 nm in diameter.
  • MLV multilamellar vesicle
  • SUV small unicellular vesicle
  • LUV large unilamellar vesicle
  • Liposome design may include, but is not limited to, opsonins or ligands in order to improve the attachment of liposomes to unhealthy tissue or to activate events such as, but not limited to, endocytosis.
  • Liposomes may contain a low or a high pH in order to improve the delivery of the pharmaceutical formulations.
  • liposomes may depend on the physicochemical characteristics such as, but not limited to, the pharmaceutical formulation entrapped and the liposomal ingredients , the nature of the medium in which the lipid vesicles are dispersed, the effective concentration of the entrapped substance and its potential toxicity, any additional processes involved during the application and/or delivery of the vesicles, the optimization size, polydispersity and the shelf-life of the vesicles for the intended application, and the batch-to-batch reproducibility and possibility of large-scale production of safe and efficient liposomal products.
  • compositions described herein may include, without limitation, liposomes such as those formed from l,2-dioleyloxy-N,N- dimethylaminopropane (DODMA) liposomes, DiLa2 liposomes from Marina Biotech (Bothell, WA), l,2-dilinoleyloxy-3-dimethylaminopropane (DLin-DMA), 2,2-dilinoleyl- 4-(2-dimethylaminoethyl)-[l,3]-dioxolane (DLin-KC2-DMA), and MC3
  • DODMA dioleyloxy-N,N- dimethylaminopropane
  • liposomes which may deliver small molecule drugs such as, but not limited to, DOXIL® from Janssen Biotech, Inc. (Horsham, PA).
  • compositions described herein may include, without limitation, liposomes such as those formed from the synthesis of stabilized plasmid-lipid particles (SPLP) or stabilized nucleic acid lipid particle (SNALP) that have been previously described and shown to be suitable for oligonucleotide delivery in vitro and in vivo (see Wheeler et al. Gene Therapy. 1999 6:271-281; Zhang et al. Gene Therapy. 1999 6: 1438-1447; Jeffs et al. Pharm Res. 2005 22:362-372; Morrissey et al, Nat Biotechnol. 2005 2: 1002-1007; Zimmermann et al, Nature.
  • liposomes such as those formed from the synthesis of stabilized plasmid-lipid particles (SPLP) or stabilized nucleic acid lipid particle (SNALP) that have been previously described and shown to be suitable for oligonucleotide delivery in vitro and in vivo (see Wheeler et al. Gene Therapy. 1999 6:
  • a liposome can contain, but is not limited to, 55% cholesterol, 20% disteroylphosphatidyl choline (DSPC), 10% PEG-S-DSG, and 15% l,2-dioleyloxy-N,N-dimethylaminopropane (DODMA), as described by Jeffs et al.
  • DSPC disteroylphosphatidyl choline
  • PEG-S-DSG 10%
  • DODMA l,2-dioleyloxy-N,N-dimethylaminopropane
  • certain liposome formulations may contain, but are not limited to, 48% cholesterol, 20% DSPC, 2% PEG-c-DMA, and 30% cationic lipid, where the cationic lipid can be l,2-distearloxy-N,N-dimethylaminopropane (DSDMA), DODMA, DLin-DMA, or l,2-dilinolenyloxy-3-dimethylaminopropane (DLenDMA), as described by Heyes et al.
  • DSDMA l,2-distearloxy-N,N-dimethylaminopropane
  • DODMA DODMA
  • DLin-DMA DLenDMA
  • DLenDMA l,2-dilinolenyloxy-3-dimethylaminopropane
  • the polynucleotides, primary constructs and/or mmRNA may be formulated in a lipid vesicle which may have crosslinks between functionalized lipid bilayers.
  • the polynucleotides, primary constructs and/or mmRNA may be formulated in a lipid-polycation complex.
  • the formation of the lipid-polycation complex may be accomplished by methods known in the art and/or as described in U.S. Pub. No. 20120178702, herein incorporated by reference in its entirety.
  • the polycation may include a cationic peptide or a polypeptide such as, but not limited to, polylysine, polyomithine and/or polyarginine.
  • the polynucleotides, primary constructs and/or mmRNA may be formulated in a lipid- polycation complex which may further include a neutral lipid such as, but not limited to, cholesterol or dioleoyl phosphatidylethanolamine (DOPE).
  • a neutral lipid such as, but not limited to, cholesterol or dioleoyl phosphatidylethanolamine (DOPE).
  • DOPE dioleoyl phosphatidylethanolamine
  • the liposome formulation may be influenced by, but not limited to, the selection of the cationic lipid component, the degree of cationic lipid saturation, the nature of the PEGylation, ratio of all components and biophysical parameters such as size.
  • the liposome formulation was composed of 57.1 % cationic lipid, 7.1%
  • dipalmitoylphosphatidylcholine 34.3 % cholesterol, and 1.4% PEG-c-DMA.
  • changing the composition of the cationic lipid could more effectively deliver siRNA to various antigen presenting cells (Basha et al. Mol Ther. 201 1 19:2186-2200; herein incorporated by reference in its entirety).
  • the ratio of PEG in the LNP formulations may be increased or decreased and/or the carbon chain length of the PEG lipid may be modified from C14 to CI 8 to alter the pharmacokinetics and/or biodistribution of the LNP formulations.
  • LNP formulations may contain 1-5% of the lipid molar ratio of PEG-c-DOMG as compared to the cationic lipid, DSPC and cholesterol.
  • the PEG-c-DOMG may be replaced with a PEG lipid such as, but not limited to, PEG- DSG (1,2-Distearoyl-sn-glycerol, methoxypolyethylene glycol) or PEG-DPG (1,2-Dipalmitoyl-sn-glycerol, methoxypolyethylene glycol).
  • PEG- DSG (1,2-Distearoyl-sn-glycerol, methoxypolyethylene glycol
  • PEG-DPG 1,2-Dipalmitoyl-sn-glycerol, methoxypolyethylene glycol
  • the cationic lipid may be selected from any lipid known in the art such as, but not limited to, DLin-MC3 -DMA, DLin-DMA, CI 2-200 and DLin-KC2-DMA.
  • the cationic lipid may be selected from, but not limited to, a cationic lipid described in International Publication Nos. WO2012040184,
  • the cationic lipid may be selected from, but not limited to, formula A described in International Publication Nos.
  • the cationic lipid may be selected from, but not limited to, formula CLI-CLXXIX of International Publication No. WO2008103276, formula CLI-CLXXIX of US Patent No. 7,893,302, formula CLI-CLXXXXII of US Patent No. 7,404,969 and formula I-VI of US Patent Publication No.
  • the cationic lipid may be selected from (20Z,23Z)-N,N-dimethylnonacosa- 20,23-dien-10-amine, (17Z,20Z)-N,N-dimemylhexacosa-17,20-dien-9-amine, (1 Z, 19Z)- N5N ⁇ dimethylpentacosa ⁇ l 6, 19-dien-8-amine, (13Z, 16Z)-N,N-dimethyldocosa-13J16- dien-5-amine, ( 12Z, 15Z)-NJN-dimethylhenicosa- 12, 15 -dien-4-amine, ( 14Z, 17Z)-N,N- dimethyltricosa- 14, 17-dien-6-amine, ( 15Z, 18Z)-N,N-dimethyltetracosa- 15, 18-dien-7- amine, ( 18Z,21
  • the cationic lipid may be synthesized by methods known in the art and/or as described in International Publication Nos. WO2012040184,
  • the LNP formulations of the polynucleotides, primary constructs and/or mmRNA may contain PEG-c-DOMG 3% lipid molar ratio. In another embodiment, the LNP formulations of the polynucleotides, primary constructs and/or mmRNA may contain PEG-c-DOMG 1.5% lipid molar ratio.
  • the pharmaceutical compositions of the polynucleotides, primary constructs and/or mmRNA may include at least one of the PEGylated lipids described in International Publication No. 2012099755, herein incorporated by reference.
  • the LNP formulation may contain PEG-DMG 2000 (1,2- dimyristoyl-sn-glycero-3-phophoethanolamine-N-[methoxy(polyethylene glycol)-2000).
  • the LNP formulation may contain PEG-DMG 2000, a cationic lipid known in the art and at least one other component.
  • the LNP formulation may contain PEG-DMG 2000, a cationic lipid known in the art, DSPC and cholesterol.
  • the LNP formulation may contain PEG-DMG 2000, DLin-DMA, DSPC and cholesterol.
  • the LNP formulation may contain PEG-DMG 2000, DLin-DMA, DSPC and cholesterol in a molar ratio of 2:40: 10:48 (see Geall et al, Nonviral delivery of self-amplifying RNA vaccines, PNAS 2012; PMID: 22908294).
  • the LNP formulation may be formulated by the methods described in International Publication Nos. WO2011 127255 or WO2008103276, each of which is herein incorporated by reference in their entirety.
  • modified RNA described herein may be encapsulated in LNP formulations as described in WO2011 127255 and/or WO2008103276; each of which is herein incorporated by reference in their entirety.
  • LNP formulations described herein may comprise a polycationic composition.
  • the polycationic composition may be selected from formula 1-60 of US Patent Publication No. US20050222064; herein incorporated by reference in its entirety.
  • the LNP formulations comprising a polycationic composition may be used for the delivery of the modified RNA described herein in vivo and/or in vitro.
  • the LNP formulations described herein may additionally comprise a permeability enhancer molecule.
  • a permeability enhancer molecule are described in US Patent Publication No. US20050222064; herein incorporated by reference in its entirety.
  • the pharmaceutical compositions may be formulated in liposomes such as, but not limited to, DiLa2 liposomes (Marina Biotech, Bothell, WA), SMARTICLES® (Marina Biotech, Bothell, WA), neutral DOPC (1,2-dioleoyl-sn- glycero-3-phosphocholine) based liposomes (e.g., siRNA delivery for ovarian cancer (Landen et al. Cancer Biology & Therapy 2006 5(12)1708-1713)) and hyaluronan-coated liposomes (Quiet Therapeutics, Israel).
  • DiLa2 liposomes Marina Biotech, Bothell, WA
  • SMARTICLES® Marina Biotech, Bothell, WA
  • neutral DOPC 1,2-dioleoyl-sn- glycero-3-phosphocholine
  • Lipid nanoparticle formulations may be improved by replacing the cationic lipid with a biodegradable cationic lipid which is known as a rapidly eliminated lipid nanoparticle (reLNP).
  • Ionizable cationic lipids such as, but not limited to, DLinDMA, DLin-KC2-DMA, and DLin-MC3-DMA, have been shown to accumulate in plasma and tissues over time and may be a potential source of toxicity.
  • the rapid metabolism of the rapidly eliminated lipids can improve the tolerability and therapeutic index of the lipid nanoparticles by an order of magnitude from a 1 mg/kg dose to a 10 mg/kg dose in rat.
  • ester linkage can improve the degradation and metabolism profile of the cationic component, while still maintaining the activity of the reLNP formulation.
  • the ester linkage can be internally located within the lipid chain or it may be terminally located at the terminal end of the lipid chain.
  • the internal ester linkage may replace any carbon in the lipid chain.
  • the internal ester linkage may be located on either side of the saturated carbon.
  • Non-limitin examples of reLNPs include,
  • an immune response may be elicited by delivering a lipid nanoparticle which may include a nanospecies, a polymer and an immunogen.
  • a lipid nanoparticle which may include a nanospecies, a polymer and an immunogen.
  • nanospecies encapsulate the nanospecies or partially encapsulate the nanospecies.
  • Lipid nanoparticles may be engineered to alter the surface properties of particles so the lipid nanoparticles may penetrate the mucosal barrier.
  • Mucus is located on mucosal tissue such as, but not limited to, oral (e.g., the buccal and esophageal membranes and tonsil tissue), ophthalmic, gastrointestinal (e.g., stomach, small intestine, large intestine, colon, rectum), nasal, respiratory (e.g., nasal, pharyngeal, tracheal and bronchial membranes), genital (e.g., vaginal, cervical and urethral membranes).
  • oral e.g., the buccal and esophageal membranes and tonsil tissue
  • ophthalmic e.g., gastrointestinal (e.g., stomach, small intestine, large intestine, colon, rectum)
  • nasal, respiratory e.g., nasal, pharyngeal, tracheal and bronchial
  • Nanoparticles larger than 10-200 nm which are preferred for higher drug encapsulation efficiency and the ability to provide the sustained delivery of a wide array of drugs have been thought to be too large to rapidly diffuse through mucosal barriers. Mucus is continuously secreted, shed, discarded or digested and recycled so most of the trapped particles may be removed from the mucosal tissue within seconds or within a few hours. Large polymeric nanoparticles (200nm -500nm in diameter) which have been coated densely with a low molecular weight polyethylene glycol (PEG) diffused through mucus only 4 to 6-fold lower than the same particles diffusing in water (Lai et al. PNAS 2007 104(5): 1482-487; Lai et al.
  • PEG polyethylene glycol
  • the transport of nanoparticles may be determined using rates of permeation and/or fluorescent microscopy techniques including, but not limited to, fluorescence recovery after photobleaching (FRAP) and high resolution multiple particle tracking (MPT).
  • FRAP fluorescence recovery after photobleaching
  • MPT high resolution multiple particle tracking
  • the lipid nanoparticle engineered to penetrate mucus may comprise a polymeric material (i.e. a polymeric core) and/or a polymer-vitamin conjugate and/or a tri-block co-polymer.
  • the polymeric material may include, but is not limited to, polyamines, polyethers, polyamides, polyesters, polycarbamates, polyureas,
  • polycarbonates poly(styrenes), polyimides, polysulfones, polyurethanes, polyacetylenes, polyethylenes, polyethyeneimines, polyisocyanates, polyacrylates, polymethacrylates, polyacrylonitriles, and polyarylates.
  • the polymeric material may be biodegradable and/or biocompatible.
  • Non-limiting examples of specific polymers include poly(caprolactone) (PCL), ethylene vinyl acetate polymer (EVA), poly(lactic acid) (PLA), poly(L-lactic acid) (PLLA), poly(glycolic acid) (PGA), poly(lactic acid-co-glycolic acid) (PLGA), poly(L- lactic acid-co-glycolic acid) (PLLGA), poly(D,L-lactide) (PDLA), poly(L-lactide) (PLLA), poly(D,L-lactide-co-caprolactone), poly(D,L-lactide-co-caprolactone-co- glycolide), poly(D,L-lactide-co-PEO-co-D,L-lactide), poly(D,L-lactide-co-PPO-co-D,L- lactide), polyalkyl cyanoacralate, polyurethane, poly-L-lysine (PLL), hydroxypropyl methacrylate (
  • the lipid nanoparticle may be coated or associated with a co-poly
  • the co-polymer may be a polymer that is generally regarded as safe (GRAS) and the formation of the lipid nanoparticle may be in such a way that no new chemical entities are created.
  • the lipid nanoparticle may comprise poloxamers coating PLGA nanoparticles without forming new chemical entities which are still able to rapidly penetrate human mucus (Yang et al. Angew. Chem. Int. Ed. 201 1 50:2597-2600; herein incorporated by reference in its entirety).
  • the vitamin of the polymer- vitamin conjugate may be vitamin E.
  • the vitamin portion of the conjugate may be substituted with other suitable components such as, but not limited to, vitamin A, vitamin E, other vitamins, cholesterol, a hydrophobic moiety, or a hydrophobic component of other surfactants (e.g., sterol chains, fatty acids, hydrocarbon chains and alkylene oxide chains).
  • the lipid nanoparticle engineered to penetrate mucus may include surface altering agents such as, but not limited to, mmRNA, anionic protein (e.g., bovine serum albumin), surfactants (e.g., cationic surfactants such as for example dimethyldioctadecyl- ammonium bromide), sugars or sugar derivatives (e.g., cyclodextrin), nucleic acids, polymers (e.g., heparin, polyethylene glycol and poloxamer), mucolytic agents (e.g., N- acetylcysteine, mugwort, bromelain, papain, clerodendrum, acetylcysteine, bromhexine, carbocisteine, eprazinone, mesna, ambroxol, sobrerol, domiodol, letosteine, stepronin, tiopronin, gelsolin, thymosin
  • the surface altering agent may be embedded or enmeshed in the particle's surface or disposed (e.g., by coating, adsorption, covalent linkage, or other process) on the surface of the lipid nanoparticle.
  • the mucus penetrating lipid nanoparticles may comprise at least one mmRNA described herein.
  • the mmRNA may be encapsulated in the lipid nanoparticle and/or disposed on the surface of the particle.
  • the mmRNA may be covalently coupled to the lipid nanoparticle.
  • Formulations of mucus penetrating lipid nanoparticles may comprise a plurality of nanoparticles. Further, the formulations may contain particles which may interact with the mucus and alter the structural and/or adhesive properties of the surrounding mucus to decrease mucoadhesion which may increase the delivery of the mucus penetrating lipid nanoparticles to the mucosal tissue.
  • the polynucleotide, primary construct, or mmRNA is formulated as a lipoplex, such as, without limitation, the ATUPLEXTM system, the DACC system, the DBTC system and other siRNA-lipoplex technology from Silence
  • such formulations may also be constructed or compositions altered such that they passively or actively are directed to different cell types in vivo, including but not limited to hepatocytes, immune cells, tumor cells, endothelial cells, antigen presenting cells, and leukocytes (Akinc et al. Mol Ther. 2010 18: 1357-1364; Song et al, Nat Biotechnol. 2005 23 :709-717; Judge et al, J Clin Invest.
  • lipid nanoparticle formulations which have been shown to bind to apolipoprotein E and promote binding and uptake of these formulations into hepatocytes in vivo (Akinc et al. Mol Ther. 2010 18: 1357-1364; herein incorporated by reference in its entirety).
  • Formulations can also be selectively targeted through expression of different ligands on their surface as exemplified by, but not limited by, folate, transferrin, N-acetylgalactosamine (GalNAc), and antibody targeted approaches (Kolhatkar et al., Curr Drug Discov Technol.
  • 201 1 8 197-206; Musacchio and Torchilin, Front Biosci. 201 1 16: 1388-1412; Yu et al, Mol Membr Biol. 2010 27:286-298; Patil et al, Crit Rev Ther Drug Carrier Syst. 2008 25: 1- 61 ; Benoit et al, Biomacromolecules. 201 1 12:2708-2714Zhao et al, Expert Opin Drug Deliv. 2008 5:309-319; Akinc et al, Mol Ther. 2010 18: 1357-1364; Srinivasan et al, Methods Mol Biol. 2012 820: 105-116; Ben-Arie et al, Methods Mol Biol.
  • the polynucleotide, primary construct, or mmRNA is formulated as a solid lipid nanoparticle.
  • a solid lipid nanoparticle may be spherical with an average diameter between 10 to 1000 nm. SLN possess a solid lipid core matrix that can solubilize lipophilic molecules and may be stabilized with surfactants and/or emulsifiers.
  • the lipid nanoparticle may be a self-assembly lipid-polymer nanoparticle (see Zhang et al, ACS Nano, 2008, 2 (8), pp 1696-1702; herein incorporated by reference in its entirety).
  • Liposomes, lipoplexes, or lipid nanoparticles may be used to improve the efficacy of polynucleotide, primary construct, or mmRNA directed protein production as these formulations may be able to increase cell transfection by the polynucleotide, primary construct, or mmRNA; and/or increase the translation of encoded protein.
  • One such example involves the use of lipid encapsulation to enable the effective systemic delivery of polyplex plasmid DNA (Heyes et al, Mol Ther. 2007 15:713-720; herein incorporated by reference in its entirety).
  • the liposomes, lipoplexes, or lipid nanoparticles may also be used to increase the stability of the polynucleotide, primary construct, or mmRNA.
  • the polynucleotides, primary constructs, and/or the mmRNA of the present invention can be formulated for controlled release and/or targeted delivery.
  • controlled release refers to a pharmaceutical composition or compound release profile that conforms to a particular pattern of release to effect a therapeutic outcome.
  • the polynucleotides, primary constructs or the mmRNA may be encapsulated into a delivery agent described herein and/or known in the art for controlled release and/or targeted delivery.
  • the term "encapsulate” means to enclose, surround or encase. As it relates to the formulation of the compounds of the invention, encapsulation may be substantial, complete or partial. The term
  • substantially encapsulated means that at least greater than 50, 60, 70, 80, 85, 90, 95, 96, 97, 98, 99, 99.9, 99.9 or greater than 99.999% of the pharmaceutical composition or compound of the invention may be enclosed, surrounded or encased within the delivery agent.
  • Partially encapsulation means that less than 10, 10, 20, 30, 40 50 or less of the pharmaceutical composition or compound of the invention may be enclosed, surrounded or encased within the delivery agent.
  • encapsulation may be determined by measuring the escape or the activity of the pharmaceutical composition or compound of the invention using fluorescence and/or electron micrograph. For example, at least 1, 5, 10, 20, 30, 40, 50, 60, 70, 80, 85, 90, 95, 96, 97, 98, 99, 99.9, 99.99 or greater than 99.99% of the pharmaceutical composition or compound of the invention are
  • the polynucleotides, primary constructs, or the mmRNA may be encapsulated into a lipid nanoparticle or a rapidly eliminating lipid nanoparticle and the lipid nanoparticles or a rapidly eliminating lipid nanoparticle may then be encapsulated into a polymer, hydrogel and/or surgical sealant described herein and/or known in the art.
  • the polymer, hydrogel or surgical sealant may be PLGA, ethylene vinyl acetate (EVAc), poloxamer, GELSITE®
  • HYLENEX® Hazyme Therapeutics, San Diego CA
  • surgical sealants such as fibrinogen polymers (Ethicon Inc. Cornelia, GA), TISSELL® (Baxter International, Inc Deerfield, IL), PEG-based sealants, and COSEAL® (Baxter International, Inc Deerfield, IL).
  • the lipid nanoparticle may be encapsulated into any polymer or hydrogel known in the art which may form a gel when injected into a subject.
  • the lipid nanoparticle may be encapsulated into a polymer matrix which may be biodegradable.
  • the polynucleotide, primary construct, or mmRNA formulation for controlled release and/or targeted delivery may also include at least one controlled release coating.
  • Controlled release coatings include, but are not limited to, OPADRY®, polyvinylpyrrolidone/vinyl acetate copolymer, polyvinylpyrrolidone, hydroxypropyl methylcellulose, hydroxypropyl cellulose, hydroxyethyl cellulose, EUDRAGIT RL®, EUDRAGIT RS® and cellulose derivatives such as ethylcellulose aqueous dispersions (AQUACOAT® and SURELEASE®).
  • the controlled release and/or targeted delivery formulation may comprise at least one degradable polyester which may contain polycationic side chains.
  • Degradable polyesters include, but are not limited to, poly(serine ester), poly(L- lactide-co-L-lysine), poly(4-hydroxy-L-proline ester), and combinations thereof.
  • the degradable polyesters may include a PEG conjugation to form a PEGylated polymer.
  • the polynucleotides, primary constructs, and/or the mmRNA of the present invention may be encapsulated in a therapeutic nanoparticle.
  • Therapeutic nanoparticles may be formulated by methods described herein and known in the art such as, but not limited to, International Pub Nos. WO2010005740,
  • therapeutic polymer nanoparticles may be identified by the methods described in US Pub No.
  • the therapeutic nanoparticle of may be formulated for sustained release.
  • sustained release refers to a pharmaceutical composition or compound that conforms to a release rate over a specific period of time. The period of time may include, but is not limited to, hours, days, weeks, months and years.
  • the sustained release nanoparticle may comprise a polymer and a therapeutic agent such as, but not limited to, the polynucleotides, primary constructs, and mmRNA of the present invention (see International Pub No. 2010075072 and US Pub No. US20100216804 and US201 10217377, each of which is herein incorporated by reference in their entirety).
  • the therapeutic nanoparticles may be formulated to be target specific.
  • the therapeutic nanoparticles may include a corticosteroid (see International Pub. No. WO2011084518).
  • the therapeutic nanoparticles may be formulated to be cancer specific.
  • the therapeutic nanoparticles may be formulated in nanoparticles described in International Pub No. WO2008121949, WO2010005726, WO2010005725,
  • the nanoparticles of the present invention may comprise a polymeric matrix.
  • the nanoparticle may comprise two or more polymers such as, but not limited to, polyethylenes, polycarbonates,
  • polyanhydrides polyhydroxyacids, polypropylfumerates, polycaprolactones, polyamides, polyacetals, polyethers, polyesters, poly(orthoesters), polycyanoacrylates, polyvinyl alcohols, polyurethanes, polyphosphazenes, polyacrylates, polymethacrylates, polycyanoacrylates, polyureas, polystyrenes, polyamines, polylysine, poly(ethylene imine), poly(serine ester), poly(L-lactide-co-L-lysine), poly(4-hydroxy-L-proline ester) or combinations thereof.
  • the diblock copolymer may include PEG in combination with a polymer such as, but not limited to, polyethylenes, polycarbonates,
  • polyanhydrides polyhydroxyacids, polypropylfumerates, polycaprolactones, polyamides, polyacetals, polyethers, polyesters, poly(orthoesters), polycyanoacrylates, polyvinyl alcohols, polyurethanes, polyphosphazenes, polyacrylates, polymethacrylates, polycyanoacrylates, polyureas, polystyrenes, polyamines, polylysine, poly(ethylene imine), poly(serine ester), poly(L-lactide-co-L-lysine), poly(4-hydroxy-L-proline ester) or combinations thereof.
  • the therapeutic nanoparticle comprises a diblock copolymer.
  • the therapeutic nanoparticle comprises a PLGA- PEG block copolymer (see US Pub. No. US20120004293 and US Pat No. 8,236,330, herein incorporated by reference in their entireties).
  • the therapeutic nanoparticle is a stealth nanoparticle comprising a diblock copolymer of PEG and PLA or PEG and PLGA (see US Pat No 8,246,968, each of which is herein incorporated by reference in its entirety).
  • the therapeutic nanoparticle may comprise at least one acrylic polymer.
  • Acrylic polymers include but are not limited to, acrylic acid, methacrylic acid, acrylic acid and methacrylic acid copolymers, methyl methacrylate copolymers, ethoxyethyl methacrylates, cyanoethyl methacrylate, amino alkyl methacrylate copolymer, poly(acrylic acid), poly(methacrylic acid), polycyanoacrylates and combinations thereof.
  • the therapeutic nanoparticles may comprise at least one cationic polymer described herein and/or known in the art.
  • the therapeutic nanoparticles may comprise at least one amine-containing polymer such as, but not limited to polylysine, polyethylene imine, poly(amidoamine) dendrimers and combinations thereof.
  • the therapeutic nanoparticles may comprise at least one degradable polyester which may contain polycationic side chains.
  • Degradable polyesters include, but are not limited to, poly(serine ester), poly(L-lactide-co-L-lysine), poly(4- hydroxy-L-proline ester), and combinations thereof.
  • the degradable polyesters may include a PEG conjugation to form a PEGylated polymer.
  • the therapeutic nanoparticle may include a conjugation of at least one targeting ligand.
  • the therapeutic nanoparticle may be formulated in an aqueous solution which may be used to target cancer (see International Pub No.
  • the polynucleotides, primary constructs, or mmRNA may be encapsulated in, linked to and/or associated with synthetic nanocarriers.
  • the synthetic nanocarriers may be formulated using methods known in the art and/or described herein.
  • the synthetic nanocarriers may be formulated by the methods described in International Pub Nos. WO2010005740, WO2010030763 and US Pub. Nos. US20110262491, US20100104645 and US20100087337, each of which is herein incorporated by reference in their entirety.
  • the synthetic nanocarrier formulations may be lyophilized by methods described in International Pub. No. WO2011072218 and US Pat No. 8,21 1,473; each of which is herein incorporated by reference in their entireties.
  • the synthetic nanocarriers may contain reactive groups to release the polynucleotides, primary constructs and/or mmRNA described herein (see International Pub. No. WO20120952552 and US Pub No. US20120171229, each of which is herein incorporated by reference in their entirety).
  • the synthetic nanocarriers may contain an
  • the synthetic nanocarrier may comprise a Thl immunostimulatory agent which may enhance a Thl -based response of the immune system (see International Pub No. WO2010123569 and US Pub. No. US20110223201, each of which is herein incorporated by reference in its entirety).
  • the synthetic nanocarriers may be formulated for targeted release.
  • the synthetic nanocarrier is formulated to release the polynucleotides, primary constructs and/or mmRNA at a specified pH and/or after a desired time interval.
  • the synthetic nanoparticle may be formulated to release the polynucleotides, primary constructs and/or mmRNA after 24 hours and/or at a pH of 4.5 (see International Pub. Nos. WO2010138193 and
  • the synthetic nanocarriers may be formulated for controlled and/or sustained release of the polynucleotides, primary constructs and/or mmRNA described herein.
  • the synthetic nanocarriers for sustained release may be formulated by methods known in the art, described herein and/or as described in International Pub No. WO2010138192 and US Pub No. 20100303850, each of which is herein incorporated by reference in their entireties.
  • polymers Biodegradable Nanoparticles, and Core-Shell Nanoparticles
  • the polynucleotide, primary construct, and mmRNA of the invention can be formulated using natural and/or synthetic polymers.
  • Non-limiting examples of polymers which may be used for delivery include, but are not limited to, Dynamic
  • PHASERXTM polymer formulations such as, without limitation, SMARTT POLYMER TECHNOLOGYTM (Seattle, WA), DMRLDOPE, poloxamer, VAXFECTIN® adjuvant from Vical (San Diego, CA), chitosan, cyclodextrin from Calando Pharmaceuticals (Pasadena, CA), dendrimers and poly(lactic-co-glycolic acid) (PLGA) polymers.
  • RONDELTM RNAi/Oligonucleotide Nanoparticle Delivery
  • PHASERXTM pH responsive co-block polymers
  • a non-limiting example of PLGA formulations include, but are not limited to, PLGA injectable depots (e.g., ELIGARD® which is formed by dissolving PLGA in 66% N-methyl-2-pyrrolidone (NMP) and the remainder being aqueous solvent and leuprolide. Once injected, the PLGA and leuprolide peptide precipitates into the subcutaneous space).
  • PLGA injectable depots e.g., ELIGARD® which is formed by dissolving PLGA in 66% N-methyl-2-pyrrolidone (NMP) and the remainder being aqueous solvent and leuprolide. Once injected, the PLGA and leuprolide peptide precipitates into the subcutaneous space).
  • the first of these delivery approaches uses dynamic polyconjugates and has been shown in vivo in mice to effectively deliver siRNA and silence endogenous target mRNA in hepatocytes (Rozema et al, Proc Natl Acad Sci U S A. 2007 104: 12982- 12887).
  • This particular approach is a multicomponent polymer system whose key features include a membrane-active polymer to which nucleic acid, in this case siRNA, is covalently coupled via a disulfide bond and where both PEG (for charge masking) and N- acetylgalactosamine (for hepatocyte targeting) groups are linked via pH-sensitive bonds (Rozema et al, Proc Natl Acad Sci U S A.
  • the polymer formulation can permit the sustained or delayed release of the polynucleotide, primary construct, or mmRNA (e.g., following intramuscular or subcutaneous injection).
  • the altered release profile for the polynucleotide, primary construct, or mmRNA can result in, for example, translation of an encoded protein over an extended period of time.
  • the polymer formulation may also be used to increase the stability of the polynucleotide, primary construct, or mmRNA.
  • Biodegradable polymers have been previously used to protect nucleic acids other than mmRNA from degradation and been shown to result in sustained release of payloads in vivo (Rozema et al., Proc Natl Acad Sci U S A.
  • the pharmaceutical compositions may be sustained release formulations.
  • the sustained release formulations may be for subcutaneous delivery.
  • Sustained release formulations may include, but are not limited to, PLGA microspheres, ethylene vinyl acetate (EVAc), poloxamer, GELSITE®
  • HYLENEX® Hazyme Therapeutics, San Diego CA
  • surgical sealants such as fibrinogen polymers (Ethicon Inc. Cornelia, GA), TISSELL® (Baxter International, Inc Deerfield, IL), PEG-based sealants, and COSEAL® (Baxter International, Inc Deerfield, IL).
  • modified mRNA may be formulated in PLGA microspheres by preparing the PLGA microspheres with tunable release rates (e.g., days and weeks) and encapsulating the modified mRNA in the PLGA microspheres while maintaining the integrity of the modified mRNA during the encapsulation process.
  • EVAc are non-biodegradable, biocompatible polymers which are used extensively in pre-clinical sustained release implant applications (e.g., extended release products Ocusert a pilocarpine ophthalmic insert for glaucoma or progestasert a sustained release progesterone intrauterine device; transdermal delivery systems Testoderm, Duragesic and Selegiline; catheters).
  • Poloxamer F-407 NF is a hydrophilic, non-ionic surfactant triblock copolymer of poly oxyethylene-polyoxypropylene-polyoxy ethylene having a low viscosity at temperatures less than 5°C and forms a solid gel at temperatures greater than 15°C.
  • PEG-based surgical sealants comprise two synthetic PEG components mixed in a delivery device which can be prepared in one minute, seals in 3 minutes and is reabsorbed within 30 days.
  • GELSITE® and natural polymers are capable of in-situ gelation at the site of administration. They have been shown to interact with protein and peptide therapeutic candidates through ionic interaction to provide a stabilizing effect.
  • Polymer formulations can also be selectively targeted through expression of different ligands as exemplified by, but not limited by, folate, transferrin, and N- acetylgalactosamine (GalNAc) (Benoit et al, Biomacromolecules. 201 1 12:2708-2714; Rozema et al, Proc Natl Acad Sci U S A. 2007 104: 12982-12887; Davis, Mol Pharm. 2009 6:659-668; Davis, Nature 2010 464: 1067-1070; each of which is herein
  • the polynucleotides, primary constructs and/or mmRNA of the invention may be formulated with or in a polymeric compound.
  • the polymer may include at least one polymer such as, but not limited to, polyethenes, polyethylene glycol (PEG), poly(l- lysine)(PLL), PEG grafted to PLL, cationic lipopolymer, biodegradable cationic lipopolymer, polyethyleneimine (PEI), cross-linked branched poly(alkylene imines), a polyamine derivative, a modified poloxamer, a biodegradable polymer, biodegradable block copolymer, biodegradable random copolymer, biodegradable polyester copolymer, biodegradable polyester block copolymer, biodegradable polyester block random copolymer, linear biodegradable copolymer, poly[a-(4-aminobutyl)-L-glycolic acid) (PAGA), biodegradable cross-
  • the polynucleotides, primary constructs and/or mmRNA of the invention may be formulated with the polymeric compound of PEG grafted with PLL as described in U.S. Pat. No. 6,177,274 herein incorporated by reference in its entirety.
  • the formulation may be used for transfecting cells in vitro or for in vivo delivery of the polynucleotides, primary constructs and/or mmRNA.
  • the polynucleotides, primary constructs and/or mmRNA may be suspended in a solution or medium with a cationic polymer, in a dry pharmaceutical composition or in a solution that is capable of being dried as described in U.S. Pub. Nos. 20090042829 and 20090042825 each of which are herein incorporated by reference in their entireties.
  • polynucleotides, primary constructs or mmRNA of the invention may be formulated with a PLGA-PEG block copolymer (see US Pub. No. US20120004293 and US Pat No. 8,236,330, each of which is herein incorporated by reference in their entireties).
  • a PLGA-PEG block copolymer see US Pub. No. US20120004293 and US Pat No. 8,236,330, each of which is herein incorporated by reference in their entireties.
  • polynucleotides, primary constructs or mmRNA of the invention may be formulated with a diblock copolymer of PEG and PLA or PEG and PLGA (see US Pat No 8,246,968, herein incorporated by reference in its entirety).
  • a polyamine derivative may be used to deliver nucleic acids or to treat and/or prevent a disease or to be included in an implantable or injectable device (U.S. Pub. No. 20100260817 herein incorporated by reference in its entirety).
  • a pharmaceutical composition may include the modified nucleic acids and mmRNA and the polyamine derivative described in U.S. Pub. No. 20100260817 (the contents of which are incorporated herein by reference in its entirety.
  • the polynucleotides, primary constructs or mmRNA of the invention may be formulated with at least one acrylic polymer.
  • Acrylic polymers include but are not limited to, acrylic acid, methacrylic acid, acrylic acid and methacrylic acid copolymers, methyl methacrylate copolymers, ethoxyethyl methacrylates, cyanoethyl methacrylate, amino alkyl methacrylate copolymer, poly(acrylic acid), poly(methacrylic acid), polycyanoacrylates and combinations thereof.
  • the polynucleotides, primary constructs or mmRNA of the present invention may be formulated with at least one polymer described in International Publication Nos. WO20111 15862, WO2012082574 and WO2012068187, each of which is herein incorporated by reference in their entireties.
  • the polynucleotides, primary constructs or mmRNA of the present invention may be formulated with a polymer of formula Z as described in WO2011 115862, herein incorporated by reference in its entirety.
  • the polynucleotides, primary constructs or mmRNA may be formulated with a polymer of formula Z, Z' or Z" as described in WO2012082574 or WO2012068187, each of which are herein incorporated by reference in their entireties.
  • the polymers formulated with the modified RNA of the present invention may be synthesized by the methods described in
  • Formulations of polynucleotides, primary constructs or mmRNA of the invention may include at least one amine-containing polymer such as, but not limited to polylysine, polyethylene imine, poly(amidoamine) dendrimers or combinations thereof.
  • the polynucleotides, primary constructs and/or mmRNA of the invention may be formulated in a pharmaceutical compound including a poly(alkylene imine), a biodegradable cationic lipopolymer, a biodegradable block copolymer, a biodegradable polymer, or a biodegradable random copolymer, a biodegradable polyester block copolymer, a biodegradable polyester polymer, a biodegradable polyester random copolymer, a linear biodegradable copolymer, PAGA, a biodegradable cross-linked cationic multi-block copolymer or combinations thereof.
  • a pharmaceutical compound including a poly(alkylene imine), a biodegradable cationic lipopolymer, a biodegradable block copolymer, a biodegradable polymer, or a biodegradable random copolymer, a biodegradable polyester block copolymer, a biodegradable polyester polymer,
  • the biodegradable cationic lipopolymer may be made my methods known in the art and/or described in U.S. Pat. No. 6,696,038, U.S. App. Nos. 20030073619 and 20040142474 each of which is herein incorporated by reference in their entireties.
  • the poly(alkylene imine) may be made using methods known in the art and/or as described in U.S. Pub. No. 20100004315, herein incorporated by reference in its entirety.
  • biodegradable polymer, biodegradable block copolymer, the biodegradable random copolymer, biodegradable polyester block copolymer, biodegradable polyester polymer, or biodegradable polyester random copolymer may be made using methods known in the art and/or as described in U.S. Pat. Nos. 6,517,869 and 6,267,987, the contents of which are each incorporated herein by reference in its entirety.
  • the linear biodegradable copolymer may be made using methods known in the art and/or as described in U.S. Pat. No. 6,652,886.
  • the PAGA polymer may be made using methods known in the art and/or as described in U.S. Pat. Nos.
  • the PAGA polymer may be copolymerized to form a copolymer or block copolymer with polymers such as but not limited to, poly-L-lysine, polyarginine, polyornithine, histones, avidin, protamines, polylactides and poly(lactide-co-glycolides).
  • the biodegradable cross-linked cationic multi-block copolymers may be made my methods known in the art and/or as described in U.S. Pat. No. 8,057,821 or U.S. Pub. No. 2012009145 each of which is herein incorporated by reference in their entireties.
  • the multi-block copolymers may be synthesized using linear polyethyleneimine (LPEI) blocks which have distinct patterns as compared to branched polyethyleneimines.
  • LPEI linear polyethyleneimine
  • the composition or pharmaceutical composition may be made by the methods known in the art, described herein, or as described in U.S. Pub. No. 20100004315 or U.S. Pat. Nos. 6,267,987 and 6,217,912 each of which is herein incorporated by reference in their entireties.
  • the polynucleotides, primary constructs, and mmRNA of the invention may be formulated with at least one degradable polyester which may contain polycationic side chains.
  • Degradable polyesters include, but are not limited to, poly(serine ester), poly(L- lactide-co-L-lysine), poly(4-hydroxy-L-proline ester), and combinations thereof.
  • the degradable polyesters may include a PEG conjugation to form a PEGylated polymer.
  • the polymers described herein may be conjugated to a lipid-terminating PEG.
  • PLGA may be conjugated to a lipid- terminating PEG forming PLGA-DSPE-PEG.
  • PEG conjugates for use with the present invention are described in International Publication No. WO2008103276, herein incorporated by reference in its entirety.
  • the polynucleotides, primary constructs and/or mmRNA described herein may be conjugated with another compound.
  • conjugates are described in US Patent Nos. 7,964,578 and 7,833,992, each of which are herein incorporated by reference in their entireties.
  • the polynucleotides, primary constructs and/or mmRNA of the present invention may be conjugated with conjugates of formula 1-122 as described in US Patent Nos. 7,964,578 and 7,833,992, each of which are herein incorporated by reference in their entireties.
  • a gene delivery composition may include a nucleotide sequence and a poloxamer.
  • the polynucleotide, primary construct and/or mmRNA of the present invention may be used in a gene delivery composition with the poloxamer described in U.S. Pub. No. 20100004313.
  • the polymer formulation of the present invention may be stabilized by contacting the polymer formulation, which may include a cationic carrier, with a cationic lipopolymer which may be covalently linked to cholesterol and polyethylene glycol groups.
  • the polymer formulation may be contacted with a cationic lipopolymer using the methods described in U.S. Pub. No. 20090042829 herein incorporated by reference in its entirety.
  • the cationic carrier may include, but is not limited to, polyethylenimine, poly(trimethylenimine), poly(tetramethylenimine), polypropylenimine, aminoglycoside-polyamine, dideoxy-diamino-b-cyclodextrin, spermine, spermidine, poly(2-dimethylamino)ethyl methacrylate, poly(lysine), poly(histidine), poly(arginine), cationized gelatin, dendrimers, chitosan, l,2-Dioleoyl-3- Trimethylammonium-Propane(DOTAP), N-[l-(2,3-dioleoyloxy)propyl]-N,N,N- trimethylammonium chloride (DOTMA), l-[2-(oleoyloxy)ethyl]-2-oleyl-3-(2- hydroxyethyl)imidazolinium chloride (DOTIM), 2,3-di
  • the polynucleotide, primary construct, and mmRNA of the invention can also be formulated as a nanoparticle using a combination of polymers, lipids, and/or other biodegradable agents, such as, but not limited to, calcium phosphate.
  • Components may be combined in a core-shell, hybrid, and/or layer-by-layer architecture, to allow for fine- tuning of the nanoparticle so to delivery of the polynucleotide, primary construct and mmRNA may be enhanced (Wang et al, Nat Mater. 2006 5:791-796; Fuller et al, Biomaterials. 2008 29: 1526-1532; DeKoker et al, Adv Drug Deliv Rev.
  • Biodegradable calcium phosphate nanoparticles in combination with lipids and/or polymers have been shown to deliver polynucleotides, primary constructs and mmRNA in vivo.
  • a lipid coated calcium phosphate nanoparticle which may also contain a targeting ligand such as anisamide, may be used to deliver the polynucleotide, primary construct and mmRNA of the present invention.
  • a targeting ligand such as anisamide
  • This delivery system combines both a targeted nanoparticle and a component to enhance the endosomal escape, calcium phosphate, in order to improve delivery of the siRNA.
  • calcium phosphate with a PEG-polyanion block copolymer may be used to delivery polynucleotides, primary constructs and mmRNA (Kazikawa et al, J Contr Rel. 2004 97:345-356; Kazikawa et al., J Contr Rel. 2006 11 1 :368-370).
  • a PEG-charge-conversional polymer (Pitella et al, Biomaterials. 2011 32:3106-31 14) may be used to form a nanoparticle to deliver the polynucleotides, primary constructs and mmRNA of the present invention.
  • the PEG- charge-conversional polymer may improve upon the PEG-polyanion block copolymers by being cleaved into a polycation at acidic pH, thus enhancing endosomal escape.
  • core-shell nanoparticles have additionally focused on a high- throughput approach to synthesize cationic cross-linked nanogel cores and various shells (Siegwart et al, Proc Natl Acad Sci U S A. 2011 108: 12996-13001).
  • the complexation, delivery, and internalization of the polymeric nanoparticles can be precisely controlled by altering the chemical composition in both the core and shell components of the nanoparticle.
  • the core-shell nanoparticles may efficiently deliver siRNA to mouse hepatocytes after they covalently attach cholesterol to the nanoparticle.
  • a hollow lipid core comprising a middle PLGA layer and an outer neutral lipid layer containing PEG may be used to delivery of the polynucleotide, primary construct and mmRNA of the present invention.
  • a luciferase-expressing tumor it was determined that the lipid-polymer-lipid hybrid nanoparticle significantly suppressed luciferase expression, as compared to a conventional lipoplex (Shi et al, Angew Chem Int Ed. 2011 50:7027-7031).
  • the synthetic polynucleotides and/or synthetic sgRNAs of the invention can be formulated with peptides and/or proteins in order to increase transfection of cells by the polynucleotide, primary construct, or mmRNA.
  • peptides such as, but not limited to, cell penetrating peptides and proteins and peptides that enable intracellular delivery may be used to deliver pharmaceutical formulations.
  • a non-limiting example of a cell penetrating peptide which may be used with the pharmaceutical formulations of the present invention includes a cell-penetrating peptide sequence attached to polycations that facilitates delivery to the intracellular space, e.g., HIV-derived TAT peptide, penetratins, transportans, or hCT derived cell-penetrating peptides (see, e.g., Caron et al, Mol. Ther. 3(3):310-8 (2001); Langel, Cell-Penetrating Peptides: Processes and
  • compositions can also be formulated to include a cell penetrating agent, e.g., liposomes, which enhance delivery of the compositions to the intracellular space
  • a cell penetrating agent e.g., liposomes
  • polynucleotides, primary constructs, and mmRNA of the invention may be complexed to peptides and/or proteins such as, but not limited to, peptides and/or proteins from Aileron Therapeutics (Cambridge, MA) and Permeon Biologies (Cambridge, MA) in order to enable intracellular delivery (Cronican et al, ACS Chem. Biol. 2010 5:747-752; McNaughton et al, Proc. Natl. Acad. Sci.
  • the cell-penetrating polypeptide may comprise a first domain and a second domain.
  • the first domain may comprise a supercharged
  • the second domain may comprise a protein-binding partner.
  • protein-binding partner includes, but are not limited to, antibodies and functional fragments thereof, scaffold proteins, or peptides.
  • the cell-penetrating polypeptide may further comprise an intracellular binding partner for the protein-binding partner.
  • the cell- penetrating polypeptide may be capable of being secreted from a cell where the polynucleotide, primary construct, or mmRNA may be introduced.
  • Formulations of the including peptides or proteins may be used to increase cell transfection by the polynucleotide, primary construct, or mmRNA, alter the
  • biodistribution of the polynucleotide, primary construct, or mmRNA e.g., by targeting specific tissues or cell types, and/or increase the translation of encoded protein.
  • the polynucleotide, primary construct, and mmRNA of the invention can be transfected ex vivo into cells, which are subsequently transplanted into a subject.
  • the pharmaceutical compositions may include red blood cells to deliver modified RNA to liver and myeloid cells, virosomes to deliver modified RNA in virus-like particles (VLPs), and electroporated cells such as, but not limited to, from MAXCYTE® (Gaithersburg, MD) and from ERYTECH® (Lyon, France) to deliver modified RNA. Examples of use of red blood cells, viral particles and electroporated cells to deliver payloads other than mmRNA have been documented (Godfrin et al, Expert Opin Biol Ther.
  • polynucleotides, primary constructs and mmRNA may be delivered in synthetic VLPs synthesized by the methods described in International Pub No.
  • Cell-based formulations of the polynucleotide, primary construct, and mmRNA of the invention may be used to ensure cell transfection (e.g., in the cellular carrier), alter the biodistribution of the polynucleotide, primary construct, or mmRNA (e.g., by targeting the cell carrier to specific tissues or cell types), and/or increase the translation of encoded protein.
  • nucleic acid into a cell
  • non-viral mediated techniques include, but are not limited to, electroporation, calcium phosphate mediated transfer, nucleofection, sonoporation, heat shock, magnetofection, liposome mediated transfer, microinjection, microprojectile mediated transfer (nanoparticles), cationic polymer mediated transfer (DEAE-dextran,
  • polyethylenimine polyethylene glycol (PEG) and the like
  • cell fusion cell fusion
  • Sonoporation or cellular sonication
  • sound e.g., ultrasonic frequencies
  • Sonoporation methods are known to those in the art and are used to deliver nucleic acids in vivo (Yoon and Park, Expert Opin Drug Deliv. 2010 7:321-330; Postema and Gilja, Curr Pharm Biotechnol. 2007 8:355-361 ; Newman and Bettinger, Gene Ther. 2007 14:465-475; all herein incorporated by reference in their entirety).
  • Electroporation techniques are also well known in the art and are used to deliver nucleic acids in vivo and clinically (Andre et al, Curr Gene Ther. 2010 10:267- 280; Chiarella et al, Curr Gene Ther. 2010 10:281-286; Hojman, Curr Gene Ther. 2010 10: 128-138; all herein incorporated by reference in their entirety).
  • polynucleotides, primary constructs or mmRNA may be delivered by electroporation as described in Example 26.
  • the intramuscular or subcutaneous localized injection of polynucleotide, primary construct, or mmRNA of the invention can include hyaluronidase, which catalyzes the hydrolysis of hyaluronan.
  • hyaluronidase catalyzes the hydrolysis of hyaluronan.
  • hyaluronidase By catalyzing the hydrolysis of hyaluronan, a constituent of the interstitial barrier, hyaluronidase lowers the viscosity of hyaluronan, thereby increasing tissue permeability (Frost, Expert Opin. Drug Deliv. (2007) 4:427-440; herein incorporated by reference in its entirety). It is useful to speed their dispersion and systemic distribution of encoded proteins produced by transfected cells.
  • the hyaluronidase can be used to increase the number of cells exposed to a
  • the polynucleotide, primary construct or mmRNA of the invention may be encapsulated within and/or absorbed to a nanoparticle mimic.
  • a nanoparticle mimic can mimic the delivery function organisms or particles such as, but not limited to, pathogens, viruses, bacteria, fungus, parasites, prions and cells.
  • the polynucleotide, primary construct or mmRNA of the invention may be encapsulated in a non-viron particle which can mimic the delivery function of a virus (see International Pub. No. WO2012006376 herein incorporated by reference in its entirety).
  • the polynucleotides, primary constructs or mmRNA of the invention can be attached or otherwise bound to at least one nanotube such as, but not limited to, rosette nanotubes, rosette nanotubes having twin bases with a linker, carbon nanotubes and/or single-walled carbon nanotubes,
  • the polynucleotides, primary constructs or mmRNA may be bound to the nanotubes through forces such as, but not limited to, steric, ionic, covalent and/or other forces.
  • the nanotube can release one or more polynucleotides, primary constructs or mmRNA into cells.
  • the size and/or the surface structure of at least one nanotube may be altered so as to govern the interaction of the nanotubes within the body and/or to attach or bind to the polynucleotides, primary constructs or mmRNA disclosed herein.
  • the building block and/or the functional groups attached to the building block of the at least one nanotube may be altered to adjust the dimensions and/or properties of the nanotube.
  • the length of the nanotubes may be altered to hinder the nanotubes from passing through the holes in the walls of normal blood vessels but still small enough to pass through the larger holes in the blood vessels of tumor tissue.
  • At least one nanotube may also be coated with delivery enhancing compounds including polymers, such as, but not limited to, polyethylene glycol.
  • delivery enhancing compounds including polymers, such as, but not limited to, polyethylene glycol.
  • at least one nanotube and/or the polynucleotides, primary constructs or mmRNA may be mixed with pharmaceutically acceptable excipients and/or delivery vehicles.
  • the polynucleotides, primary constructs or mmRNA are attached and/or otherwise bound to at least one rosette nanotube.
  • the rosette nanotubes may be formed by a process known in the art and/or by the process described in
  • At least one polynucleotide, primary construct and/or mmRNA may be attached and/or otherwise bound to at least one rosette nanotube by a process as described in International Publication No. WO2012094304, herein incorporated by reference in its entirety, where rosette nanotubes or modules forming rosette nanotubes are mixed in aqueous media with at least one polynucleotide, primary construct and/or mmRNA under conditions which may cause at least one polynucleotide, primary construct or mmRNA to attach or otherwise bind to the rosette nanotubes.
  • the polynucleotides, primary constructs, and mmRNA of the invention include conjugates, such as a polynucleotide, primary construct, or mmRNA covalently linked to a carrier or targeting group, or including two encoding regions that together produce a fusion protein (e.g., bearing a targeting group and therapeutic protein or peptide).
  • conjugates such as a polynucleotide, primary construct, or mmRNA covalently linked to a carrier or targeting group, or including two encoding regions that together produce a fusion protein (e.g., bearing a targeting group and therapeutic protein or peptide).
  • the conjugates of the invention include a naturally occurring substance, such as a protein (e.g., human serum albumin (HSA), low-density lipoprotein (LDL), high- density lipoprotein (HDL), or globulin); an carbohydrate (e.g., a dextran, pullulan, chitin, chitosan, inulin, cyclodextrin or hyaluronic acid); or a lipid.
  • the ligand may also be a recombinant or synthetic molecule, such as a synthetic polymer, e.g., a synthetic polyamino acid, an oligonucleotide (e.g. an aptamer).
  • polyamino acids examples include polyamino acid is a polylysine (PLL), poly L-aspartic acid, poly L-glutamic acid, styrene-maleic acid anhydride copolymer, poly(L-lactide-co-glycolied) copolymer, divinyl ether-maleic anhydride copolymer, N-(2-hydroxypropyl)methacrylamide copolymer (HMPA), polyethylene glycol (PEG), polyvinyl alcohol (PVA), polyurethane, poly(2-ethylacryllic acid), N-isopropylacrylamide polymers, or polyphosphazine.
  • PLL polylysine
  • poly L-aspartic acid poly L-glutamic acid
  • styrene-maleic acid anhydride copolymer poly(L-lactide-co-glycolied) copolymer
  • divinyl ether-maleic anhydride copolymer divinyl ether-
  • polyamines include: polyethylenimine, polylysine (PLL), spermine, spermidine, polyamine, pseudopeptide-polyamine, peptidomimetic polyamine, dendrimer polyamine, arginine, amidine, protamine, cationic lipid, cationic porphyrin, quaternary salt of a polyamine, or an alpha helical peptide.
  • the conjugate of the present invention may function as a carrier for the polynucleotides, primary constructs and/or mmRNA of the present invention.
  • the conjugate may comprise a cationic polymer such as, but not limited to, polyamine, polylysine, polyalkylenimine, and polyethylenimine which may be grafted to with poly(ethylene glycol).
  • the conjugate may be similar to the polymeric conjugate and the method of synthesizing the polymeric conjugate described in U.S. Pat. No. 6,586,524 herein incorporated by reference in its entirety.
  • the conjugates can also include targeting groups, e.g., a cell or tissue targeting agent, e.g., a lectin, glycoprotein, lipid or protein, e.g., an antibody, that binds to a specified cell type such as a kidney cell.
  • a cell or tissue targeting agent e.g., a lectin, glycoprotein, lipid or protein, e.g., an antibody, that binds to a specified cell type such as a kidney cell.
  • a targeting group can be a thyrotropin, melanotropin, lectin, glycoprotein, surfactant protein A, Mucin carbohydrate, multivalent lactose, multivalent galactose, N-acetyl-galactosamine, N-acetyl-gulucosamine multivalent mannose, multivalent fucose, glycosylated polyaminoacids, multivalent galactose, transferrin, bisphosphonate, polyglutamate, polyaspartate, a lipid, cholesterol, a steroid, bile acid, folate, vitamin B 12, biotin, an RGD peptide, an RGD peptide mimetic or an aptamer.
  • Targeting groups can be proteins, e.g., glycoproteins, or peptides, e.g., molecules having a specific affinity for a co-ligand, or antibodies e.g., an antibody, that binds to a specified cell type such as a cancer cell, endothelial cell, or bone cell.
  • Targeting groups may also include hormones and hormone receptors. They can also include non- peptidic species, such as lipids, lectins, carbohydrates, vitamins, cofactors, multivalent lactose, multivalent galactose, N-acetyl-galactosamine, N-acetyl-gulucosamine multivalent mannose, multivalent fucose, or aptamers.
  • the ligand can be, for example, a lipopolysaccharide, or an activator of p38 MAP kinase.
  • the targeting group can be any ligand that is capable of targeting a specific receptor. Examples include, without limitation, folate, GalNAc, galactose, mannose, mannose-6P, apatamers, integrin receptor ligands, chemokine receptor ligands, transferrin, biotin, serotonin receptor ligands, PSMA, endothelin, GCPII, somatostatin, LDL, and HDL ligands.
  • the targeting group is an aptamer.
  • the aptamer can be unmodified or have any combination of modifications disclosed herein.
  • compositions of the present invention may include chemical modifications such as, but not limited to, modifications similar to locked nucleic acids.
  • LNA locked nucleic acid
  • Representative U.S. patents that teach the preparation of PNA compounds include, but are not limited to, U.S. Pat. Nos. 5,539,082; 5,714,331 ; and 5,719,262, each of which is herein incorporated by reference. Further teaching of PNA compounds can be found, for example, in Nielsen et al., Science, 1991, 254, 1497-1500.
  • Some embodiments featured in the invention include polynucleotides, primary constructs or mmRNA with phosphorothioate backbones and oligonucleosides with other modified backbones, and in particular -CH 2 -NH-CH 2 -, -CH 2 -N(CH 3 )-0-CH 2 - [known as a methylene (methylimino) or MMI backbone],— CH 2 — O— N(CH 3 )— CH 2 — ,— CH 2 -N(CH 3 )-N(CH 3 )--CH 2 - and -N(CH 3 )-CH 2 -CH 2 -[wherein the native phosphodiester backbone is represented as— O— P(0) 2 — O— CH 2 ⁇ ] of the above- referenced U.S.
  • the polynucleotides featured herein have morpholino backbone structures of the above-referenced U.S. Pat. No. 5,034,506.
  • Modifications at the 2' position may also aid in delivery.
  • modifications at the 2' position are not located in a polypeptide-coding sequence, i.e., not in a translatable region.
  • Modifications at the 2' position may be located in a 5'UTR, a 3'UTR and/or a tailing region.
  • Modifications at the 2' position can include one of the following at the 2' position: H (i.e., 2'-deoxy); F; 0-, S-, or N-alkyl; 0-, S-, or N-alkenyl; 0-, S- or N-alkynyl; or O-alkyl-O-alkyl, wherein the alkyl, alkenyl and alkynyl may be substituted or unsubstituted Ci to C 10 alkyl or C 2 to C 10 alkenyl and alkynyl.
  • Exemplary suitable modifications include 0[(CH 2 ) n O] m CH 3 , 0(CH 2 ).
  • n OCH 3 0(CH 2 ) n NH 2 , 0(CH 2 ) n CH 3 , 0(CH 2 ) n ONH 2 , and 0(CH 2 ) n ON[(CH 2 ) n CH 3 )] 2 , where n and m are from 1 to about 10.
  • the polynucleotides, primary constructs or mmRNA include one of the following at the 2' position: Ci to C 10 lower alkyl, substituted lower alkyl, alkaryl, aralkyl, O-alkaryl or O-aralkyl, SH, SCH 3 , OCN, CI, Br, CN, CF 3 , OCF 3 , SOCH 3 , S0 2 CH 3 , ON0 2 , N0 2 , N 3 , NH 2 , heterocycloalkyl, heterocycloalkaryl, aminoalkylamino, polyalkylamino, substituted silyl, an RNA cleaving group, a reporter group, an intercalator, a group for improving the pharmacokinetic properties, or a group for improving the pharmacodynamic properties, and other substituents having similar properties.
  • the modification includes a 2'-methoxyethoxy (2'-0— CH 2 CH 2 OCH 3 , also known as 2'-0-(2-methoxyethyl) or 2'-MOE) (Martin et ah, Helv. Chim. Acta, 1995, 78:486-504) i.e., an alkoxy-alkoxy group.
  • Another exemplary modification is 2'-dimethylaminooxyethoxy, i.e., a 0(CH 2 ) 2 ON(CH 3 ) 2 group, also known as 2'-DMAOE, as described in examples herein below, and 2'- dimethylaminoethoxyethoxy (also known in the art as 2'-0-dimethylaminoethoxyethyl or 2'-DMAEOE), i.e., 2'-0-CH 2 -0-CH 2 -N(CH 2 ) 2 , also described in examples herein below.
  • the polynucleotide, primary construct, or mmRNA is covalently conjugated to a cell penetrating polypeptide.
  • the cell-penetrating peptide may also include a signal sequence.
  • the conjugates of the invention can be designed to have increased stability; increased cell transfection; and/or altered the biodistribution (e.g., targeted to specific tissues or cell types).
  • Self-assembled nanoparticles have a well-defined size which may be precisely controlled as the nucleic acid strands may be easily reprogrammable.
  • the optimal particle size for a cancer-targeting nanodelivery carrier is 20-100 nm as a diameter greater than 20 nm avoids renal clearance and enhances delivery to certain tumors through enhanced permeability and retention effect.
  • Using self-assembled nucleic acid nanoparticles a single uniform population in size and shape having a precisely controlled spatial orientation and density of cancer-targeting ligands for enhanced delivery.
  • oligonucleotide nanoparticles are prepared using programmable self-assembly of short DNA fragments and therapeutic siRNAs.
  • nanoparticles are molecularly identical with controllable particle size and target ligand location and density.
  • the DNA fragments and siRNAs self-assembled into a one-step reaction to generate DNA/siRNA tetrahedral nanoparticles for targeted in vivo delivery. (Lee et al, Nature Nanotechnology 2012 7:389-393).
  • compositions may additionally comprise a pharmaceutically acceptable excipient, which, as used herein, includes any and all solvents, dispersion media, diluents, or other liquid vehicles, dispersion or suspension aids, surface active agents, isotonic agents, thickening or emulsifying agents, preservatives, solid binders, lubricants and the like, as suited to the particular dosage form desired.
  • a pharmaceutically acceptable excipient includes any and all solvents, dispersion media, diluents, or other liquid vehicles, dispersion or suspension aids, surface active agents, isotonic agents, thickening or emulsifying agents, preservatives, solid binders, lubricants and the like, as suited to the particular dosage form desired.
  • Remington's The Science and Practice of Pharmacy 21 st Edition, A. R. Gennaro (Lippincott, Williams & Wilkins, Baltimore, MD, 2006; incorporated herein by reference) discloses various excipients used in
  • a pharmaceutically acceptable excipient is at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% pure.
  • an excipient is approved for use in humans and for veterinary use. In some embodiments, an excipient is approved by United States Food and Drug Administration. In some embodiments, an excipient is pharmaceutical grade. In some embodiments, an excipient meets the standards of the United States Pharmacopoeia (USP), the European Pharmacopoeia (EP), the British Pharmacopoeia, and/or the International Pharmacopoeia.
  • USP United States Pharmacopoeia
  • EP European Pharmacopoeia
  • British Pharmacopoeia the British Pharmacopoeia
  • International Pharmacopoeia International Pharmacopoeia
  • compositions include, but are not limited to, inert diluents, dispersing and/or granulating agents, surface active agents and/or emulsifiers, disintegrating agents, binding agents, preservatives, buffering agents, lubricating agents, and/or oils. Such excipients may optionally be included in pharmaceutical compositions.
  • Exemplary diluents include, but are not limited to, calcium carbonate, sodium carbonate, calcium phosphate, dicalcium phosphate, calcium sulfate, calcium hydrogen phosphate, sodium phosphate lactose, sucrose, cellulose, microcrystalline cellulose, kaolin, mannitol, sorbitol, inositol, sodium chloride, dry starch, cornstarch, powdered sugar, etc., and/or combinations thereof.
  • Exemplary granulating and/or dispersing agents include, but are not limited to, potato starch, corn starch, tapioca starch, sodium starch glycolate, clays, alginic acid, guar gum, citrus pulp, agar, bentonite, cellulose and wood products, natural sponge, cation- exchange resins, calcium carbonate, silicates, sodium carbonate, cross-linked polyvinylpyrrolidone) (crospovidone), sodium carboxymethyl starch (sodium starch glycolate), carboxymethyl cellulose, cross-linked sodium carboxymethyl cellulose (croscarmellose), methylcellulose, pregelatinized starch (starch 1500), microcrystalline starch, water insoluble starch, calcium carboxymethyl cellulose, magnesium aluminum silicate (VEEGUM ® ), sodium lauryl sulfate, quaternary ammonium compounds, etc., and/or combinations thereof.
  • crospovidone cross-linked polyvinylpyrrolidone
  • sodium carboxymethyl starch sodium
  • Exemplary surface active agents and/or emulsifiers include, but are not limited to, natural emulsifiers (e.g. acacia, agar, alginic acid, sodium alginate, tragacanth, chondrux, cholesterol, xanthan, pectin, gelatin, egg yolk, casein, wool fat, cholesterol, wax, and lecithin), colloidal clays (e.g. bentonite [aluminum silicate] and VEEGUM ® [magnesium aluminum silicate]), long chain amino acid derivatives, high molecular weight alcohols (e.g.
  • natural emulsifiers e.g. acacia, agar, alginic acid, sodium alginate, tragacanth, chondrux, cholesterol, xanthan, pectin, gelatin, egg yolk, casein, wool fat, cholesterol, wax, and lecithin
  • colloidal clays e.g. bentonite [aluminum si
  • stearyl alcohol cetyl alcohol, oleyl alcohol, triacetin monostearate, ethylene glycol distearate, glyceryl monostearate, and propylene glycol monostearate, polyvinyl alcohol), carbomers (e.g. carboxy polymethylene, polyacrylic acid, acrylic acid polymer, and carboxyvinyl polymer), carrageenan, cellulosic derivatives (e.g.
  • sorbitan fatty acid esters e.g. polyoxyethylene sorbitan monolaurate [TWEEN ® 20], polyoxyethylene sorbitan [TWEENn ® 60], polyoxyethylene sorbitan monooleate [TWEEN ® 80], sorbitan monopalmitate [SPAN ® 40], sorbitan monostearate [Span ® 60], sorbitan tristearate
  • Span ® 65 glyceryl monooleate, sorbitan monooleate [SPAN ® 80]
  • polyoxyethylene esters e.g. polyoxyethylene monostearate [MYRJ ® 45], polyoxyethylene hydrogenated castor oil, polyethoxylated castor oil, polyoxymethylene stearate, and SOLUTOL ®
  • sucrose fatty acid esters e.g. CREMOPHOR ®
  • polyoxyethylene ethers e.g.
  • polyoxyethylene lauryl ether [BRIJ ® 30]), polyvinylpyrrolidone), diethylene glycol monolaurate, triethanolamine oleate, sodium oleate, potassium oleate, ethyl oleate, oleic acid, ethyl laurate, sodium lauryl sulfate,
  • Exemplary binding agents include, but are not limited to, starch (e.g. cornstarch and starch paste); gelatin; sugars (e.g. sucrose, glucose, dextrose, dextrin, molasses, lactose, lactitol, mannitol,); natural and synthetic gums (e.g. acacia, sodium alginate, extract of Irish moss, panwar gum, ghatti gum, mucilage of isapol husks,
  • starch e.g. cornstarch and starch paste
  • gelatin e.g. sucrose, glucose, dextrose, dextrin, molasses, lactose, lactitol, mannitol
  • natural and synthetic gums e.g. acacia, sodium alginate, extract of Irish moss, panwar gum, ghatti gum, mucilage of isapol husks
  • carboxymethylcellulose methylcellulose, ethylcellulose, hydroxyethylcellulose, hydroxypropyl cellulose, hydroxypropyl methylcellulose, microcrystalline cellulose, cellulose acetate, poly(vinyl-pyrrolidone), magnesium aluminum silicate (Veegum ® ), and larch arabogalactan); alginates; polyethylene oxide; polyethylene glycol; inorganic calcium salts; silicic acid; polymethacrylates; waxes; water; alcohol; etc. ; and
  • Exemplary preservatives may include, but are not limited to, antioxidants, chelating agents, antimicrobial preservatives, antifungal preservatives, alcohol preservatives, acidic preservatives, and/or other preservatives.
  • Exemplary antioxidants include, but are not limited to, alpha tocopherol, ascorbic acid, acorbyl palmitate, butylated hydroxyanisole, butylated hydroxytoluene, monothioglycerol, potassium metabisulfite, propionic acid, propyl gallate, sodium ascorbate, sodium bisulfite, sodium metabisulfite, and/or sodium sulfite.
  • Exemplary chelating agents include
  • ethylenediaminetetraacetic acid citric acid monohydrate, disodium edetate, dipotassium edetate, edetic acid, fumaric acid, malic acid, phosphoric acid, sodium edetate, tartaric acid, and/or trisodium edetate.
  • EDTA ethylenediaminetetraacetic acid
  • antimicrobial preservatives include, but are not limited to, benzalkonium chloride, benzethonium chloride, benzyl alcohol, bronopol, cetrimide, cetylpyridinium chloride, chlorhexidine, chlorobutanol, chlorocresol, chloroxylenol, cresol, ethyl alcohol, glycerin, hexetidine, imidurea, phenol, phenoxyethanol, phenylethyl alcohol, phenylmercuric nitrate, propylene glycol, and/or thimerosal.
  • Exemplary antifungal preservatives include, but are not limited to, butyl paraben, methyl paraben, ethyl paraben, propyl paraben, benzoic acid, hydroxybenzoic acid, potassium benzoate, potassium sorbate, sodium benzoate, sodium propionate, and/or sorbic acid.
  • Exemplary alcohol preservatives include, but are not limited to, ethanol, polyethylene glycol, phenol, phenolic compounds, bisphenol, chlorobutanol,
  • Exemplary acidic preservatives include, but are not limited to, vitamin A, vitamin C, vitamin E, beta-carotene, citric acid, acetic acid, dehydroacetic acid, ascorbic acid, sorbic acid, and/or phytic acid.
  • Other acids include, but are not limited to, vitamin A, vitamin C, vitamin E, beta-carotene, citric acid, acetic acid, dehydroacetic acid, ascorbic acid, sorbic acid, and/or phytic acid.
  • Other acidsic preservatives include, but are not limited to, vitamin A, vitamin C, vitamin E, beta-carotene, citric acid, acetic acid, dehydroacetic acid, ascorbic acid, sorbic acid, and/or phytic acid.
  • preservatives include, but are not limited to, tocopherol, tocopherol acetate, deteroxime mesylate, cetrimide, butylated hydroxyanisol (BHA), butylated hydroxytoluened (BHT), ethylenediamine, sodium lauryl sulfate (SLS), sodium lauryl ether sulfate (SLES), sodium bisulfite, sodium metabisulfite, potassium sulfite, potassium metabisulfite, GLYDANT PLUS ® , PHENONIP ® , methylparaben, GERMALL ® 115, GERMABEN ® II, NEOLONETM, KATHONTM, and/or EUXYL ® .
  • Exemplary buffering agents include, but are not limited to, citrate buffer solutions, acetate buffer solutions, phosphate buffer solutions, ammonium chloride, calcium carbonate, calcium chloride, calcium citrate, calcium glubionate, calcium gluceptate, calcium gluconate, D-gluconic acid, calcium glycerophosphate, calcium lactate, propanoic acid, calcium levulinate, pentanoic acid, dibasic calcium phosphate, phosphoric acid, tribasic calcium phosphate, calcium hydroxide phosphate, potassium acetate, potassium chloride, potassium gluconate, potassium mixtures, dibasic potassium phosphate, monobasic potassium phosphate, potassium phosphate mixtures, sodium acetate, sodium bicarbonate, sodium chloride, sodium citrate, sodium lactate, dibasic sodium phosphate, monobasic sodium phosphate, sodium phosphate mixtures, tromethamine, magnesium hydroxide, aluminum hydroxide, alginic acid, pyrogen-free water,
  • Exemplary lubricating agents include, but are not limited to, magnesium stearate, calcium stearate, stearic acid, silica, talc, malt, glyceryl behanate, hydrogenated vegetable oils, polyethylene glycol, sodium benzoate, sodium acetate, sodium chloride, leucine, magnesium lauryl sulfate, sodium lauryl sulfate, etc., and combinations thereof.
  • oils include, but are not limited to, almond, apricot kernel, avocado, babassu, bergamot, black current seed, borage, cade, camomile, canola, caraway, carnauba, castor, cinnamon, cocoa butter, coconut, cod liver, coffee, corn, cotton seed, emu, eucalyptus, evening primrose, fish, flaxseed, geraniol, gourd, grape seed, hazel nut, hyssop, isopropyl myristate, jojoba, kukui nut, lavandin, lavender, lemon, litsea cubeba, macademia nut, mallow, mango seed, meadowfoam seed, mink, nutmeg, olive, orange, orange roughy, palm, palm kernel, peach kernel, peanut, poppy seed, pumpkin seed, rapeseed, rice bran, rosemary, safflower, sandalwood, sasquana,
  • oils include, but are not limited to, butyl stearate, caprylic triglyceride, capric triglyceride, cyclomethicone, diethyl sebacate, dimethicone 360, isopropyl myristate, mineral oil, octyldodecanol, oleyl alcohol, silicone oil, and/or combinations thereof.
  • Excipients such as cocoa butter and suppository waxes, coloring agents, coating agents, sweetening, flavoring, and/or perfuming agents can be present in the composition, according to the judgment of the formulator.
  • the present disclosure encompasses the delivery of polynucleotides, primary constructs or mmRNA for any of therapeutic, pharmaceutical, diagnostic or imaging by any appropriate route taking into consideration likely advances in the sciences of drug delivery. Delivery may be naked or formulated. Naked Delivery
  • the polynucleotides, primary constructs or mmRNA of the present invention may be delivered to a cell naked.
  • naked refers to delivering polynucleotides, primary constructs or mmRNA free from agents which promote transfection.
  • the polynucleotides, primary constructs or mmRNA delivered to the cell may contain no modifications.
  • the naked polynucleotides, primary constructs or mmRNA may be delivered to the cell using routes of administration known in the art and described herein.
  • the polynucleotides, primary constructs or mmRNA of the present invention may be formulated, using the methods described herein.
  • the formulations may contain polynucleotides, primary constructs or mmRNA which may be modified and/or unmodified.
  • the formulations may further include, but are not limited to, cell penetration agents, a pharmaceutically acceptable carrier, a delivery agent, a bioerodible or biocompatible polymer, a solvent, and a sustained-release delivery depot.
  • the formulated polynucleotides, primary constructs or mmRNA may be delivered to the cell using routes of administration known in the art and described herein.
  • compositions may also be formulated for direct delivery to an organ or tissue in any of several ways in the art including, but not limited to, direct soaking or bathing, via a catheter, by gels, powder, ointments, creams, gels, lotions, and/or drops, by using substrates such as fabric or biodegradable materials coated or impregnated with the compositions, and the like.
  • the polynucleotides, primary constructs or mmRNA of the present invention may be administered by any route which results in a therapeutically effective outcome. These include, but are not limited to enteral, gastroenteral, epidural, oral, transdermal, epidural (peridural), intracerebral (into the cerebrum), intracerebroventricular (into the cerebral ventricles), epicutaneous (application onto the skin), intradermal, (into the skin itself), subcutaneous (under the skin), nasal administration (through the nose), intravenous (into a vein), intraarterial (into an artery), intramuscular (into a muscle), intracardiac (into the heart), intraosseous infusion (into the bone marrow), intrathecal (into the spinal canal), intraperitoneal, (infusion or injection into the peritoneum), intravesical infusion, intravitreal, (through the eye), intracavernous injection, ( into the base of the penis), intravaginal administration, intrauter
  • compositions may be administered in a way which allows them cross the blood-brain barrier, vascular barrier, or other epithelial barrier .
  • routes of administration for the polynucleotides, primary constructs or mmRNA of the present invention are described below.
  • Liquid dosage forms for oral and parenteral administration include, but are not limited to, pharmaceutically acceptable emulsions, microemulsions, solutions, suspensions, syrups, and/or elixirs.
  • liquid dosage forms may comprise inert diluents commonly used in the art such as, for example, water or other solvents, solubilizing agents and emulsifiers such as ethyl alcohol, isopropyl alcohol, ethyl carbonate, ethyl acetate, benzyl alcohol, benzyl benzoate, propylene glycol, 1,3-butylene glycol, dimethylformamide, oils (in particular, cottonseed, groundnut, corn, germ, olive, castor, and sesame oils), glycerol, tetrahydrofurfuryl alcohol, polyethylene glycols and fatty acid esters of sorbitan, and mixtures thereof.
  • inert diluents commonly used in the art such as, for example,
  • oral compositions can include adjuvants such as wetting agents, emulsifying and suspending agents, sweetening, flavoring, and/or perfuming agents.
  • adjuvants such as wetting agents, emulsifying and suspending agents, sweetening, flavoring, and/or perfuming agents.
  • compositions are mixed with solubilizing agents such as CREMOPHOR ® , alcohols, oils, modified oils, glycols, polysorbates, cyclodextrins, polymers, and/or combinations thereof.
  • Injectable preparations for example, sterile injectable aqueous or oleaginous suspensions may be formulated according to the known art using suitable dispersing agents, wetting agents, and/or suspending agents.
  • Sterile injectable preparations may be sterile injectable solutions, suspensions, and/or emulsions in nontoxic parenterally acceptable diluents and/or solvents, for example, as a solution in 1,3-butanediol.
  • acceptable vehicles and solvents that may be employed are water, Ringer's solution, U.S. P., and isotonic sodium chloride solution.
  • Sterile, fixed oils are conventionally employed as a solvent or suspending medium.
  • injectable formulations can be sterilized, for example, by filtration through a bacterial-retaining filter, and/or by incorporating sterilizing agents in the form of sterile solid compositions which can be dissolved or dispersed in sterile water or other sterile injectable medium prior to use.
  • injectable depot forms are made by forming microencapsule matrices of the drug in biodegradable polymers such as polylactide-polyglycolide. Depending upon the ratio of drug to polymer and the nature of the particular polymer employed, the rate of drug release can be controlled. Examples of other biodegradable polymers include poly(orthoesters) and poly(anhydrides). Depot injectable formulations are prepared by entrapping the drug in liposomes or microemulsions which are compatible with body tissues.
  • compositions for rectal or vaginal administration are typically suppositories which can be prepared by mixing compositions with suitable non-irritating excipients such as cocoa butter, polyethylene glycol or a suppository wax which are solid at ambient temperature but liquid at body temperature and therefore melt in the rectum or vaginal cavity and release the active ingredient.
  • suitable non-irritating excipients such as cocoa butter, polyethylene glycol or a suppository wax which are solid at ambient temperature but liquid at body temperature and therefore melt in the rectum or vaginal cavity and release the active ingredient.
  • Solid dosage forms for oral administration include capsules, tablets, pills, powders, and granules.
  • an active ingredient is mixed with at least one inert, pharmaceutically acceptable excipient such as sodium citrate or dicalcium phosphate and/or fillers or extenders (e.g. starches, lactose, sucrose, glucose, mannitol, and silicic acid), binders (e.g. carboxymethylcellulose, alginates, gelatin,
  • the dosage form may comprise buffering agents.
  • humectants e.g. glycerol
  • disintegrating agents e.g. agar, calcium carbonate, potato or tapioca starch, alginic acid, certain silicates, and sodium carbonate
  • solution retarding agents e.g. paraffin
  • absorption accelerators e.g. quaternary ammonium compounds
  • wetting agents e.g. cetyl alcohol and glycerol monostearate
  • absorbents e.g. kaolin and bentonite clay
  • lubricants e.g. talc, calcium stearate, magnesium stearate, solid polyethylene glycols, sodium lauryl sulfate
  • the dosage form may comprise buffering agents.
  • compositions containing the polynucleotides, primary constructs or mmRNA of the invention may be formulated for administration topically.
  • the skin may be an ideal target site for delivery as it is readily accessible. Gene expression may be restricted not only to the skin, potentially avoiding nonspecific toxicity, but also to specific layers and cell types within the skin.
  • the site of cutaneous expression of the delivered compositions will depend on the route of nucleic acid delivery.
  • Three routes are commonly considered to deliver polynucleotides, primary constructs or mmRNA to the skin: (i) topical application (e.g. for local/regional treatment and/or cosmetic applications); (ii) intradermal injection (e.g. for local/regional treatment and/or cosmetic applications); and (iii) systemic delivery (e.g. for treatment of dermatologic diseases that affect both cutaneous and extracutaneous regions), polynucleotides, primary constructs or mmRNA can be delivered to the skin by several different approaches known in the art.
  • the invention provides for a variety of dressings (e.g., wound dressings) or bandages (e.g., adhesive bandages) for conveniently and/or effectively carrying out methods of the present invention.
  • dressing or bandages may comprise sufficient amounts of pharmaceutical compositions and/or polynucleotides, primary constructs or mmRNA described herein to allow a user to perform multiple treatments of a subject(s).
  • the invention provides for the polynucleotides, primary constructs or mmRNA compositions to be delivered in more than one injection.
  • at least one area of tissue such as skin, may be subjected to a device and/or solution which may increase permeability.
  • the tissue may be subjected to an abrasion device to increase the permeability of the skin (see U.S. Patent Publication No.
  • the tissue may be subjected to an ultrasound enhancement device.
  • An ultrasound enhancement device may include, but is not limited to, the devices described in U.S. Publication No. 20040236268 and U.S. Patent Nos. 6,491,657 and 6,234,990; each of which is herein incorporated by reference in their entireties. Methods of enhancing the permeability of tissue are described in U.S. Publication Nos. 20040171980 and
  • a device may be used to increase permeability of tissue before delivering formulations of the polynucleotides, primary constructs and mmRNA described herein.
  • the permeability of skin may be measured by methods known in the art and/or described in U.S. Patent No. 6, 190,315, herein incorporated by reference in its entirety.
  • a modified mRNA formulation may be delivered by the drug delivery methods described in U.S. Patent No. 6, 190,315, herein incorporated by reference in its entirety.
  • tissue may be treated with a eutectic mixture of local anesthetics (EMLA) cream before, during and/or after the tissue may be subjected to a device which may increase permeability.
  • EMLA local anesthetics
  • enhancers may be applied to the tissue before, during, and/or after the tissue has been treated to increase permeability.
  • Enhancers include, but are not limited to, transport enhancers, physical enhancers, and cavitation enhancers.
  • Non-limiting examples of enhancers are described in U.S. Patent No. 6,190,315, herein incorporated by reference in its entirety.
  • a device may be used to increase permeability of tissue before delivering formulations of polynucleotides, primary constructs and/or mmRNA described herein, which may further contain a substance that invokes an immune response.
  • a formulation containing a substance to invoke an immune response may be delivered by the methods described in U.S.
  • Dosage forms for topical and/or transdermal administration of a composition may include ointments, pastes, creams, lotions, gels, powders, solutions, sprays, inhalants and/or patches.
  • an active ingredient is admixed under sterile conditions with a pharmaceutically acceptable excipient and/or any needed preservatives and/or buffers as may be required.
  • the present invention contemplates the use of transdermal patches, which often have the added advantage of providing controlled delivery of a compound to the body.
  • dosage forms may be prepared, for example, by dissolving and/or dispensing the compound in the proper medium.
  • rate may be controlled by either providing a rate controlling membrane and/or by dispersing the compound in a polymer matrix and/or gel.
  • Formulations suitable for topical administration include, but are not limited to, liquid and/or semi liquid preparations such as liniments, lotions, oil in water and/or water in oil emulsions such as creams, ointments and/or pastes, and/or solutions and/or suspensions.
  • Topically-administrable formulations may, for example, comprise from about 0.1% to about 10% (w/w) active ingredient, although the concentration of active ingredient may be as high as the solubility limit of the active ingredient in the solvent.
  • Formulations for topical administration may further comprise one or more of the additional ingredients described herein.
  • the composition is formulated in depots for extended release.
  • a specific organ or tissue a "target tissue" is targeted for administration.
  • the polynucleotides, primary constructs or mmRNA are spatially retained within or proximal to a target tissue.
  • a composition to a target tissue of a mammalian subject by contacting the target tissue (which contains one or more target cells) with the composition under conditions such that the composition, in particular the nucleic acid component(s) of the composition, is substantially retained in the target tissue, meaning that at least 10, 20, 30, 40, 50, 60, 70, 80, 85, 90, 95, 96, 97, 98, 99, 99.9, 99.99 or greater than 99.99% of the composition is retained in the target tissue.
  • retention is determined by measuring the amount of the nucleic acid present in the composition that enters one or more target cells. For example, at least 1, 5, 10, 20, 30, 40, 50, 60, 70, 80, 85, 90, 95, 96, 97, 98, 99, 99.9, 99.99 or greater than 99.99% of the nucleic acids administered to the subject are present intracellularly at a period of time following administration.
  • intramuscular injection to a mammalian subject is performed using an aqueous composition containing a ribonucleic acid and a transfection reagent, and retention of the composition is determined by measuring the amount of the ribonucleic acid present in the muscle cells.
  • aspects of the invention are directed to methods of providing a composition to a target tissue of a mammalian subject, by contacting the target tissue (containing one or more target cells) with the composition under conditions such that the composition is substantially retained in the target tissue.
  • the composition contains an effective amount of a polynucleotide, primary construct or mmRNA such that the polypeptide of interest is produced in at least one target cell.
  • the compositions generally contain a cell penetration agent, although "naked" nucleic acid (such as nucleic acids without a cell penetration agent or other agent) is also contemplated, and a pharmaceutically acceptable carrier.
  • the amount of a protein produced by cells in a tissue is desirably increased.
  • this increase in protein production is spatially restricted to cells within the target tissue.
  • a composition is provided that contains polynucleotides, primary constructs or mmRNA characterized in that a unit quantity of composition has been determined to produce the polypeptide of interest in a substantial percentage of cells contained within a predetermined volume of the target tissue.
  • the composition includes a plurality of different polynucleotides, primary constructs or mmRNA, where one or more than one of the polynucleotides, primary constructs or mmRNA encodes a polypeptide of interest.
  • the composition also contains a cell penetration agent to assist in the intracellular delivery of the composition.
  • a determination is made of the dose of the composition required to produce the polypeptide of interest in a substantial percentage of cells contained within the predetermined volume of the target tissue (generally, without inducing significant production of the polypeptide of interest in tissue adjacent to the predetermined volume, or distally to the target tissue). Subsequent to this determination, the determined dose is introduced directly into the tissue of the mammalian subject.
  • the invention provides for the polynucleotides, primary constructs or mmRNA to be delivered in more than one injection or by split dose injections.
  • the invention may be retained near target tissue using a small disposable drug reservoir or patch pump.
  • patch pumps include those manufactured and/or sold by BD® (Franklin Lakes, NJ), Insulet
  • a pharmaceutical composition may be prepared, packaged, and/or sold in a formulation suitable for pulmonary administration via the buccal cavity.
  • a formulation may comprise dry particles which comprise the active ingredient and which have a diameter in the range from about 0.5 nm to about 7 nm or from about 1 nm to about 6 nm.
  • Such compositions are suitably in the form of dry powders for
  • Such powders comprise particles wherein at least 98% of the particles by weight have a diameter greater than 0.5 nm and at least 95% of the particles by number have a diameter less than 7 nm. Alternatively, at least 95% of the particles by weight have a diameter greater than 1 nm and at least 90% of the particles by number have a diameter less than 6 nm.
  • Dry powder compositions may include a solid fine powder diluent such as sugar and are conveniently provided in a unit dose form.
  • Low boiling propellants generally include liquid propellants having a boiling point of below 65 °F at atmospheric pressure. Generally the propellant may constitute 50% to 99.9% (w/w) of the composition, and active ingredient may constitute 0.1% to 20% (w/w) of the composition. A propellant may further comprise additional ingredients such as a liquid non-ionic and/or solid anionic surfactant and/or a solid diluent (which may have a particle size of the same order as particles comprising the active ingredient). [00394] Pharmaceutical compositions formulated for pulmonary delivery may provide an active ingredient in the form of droplets of a solution and/or suspension.
  • Such formulations may be prepared, packaged, and/or sold as aqueous and/or dilute alcoholic solutions and/or suspensions, optionally sterile, comprising active ingredient, and may conveniently be administered using any nebulization and/or atomization device.
  • Such formulations may further comprise one or more additional ingredients including, but not limited to, a flavoring agent such as saccharin sodium, a volatile oil, a buffering agent, a surface active agent, and/or a preservative such as methylhydroxybenzoate.
  • Droplets provided by this route of administration may have an average diameter in the range from about 0.1 nm to about 200 nm.
  • Formulations described herein as being useful for pulmonary delivery are useful for intranasal delivery of a pharmaceutical composition.
  • Another formulation suitable for intranasal administration is a coarse powder comprising the active ingredient and having an average particle from about 0.2 ⁇ to 500 ⁇ . Such a formulation is administered in the manner in which snuff is taken, i.e. by rapid inhalation through the nasal passage from a container of the powder held close to the nose.
  • Formulations suitable for nasal administration may, for example, comprise from about as little as 0.1% (w/w) and as much as 100% (w/w) of active ingredient, and may comprise one or more of the additional ingredients described herein.
  • compositions may be prepared, packaged, and/or sold in a formulation suitable for buccal administration.
  • formulations may, for example, be in the form of tablets and/or lozenges made using conventional methods, and may, for example, 0.1% to 20% (w/w) active ingredient, the balance comprising an orally dissolvable and/or degradable composition and, optionally, one or more of the additional ingredients described herein.
  • formulations suitable for buccal administration may comprise a powder and/or an aerosolized and/or atomized solution and/or suspension comprising active ingredient.
  • Such powdered, aerosolized, and/or aerosolized formulations when dispersed, may have an average particle and/or droplet size in the range from about 0.1 nm to about 200 nm, and may further comprise one or more of any additional ingredients described herein.
  • a pharmaceutical composition may be prepared, packaged, and/or sold in a formulation suitable for ophthalmic administration.
  • Such formulations may, for example, be in the form of eye drops including, for example, a 0.1/1.0% (w/w) solution and/or suspension of the active ingredient in an aqueous or oily liquid excipient.
  • Such drops may further comprise buffering agents, salts, and/or one or more other of any additional ingredients described herein.
  • Other ophthalmically-administrable formulations which are useful include those which comprise the active ingredient in microcrystalline form and/or in a liposomal preparation. Ear drops and/or eye drops are contemplated as being within the scope of this invention.
  • the polynucleotides, primary constructs or mmRNA described herein can be used in a number of different scenarios in which delivery of a substance (the "payload") to a biological target is desired, for example delivery of detectable substances for detection of the target, or delivery of a therapeutic agent.
  • Detection methods can include, but are not limited to, both imaging in vitro and in vivo imaging methods, e.g., immunohistochemistry, bioluminescence imaging (BLI), Magnetic Resonance Imaging (MRI), positron emission tomography (PET), electron microscopy, X-ray computed tomography, Raman imaging, optical coherence tomography, absorption imaging, thermal imaging, fluorescence reflectance imaging, fluorescence microscopy, fluorescence molecular tomographic imaging, nuclear magnetic resonance imaging, X-ray imaging, ultrasound imaging, photoacoustic imaging, lab assays, or in any situation where tagging/staining/imaging is required.
  • imaging in vitro and in vivo imaging methods e.g., immunohistochemistry, bioluminescence imaging (BLI), Magnetic Resonance Imaging (MRI), positron emission tomography (PET), electron microscopy, X-ray computed tomography, Raman imaging, optical coherence tomography, absorption imaging, thermal imaging
  • the polynucleotides, primary constructs or mmRNA can be designed to include both a linker and a payload in any useful orientation.
  • a linker having two ends is used to attach one end to the payload and the other end to the nucleobase, such as at the C-7 or C-8 positions of the deaza-adenosine or deaza- guanosine or to the N-3 or C-5 positions of cytosine or uracil.
  • the polynucleotide of the invention can include more than one payload (e.g., a label and a transcription inhibitor), as well as a cleavable linker.
  • the modified nucleotide is a modified 7-deaza-adenosine triphosphate, where one end of a cleavable linker is attached to the C7 position of 7-deaza-adenine, the other end of the linker is attached to an inhibitor (e.g., to the C5 position of the nucleobase on a cytidine), and a label (e.g., Cy5) is attached to the center of the linker (see, e.g., compound 1 of A*pCp C5 Parg Capless in Fig. 5 and columns 9 and 10 of U.S. Pat. No. 7,994,304, incorporated herein by reference).
  • an inhibitor e.g., to the C5 position of the nucleobase on a cytidine
  • a label e.g., Cy5
  • the resulting polynucleotide Upon incorporation of the modified 7-deaza-adenosine triphosphate to an encoding region, the resulting polynucleotide will have a cleavable linker attached to a label and an inhibitor (e.g., a polymerase inhibitor).
  • an inhibitor e.g., a polymerase inhibitor
  • the linker e.g., with reductive conditions to reduce a linker having a cleavable disulfide moiety
  • the label and inhibitor are released. Additional linkers and payloads (e.g., therapeutic agents, detectable labels, and cell penetrating payloads) are described herein.
  • the polynucleotides, primary constructs or mmRNA described herein can be used in induced pluripotent stem cells (iPS cells), which can directly track cells that are transfected compared to total cells in the cluster.
  • iPS cells induced pluripotent stem cells
  • a drug that may be attached to the polynucleotides, primary constructs or mmRNA via a linker and may be fluorescently labeled can be used to track the drug in vivo, e.g. intracellularly.
  • Other examples include, but are not limited to, the use of a polynucleotide, primary construct or mmRNA in reversible drug delivery into cells.
  • the polynucleotides, primary constructs or mmRNA described herein can be used in intracellular targeting of a payload, e.g., detectable or therapeutic agent, to specific organelle.
  • exemplary intracellular targets can include, but are not limited to, the nuclear localization for advanced mRNA processing, or a nuclear localization sequence (NLS) linked to the mRNA containing an inhibitor.
  • NLS nuclear localization sequence
  • polynucleotides, primary constructs or mmRNA described herein can be used to deliver therapeutic agents to cells or tissues, e.g., in living animals.
  • the polynucleotides, primary constructs or mmRNA attached to the therapeutic agent through a linker can facilitate member permeation allowing the therapeutic agent to travel into a cell to reach an intracellular target.
  • the payload may be a therapeutic agent such as a cytotoxin, radioactive ion, chemotherapeutic, or other therapeutic agent.
  • a cytotoxin or cytotoxic agent includes any agent that may be detrimental to cells.
  • Examples include, but are not limited to, taxol, cytochalasin B, gramicidin D, ethidium bromide, emetine, mitomycin, etoposide, teniposide, vincristine, vinblastine, colchicine, doxorubicin, daunorubicin, dihydroxyanthracinedione, mitoxantrone, mithramycin, actinomycin D, 1- dehydrotestosterone, glucocorticoids, procaine, tetracaine, lidocaine, propranolol, puromycin, maytansinoids, e.g., maytansinol (see U.S. Pat. No.
  • Radioactive ions include, but are not limited to iodine (e.g., iodine 125 or iodine 131), strontium 89, phosphorous, palladium, cesium, iridium, phosphate, cobalt, yttrium 90, samarium 153, and praseodymium.
  • iodine e.g., iodine 125 or iodine 131
  • strontium 89 phosphorous, palladium, cesium, iridium, phosphate, cobalt, yttrium 90, samarium 153, and praseodymium.
  • therapeutic agents include, but are not limited to, antimetabolites (e.g., methotrexate, 6-mercaptopurine, 6-thioguanine, cytarabine, 5-fluorouracil decarbazine), alkylating agents (e.g., mechlorethamine, thiotepa chlorambucil, rachelmycin (CC-1065), melphalan, carmustine (BS U), lomustine (CCNU), cyclophosphamide, busulfan, dibromomannitol, streptozotocin, mitomycin C, and cis-dichlorodiamine platinum (II) (DDP) cisplatin), anthracyclines (e.g., daunorubicin (formerly daunomycin) and doxorubicin), antibiotics (e.g., dactinomycin (formerly actinomycin), bleomycin, mithramycin, and anthramycin (AMC)), and
  • the payload may be a detectable agent, such as various organic small molecules, inorganic compounds, nanoparticles, enzymes or enzyme substrates, fluorescent materials, luminescent materials (e.g., luminol), bioluminescent materials (e.g., luciferase, luciferin, and aequorin), chemiluminescent materials, radioactive materials (e.g., 18 F, 67 Ga, 81m Kr, 82 Rb, m In, 123 I, 133 Xe, 201 T1, 125 1, 35 S, 14 C, 3 H, or 99m Tc (e.g., as pertechnetate (technetate(VII), Tc0 4 ⁇ )), and contrast agents (e.g., gold (e.g., gold nanoparticles), gadolinium (e.g., chelated Gd), iron oxides (e.g.,
  • SPIO superparamagnetic iron oxide
  • MIONs monocrystalline iron oxide nanoparticles
  • USPIO ultrasmall superparamagnetic iron oxide
  • Mn- DPDP manganese chelates
  • barium sulfate barium sulfate
  • iodinated contrast media iohexol
  • microbubbles or
  • optically-detectable labels include for example, without limitation, 4-acetamido-4'-isothiocyanatostilbene-2,2'disulfonic acid; acridine and derivatives (e.g., acridine and acridine isothiocyanate); 5-(2'- aminoethyl)aminonaphthalene- 1 -sulfonic acid (EDANS); 4-amino-N-[3- vinylsulfonyl)phenyl]naphthalimide-3,5 disulfonate; N-(4-anilino-l-naphthyl)maleimide; anthranilamide; BODIPY; Brilliant Yellow; coumarin and derivatives (e.g., coumarin, 7- amino-4-methylcoumarin (AMC, Coumarin 120), and 7-amino-4- trifluoromethylcoumarin (Coumarin 151)); cyanine dyes; cyanosine; 4
  • rhodamine and derivatives e.g., 6-carboxy-X- rhodamine (ROX), 6-carboxyrhodamine (R6G), lissamine rhodamine B sulfonyl chloride rhodamine (Rhod), rhodamine B, rhodamine 123, rhodamine X
  • sulforhodamine B sulforhodamine 101, sulfonyl chloride derivative of sulforhodamine 101 (Texas Red), ⁇ , ⁇ , ⁇ ', ⁇ 'tetramethyl-6-carboxyrhodamine (TAMRA) tetramethyl rhodamine, and tetramethyl rhodamine isothiocyanate (TRITC)); riboflavin; rosolic acid; terbium chelate derivatives; Cyanine-3 (Cy3); Cyanine-5 (Cy5); cyanine-5.5 (Cy5.5), Cyanine-7 (Cy7); IRD 700; IRD 800; Alexa 647; La Jolta Blue; phthalo cyanine; and naphthalo cyanine.
  • TAMRA ⁇ , ⁇ , ⁇ 'tetramethyl-6-carboxyrhodamine
  • TRITC tetramethyl rhodamine isothio
  • the detectable agent may be a non-detectable pre-cursor that becomes detectable upon activation (e.g., fluorogenic tetrazine-fluorophore constructs (e.g., tetrazine-BODIPY FL, tetrazine-Oregon Green 488, or tetrazine- BODIPY TMR-X) or enzyme activatable fluorogenic agents (e.g., PROSENSE® (VisEn Medical))).
  • fluorogenic tetrazine-fluorophore constructs e.g., tetrazine-BODIPY FL, tetrazine-Oregon Green 488, or tetrazine- BODIPY TMR-X
  • enzyme activatable fluorogenic agents e.g., PROSENSE® (VisEn Medical)
  • ELISAs enzyme linked immunosorbent assays
  • IA enzyme immunoassays
  • RLA radioimmunoassays
  • Western blot analysis In vitro assays in which the enzyme labeled compositions can be used include, but are not limited to, enzyme linked immunosorbent assays (ELISAs), immunoprecipitation assays, immunofluorescence, enzyme immunoassays (EIA), radioimmunoassays (RLA), and Western blot analysis.
  • the polynucleotides, primary constructs or mmRNA may be used in combination with one or more other therapeutic, prophylactic, diagnostic, or imaging agents.
  • Compositions can be administered concurrently with, prior to, or subsequent to, one or more other desired therapeutics or medical procedures. In general, each agent will be administered at a dose and/or on a time schedule determined for that agent.
  • the present disclosure encompasses the delivery of pharmaceutical, prophylactic, diagnostic, or imaging compositions in combination with agents that may improve their bioavailability, reduce and/or modify their metabolism, inhibit their excretion, and/or modify their distribution within the body.
  • the polynucleotides, primary constructs and/or mmRNA may be used in combination with a pharmaceutical agent for the treatment of cancer or to control hyperproliferative cells.
  • a combination therapy for the treatment of solid primary or metastasized tumor is described using a pharmaceutical composition including a DNA plasmid encoding for interleukin-12 with a lipopolymer and also administering at least one anticancer agent or chemotherapeutic.
  • polynucleotides, primary constructs and/or mmRNA of the present invention that encodes anti-proliferative molecules may be in a pharmaceutical composition with a lipopolymer (see e.g., U.S. Pub. No. 20110218231, herein incorporated by reference in its entirety, claiming a pharmaceutical composition comprising a DNA plasmid encoding an antiproliferative molecule and a lipopolymer) which may be administered with at least one chemotherapeutic or anticancer agent.
  • the present invention provides methods comprising administering
  • nucleic acids, proteins or complexes, or pharmaceutical, imaging, diagnostic, or prophylactic compositions thereof may be administered to a subject using any amount and any route of administration effective for preventing, treating, diagnosing, or imaging a disease, disorder, and/or condition (e.g., a disease, disorder, and/or condition relating to working memory deficits).
  • a disease, disorder, and/or condition e.g., a disease, disorder, and/or condition relating to working memory deficits.
  • the exact amount required will vary from subject to subject, depending on the species, age, and general condition of the subject, the severity of the disease, the particular composition, its mode of administration, its mode of activity, and the like.
  • compositions in accordance with the invention are typically formulated in dosage unit form for ease of administration and uniformity of dosage. It will be understood, however, that the total daily usage of the compositions of the present invention may be decided by the attending physician within the scope of sound medical judgment.
  • the specific therapeutically effective, prophylactically effective, or appropriate imaging dose level for any particular patient will depend upon a variety of factors including the disorder being treated and the severity of the disorder; the activity of the specific compound employed; the specific composition employed; the age, body weight, general health, sex and diet of the patient; the time of administration, route of administration, and rate of excretion of the specific compound employed; the duration of the treatment; drugs used in combination or coincidental with the specific compound employed; and like factors well known in the medical arts.
  • compositions in accordance with the present invention may be administered at dosage levels sufficient to deliver from about 0.0001 mg/kg to about 100 mg/kg, from about 0.001 mg/kg to about 0.05 mg/kg, from about 0.005 mg/kg to about 0.05 mg/kg, from about 0.001 mg/kg to about 0.005 mg/kg, from about 0.05 mg/kg to about 0.5 mg/kg, from about 0.01 mg/kg to about 50 mg/kg, from about 0.1 mg/kg to about 40 mg/kg, from about 0.5 mg/kg to about 30 mg/kg, from about 0.01 mg/kg to about 10 mg/kg, from about 0.1 mg/kg to about 10 mg/kg, or from about 1 mg/kg to about 25 mg/kg, of subject body weight per day, one or more times a day, to obtain the desired therapeutic, diagnostic, prophylactic, or imaging effect.
  • the desired dosage may be delivered three times a day, two times a day, once a day, every other day, every third day, every week
  • administrations e.g., two, three, four, five, six, seven, eight, nine, ten, eleven, twelve, thirteen, fourteen, or more administrations.
  • a split dose is the division of single unit dose or total daily dose into two or more doses, e.g., two or more administrations of the single unit dose.
  • a "single unit dose” is a dose of any therapeutic administered in one dose/at one time/single route/single point of contact, i.e., single administration event.
  • a "total daily dose” is an amount given or prescribed in 24 hr period. It may be administered as a single unit dose.
  • the mmRNA of the present invention are administered to a subject in split doses.
  • the mmRNA may be formulated in buffer only or in a formulation described herein.
  • a pharmaceutical composition described herein can be formulated into a dosage form described herein, such as a topical, intranasal, intratracheal, or injectable (e.g., intravenous, intraocular, intravitreal, intramuscular, intracardiac, intraperitoneal, subcutaneous).
  • injectable e.g., intravenous, intraocular, intravitreal, intramuscular, intracardiac, intraperitoneal, subcutaneous.
  • Liquid dosage forms for parenteral administration include, but are not limited to, pharmaceutically acceptable emulsions, microemulsions, solutions, suspensions, syrups, and/or elixirs.
  • liquid dosage forms may comprise inert diluents commonly used in the art including, but not limited to, water or other solvents, solubilizing agents and emulsifiers such as ethyl alcohol, isopropyl alcohol, ethyl carbonate, ethyl acetate, benzyl alcohol, benzyl benzoate, propylene glycol, 1,3- butylene glycol, dimethylformamide, oils (in particular, cottonseed, groundnut, corn, germ, olive, castor, and sesame oils), glycerol, tetrahydrofurfuryl alcohol, polyethylene glycols and fatty acid esters of sorbitan, and mixtures thereof.
  • inert diluents commonly used in the art including, but not limited to,
  • compositions may be mixed with solubilizing agents such as CREMOPHOR ® , alcohols, oils, modified oils, glycols, polysorbates, cyclodextrins, polymers, and/or combinations thereof.
  • solubilizing agents such as CREMOPHOR ® , alcohols, oils, modified oils, glycols, polysorbates, cyclodextrins, polymers, and/or combinations thereof.
  • Injectable preparations for example, sterile injectable aqueous or oleaginous suspensions may be formulated according to the known art and may include suitable dispersing agents, wetting agents, and/or suspending agents.
  • Sterile injectable preparations may be sterile injectable solutions, suspensions, and/or emulsions in nontoxic parenterally acceptable diluents and/or solvents, for example, a solution in 1,3- butanediol.
  • the acceptable vehicles and solvents that may be employed include, but are not limited to, are water, Ringer's solution, U.S.P., and isotonic sodium chloride solution.
  • Sterile, fixed oils are conventionally employed as a solvent or suspending medium. For this purpose any bland fixed oil can be employed including synthetic mono- or diglycerides. Fatty acids such as oleic acid can be used in the preparation of injectables.
  • Injectable formulations can be sterilized, for example, by filtration through a bacterial-retaining filter, and/or by incorporating sterilizing agents in the form of sterile solid compositions which can be dissolved or dispersed in sterile water or other sterile injectable medium prior to use.
  • the absorption of the active ingredient may be desirable to slow the absorption of the active ingredient from subcutaneous or intramuscular injection. This may be accomplished by the use of a liquid suspension of crystalline or amorphous material with poor water solubility.
  • the rate of absorption of the polynucleotide, primary construct or mmRNA then depends upon its rate of dissolution which, in turn, may depend upon crystal size and crystalline form.
  • delayed absorption of a parenterally administered polynucleotide, primary construct or mmRNA may be accomplished by dissolving or suspending the polynucleotide, primary construct or mmRNA in an oil vehicle.
  • Injectable depot forms are made by forming microencapsule matrices of the polynucleotide, primary construct or mmRNA in biodegradable polymers such as polylactide-polyglycolide. Depending upon the ratio of polynucleotide, primary construct or mmRNA to polymer and the nature of the particular polymer employed, the rate of polynucleotide, primary construct or mmRNA release can be controlled. Examples of other biodegradable polymers include, but are not limited to, poly(orthoesters) and poly(anhydrides). Depot injectable formulations may be prepared by entrapping the polynucleotide, primary construct or mmRNA in liposomes or microemulsions which are compatible with body tissues.
  • Formulations described herein as being useful for pulmonary delivery may also be use for intranasal delivery of a pharmaceutical composition.
  • Another formulation suitable for intranasal administration may be a coarse powder comprising the active ingredient and having an average particle from about 0.2 ⁇ to 500 ⁇ .
  • Such a formulation may be administered in the manner in which snuff is taken, i.e. by rapid inhalation through the nasal passage from a container of the powder held close to the nose.
  • Formulations suitable for nasal administration may, for example, comprise from about as little as 0.1% (w/w) and as much as 100% (w/w) of active ingredient, and may comprise one or more of the additional ingredients described herein.
  • compositions may be prepared, packaged, and/or sold in a formulation suitable for buccal administration.
  • formulations may, for example, be in the form of tablets and/or lozenges made using conventional methods, and may, for example, contain about 0.1% to 20% (w/w) active ingredient, where the balance may comprise an orally dissolvable and/or degradable composition and, optionally, one or more of the additional ingredients described herein.
  • formulations suitable for buccal administration may comprise a powder and/or an aerosolized and/or atomized solution and/or suspension comprising active ingredient.
  • formulations when dispersed, may have an average particle and/or droplet size in the range from about 0.1 nm to about 200 nm, and may further comprise one or more of any additional ingredients described herein.
  • Solid dosage forms of tablets, dragees, capsules, pills, and granules can be prepared with coatings and shells such as enteric coatings and other coatings well known in the pharmaceutical formulating art. They may optionally comprise opacifying agents and can be of a composition that they release the active ingredient(s) only, or
  • embedding compositions which can be used include polymeric substances and waxes.
  • Solid compositions of a similar type may be employed as fillers in soft and hard-filled gelatin capsules using such excipients as lactose or milk sugar as well as high molecular weight polyethylene glycols and the like.
  • compositions described herein can be characterized by one or more of bioavailability, therapeutic window and/or volume of distribution.
  • the polynucleotides, primary constructs or mmRNA when formulated into a composition with a delivery agent as described herein, can exhibit an increase in bioavailability as compared to a composition lacking a delivery agent as described herein.
  • bioavailability refers to the systemic availability of a given amount of polynucleotides, primary constructs or mmRNA administered to a mammal. Bioavailability can be assessed by measuring the area under the curve (AUC) or the maximum serum or plasma concentration (C max ) of the unchanged form of a compound following administration of the compound to a mammal.
  • AUC is a determination of the area under the curve plotting the serum or plasma concentration of a compound along the ordinate (Y-axis) against time along the abscissa (X-axis).
  • the AUC for a particular compound can be calculated using methods known to those of ordinary skill in the art and as described in G. S. Banker, Modern Pharmaceutics, Drugs and the
  • the C max value is the maximum concentration of the compound achieved in the serum or plasma of a mammal following administration of the compound to the mammal.
  • the Cmax value of a particular compound can be measured using methods known to those of ordinary skill in the art.
  • the phrases "increasing bioavailability" or “improving the pharmacokinetics,” as used herein mean that the systemic availability of a first polynucleotide, primary construct or mmRNA, measured as AUC, C max , or C m i n in a mammal is greater, when co-administered with a delivery agent as described herein, than when such co-administration does not take place.
  • the phrases "increasing bioavailability" or “improving the pharmacokinetics,” as used herein mean that the systemic availability of a first polynucleotide, primary construct or mmRNA, measured as AUC, C max , or C m i n in a mammal is greater, when co-
  • bioavailability of the polynucleotide, primary construct or mmRNA can increase by at least about 2%, at least about 5%, at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or about 100%.
  • the polynucleotides, primary constructs or mmRNA when formulated into a composition with a delivery agent as described herein, can exhibit an increase in the therapeutic window of the administered polynucleotide, primary construct or mmRNA composition as compared to the therapeutic window of the administered polynucleotide, primary construct or mmRNA composition lacking a delivery agent as described herein.
  • therapeutic window refers to the range of plasma concentrations, or the range of levels of therapeutically active substance at the site of action, with a high probability of eliciting a therapeutic effect.
  • the therapeutic window of the polynucleotide, primary construct or mmRNA when co-administered with a delivery agent as described herein can increase by at least about 2%, at least about 5%, at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or about 100%.
  • the polynucleotides, primary constructs or mmRNA when formulated into a composition with a delivery agent as described herein, can exhibit an improved volume of distribution (Vdist), e.g., reduced or targeted, relative to a composition lacking a delivery agent as described herein.
  • the volume of distribution (Vdi s t) relates the amount of the drug in the body to the concentration of the drug in the blood or plasma.
  • the term "volume of distribution” refers to the fluid volume that would be required to contain the total amount of the drug in the body at the same concentration as in the blood or plasma: Vdi s t equals the amount of drug in the body/concentration of drug in blood or plasma.
  • the volume of distribution would be 1 liter.
  • the volume of distribution reflects the extent to which the drug is present in the extravascular tissue.
  • a large volume of distribution reflects the tendency of a compound to bind to the tissue components compared with plasma protein binding.
  • Vdi s t can be used to determine a loading dose to achieve a steady state concentration.
  • the volume of distribution of the polynucleotide, primary construct or mmRNA when co-administered with a delivery agent as described herein can decrease at least about 2%, at least about 5%, at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%.
  • the biological effect of the modified mRNA delivered to the animals may be categorized by analyzing the protein expression in the animals.
  • the reprogrammed protein expression may be determined from analyzing a biological sample collected from a mammal administered the modified mRNA of the present invention.
  • the expression protein encoded by the modified mRNA administered to the mammal of at least 50 pg/ml may be preferred.
  • a protein expression of 50-200 pg/ml for the protein encoded by the modified mRNA delivered to the mammal may be seen as a therapeutically effective amount of protein in the mammal.
  • the polynucleotides, primary constructs or mmRNA of the present invention may be quantified in exosomes derived from one or more bodily fluid.
  • bodily fluids include peripheral blood, serum, plasma, ascites, urine, cerebrospinal fluid (CSF), sputum, saliva, bone marrow, synovial fluid, aqueous humor, amniotic fluid, cerumen, breast milk, broncheoalveolar lavage fluid, semen, prostatic fluid, cowper's fluid or pre-ejaculatory fluid, sweat, fecal matter, hair, tears, cyst fluid, pleural and peritoneal fluid, pericardial fluid, lymph, chyme, chyle, bile, interstitial fluid, menses, pus, sebum, vomit, vaginal secretions, mucosal secretion, stool water, pancreatic juice, lavage fluids from sinus cavities, bronchopulmonary aspirates, blastocyl
  • exosomes may be retrieved from an organ selected from the group consisting of lung, heart, pancreas, stomach, intestine, bladder, kidney, ovary, testis, skin, colon, breast, prostate, brain, esophagus, liver, and placenta.
  • a sample of not more than 2mL is obtained from the subject and the exosomes isolated by size exclusion chromatography, density gradient centrifugation, differential centrifugation, nanomembrane ultrafiltration,
  • the level or concentration of a polynucleotide, primary construct or mmRNA may be an expression level, presence, absence, truncation or alteration of the administered construct. It is advantageous to correlate the level with one or more clinical phenotypes or with an assay for a human disease biomarker.
  • the assay may be performed using construct specific probes, cytometry, qRT-PCR, real-time PCR, PCR, flow cytometry, electrophoresis, mass spectrometry, or combinations thereof while the exosomes may be isolated using immunohistochemical methods such as enzyme linked immunosorbent assay (ELISA) methods.
  • ELISA enzyme linked immunosorbent assay
  • Exosomes may also be isolated by size exclusion chromatography, density gradient centrifugation, differential centrifugation, nanomembrane ultrafiltration, immunoabsorbent capture, affinity purification, microfluidic separation, or combinations thereof. [00427] These methods afford the investigator the ability to monitor, in real time, the level of polynucleotides, primary constructs or mmRNA remaining or delivered. This is possible because the polynucleotides, primary constructs or mmRNA of the present invention differ from the endogenous forms due to the structural or chemical
  • Mass spectrometry is an analytical technique that can provide structural and molecular mass/concentration information on molecules after their conversion to ions.
  • the molecules are first ionized to acquire positive or negative charges and then they travel through the mass analyzer to arrive at different areas of the detector according to their mass/charge (m/z) ratio.
  • Mass spectrometry is performed using a mass spectrometer which includes an ion source for ionizing the fractionated sample and creating charged molecules for further analysis.
  • ionization of the sample may be performed by electrospray ionization (ESI), atmospheric pressure chemical ionization (APCI), photoionization, electron ionization, fast atom bombardment (FAB)/liquid secondary ionization (LSIMS), matrix assisted laser desorption/ionization (MALDI), field ionization, field desorption, thermospray/plasmaspray ionization, and particle beam ionization.
  • ESI electrospray ionization
  • APCI atmospheric pressure chemical ionization
  • FAB fast atom bombardment
  • LIMS liquid secondary ionization
  • MALDI matrix assisted laser desorption/ionization
  • field ionization field desorption
  • thermospray/plasmaspray ionization and particle beam ionization.
  • the positively charged or negatively charged ions thereby created may be analyzed to determine a mass-to-charge ratio (i.e., m/z).
  • Suitable analyzers for determining mass-to-charge ratios include quadropole analyzers, ion traps analyzers, and time-of-flight analyzers.
  • the ions may be detected using several detection modes. For example, selected ions may be detected (i.e., using a selective ion monitoring mode (SIM)), or alternatively, ions may be detected using a scanning mode, e.g., multiple reaction monitoring (MRM) or selected reaction monitoring (SRM).
  • SIM selective ion monitoring mode
  • MRM multiple reaction monitoring
  • SRM selected reaction monitoring
  • LC-MS/MRM Liquid chromatography-multiple reaction monitoring
  • MRM multiple reaction monitoring
  • a biological sample which may contain at least one protein encoded by at least one modified mRNA of the present invention may be analyzed by the method of MRM-MS.
  • the quantification of the biological sample may further include, but is not limited to, isotopically labeled peptides or proteins as internal standards.
  • the biological sample once obtained from the subject, may be subjected to enzyme digestion.
  • digest means to break apart into shorter peptides.
  • the phrase "treating a sample to digest proteins” means manipulating a sample in such a way as to break down proteins in a sample.
  • enzymes include, but are not limited to, trypsin, endoproteinase Glu-C and chymotrypsin.
  • a biological sample which may contain at least one protein encoded by at least one modified mRNA of the present invention may be digested using enzymes.
  • a biological sample which may contain protein encoded by modified mRNA of the present invention may be analyzed for protein using electrospray ionization.
  • Electrospray ionization (ESI) mass spectrometry (ESIMS) uses electrical energy to aid in the transfer of ions from the solution to the gaseous phase before they are analyzed by mass spectrometry.
  • Samples may be analyzed using methods known in the art (e.g., Ho et al., Clin Biochem Rev. 2003 24(1):3-12).
  • the ionic species contained in solution may be transferred into the gas phase by dispersing a fine spray of charge droplets, evaporating the solvent and ejecting the ions from the charged droplets to generate a mist of highly charged droplets.
  • the mist of highly charged droplets may be analyzed using at least 1, at least 2, at least 3 or at least 4 mass analyzers such as, but not limited to, a quadropole mass analyzer.
  • the mass spectrometry method may include a purification step.
  • the first quadrapole may be set to select a single m/z ratio so it may filter out other molecular ions having a different m/z ratio which may eliminate complicated and time-consuming sample purification procedures prior to MS analysis.
  • a biological sample which may contain protein encoded by modified mRNA of the present invention may be analyzed for protein in a tandem ESIMS system (e.g., MS/MS).
  • the droplets may be analyzed using a product scan (or daughter scan) a precursor scan (parent scan) a neutral loss or a multiple reaction monitoring.
  • a biological sample which may contain protein encoded by modified mRNA of the present invention may be analyzed using matrix-assisted laser desorption/ionization (MALDI) mass spectrometry (MALDIMS).
  • MALDI matrix-assisted laser desorption/ionization
  • MALDIMS matrix-assisted laser desorption/ionization mass spectrometry
  • MALDI provides for the nondestructive vaporization and ionization of both large and small molecules, such as proteins.
  • the analyte is first co-crystallized with a large molar excess of a matrix compound, which may also include, but is not limited to, an ultraviolet absorbing weak organic acid.
  • Non-limiting examples of matrices used in MALDI are a- cyano-4-hydroxycinnamic acid, 3,5-dimethoxy-4-hydroxycinnamic acid and 2,5- dihydroxybenzoic acid.
  • Laser radiation of the analyte- matrix mixture may result in the vaporization of the matrix and the analyte.
  • the laser induced desorption provides high ion yields of the intact analyte and allows for measurement of compounds with high accuracy.
  • Samples may be analyzed using methods known in the art (e.g., Lewis, Wei and Siuzdak, Encyclopedia of Analytical Chemistry 2000:5880-5894).
  • mass analyzers used in the MALDI analysis may include a linear time-of-flight (TOF), a TOF reflectron or a Fourier transform mass analyzer.
  • the analyte-matrix mixture may be formed using the dried- droplet method.
  • a biologic sample is mixed with a matrix to create a saturated matrix solution where the matrix-to-sample ratio is approximately 5000: 1.
  • An aliquot is approximately 5000: 1.
  • the analyte-matrix mixture may be formed using the thin- layer method.
  • a matrix homogeneous film is first formed and then the sample is then applied and may be absorbed by the matrix to form the analyte-matrix mixture.
  • the analyte-matrix mixture may be formed using the thick- layer method.
  • a matrix homogeneous film is formed with a nitro-cellulose matrix additive. Once the uniform nitro-cellulose matrix layer is obtained the sample is applied and absorbed into the matrix to form the analyte-matrix mixture.
  • the analyte-matrix mixture may be formed using the sandwich method.
  • a thin layer of matrix crystals is prepared as in the thin-layer method followed by the addition of droplets of aqueous trifluoroacetic acid, the sample and matrix. The sample is then absorbed into the matrix to form the analyte-matrix mixture.
  • the synthetic polynucleotides and/or synthetic sgRNAs of the present invention may be used to alter the phenotype of cells.
  • the polynucleotides, primary constructs and mmRNA of the invention may encode peptides, polypeptides or multiple proteins to produce polypeptides of interest.
  • the polypeptides of interest may be used in therapeutics and/or clinical and research settings.
  • the polypeptides of interest may include reprogramming factors, differentiation factors and de-differentiation factors.
  • polynucleotides, primary constructs or mmRNA of the present invention such as modified nucleic acids and modified RNAs, and the proteins translated from them described herein can be used as therapeutic or prophylactic agents. They are provided for use in medicine, therapy and preventative treatments.
  • a polynucleotide, primary construct or mmRNA described herein e.g. , a modified mRNA encoding a CRISPR-related polypeptide or protein
  • a polynucleotide, primary construct or mmRNA described herein can be administered to a subject, wherein the polynucleotide, primary construct or mmRNA is translated in vivo to produce a therapeutic or prophylactic polypeptide in the subject.
  • a polynucleotide, primary construct or mmRNA described herein can be administered to a subject, wherein the polynucleotide, primary construct or mmRNA guides gene-editing by a CRISPR-related polypeptide or protein.
  • compositions, methods, kits, and reagents for diagnosis, treatment or prevention of a disease or condition in humans and other mammals are provided.
  • the active therapeutic agents of the invention include polynucleotides, primary constructs or mmRNA, cells containing the polynucleotides, primary constructs or mmRNA or polypeptides translated from the polynucleotides, primary constructs or mmRNA.
  • combination therapeutics containing one or more polynucleotide, primary construct or mmRNA containing translatable regions that encode for a protein or proteins are provided herein.
  • combination therapeutics containing one or more polynucleotide, primary construct or mmRNA containing non-translatable regions for example, regions complementary to target gene sequences, e.g., sgRNAs.
  • a recombinant polypeptide in a cell population using the polynucleotide, primary construct or mmRNA described herein.
  • Such translation can be in vivo, ex vivo, in culture, or in vitro.
  • the cell population is contacted with an effective amount of a composition containing a nucleic acid that has at least one nucleoside modification, and a translatable region encoding the recombinant polypeptide.
  • the cell population is optionally also contacted with an effective amount of a composition containing a nucleic acid that has at least one nucleoside modification, and has complementarity to a target gene sequence, e.g., a sgRNA.
  • the population is contacted under conditions such that the nucleic acid is localized into one or more cells of the cell population and the recombinant polypeptide is translated in the cell from the nucleic acid and or the sgRNA (or plurality thereof) is also is localized into one or more cells of the cell population.
  • an "effective amount" of the composition is provided based, at least in part, on the target tissue, target cell type, means of administration, physical characteristics of the nucleic acid (e.g., size, and extent of modified nucleosides), and other determinants.
  • an effective amount of the composition provides efficient protein production in the cell, preferably more efficient than a composition containing a corresponding unmodified nucleic acid. Increased efficiency may be demonstrated by increased cell transfection (i.e., the percentage of cells transfected with the nucleic acid), increased protein translation from the nucleic acid, decreased nucleic acid degradation (as demonstrated, e.g., by increased duration of protein translation from a modified nucleic acid), or reduced innate immune response of the host cell.
  • aspects of the invention are directed to methods of inducing in vivo translation of a recombinant polypeptide in a mammalian subject in need thereof, e.g., a recombinant CRISPR-related protein. Further aspects of the invention are directed to methods of inducing egne editing in vivo in a mammalian subject in need thereof.
  • an effective amount of a composition containing a nucleic acid that has at least one structural or chemical modification and a translatable region encoding the recombinant polypeptide is administered to the subject using the delivery methods described herein.
  • the nucleic acid is provided in an amount and under other conditions such that the nucleic acid is localized into a cell of the subject and (1) the recombinant polypeptide is translated in the cell from the nucleic acid and/or (2) the sgRNA(s) bind complementary sequences within target genes.
  • the cell in which a nucleic acid of the invention is localized, or the tissue in which the cell is present, may be targeted with one or more than one rounds of nucleic acid administration.
  • the administered polynucleotide, primary construct or mmRNA directs production of one or more recombinant polypeptides and/or regulatory RNA, e.g., sgRNA, that provides a functional activity which is substantially absent in the cell, tissue or organism in which the recombinant polypeptide is translated, e.g., a gene editing activity.
  • regulatory RNA e.g., sgRNA
  • an administered polynucleotide, primary construct or mmRNA directs production of one or more recombinant polypeptides and/or regulatory RNA, e.g., sgRNA, involved in gene editing, and is administered in combination with oen or more additional polynucleotide, primary construct or mmRNA that directs production of one or more additional recombinant polypeptides having therapeutic utility, e.g., providing a functional activity which is substantially absent in the cell, tissue or organism in which the recombinant polypeptide is translated.
  • the missing functional activity may be enzymatic, structural, or gene regulatory in nature.
  • the administered polynucleotide, primary construct or mmRNA directs production of one or more recombinant polypeptides that increases (e.g., synergistically) a functional activity which is present but substantially deficient in the cell in which the recombinant polypeptide is translated.
  • the administered polynucleotide, primary construct or mmRNA directs production of one or more recombinant polypeptides that replace a polypeptide (or multiple polypeptides) that is substantially absent in the cell in which the recombinant polypeptide is translated. Such absence may be due to genetic mutation of the encoding gene or regulatory pathway thereof.
  • the recombinant polypeptide increases the level of an endogenous protein in the cell to a desirable level; such an increase may bring the level of the endogenous protein from a subnormal level to a normal level or from a normal level to a super-normal level.
  • the recombinant polypeptide functions to antagonize the activity of an endogenous protein present in, on the surface of, or secreted from the cell.
  • the activity of the endogenous protein is deleterious to the subject; for example, due to mutation of the endogenous protein resulting in altered activity or localization.
  • the recombinant polypeptide antagonizes, directly or indirectly, the activity of a biological moiety present in, on the surface of, or secreted from the cell.
  • antagonized biological moieties include lipids (e.g., cholesterol), a lipoprotein (e.g., low density lipoprotein), a nucleic acid, a carbohydrate, a metabolite (e.g. bilirubin), a protein toxin such as shiga and tetanus toxins, or a small molecule toxin such as botulinum, cholera, and diphtheria toxins.
  • the antagonized biological molecule may be an endogenous protein that exhibits an undesirable activity, such as a cytotoxic or cytostatic activity.
  • a mmRNA encoding a CRISPR-related polypeptide or protein is administered in combination with one or more sgRNAs, optionally in combination with a corrected DNA template.
  • the DNA template includes a correct sequence of corresponding to a mutated gene associated with a disease.
  • Exemplary DNA templates correspond to single-mutation disease causing genes.
  • a cell into which the requisite components are introduced repairs the damaged gene using the CRISPER-related protein. In doing so, it copies from the template, introducing new genetic material into the genome.
  • the data presented herein demonstrate effective liver delivery of components of the invention.
  • the methodology described herein is particularly suited to treatment of metabolic disease, e.g., metabolic disease caused by inborn genetic errors, .e.g., ornithine transcarbamylase deficiency-related diseases.
  • the methods of the invention can also serve to attenuate disease progression.
  • intramuscular delivery e.g., via multiple muscle injection, can serve to treat muscle diseases, for example, muscular dustrophy, by inclusion of appropriate corrected DNA templates.
  • ex vivo approaches are envisioned involving, for example, administration of agents to hematopoetic cells ex vivo (e,g,, via electroporation), followed optionally by selection of cells expressing the proper components, followed by administration of treated cells, where recolonization can subsequently occur.
  • the recombinant proteins, mmRNAs encoding same, and/or sgRNAs, described herein may be engineered for localization within the cell, potentially within a specific compartment such as the nucleus, or are engineered for secretion from the cell or translocation to the plasma membrane of the cell.
  • the recombinant proteins, mmRNAs encoding same, and/or sgR As are engineered for nuclear localization.
  • compositions containing polynucleotide, primary construct, or mmRNA can be formulated for administration intramuscularly, transarterially, intraperitoneally, intravenously, intranasally, subcutaneously, endoscopically, transdermally, or intrathecally.
  • the composition may be formulated for extended release.
  • the subject to whom the therapeutic agent may be administered suffers from or may be at risk of developing a disease, disorder, or deleterious condition.
  • GWAS genome-wide association studies
  • kits for conveniently and/or effectively carrying out methods of the present invention.
  • kits will comprise sufficient amounts and/or numbers of components to allow a user to perform multiple treatments of a subject(s) and/or to perform multiple experiments, and contact cells and/or a population of cells at least once.
  • kits comprising the molecules (polynucleotides, primary constructs or mmRNA) of the invention.
  • the kit comprises one or more functional antibodies or function fragments thereof.
  • Kits and devices useful in combination with the polynucleotides, primary constructs or mmRNA) of the invention include those disclosed in co-pending U.S.
  • substituents of compounds of the present disclosure are disclosed in groups or in ranges. It is specifically intended that the present disclosure include each and every individual subcombination of the members of such groups and ranges.
  • the term "Ci_6 alkyl” is specifically intended to individually disclose methyl, ethyl, C3 alkyl, C 4 alkyl, C5 alkyl, and Ce alkyl.
  • Administered in combination means that two or more agents are administered to a subject at the same time or within an interval such that there may be an overlap of an effect of each agent on the patient. In some embodiments, they are administered within about 60, 30, 15, 10, 5, or 1 minute of one another. In some embodiments, the administrations of the agents are spaced sufficiently closely together such that a combinatorial (e.g., a synergistic) effect is achieved.
  • animal As used herein, the term “animal” refers to any member of the animal kingdom. In some embodiments, “animal” refers to humans at any stage of development. In some embodiments, “animal” refers to non-human animals at any stage of
  • the non-human animal is a mammal (e.g., a rodent, a mouse, a rat, a rabbit, a monkey, a dog, a cat, a sheep, cattle, a primate, or a pig).
  • animals include, but are not limited to, mammals, birds, reptiles, amphibians, fish, and worms.
  • the animal is a transgenic animal, genetically-engineered animal, or a clone.
  • association with means that the moieties are physically associated or connected with one another, either directly or via one or more additional moieties that serves as a linking agent, to form a structure that is sufficiently stable so that the moieties remain physically associated under the conditions in which the structure is used, e.g., physiological conditions.
  • association need not be strictly through direct covalent chemical bonding. It may also suggest ionic or hydrogen bonding or a hybridization based connectivity sufficiently stable such that the "associated" entities remain physically associated.
  • bifunctional refers to any substance, molecule or moiety which is capable of or maintains at least two functions. The functions may affect the same outcome or a different outcome. The structure that produces the function may be the same or different.
  • bifunctional modified RNAs of the present invention may encode a cytotoxic peptide (a first function) while those nucleosides which comprise the encoding RNA are, in and of themselves, cytotoxic (second function).
  • delivery of the bifunctional modified RNA to a cancer cell would produce not only a peptide or protein molecule which may ameliorate or treat the cancer but would also deliver a cytotoxic payload of nucleosides to the cell should degradation, instead of translation of the modified RNA, occur.
  • Biocompatible As used herein, the term “biocompatible” means compatible with living cells, tissues, organs or systems posing little to no risk of injury, toxicity or rejection by the immune system.
  • Biodegradable As used herein, the term “biodegradable” means capable of being broken down into innocuous products by the action of living things.
  • biologically active refers to a characteristic of any substance that has activity in a biological system and/or organism. For instance, a substance that, when administered to an organism, has a biological effect on that organism, is considered to be biologically active.
  • a polynucleotide, primary construct or mmRNA of the present invention may be considered biologically active if even a portion of the polynucleotide, primary construct or mmRNA is biologically active or mimics an activity considered biologically relevant.
  • cancer stem cells are cells that can undergo self-renewal and/or abnormal proliferation and differentiation to form a tumor.
  • an effective amount of an agent is that amount sufficient to effect beneficial or desired results, for example, clinical results, and, as such, an "effective amount” depends upon the context in which it is being applied.
  • an effective amount of an agent is, for example, an amount sufficient to achieve treatment, as defined herein, of cancer, as compared to the response obtained without administration of the agent.
  • enantiomer means each individual optically active form of a compound of the invention, having an optical purity or enantiomeric excess (as determined by methods standard in the art) of at least 80% (i.e., at least 90% of one enantiomer and at most 10% of the other enantiomer), preferably at least 90% and more preferably at least 98%.
  • isomer means any tautomer, stereoisomer, enantiomer, or diastereomer of any compound of the invention. It is recognized that the compounds of the invention can have one or more chiral centers and/or double bonds and, therefore, exist as stereoisomers, such as double-bond isomers (i.e., geometric E/Z isomers) or diastereomers (e.g., enantiomers (i.e., (+) or (-)) or cis/trans isomers).
  • stereoisomers such as double-bond isomers (i.e., geometric E/Z isomers) or diastereomers (e.g., enantiomers (i.e., (+) or (-)) or cis/trans isomers).
  • the chemical structures depicted herein, and therefore the compounds of the invention encompass all of the corresponding stereoisomers, that is, both the stereomerically pure form (e.g., geometrically pure, enantiomerically pure, or diastereomerically pure) and enantiomeric and stereoisomeric mixtures, e.g., racemates.
  • Enantiomeric and stereoisomeric mixtures of compounds of the invention can typically be resolved into their component enantiomers or stereoisomers by well-known methods, such as chiral-phase gas chromatography, chiral-phase high performance liquid chromatography, crystallizing the compound as a chiral salt complex, or crystallizing the compound in a chiral solvent.
  • Enantiomers and stereoisomers can also be obtained from stereomerically or enantiomerically pure intermediates, reagents, and catalysts by well- known asymmetric synthetic methods.
  • stereoisomer refers to all possible different isomeric as well as conformational forms which a compound may possess (e.g., a compound of any formula described herein), in particular all possible stereochemically and conformationally isomeric forms, all diastereomers, enantiomers and/or conformers of the basic molecular structure. Some compounds of the present invention may exist in different tautomeric forms, all of the latter being included within the scope of the present invention.
  • Compound As used herein, the term “compound,” is meant to include all stereoisomers, geometric isomers, tautomers, and isotopes of the structures depicted.
  • asymmetrically substituted carbon atoms can be isolated in optically active or racemic forms.
  • Methods on how to prepare optically active forms from optically active starting materials are known in the art, such as by resolution of racemic mixtures or by stereoselective synthesis.
  • Cis and trans geometric isomers of the compounds of the present disclosure are described and may be isolated as a mixture of isomers or as separated isomeric forms.
  • Tautomeric forms result from the swapping of a single bond with an adjacent double bond and the concomitant migration of a proton.
  • Tautomeric forms include prototropic tautomers which are isomeric protonation states having the same empirical formula and total charge. Examples prototropic tautomers include ketone - enol pairs, amide - imidic acid pairs, lactam - lactim pairs, amide - imidic acid pairs, enamine - imine pairs, and annular forms where a proton can occupy two or more positions of a heterocyclic system, such as, 1H- and 3H-imidazole, 1H-, 2H- and 4H- 1,2,4-triazole, 1H- and 2H- isoindole, and 1H- and 2H-pyrazole. Tautomeric forms can be in equilibrium or sterically locked into one form by appropriate substitution.
  • Compounds of the present disclosure also include all of the isotopes of the atoms occurring in the intermediate or final compounds.
  • “Isotopes” refers to atoms having the same atomic number but different mass numbers resulting from a different number of neutrons in the nuclei.
  • isotopes of hydrogen include tritium and deuterium.
  • the compounds and salts of the present disclosure can be prepared in combination with solvent or water molecules to form solvates and hydrates by routine methods.
  • Committed means, when referring to a cell, when the cell is far enough into the differentiation pathway where, under normal circumstances, it will continue to differentiate into a specific cell type or subset of cell type instead of into a different cell type or reverting to a lesser differentiated cell type.
  • conserved refers to nucleotides or amino acid residues of a polynucleotide sequence or polypeptide sequence, respectively, that are those that occur unaltered in the same position of two or more sequences being compared. Nucleotides or amino acids that are relatively conserved are those that are conserved amongst more related sequences than nucleotides or amino acids appearing elsewhere in the sequences.
  • two or more sequences are said to be “completely conserved” if they are 100% identical to one another. In some embodiments, two or more sequences are said to be "highly conserved” if they are at least 70% identical, at least 80% identical, at least 90% identical, or at least 95% identical to one another. In some embodiments, two or more sequences are said to be "highly conserved” if they are about 70% identical, about 80% identical, about 90% identical, about 95%, about 98%, or about 99% identical to one another.
  • two or more sequences are said to be "conserved” if they are at least 30% identical, at least 40% identical, at least 50% identical, at least 60% identical, at least 70% identical, at least 80% identical, at least 90% identical, or at least 95% identical to one another. In some embodiments, two or more sequences are said to be “conserved” if they are about 30% identical, about 40% identical, about 50% identical, about 60% identical, about 70% identical, about 80% identical, about 90% identical, about 95% identical, about 98% identical, or about 99% identical to one another. Conservation of sequence may apply to the entire length of an
  • oligonucleotide or polypeptide may apply to a portion, region or feature thereof.
  • Controlled Release refers to a pharmaceutical composition or compound release profile that conforms to a particular pattern of release to effect a therapeutic outcome.
  • Cyclic or Cyclized As used herein, the term “cyclic” refers to the presence of a continuous loop. Cyclic molecules need not be circular, only joined to form an unbroken chain of subunits. Cyclic molecules such as the engineered RNA or mRNA of the present invention may be single units or multimers or comprise one or more components of a complex or higher order structure.
  • Cytostatic refers to inhibiting, reducing, suppressing the growth, division, or multiplication of a cell (e.g., a mammalian cell (e.g., a human cell)), bacterium, virus, fungus, protozoan, parasite, prion, or a combination thereof.
  • Cytotoxic refers to killing or causing injurious, toxic, or deadly effect on a cell (e.g., a mammalian cell (e.g., a human cell)), bacterium, virus, fungus, protozoan, parasite, prion, or a combination thereof.
  • Delivery refers to the act or manner of delivering a compound, substance, entity, moiety, cargo or payload.
  • Delivery agent refers to any substance which facilitates, at least in part, the in vivo delivery of a polynucleotide, primary construct or mmRNA to targeted cells.
  • Destabilized As used herein, the term “destable,” “destabilize,” or
  • stabilizing region means a region or molecule that is less stable than a starting, wild- type or native form of the same region or molecule.
  • Detectable label refers to one or more markers, signals, or moieties which are attached, incorporated or associated with another entity that is readily detected by methods known in the art including radiography, fluorescence, chemiluminescence, enzymatic activity, absorbance and the like. Detectable labels include radioisotopes, fluorophores, chromophores, enzymes, dyes, metal ions, ligands such as biotin, avidin, streptavidin and haptens, quantum dots, and the like.
  • Detectable labels may be located at any position in the peptides or proteins disclosed herein. They may be within the amino acids, the peptides, or proteins, or located at the N- or C- termini.
  • developmental potential or “developmental potency” refers to the total of all developmental cell fates or cell types that can be achieved by a cell upon differentiation.
  • developmental potential altering factor refers to a protein or RNA which can alter the developmental potential of a cell.
  • Digest As used herein, the term “digest” means to break apart into smaller pieces or components. When referring to polypeptides or proteins, digestion results in the production of peptides. [00495] Differentiated cell: As used herein, the term “differentiated cell” refers to any somatic cell that is not, in its native form, pluripotent. Differentiated cell also encompasses cells that are partially differentiated.
  • Differentiation factor refers to a developmental potential altering factor such as a protein, RNA or small molecule that can induce a cell to differentiate to a desired cell-type.
  • Differentiate refers to the process where an uncommitted or less committed cell acquires the features of a committed cell.
  • Disease refers to an abnormal condition affecting the body of an organism often showing specific bodily symptoms.
  • disorders refers to a disruption of or an interference with normal functions or established systems of the body.
  • distal As used herein, the term “distal” means situated away from the center or away from a point or region of interest.
  • Embryonic stem cell As used herein, the term “embryonic stem cell” refers to naturally occurring pluripotent stem cells of the inner cell mass of the embryonic blastocyst.
  • Encapsulate As used herein, the term “encapsulate” means to enclose, surround or encase.
  • Encoded protein cleavage signal refers to the nucleotide sequence which encodes a protein cleavage signal.
  • Engineered As used herein, embodiments of the invention are "engineered” when they are designed to have a feature or property, whether structural or chemical, that varies from a starting point, wild type or native molecule.
  • Exosome is a vesicle secreted by mammalian cells or a complex involved in RNA degradation.
  • expression refers to one or more of the following events: (1) production of an RNA template from a DNA sequence (e.g., by transcription); (2) processing of an RNA transcript (e.g., by splicing, editing, 5' cap formation, and/or 3' end processing); (3) translation of an RNA into a polypeptide or protein; and (4) post-translational modification of a polypeptide or protein.
  • Feature As used herein, a “feature” refers to a characteristic, a property, or a distinctive element.
  • formulation includes at least a
  • polynucleotide, primary construct or mmRNA and a delivery agent are examples of delivery agents.
  • fragment refers to a portion.
  • fragments of proteins may comprise polypeptides obtained by digesting full-length protein isolated from cultured cells.
  • a "functional" biological molecule is a biological molecule in a form in which it exhibits a property and/or activity by which it is characterized.
  • homology refers to the overall relatedness between polymeric molecules, e.g. between nucleic acid molecules (e.g. DNA molecules and/or RNA molecules) and/or between polypeptide molecules.
  • polymeric molecules are considered to be “homologous” to one another if their sequences are at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical or similar.
  • homologous necessarily refers to a comparison between at least two sequences (polynucleotide or polypeptide sequences).
  • two polynucleotide sequences are considered to be homologous if the polypeptides they encode are at least about 50%, 60%, 70%, 80%, 90%, 95%, or even 99% for at least one stretch of at least about 20 amino acids.
  • homologous polynucleotide sequences are characterized by the ability to encode a stretch of at least 4-5 uniquely specified amino acids. For polynucleotide sequences less than 60 nucleotides in length, homology is determined by the ability to encode a stretch of at least 4-5 uniquely specified amino acids.
  • two protein sequences are considered to be homologous if the proteins are at least about 50%, 60%, 70%, 80%, or 90% identical for at least one stretch of at least about 20 amino acids.
  • Identity refers to the overall relatedness between polymeric molecules, e.g., between oligonucleotide molecules (e.g. DNA molecules and/or RNA molecules) and/or between polypeptide molecules. Calculation of the percent identity of two polynucleotide sequences, for example, can be performed by aligning the two sequences for optimal comparison purposes (e.g., gaps can be introduced in one or both of a first and a second nucleic acid sequences for optimal alignment and non-identical sequences can be disregarded for comparison purposes).
  • the length of a sequence aligned for comparison purposes is at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or 100% of the length of the reference sequence.
  • the nucleotides at corresponding nucleotide positions are then compared. When a position in the first sequence is occupied by the same nucleotide as the corresponding position in the second sequence, then the molecules are identical at that position.
  • the percent identity between the two sequences is a function of the number of identical positions shared by the sequences, taking into account the number of gaps, and the length of each gap, which needs to be introduced for optimal alignment of the two sequences.
  • the comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm.
  • the percent identity between two nucleotide sequences can be determined using methods such as those described in Computational Molecular Biology, Lesk, A. M., ed., Oxford University Press, New York, 1988; Biocomputing: Informatics and Genome Projects, Smith, D. W., ed., Academic Press, New York, 1993; Sequence Analysis in Molecular Biology, von Heinje, G., Academic Press, 1987; Computer Analysis of Sequence Data, Part I, Griffin, A. M., and Griffin, H. G., eds., Humana Press, New Jersey, 1994; and Sequence Analysis Primer, Gribskov, M.
  • the percent identity between two nucleotide sequences can be determined using the algorithm of Meyers and Miller (CABIOS, 1989, 4: 1 1-17), which has been incorporated into the ALIGN program (version 2.0) using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4.
  • the percent identity between two nucleotide sequences can, alternatively, be determined using the GAP program in the GCG software package using an NWSgapdna.CMP matrix.
  • Methods commonly employed to determine percent identity between sequences include, but are not limited to those disclosed in Carillo, FL, and Lipman, D., SIAM J Applied Math., 48: 1073 (1988); incorporated herein by reference. Techniques for determining identity are codified in publicly available computer programs. Exemplary computer software to determine homology between two sequences include, but are not limited to, GCG program package, Devereux, J., et al, Nucleic Acids Research, 12(1), 387 (1984)), BLASTP, BLASTN, and FASTA Altschul, S. F. et al, J. Molec. Biol, 215, 403 (1990)).
  • Inhibit expression of a gene means to cause a reduction in the amount of an expression product of the gene.
  • the expression product can be an RNA transcribed from the gene (e.g., an mRNA) or a polypeptide translated from an mRNA transcribed from the gene.
  • a reduction in the level of an mRNA results in a reduction in the level of a polypeptide translated therefrom.
  • the level of expression may be determined using standard techniques for measuring mRNA or protein.
  • in vitro refers to events that occur in an artificial environment, e.g., in a test tube or reaction vessel, in cell culture, in a Petri dish, etc., rather than within an organism (e.g., animal, plant, or microbe).
  • in vivo refers to events that occur within an organism (e.g., animal, plant, or microbe or cell or tissue thereof).
  • Isolated refers to a substance or entity that has been separated from at least some of the components with which it was associated (whether in nature or in an experimental setting). Isolated substances may have varying levels of purity in reference to the substances from which they have been associated. Isolated substances and/or entities may be separated from at least about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, or more of the other components with which they were initially associated.
  • isolated agents are more than about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99%, or more than about 99% pure.
  • a substance is "pure" if it is substantially free of other components.
  • Substantially isolated By “substantially isolated” is meant that the compound is substantially separated from the environment in which it was formed or detected. Partial separation can include, for example, a composition enriched in the compound of the present disclosure. Substantial separation can include compositions containing at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, at least about 97%, or at least about 99% by weight of the compound of the present disclosure, or salt thereof. Methods for isolating compounds and their salts are routine in the art.
  • Linker refers to a group of atoms, e.g., 10-1,000 atoms, and can be comprised of the atoms or groups such as, but not limited to, carbon, amino, alkylamino, oxygen, sulfur, sulfoxide, sulfonyl, carbonyl, and imine.
  • the linker can be attached to a modified nucleoside or nucleotide on the nucleobase or sugar moiety at a first end, and to a payload, e.g., a detectable or therapeutic agent, at a second end.
  • the linker may be of sufficient length as to not interfere with incorporation into a nucleic acid sequence.
  • the linker can be used for any useful purpose, such as to form mmRNA multimers (e.g., through linkage of two or more polynucleotides, primary constructs, or mmRNA molecules) or mmRNA conjugates, as well as to administer a payload, as described herein.
  • Examples of chemical groups that can be incorporated into the linker include, but are not limited to, alkyl, alkenyl, alkynyl, amido, amino, ether, thioether, ester, alkylene, heteroalkylene, aryl, or heterocyclyl, each of which can be optionally substituted, as described herein.
  • a disulfide bond e.g., ethylene or propylene glycol monomeric units, e.g., diethylene glycol, dipropylene glycol, triethylene glycol, tripropylene glycol, tetraethylene glycol, or tetraethylene glycol
  • dextran polymers Other examples include, but are
  • Non-limiting examples of a selectively cleavable bond include an amido bond can be cleaved for example by the use of tris(2-carboxyethyl)phosphine (TCEP), or other reducing agents, and/or photolysis, as well as an ester bond can be cleaved for example by acidic or basic hydrolysis.
  • TCEP tris(2-carboxyethyl)phosphine
  • MicroRNA (miRNA) binding site As used herein, a microRNA (miRNA) binding site represents a nucleotide location or region of a nucleic acid transcript to which at least the "seed" region of a miRNA binds.
  • Modified refers to a changed state or structure of a molecule of the invention. Molecules may be modified in many ways including chemically, structurally, and functionally.
  • the mRNA molecules of the present invention are modified by the introduction of non-natural nucleosides and/or nucleotides, e.g., as it relates to the natural ribonucleotides A, U, G, and C.
  • Noncanonical nucleotides such as the cap structures are not considered “modified” although they differ from the chemical structure of the A, C, G, U ribonucleotides.
  • Mucus As used herein, “mucus” refers to the natural substance that is viscous and comprises mucin glycoproteins.
  • Multipotent As used herein, “multipotent” or “partially differentiated cell” when referring to a cell refers to a cell that has a developmental potential to differentiate into cells of one or more germ layers, but not all three germ layers.
  • Non-human vertebrate As used herein, a “non human vertebrate” includes all vertebrates except Homo sapiens, including wild and domesticated species. Examples of non-human vertebrates include, but are not limited to, mammals, such as alpaca, banteng, bison, camel, cat, cattle, deer, dog, donkey, gayal, goat, guinea pig, horse, llama, mule, pig, rabbit, reindeer, sheep water buffalo, and yak.
  • mammals such as alpaca, banteng, bison, camel, cat, cattle, deer, dog, donkey, gayal, goat, guinea pig, horse, llama, mule, pig, rabbit, reindeer, sheep water buffalo, and yak.
  • Off-target refers to any unintended effect on any one or more target, gene, or cellular transcript.
  • Oligopotent when referring to a cell means to give rise to a more restricted subset of cell lineages than multipotent stem cells.
  • Open reading frame As used herein, "open reading frame” or “ORE” refers to a sequence which does not contain a stop codon in a given reading frame.
  • Operably linked refers to a functional connection between two or more molecules, constructs, transcripts, entities, moieties or the like.
  • Peptide As used herein, "peptide” is less than or equal to 50 amino acids long, e.g., about 5, 10, 15, 20, 25, 30, 35, 40, 45, or 50 amino acids long.
  • Paratope As used herein, a “paratope” refers to the antigen-binding site of an antibody.
  • patient refers to a subject who may seek or be in need of treatment, requires treatment, is receiving treatment, will receive treatment, or a subject who is under care by a trained professional for a particular disease or condition.
  • compositions, and/or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio.
  • compositions refers any ingredient other than the compounds described herein (for example, a vehicle capable of suspending or dissolving the active compound) and having the properties of being substantially nontoxic and noninflammatory in a patient.
  • Excipients may include, for example: antiadherents, antioxidants, binders, coatings, compression aids, dis integrants, dyes (colors), emollients, emulsifiers, fillers (diluents), film formers or coatings, flavors, fragrances, glidants (flow enhancers), lubricants, preservatives, printing inks, sorbents, suspensing or dispersing agents, sweeteners, and waters of hydration.
  • antiadherents antioxidants, binders, coatings, compression aids, dis integrants, dyes (colors), emollients, emulsifiers, fillers (diluents), film formers or coatings, flavors, fragrances, glidants (flow enhancers), lubricants, preservatives, printing inks, sorbents, suspensing or dispersing agents, sweeteners, and waters of hydration.
  • excipients include, but are not limited to: butylated hydroxytoluene (BHT), calcium carbonate, calcium phosphate (dibasic), calcium stearate, croscarmellose, crosslinked polyvinyl pyrrolidone, citric acid, crospovidone, cysteine, ethylcellulose, gelatin, hydroxypropyl cellulose, hydroxypropyl methylcellulose, lactose, magnesium stearate, maltitol, mannitol, methionine, methylcellulose, methyl paraben, microcrystalline cellulose, polyethylene glycol, polyvinyl pyrrolidone, povidone, pregelatinized starch, propyl paraben, retinyl palmitate, shellac, silicon dioxide, sodium carboxymethyl cellulose, sodium citrate, sodium starch glycolate, sorbitol, starch (corn), stearic acid, sucrose, talc, titanium dioxide, vitamin A, vitamin E, vitamin C,
  • compositions described herein also includes pharmaceutically acceptable salts of the compounds described herein.
  • pharmaceutically acceptable salts refers to derivatives of the disclosed compounds wherein the parent compound is modified by converting an existing acid or base moiety to its salt form (e.g., by reacting the free base group with a suitable organic acid).
  • Examples of pharmaceutically acceptable salts include, but are not limited to, mineral or organic acid salts of basic residues such as amines; alkali or organic salts of acidic residues such as carboxylic acids; and the like.
  • Representative acid addition salts include acetate, adipate, alginate, ascorbate, aspartate, benzenesulfonate, benzoate, bisulfate, borate, butyrate, camphorate, camphorsulfonate, citrate, cyclopentanepropionate, digluconate, dodecylsulfate, ethanesulfonate, fumarate, glucoheptonate,
  • glycerophosphate hemisulfate, heptonate, hexanoate, hydrobromide, hydrochloride, hydroiodide, 2-hydroxy-ethanesulfonate, lactobionate, lactate, laurate, lauryl sulfate, malate, maleate, malonate, methanesulfonate, 2-naphthalenesulfonate, nicotinate, nitrate, oleate, oxalate, palmitate, pamoate, pectinate, persulfate, 3-phenylpropionate, phosphate, picrate, pivalate, propionate, stearate, succinate, sulfate, tartrate, thiocyanate, toluenesulfonate, undecanoate, valerate salts, and the like.
  • alkali or alkaline earth metal salts include sodium, lithium, potassium, calcium, magnesium, and the like, as well as nontoxic ammonium, quaternary ammonium, and amine cations, including, but not limited to ammonium, tetramethylammonium, tetraethylammonium, methylamine, dimethylamine, trimethylamine, triethylamine, ethylamine, and the like.
  • the pharmaceutically acceptable salts of the present disclosure include the conventional non-toxic salts of the parent compound formed, for example, from non-toxic inorganic or organic acids.
  • the pharmaceutically acceptable salts of the present disclosure can be synthesized from the parent compound which contains a basic or acidic moiety by conventional chemical methods.
  • such salts can be prepared by reacting the free acid or base forms of these compounds with a stoichiometric amount of the appropriate base or acid in water or in an organic solvent, or in a mixture of the two; generally, nonaqueous media like ether, ethyl acetate, ethanol, isopropanol, or acetonitrile are preferred.
  • nonaqueous media like ether, ethyl acetate, ethanol, isopropanol, or acetonitrile are preferred.
  • Lists of suitable salts are found in Remington 's Pharmaceutical Sciences, 17 th ed., Mack Publishing Company, Easton, Pa., 1985, p. 1418, Pharmaceutical Salts: Properties, Selection, and Use, P.H. Stahl and C.G. Wermuth (eds.), Wiley-VCH, 2008, and Berge et al, Journal of Pharmaceutical Science, 66, 1-19 (1977), each of which is incorporated herein by reference in its entirety.
  • Pharmacokinetic refers to any one or more properties of a molecule or compound as it relates to the determination of the fate of substances administered to a living organism. Pharmacokinetics is divided into several areas including the extent and rate of absorption, distribution, metabolism and excretion. This is commonly referred to as ADME where: (A) Absorption is the process of a substance entering the blood circulation; (D) Distribution is the dispersion or
  • Metabolism or Biotransformation
  • E Excretion
  • compositions comprising: a compound of the invention wherein molecules of a suitable solvent are incorporated in the crystal lattice.
  • a suitable solvent is
  • solvates may be prepared by crystallization, recrystallization, or precipitation from a solution that includes organic solvents, water, or a mixture thereof.
  • suitable solvents are ethanol, water (for example, mono-, di-, and tri-hydrates), N-methylpyrrolidinone ( ⁇ ), dimethyl sulfoxide (DMSO), N,N'-dimethylformamide (DMF), N,N'-dimethylacetamide (DMAC), l,3-dimethyl-2-imidazolidinone (DMEU), l,3-dimethyl-3,4,5,6-tetrahydro-2- (lH)-pyrimidinone (DMPU), acetonitrile (ACN), propylene glycol, ethyl acetate, benzyl alcohol, 2-pyrrolidone, benzyl benzoate, and the like.
  • water is the solvent
  • the solvate is referred to as a "hydrate.”
  • Physicochemical means of or relating to a physical and/or chemical property.
  • Pluripotent refers to a cell with the
  • Pluripotency As used herein, “pluripotency” or “pluripotent state” refers to the developmental potential of a cell where the cell has the ability to differentitate into all three embryonic germ layers (endoderm, mesoderm and ectoderm).
  • the term "preventing” refers to partially or completely delaying onset of an infection, disease, disorder and/or condition; partially or completely delaying onset of one or more symptoms, features, or clinical manifestations of a particular infection, disease, disorder, and/or condition; partially or completely delaying onset of one or more symptoms, features, or manifestations of a particular infection, disease, disorder, and/or condition; partially or completely delaying progression from an infection, a particular disease, disorder and/or condition; and/or decreasing the risk of developing pathology associated with the infection, the disease, disorder, and/or condition.
  • Prodrug The present disclosure also includes prodrugs of the compounds described herein.
  • prodrugs refer to any substance, molecule or entity which is in a form predicate for that substance, molecule or entity to act as a therapeutic upon chemical or physical alteration. Prodrugs may by covalently bonded or sequestered in some way and which release or are converted into the active drug moiety prior to, upon or after administered to a mammalian subject. Prodrugs can be prepared by modifying functional groups present in the compounds in such a way that the modifications are cleaved, either in routine manipulation or in vivo, to the parent compounds.
  • Prodrugs include compounds wherein hydroxyl, amino, sulfhydryl, or carboxyl groups are bonded to any group that, when administered to a mammalian subject, cleaves to form a free hydroxyl, amino, sulfhydryl, or carboxyl group respectively. Preparation and use of prodrugs is discussed in T. Higuchi and V. Stella, "Pro-drugs as Novel Delivery
  • Proliferate As used herein, the term “proliferate” means to grow, expand or increase or cause to grow, expand or increase rapidly. “Proliferative” means having the ability to proliferate. “Anti-proliferative” means having properties counter to or inapposite to proliferative properties.
  • Progenitor cell refers to cells that have greater developmental potential relative to a cell which it can give rise to by differentiation.
  • Protein cleavage site refers to a site where controlled cleavage of the amino acid chain can be accomplished by chemical, enzymatic or photochemical means.
  • Protein cleavage signal refers to at least one amino acid that flags or marks a polypeptide for cleavage.
  • Protein of interest As used herein, the terms “proteins of interest” or “desired proteins” include those provided herein and fragments, mutants, variants, and alterations thereof.
  • Proximal As used herein, the term “proximal” means situated nearer to the center or to a point or region of interest.
  • Purified means to make substantially pure or clear from unwanted components, material defilement, admixture or imperfection.
  • the term "repeated transfection” refers to transfection of the same cell culture with a polynucleotide, primary construct or mmRNA a plurality of times.
  • the cell culture can be transfected at least twice, at least 3 times, at least 4 times, at least 5 times, at least 6 times, at least 7 times, at least 8 times, at least 9 times, at least 10 times, at least 1 1 times, at least 12 times, at least 13 times, at least 14 times, at least 15 times, at least 16 times, at least 17 times at least 18 times, at least 19 times, at least 20 times, at least 25 times, at least 30 times, at least 35 times, at least 40 times, at least 45 times, at least 50 times or more.
  • Reprogramming refers to a process that reverses the developmental potential of a cell or population of cells.
  • Reprogramming factor refers to a developmental potential altering factor such as a protein, RNA or small molecule, the expression of which contributes to the reprogramming of a cell to a less differentiated or undifferentiated state.
  • sample refers to a subset of its tissues, cells or component parts (e.g. body fluids, including but not limited to blood, mucus, lymphatic fluid, synovial fluid, cerebrospinal fluid, saliva, amniotic fluid, amniotic cord blood, urine, vaginal fluid and semen).
  • body fluids including but not limited to blood, mucus, lymphatic fluid, synovial fluid, cerebrospinal fluid, saliva, amniotic fluid, amniotic cord blood, urine, vaginal fluid and semen).
  • a sample further may include a homogenate, lysate or extract prepared from a whole organism or a subset of its tissues, cells or component parts, or a fraction or portion thereof, including but not limited to, for example, plasma, serum, spinal fluid, lymph fluid, the external sections of the skin, respiratory, intestinal, and genitourinary tracts, tears, saliva, milk, blood cells, tumors, organs.
  • a sample further refers to a medium, such as a nutrient broth or gel, which may contain cellular components, such as proteins or nucleic acid molecule.
  • Signal Sequences refers to a sequence which can direct the transport or localization of a protein.
  • Single unit dose is a dose of any therapeutic administered in one dose/at one time/single route/single point of contact, i.e., single administration event.
  • Similarity refers to the overall relatedness between polymeric molecules, e.g. between polynucleotide molecules (e.g. DNA molecules and/or RNA molecules) and/or between polypeptide molecules.
  • Calculation of percent similarity of polymeric molecules to one another can be performed in the same manner as a calculation of percent identity, except that calculation of percent similarity takes into account conservative substitutions as is understood in the art.
  • Somatic cell refers to any cell other than a germ cell, a cell present in or obtained from a pre-implantation embryo, or a cell resulting from proliferation of such a cell in vitro.
  • Somatic stem cell refers to any pluripotent or multipotent stem cell derived from non-embryonic tissue including fetal, juvenile and adult tissue.
  • Somatic pluripotent cell As used herein, a "somatic pluripotent cell” refers to a somatic cell that has had its developmental potential altered to that of a pluripotent state.
  • split dose As used herein, a “split dose” is the division of single unit dose or total daily dose into two or more doses.
  • Stable As used herein “stable” refers to a compound that is sufficiently robust to survive isolation to a useful degree of purity from a reaction mixture, and preferably capable of formulation into an efficacious therapeutic agent.
  • Stabilized As used herein, the term “stabilize”, “stabilized,” “stabilized region” means to make or become stable.
  • Stem cell As used herein, the term “stem cell” refers to a cell in an
  • a stem cell may be able capable of proliferation and giving rise to more such stem cells while maintaining its developmental potential.
  • Subject refers to any organism to which a composition in accordance with the invention may be administered, e.g., for experimental, diagnostic, prophylactic, and/or therapeutic purposes. Typical subjects include animals (e.g., mammals such as mice, rats, rabbits, non-human primates, and humans) and/or plants.
  • animals e.g., mammals such as mice, rats, rabbits, non-human primates, and humans
  • the term “substantially” refers to the qualitative condition of exhibiting total or near-total extent or degree of a characteristic or property of interest.
  • One of ordinary skill in the biological arts will understand that biological and chemical phenomena rarely, if ever, go to completion and/or proceed to completeness or achieve or avoid an absolute result.
  • the term “substantially” is therefore used herein to capture the potential lack of completeness inherent in many biological and chemical phenomena.
  • Substantially equal As used herein as it relates to time differences between doses, the term means plus/minus 2%.
  • Susceptible to An individual who is "susceptible to" a disease, disorder, and/or condition has not been diagnosed with and/or may not exhibit symptoms of the disease, disorder, and/or condition but harbors a propensity to develop a disease or its symptoms.
  • an individual who is susceptible to a disease, disorder, and/or condition may be characterized by one or more of the following: (1) a genetic mutation associated with development of the disease, disorder, and/or condition; (2) a genetic polymorphism associated with development of the disease, disorder, and/or condition; (3) increased and/or decreased expression and/or activity of a protein and/or nucleic acid associated with the disease, disorder, and/or condition; (4) habits and/or lifestyles associated with development of the disease, disorder, and/or condition; (5) a family history of the disease, disorder, and/or condition; and (6) exposure to and/or infection with a microbe associated with development of the disease, disorder, and/or condition.
  • an individual who is susceptible to a disease, disorder, and/or condition will develop the disease, disorder, and/or condition. In some embodiments, an individual who is susceptible to a disease, disorder, and/or condition will not develop the disease, disorder, and/or condition.
  • Sustained release refers to a pharmaceutical composition or compound release profile that conforms to a release rate over a specific period of time.
  • Synthetic means produced, prepared, and/or
  • Synthesis of polynucleotides or polypeptides or other molecules of the present invention may be chemical or enzymatic.
  • Targeted cells refers to any one or more cells of interest.
  • the cells may be found in vitro, in vivo, in situ or in the tissue or organ of an organism.
  • the organism may be an animal, preferably a mammal, more preferably a human and most preferably a patient.
  • therapeutic agent refers to any agent that, when administered to a subject, has a therapeutic, diagnostic, and/or prophylactic effect and/or elicits a desired biological and/or pharmacological effect.
  • therapeutically effective amount means an amount of an agent to be delivered (e.g., nucleic acid, drug, therapeutic agent, diagnostic agent, prophylactic agent, etc.) that is sufficient, when administered to a subject suffering from or susceptible to an infection, disease, disorder, and/or condition, to treat, improve symptoms of, diagnose, prevent, and/or delay the onset of the infection, disease, disorder, and/or condition.
  • an agent to be delivered e.g., nucleic acid, drug, therapeutic agent, diagnostic agent, prophylactic agent, etc.
  • Therapeutically effective outcome means an outcome that is sufficient in a subject suffering from or susceptible to an infection, disease, disorder, and/or condition, to treat, improve symptoms of, diagnose, prevent, and/or delay the onset of the infection, disease, disorder, and/or condition.
  • Total daily dose As used herein, a "total daily dose” is an amount given or prescribed in 24 hr period. It may be administered as a single unit dose.
  • Totipotency refers to a cell with a developmental potential to make all of the cells found in the adult body as well as the extra-embryonic tissues, including the placenta.
  • Transcription factor refers to a DNA-binding protein that regulates transcription of DNA into RNA, for example, by activation or repression of transcription. Some transcription factors effect regulation of transcription alone, while others act in concert with other proteins. Some transcription factor can both activate and repress transcription under certain conditions. In general, transcription factors bind a specific target sequence or sequences highly similar to a specific consensus sequence in a regulatory region of a target gene. Transcription factors may regulate transcription of a target gene alone or in a complex with other molecules.
  • Transcription refers to methods to introduce exogenous nucleic acids into a cell. Methods of transfection include, but are not limited to, chemical methods, plysical treatments and cationic lipids or mixtures.
  • Transdifferentiation refers to the capacity of differentiated cells of one type to lose identifying characteristics and to change their phenotype to that of other fully differentiated cells.
  • treating refers to partially or completely alleviating, ameliorating, improving, relieving, delaying onset of, inhibiting progression of, reducing severity of, and/or reducing incidence of one or more symptoms or features of a particular infection, disease, disorder, and/or condition.
  • treating cancer may refer to inhibiting survival, growth, and/or spread of a tumor.
  • Treatment may be administered to a subject who does not exhibit signs of a disease, disorder, and/or condition and/or to a subject who exhibits only early signs of a disease, disorder, and/or condition for the purpose of decreasing the risk of developing pathology associated with the disease, disorder, and/or condition.
  • Unmodified refers to any substance, compound or molecule prior to being changed in any way. Unmodified may, but does not always, refer to the wild type or native form of a biomolecule. Molecules may undergo a series of modifications whereby each modified molecule may serve as the "unmodified" starting molecule for a subsequent modification.
  • articles such as “a,” “an,” and “the” may mean one or more than one unless indicated to the contrary or otherwise evident from the context. Claims or descriptions that include “or” between one or more members of a group are considered satisfied if one, more than one, or all of the group members are present in, employed in, or otherwise relevant to a given product or process unless indicated to the contrary or otherwise evident from the context.
  • the invention includes embodiments in which exactly one member of the group is present in, employed in, or otherwise relevant to a given product or process.
  • the invention includes embodiments in which more than one, or all of the group members are present in, employed in, or otherwise relevant to a given product or process.
  • any particular embodiment of the present invention that falls within the prior art may be explicitly excluded from any one or more of the claims. Since such embodiments are deemed to be known to one of ordinary skill in the art, they may be excluded even if the exclusion is not set forth explicitly herein. Any particular embodiment of the compositions of the invention (e.g., any nucleic acid or protein encoded thereby; any method of production; any method of use; etc. ) can be excluded from any one or more claims, for any reason, whether or not related to the existence of prior art.
  • Synthetic polynucleotides and sgRNA of the invention are produced via creation of a DNA construct; PCR amplification of a cDNA template; in-vitro transcription of the cDNA template (using, in some embodiments, modified nucleotides); if necessary, post-in vitro transcription enzymatic poly -A tailing and/or 5' capping; and purification and analysis.
  • the DNA construct for the synthetic polynucleotide includes an open reading frame.
  • the open reading frame (ORF) coding for the CRISPR related protein, e.g., dCAS9 or dCAS9-activator fusion protein may be flanked by a 5' untranslated region (UTR) which may contain a strong Kozak trans lational initiation signal and/or an alpha- globin 3' UTR which may include an oligo(dT) sequence for templated addition of a poly- A tail.
  • UTR 5' untranslated region
  • the ORF may also include various upstream or downstream additions (such as, but not limited to, ⁇ -globin, tags, etc.) may be ordered from an optimization service such as, but limited to, DNA2.0 (Menlo Park, CA) and may contain multiple cloning sites which may have Xbal recognition.
  • an optimization service such as, but limited to, DNA2.0 (Menlo Park, CA) and may contain multiple cloning sites which may have Xbal recognition.
  • the DNA construct for the sgRNA of the invention is made using similar methods.
  • the plasmid construct includes an insert with a sgRNA sequence including the N(20-25) guides sequence and the guide scaffold sequence flanked on the 5' end with a RNA polymerase specific 5'UTR, e.g., a T7 polymerase 5' UTR.
  • the DNA construct for the synthetic polynucleotide and/or the sgRNA is transformed in E. coli.
  • E. coli For the present invention, NEB DH5 -alpha Competent E. coli are used. Transformations are performed according to NEB instructions using 100 ng of plasmid. The protocol is as follows: 1. Thaw a tube of NEB 5 -alpha Competent E. coli cells on ice for 10 minutes.
  • a single colony is then used to inoculate 5 ml of LB growth media using the appropriate antibiotic and then allowed to grow (250 RPM, 37° C) for 5 hours. This is then used to inoculate a 200 ml culture medium and allowed to grow overnight under the same conditions.
  • the plasmid is first linearized using a restriction enzyme such as Xbal.
  • a typical restriction digest with Xbal will comprise the following: Plasmid 1.0 ⁇ g; lOx Buffer 1.0 ⁇ ; Xbal 1.5 ⁇ ; dH 2 0 up to 10 ⁇ ; incubated at 37° C for 1 hr. If performing at lab scale ( ⁇ 5 ⁇ g), the reaction is cleaned up using Invitrogen' s PURELINKTM PCR Micro Kit (Carlsbad, CA) per manufacturer's instructions.
  • the linearized plasmid (encoding the synthetic polynucleotide encoding the CRISPR related protein or encoding the sgRNA) is amplified using PCR for preparation of cDNA, e.g., a transcription template.
  • PCR procedures for the preparation of cDNA are performed using 2x KAPA HIFITM HotStart ReadyMix by Kapa Biosystems (Woburn, MA). This system includes 2x KAPA ReadyMixl2.5 ⁇ ; Forward Primer (10 uM); 0.75 ⁇ ; Reverse Primer (10 uM) 0.75 ⁇ ; Template cDNA ; 100 ng; and dH20 diluted to 25.0 ⁇ .
  • the reaction conditions are at 95° C for 5 min. and 25 cycles of 98° C for 20 sec, then 58° C for 15 sec, then 72° C for 45 sec, then 72° C for 5 min. then 4° C to termination.
  • the reverse primer of the instant invention incorporates a poly-T o for a poly-A ⁇ o in the mRNA.
  • Other reverse primers with longer or shorter poly(T) tracts can be used to adjust the length of the poly(A) tail in the mRNA.
  • the reaction is cleaned up using Invitrogen's PURELINKTM PCR Micro Kit (Carlsbad, CA) per manufacturer's instructions (up to 5 ⁇ g). Larger reactions will require a cleanup using a product with a larger capacity. Following the cleanup, the cDNA is quantified using the NanoDrop and analyzed by agarose gel electrophoresis to confirm the cDNA is the expected size. The cDNA is then submitted for sequencing analysis before proceeding to the in vitro transcription reaction.
  • the amplified product cDNA is used as a template for in vitro transcription to generate synthetic polynucleotides and/or synthetic sgRNAs.
  • the input nucleotide triphosphate (NTP) mix is made in-house using natural and un-natural NTPs.
  • the in vitro transcription reaction generates modified synthetic polynucleotides and/or sgRNA.
  • a typical in vitro transcription reaction includes the following:
  • Custom NTPs (25mM each) 7.2 ⁇

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Engineering & Computer Science (AREA)
  • Chemical & Material Sciences (AREA)
  • Biomedical Technology (AREA)
  • Organic Chemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Wood Science & Technology (AREA)
  • Zoology (AREA)
  • Molecular Biology (AREA)
  • Biotechnology (AREA)
  • General Engineering & Computer Science (AREA)
  • General Health & Medical Sciences (AREA)
  • Biochemistry (AREA)
  • Microbiology (AREA)
  • Medicinal Chemistry (AREA)
  • Plant Pathology (AREA)
  • Physics & Mathematics (AREA)
  • Biophysics (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Cell Biology (AREA)
  • Mycology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Epidemiology (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicinal Preparation (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Apparatus Associated With Microorganisms And Enzymes (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Peptides Or Proteins (AREA)

Abstract

The present invention relates to compositions comprising and methods of using synthetic polynucleotides, e.g., modified mRNA, encoding CRISPR related proteins including dCAS9 and synthetic sgRNAs targeting a gene of interest.

Description

TITLE
[0001] Compositions comprising synthetic polynucleotides encoding CRISPR related proteins and synthetic sgRNAs and methods of use.
CROSS-REFERENCE TO RELATED APPLICATION
[0002] This application claims the benefit of U.S. Provisional Patent Application No. 61/844,890, filed July 11, 2013, and US Provisional Patent Application No. 61/886,545, filed October 3, 2013, the disclosures of which are incorporated herein by reference.
FIELD OF THE INVENTION
[0003] The present invention is directed to compositions comprising and methods of using synthetic polynucleotides and short guide RNAs (sgRNAs). The synthetic polynucleotides are, e.g., synthetic modified RNA encoding CRISPR related proteins, e.g., dCAS9 and dCAS9-effector domain fusion proteins. The synthetic sgRNAs target a gene of interest. The synthetic polynucleotides and synthetic sgRNAs can be used to modulate transcription, e.g., in therapeutics and/or clinical and research settings.
BACKGROUND OF THE INVENTION
[0004] Bacterial and archaeal Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR) systems rely on CRISPR RNAs (crRNAs) in complex with CRISPR- associated (CAS) proteins to direct degradation of complementary sequences present within invading viral and plasmid DNA (Mali et al. Science. 2013. 339:823-826; herein incorporated by reference in its entirety).
[0005] In type II CRISPR systems, the pre-crRNAs are processed by trans-activating crRNA (tracrRNA) complementary to the repeat sequences in pre-crRNA which triggers processing by the double-stranded (ds) RNA-specific ribonuclease RNase III in the presence of the CAS9 protein. CAS9 (formerly CSN1) is the key protein in the type II CRISPR systems and is thought to be the sole protein responsible for crRNA-guided silencing of foreign DNA (Jinek et al. Science. 2012. 337:816-821; herein incorporated by reference in its entirety). The CAS9 protein is also hypothesized to be involved in both crRNA maturation and crRNA-guided DNA interference (Jinek et al. Science. 2012. 337:816-821; herein incorporated by reference in its entirety).
[0006] The CAS9 endonuclease family can be programmed with single RNA molecules to cleave specific DNA sites which may be used to develop a versatile RNA- directed system to generate dsDNA breaks for genome targeting and editing (Jinek et al. Science. 2012. 337:816-821; herein incorporated by reference in its entirety). This use of CAS9 could enhance the ease of genome engineering.
[0007] The Church Lab engineered the bacterial and archaeal type II CRISPR system to function with custom guide RNA (gRNA) in human cells (Mali et al. Science. 2013. 339:823-826; herein incorporated by reference in its entirety).
[0008] It has been shown that fusion of CRISPR-associated catalytically inactive dCas9 protein to distinct effector domains (e.g. VP64, p65AD, KRAB, and Mxil) enables repression or activation of transcription in human and yeast cells, with the site of delivery determined solely by a co-expressed short guide RNA (sgRNA). Coupling of dCas9 to a transcriptional repressor domain can silence expression of multiple endogenous genes, with no detectable off-targets as verified by RNA-seq analysis. (Qi et al. Cell. 2013. 152: 1173-1183)
[0009] One example of a catalytically inactive Cas9 protein is the mutant (D10A, H840A) Streptococcus pyogenes Cas9 protein , typically referred to as dCAS9 (Qi et al. Cell. 2013. 152: 1 173-1 183; Gilbert et al. Cell. 2013. 154: 1-10). A Streptococcus thermophiles Cas9 with 2 endonuclease domains and single amino acid substitution (D31A, H858A) has been described which also resulted in catalytically inactive Cas9 (Sapranauskas et al . Nucleic Acids Research. 201 1. 39:9275-9282).
[0010] Other publications describing the CRISPR systems, Cas9, and dCas9 include the following Cong et al (2013); Jinek et al (2012); Lei et al (2013); Gilbert et al (2013); Perez-Pinela et al (2013); Maider et al (2013).
[0011] It has been shown that certain modified mRNA sequences have the potential as therapeutics with benefits beyond just evading, avoiding or diminishing the immune response. Such studies are detailed in published co-pending applications International Publication No WO2012019168 filed August 5, 2011 and International Publication No WO2012045075 filed October 3, 2011, International Publication No WO2013052523 filed October 3, 2011, the contents of which are incorporated herein by reference in their entirety.
BRIEF DESCRIPTION OF THE DRAWINGS
[0012] The foregoing and other objects, features and advantages will be apparent from the following description of particular embodiments of the invention, as illustrated in the accompanying drawings in which like reference characters refer to the same parts throughout the different views. The drawings are not necessarily to scale, emphasis instead being placed upon illustrating the principles of various embodiments of the invention.
[0013] FIG. 1 is a schematic of a synthetic polynucleotide of the present invention.
[0014] FIG. 2 shows the results of an anti-FLAG Western and Immunoprecipitation performed on the lysates of HeLa cells transfected with FLAG-tagged Cas9 constructs or controls.
[0015] FIG. 3 shows the results of a western analysis of HeLa cells that were transfected with HA-tagged Gilbert Cas9 mRNA using Trilink-HA-tagged Cas9 mRNA as a positive control.
[0016] FIG. 4 shows the results of a LC-PRM Cas9 peptide quantification in cell lysates of HeLa cells transfected with Maeder and Gilbert Cas9 constructs versus untreated HeLa cells. Each chart shows the quantification of a peptide fragment of the Cas9 construct. Figure 4A represents quantification of GNELALPSK peptide (SEQ ID NO: 120). Figure 4B represents quantification of the YFDTTIDR peptide (SEQ ID NO:
121) . Figure 4C represents quantification of the IPYYVGPLAR peptide (SEQ ID NO:
122) .
[0017] FIG. 5 shows the results of an anti-FLAG Western and Immunoprecipitation performed on the lysates of mouse livers from animals dosed with Mug Cas9 LNP (MC3) or mock. WCE = whole cell extract. IP = immunoprecipitation with M2-agarose beads (Sigma). Ladder = See Blue Plus 2™ prestained protein marker (LifeTech).
DETAILED DESCRIPTION
[0018] The present invention is based, at least in part, on the surprising discovery that mRNAs can be expressed in the cytoplasm and translocated to the nucleus. The mRNA technology of the invention is surprisingly suited for delivery of intracellular proteins. The mRNA technology of the invention is also desirable suited for delivery of multiple mRNAs. The methodologies of the invention avoid or circumvent problems associated with conventional gene therapy approaches, such as toxicity, integration of DNA into host genome, and the like. The methodologies of the invention are particularly suited to the delivery of a plurality of mRNAs, without inducing an innate immune and without undesirable side effects associated with conventional gene therapy approaches. In particular, the mRNA delivery technology of the invention facilitates the expression both the mRNA encoding CRISPR-related proteins, e.g., Cas9, dCas9 and variants thereof, in combination with one or more guide RNAs (sgRNAs) to enable gene regulation in vitro and in vivo. Using mRNA-based pharmaceutical compositions, the technology provides for therapeutic applications of the CRISPR technologies that were previously unattainable
[0019] The data presented herein evidence that it is possible to achieve intracellular expression of CRISPR-related proteins, including proteins engineered to include regulatory sequence facilitating regulation of protein expression, and the corresponding mRNA targeting sequences (i.e., sgRNAs). The data presented herein demonstrate that is it possible to achieve intracellular protein expression of CRISPR-related proteins, in particular, via in vivo administration of pharmaceutical compositions containing modified mRNAs encoding such proteins.
[0020] The details of various embodiments of the invention are set forth in the description below. Other features, objects, and advantages of the invention will be apparent from the description and the drawings, and from the claims.
[0021] Described herein are compositions (including pharmaceutical compositions) and methods for the design, preparation, manufacture and/or formulation of synthetic polynucleotides encoding one or more one or more CRISPR related proteins, e.g., dCAS9 and/or dCAS9-effector fusion proteins. Also described herein are compositions
(including pharmaceutical compositions) and methods for the design, preparation, manufacture and/or formulation of one or more synthetic small guide RNAs ("sgRNAs") targeting a gene of interest. Both the synthetic polynucleotides and sgRNAs are typically manufactures using in vitro transcription. In one embodiment the synthetic
polynucleotide and sgRNA are modified, e.g., comprise at least one modified nucleotide. Also described herein are method of modulation of expression of a gene of interest using a synthetic polynucleotide encoding a CRISPR related protein and an sgRNA targeting the gene of interest. Included are in vitro and in vivo methods, e.g., methods of treatment of a disease state correlated with expression of the gene of interest. Also provided are systems, processes, devices and kits for the selection, design and/or utilization of the synthetic polynucleotides and synthetic sgRNAs described herein.
[0022] A key limitation of the CRISPR/Inhibition/Activation (CRISPR/I/A) systems described to date is their dependence on delivery of DNA by viral vectors to drive intracellular transcription (of the sgRNA) and transcription and translation of Cas9, dCas9 or dCas9-fusion proteins such as dCas9-VP64, and dCas9-KRAB. There are several implications of this limitation for in vivo systems using transcriptional
activation/repression as this will require repeat dosing. First, delivery of DNA by pseudo virus will induce measurable innate immune activation (e.g., thru TLRs) and these will impact transfection efficiency and have undesirable side effects. Second, the repeat dosing of viral capsids could and likely will induce an adaptive immune response on repeat dosing. Third, the use of DNA - and the risk of chronically activated dCas9 represent a significant safety and toxicity risk for in vivo therapeutics.
[0023] Modified synthetic polynucleotide (e.g., modified mR A) presents an ideal platform for the clinical translation of this prokaryotic platform. Technologies are disclosed herein to safely delivery modified mRNA in vivo that encodes for CRISPR related protein, e.g., dCA9, in a time limited and - potentially cell-type - targeted fashion. Moreover, the use of modified mRNA will avoid the risk of significant innate immune activation, and diminish the risk of adaptive responses.
ynthetic polynucleotides encoding CRISPR related proteins
[0024] The present invention provides synthetic polynucleotides which encode one or more CRISPR related proteins, e.g., dCAS9 and dCAS9 fusion proteins. The term "polynucleotide," in its broadest sense, includes any compound and/or substance that comprise a polymer of nucleotides. Exemplary polynucleotides of the invention include, but are not limited to, ribonucleic acids (RNAs), deoxyribonucleic acids (DNAs), threose nucleic acids (TNAs), glycol nucleic acids (GNAs), peptide nucleic acids (PNAs), locked nucleic acids (LNAs, including LNA having a β- D-ribo configuration, a-LNA having an a-L-ribo configuration (a diastereomer of LNA), 2'-amino-LNA having a 2'-amino functionalization, and 2'-amino- a-LNA having a 2'-amino functionalization) or hybrids thereof.
[0025] In one embodiment, the synthetic polynucleotide is a synthetic messenger RNA (mRNA). As used herein, the term "messenger RNA" (mRNA) refers to any
polynucleotide, which may be synthetic, which encodes a polypeptide, e.g., a CRISPR related protein, and which is capable of being translated to produce the encoded polypeptide in vitro, in vivo, in situ or ex vivo. In the present invention, the mRNA encodes a CRISPR related protein, e.g., dCAS9 and dCA9-effector (activator or inhibitor) fusion proteins. Additional description of and sequences for CRISPR related proteins are below.
[0026] The present invention expands the scope of functionality of traditional mRNA molecules by providing synthetic polynucleotides which comprise one or more structural and/or chemical modifications or alterations which impart useful properties to the polynucleotides including, in some embodiments, the lack of a substantial induction of the innate immune response of a cell into which the polynucleotide is introduced. As used herein, a "structural" feature or modification is one in which two or more linked nucleotides are inserted, deleted, duplicated, inverted or randomized in a synthetic polynucleotide, primary construct or mmRNA without significant chemical modification to the nucleotides themselves. Because chemical bonds will necessarily be broken and reformed to effect a structural modification, structural modifications are of a chemical nature and hence are chemical modifications. However, structural modifications will result in a different sequence of nucleotides. For example, the polynucleotide "ATCG" (SEQ ID NO: 123) may be chemically modified to "AT-5meC-G" (SEQ ID NO: 124). The same polynucleotide may be structurally modified from "ATCG" (SEQ ID NO: 123) to "ATCCCG" (SEQ ID NO: 125). Here, the dinucleotide "CC" has been inserted, resulting in a structural modification to the polynucleotide.
CRISPR related proteins
[0027] The synthetic polynucleotides of the invention encode a CRISPR related protein. The term "CRISPR related protein" includes but is not limited to CAS9, CSY4, dCAS9, and dCAS9-effector domain (activator and/or inhibitor domain) fusion proteins. Examples of CRISPR related protein polypeptide sequences and polynucleotide sequences are found in the Tables below.
[0028] The CRISPR related protein can be from any number of species including but not limited to Streptococcus pyogenes, Listeria innocua, and Streptococcus thermophilus.
[0029] The synthetic polynucleotide can encode the wild-type sequence of the CRISPR related protein or a variant CRISPR related protein. Variants are described in further details herein. As described in more detail herein, the synthetic polynucleotide can include either the wild-type codon usage or codon usage optimized for a particular application, e.g., human codon optimization for human therapeutics.
[0030] According to the present invention, the synthetic polynucleotides comprise at least a first region of linked nucleosides encoding at least one CRISPR related proteins. Example of CRISPR related proteins are listed in the Tables below. For any particular CRISPR related protein there may exist one or more variants or isoforms. It will be appreciated by those of skill in the art that disclosed in the Tables are potential flanking regions. These are encoded in each transcript either to the 5' (upstream) or 3'
(downstream) of the ORF or coding region. The coding region is definitively and specifically disclosed by teaching the protein sequence. Consequently, the sequences taught flanking that encoding the protein are considered flanking regions. It is also possible to further characterize the 5' and 3' flanking regions by utilizing one or more available databases or algorithms. Databases have annotated the features contained in the flanking regions of the transcripts and these are available in the art.
[0031] In one embodiment the CRISPR related protein is dCAS9. Typical sequences are included in the Tables below.
[0032] In another embodiment the CRISPR related protein is a dCAS9-effector domain fusion protein. The effector domain can be an activation domain or an inhibition domain, depending on the application. Examples of effector domains are well known to one of skill in the art and include, e.g., KRAB, CSD, WRPW, VP64, or p65AD.
[0033] In some embodiments, the CRISPR related protein is dCAS9-KRAB or dCAS9-VP64 fusion proteins. Examples of sequences are provided in the Tables below and the Sequence Listing.
[0034] Further constructs useful in various aspects of the invention include those set forth as SEQ ID NOs: 1-9. These include the nucleotide sequence encoding Cas9, serotype Ml (SEQ ID NO: l); nucleotide sequence encoding FLAG-tagged (i.e., trimer- FLAG) CAS9 having a nuclear localization sequence (NLS) (SEQ ID NO:2); nucleotide sequence encoding HA -tagged Cas9 having a NLS (Cas9-HAtag/2xNLS) conjugated to GFP (SEQ ID NO:3); nucleotide sequence encoding Cas9 C-terminal fragment having a NLS (SEQ ID NO:4); nucleotide sequence encoding Cas9 N-terminal fragment (SEQ ID NO:5); nucleotide sequence encoding FLAG-tagged Cas9 having NLSs (FLAG-NLS- Cas9-NLS) (SEQ ID NO:6); as well as Cas9 protein sequences (Cas9 - SEQ ID NO:8, Cas9 serotype Ml - SEQ ID NO:9) and FLAG-tagged (i.e., trimer-FLAG) CAS9 having a nuclear localization sequence (NLS) (SEQ ID NO:9.)
Synthetic polynucleotide Architecture
[0035] The modified synthetic polynucleotides or of the present invention are distinguished from wild type mRNA in their functional and/or structural design features which serve to, as evidenced herein, overcome existing problems of effective polypeptide production using nucleic acid-based therapeutics.
[0036] Figure 1 shows a representative polynucleotide primary construct 100 of the present invention. As used herein, the term "primary construct" or "primary mRNA construct" refers to a polynucleotide transcript which encodes one or more polypeptides of interest and which retains sufficient structural and/or chemical features to allow the polypeptide of interest encoded therein to be translated. Primary constructs may be polynucleotides of the invention. When structurally or chemically modified, the primary construct may be referred to as an modified synthetic polynucleotides or mmR A.
[0037] Returning to FIG. 1, the primary construct 100 here contains a first region of linked nucleotides 102 that is flanked by a first flanking region 104 and a second flanking region 106. As used herein, the "first region" may be referred to as a "coding region" or "region encoding" or simply the "first region." This first region may include, but is not limited to, the encoded polypeptide of interest, i.e., the CRISPR related protein. The polypeptide of interest may comprise at its 5' terminus one or more signal sequences encoded by a signal sequence region 103. The first flanking region 104 may comprise a region of linked nucleotides comprising one or more complete or incomplete 5' UTRs sequences. The first flanking region 104 may also comprise a 5' terminal capping region 108. The second flanking region 106 may comprise a region of linked nucleotides comprising one or more complete or incomplete 3' UTRs. The second flanking region 106 may also comprise a 3' tailing sequence 110.
[0038] Bridging the 5' terminus of the first region 102 and the first flanking region 104 is a first operational region 105. Traditionally this first operational region comprises a Start codon. The operational region may alternatively comprise any translation initiation sequence or signal including a Start codon.
[0039] Bridging the 3' terminus of the first region 102 and the second flanking region 106 is a second operational region 107. Traditionally this second operational region comprises a Stop codon. The second operational region may alternatively comprise any translation initiation sequence or signal including a Stop codon. According to the present invention, multiple serial stop codons may also be used.
[0040] In some embodiments, the synthetic polynucleotide, primary construct, or mmRNA includes from about 30 to about 100,000 nucleotides (e.g., from 30 to 50, from 30 to 100, from 30 to 250, from 30 to 500, from 30 to 1,000, from 30 to 1,500, from 30 to 3,000, from 30 to 5,000, from 30 to 7,000, from 30 to 10,000, from 30 to 25,000, from 30 to 50,000, from 30 to 70,000, from 100 to 250, from 100 to 500, from 100 to 1,000, from 100 to 1,500, from 100 to 3,000, from 100 to 5,000, from 100 to 7,000, from 100 to 10,000, from 100 to 25,000, from 100 to 50,000, from 100 to 70,000, from 100 to 100,000, from 500 to 1,000, from 500 to 1,500, from 500 to 2,000, from 500 to 3,000, from 500 to 5,000, from 500 to 7,000, from 500 to 10,000, from 500 to 25,000, from 500 to 50,000, from 500 to 70,000, from 500 to 100,000, from 1,000 to 1,500, from 1,000 to 2,000, from 1,000 to 3,000, from 1,000 to 5,000, from 1,000 to 7,000, from 1,000 to 10,000, from 1,000 to 25,000, from 1,000 to 50,000, from 1,000 to 70,000, from 1,000 to 100,000, from 1,500 to 3,000, from 1,500 to 5,000, from 1,500 to 7,000, from 1,500 to 10,000, from 1,500 to 25,000, from 1,500 to 50,000, from 1,500 to 70,000, from 1,500 to 100,000, from 2,000 to 3,000, from 2,000 to 5,000, from 2,000 to 7,000, from 2,000 to 10,000, from 2,000 to 25,000, from 2,000 to 50,000, from 2,000 to 70,000, and from 2,000 to 100,000).
[0041] Generally, the length of the first region encoding the polypeptide of interest, e.g., CRISPR related protein of the present invention is greater than about 30 nucleotides in length (e.g., at least or greater than about 35, 40, 45, 50, 55, 60, 70, 80, 90, 100, 120, 140, 160, 180, 200, 250, 300, 350, 400, 450, 500, 600, 700, 800, 900, 1,000, 1, 100, 1,200, 1,300, 1,400, 1,500, 1,600, 1,700, 1,800, 1,900, 2,000, 2,500, and 3,000, 4,000, 5,000, 6,000, 7,000, 8,000, 9,000, 10,000, 20,000, 30,000, 40,000, 50,000, 60,000, 70,000, 80,000, 90,000 or up to and including 100,000 nucleotides).
[0042] According to the present invention, the first and second flanking regions may range independently from 15-1,000 nucleotides in length (e.g., greater than 30, 40, 45, 50, 55, 60, 70, 80, 90, 100, 120, 140, 160, 180, 200, 250, 300, 350, 400, 450, 500, 600, 700, 800, and 900 nucleotides or at least 30, 40, 45, 50, 55, 60, 70, 80, 90, 100, 120, 140, 160, 180, 200, 250, 300, 350, 400, 450, 500, 600, 700, 800, 900, and 1,000 nucleotides).
[0043] According to the present invention, the 3' tailing sequence may range from absent to 500 nucleotides in length (e.g., at least 60, 70, 80, 90, 120, 140, 160, 180, 200, 250, 300, 350, 400, 450, or 500 nucleotides). Where the tailing sequence is a polyA tail, the length may be determined in units of or as a function of polyA Binding Protein binding. In this embodiment, the polyA tail is long enough to bind at least 4 monomers of PolyA Binding Protein. PolyA Binding Protein monomers bind to stretches of approximately 38 nucleotides. As such, it has been observed that polyA tails of about 80 nucleotides and 160 nucleotides are functional.
[0044] According to the present invention, the 5' terminal capping region may comprise a single cap or a series of nucleotides forming the cap. In this embodiment the capping region may be from 1 to 10, e.g. 2-9, 3-8, 4-7, 1-5, 5-10, or at least 2, or 10 or fewer nucleotides in length. In some embodiments, the capping region is absent.
[0045] According to the present invention, the first and second operational regions may range from 3 to 40, e.g., 5-30, 10-20, 15, or at least 4, or 30 or fewer nucleotides in length and may comprise, in addition to a Start and/or Stop codon, one or more signal and/or restriction sequences.
Cyclic Synthetic Polynucleotides
[0046] According to the present invention, a synthetic polynucleotide may be cyclized, or concatemerized, to generate a translation competent molecule to assist interactions between poly-A binding proteins and 5'-end binding proteins. The mechanism of cyclization or concatemerization may occur through at least 3 different routes: 1) chemical, 2) enzymatic, and 3) ribozyme catalyzed. The newly formed 5 '-/3 '-linkage may be intramolecular or intermolecular.
[0047] In the first route, the 5 '-end and the 3 '-end of the nucleic acid contain chemically reactive groups that, when close together, form a new covalent linkage between the 5 '-end and the 3 '-end of the molecule. The 5 '-end may contain an NHS-ester reactive group and the 3 '-end may contain a 3 '-amino-terminated nucleotide such that in an organic solvent the 3 '-amino-terminated nucleotide on the 3 '-end of a synthetic mRNA molecule will undergo a nucleophilic attack on the 5'-NHS-ester moiety forming a new 5 '-/3 '-amide bond.
[0048] In the second route, T4 RNA ligase may be used to enzymatically link a 5'- phosphorylated nucleic acid molecule to the 3'-hydroxyl group of a nucleic acid forming a new phosphorodiester linkage. In an example reaction, 1 μg of a nucleic acid molecule is incubated at 37°C for 1 hour with 1-10 units of T4 RNA ligase (New England Biolabs, Ipswich, MA) according to the manufacturer's protocol. The ligation reaction may occur in the presence of a split oligonucleotide capable of base-pairing with both the 5'- and 3'- region in juxtaposition to assist the enzymatic ligation reaction.
[0049] In the third route, either the 5 '-or 3 '-end of the cDNA template encodes a ligase ribozyme sequence such that during in vitro transcription, the resultant nucleic acid molecule can contain an active ribozyme sequence capable of ligating the 5'-end of a nucleic acid molecule to the 3 '-end of a nucleic acid molecule. The ligase ribozyme may be derived from the Group I Intron, Group I Intron, Hepatitis Delta Virus, Hairpin ribozyme or may be selected by SELEX (systematic evolution of ligands by exponential enrichment). The ribozyme ligase reaction may take 1 to 24 hours at temperatures between 0 and 37°C. Synthetic Polynucleotide Multimers
[0050] According to the present invention, multiple distinct synthetic polynucleotides may be linked together through the 3 '-end using nucleotides which are modified at the 3 '- terminus. Chemical conjugation may be used to control the stoichiometry of delivery into cells. For example, the glyoxylate cycle enzymes, isocitrate lyase and malate synthase, may be supplied into HepG2 cells at a 1 : 1 ratio to alter cellular fatty acid metabolism. This ratio may be controlled by chemically linking polynucleotides, primary constructs or mmRNA using a 3 '-azido terminated nucleotide on one polynucleotide, primary construct or mmRNA species and a C5-ethynyl or alkynyl-containing nucleotide on the opposite polynucleotide, primary construct or mmRNA species. The modified nucleotide is added post-transcriptionally using terminal transferase (New England Biolabs, Ipswich, MA) according to the manufacturer's protocol. After the addition of the 3 '-modified nucleotide, the two polynucleotide, primary construct or mmRNA species may be combined in an aqueous solution, in the presence or absence of copper, to form a new covalent linkage via a click chemistry mechanism as described in the literature.
[0051] In another example, more than two polynucleotides may be linked together using a functionalized linker molecule. For example, a functionalized saccharide molecule may be chemically modified to contain multiple chemical reactive groups (SH-, ΝΗ2-, N3, etc...) to react with the cognate moiety on a 3 '-functionalized mRNA molecule (i.e., a 3'-maleimide ester, 3 '-NHS-ester, alkynyl). The number of reactive groups on the modified saccharide can be controlled in a stoichiometric fashion to directly control the stoichiometric ratio of conjugated polynucleotide, primary construct or mmRNA.
Synthetic Polynucleotide Conjugates and Combinations
[0052] In order to further enhance protein production, synthetic polynucleotides of the present invention can be designed to be conjugated to other polynucleotides, dyes, intercalating agents (e.g. acridines), cross-linkers (e.g. psoralene, mitomycin C), porphyrins (TPPC4, texaphyrin, Sapphyrin), polycyclic aromatic hydrocarbons (e.g., phenazine, dihydrophenazine), artificial endonucleases (e.g. EDTA), alkylating agents, phosphate, amino, mercapto, PEG (e.g., PEG-40K), MPEG, [MPEG]2, polyamino, alkyl, substituted alkyl, radiolabeled markers, enzymes, haptens (e.g. biotin),
transport/absorption facilitators (e.g., aspirin, vitamin E, folic acid), synthetic ribonucleases, proteins, e.g., glycoproteins, or peptides, e.g., molecules having a specific affinity for a co-ligand, or antibodies e.g., an antibody, that binds to a specified cell type such as a cancer cell, endothelial cell, or bone cell, hormones and hormone receptors, non-peptidic species, such as lipids, lectins, carbohydrates, vitamins, cofactors, or a drug.
[0053] Conjugation may result in increased stability and/or half life and may be particularly useful in targeting the polynucleotides, primary constructs or mmRNA to specific sites in the cell, tissue or organism.
[0054] According to the present invention, the mmRNA or primary constructs may be administered with, or further encode one or more of RNAi agents, siRNAs, shRNAs, miRNAs, miRNA binding sites, antisense RNAs, ribozymes, catalytic DNA, tRNA, RNAs that induce triple helix formation, aptamers or vectors, and the like.
Bifunctional Synthetic Polynucleotides
[0055] In one embodiment of the invention are bifunctional polynucleotides (e.g., bifunctional primary constructs or bifunctional mmRNA). As the name implies, bifunctional polynucleotides are those having or capable of at least two functions. These molecules may also by convention be referred to as multi-functional.
[0056] The multiple functionalities of bifunctional polynucleotides may be encoded by the RNA (the function may not manifest until the encoded product is translated) or may be a property of the polynucleotide itself. It may be structural or chemical. Bifunctional modified polynucleotides may comprise a function that is covalently or electrostatically associated with the polynucleotides. Further, the two functions may be provided in the context of a complex of a mmRNA and another molecule.
[0057] Bifunctional polynucleotides may encode peptides which are anti-proliferative. These peptides may be linear, cyclic, constrained or random coil. They may function as aptamers, signaling molecules, ligands or mimics or mimetics thereof. Anti-proliferative peptides may, as translated, be from 3 to 50 amino acids in length. They may be 5-40, 10- 30, or approximately 15 amino acids long. They may be single chain, multichain or branched and may form complexes, aggregates or any multi-unit structure once translated.
Noncoding Polynucleotides and Primary Constructs
[0058] As described herein, provided are polynucleotides and primary constructs having sequences that are partially or substantially not translatable, e.g., having a noncoding region. Such noncoding region may be the "first flanking region" of the primary construct. Alternatively, the noncoding region may be a region other than the first region. Such molecules are generally not translated, but can exert an effect on protein production by one or more of binding to and sequestering one or more translational machinery components such as a ribosomal protein or a transfer RNA (tRNA), thereby effectively reducing protein expression in the cell or modulating one or more pathways or cascades in a cell which in turn alters protein levels. The polynucleotide or primary construct may contain or encode one or more long noncoding RNA (IncRNA, or lincRNA) or portion thereof, a small nucleolar RNA (sno-RNA), micro RNA (miRNA), small interfering RNA (siRNA) or Piwi-interacting RNA (piRNA).
Polypeptide of interest (CRISPR related proteins)
[0059] According to the present invention, the synthetic polynucleotide is designed to encode one or more polypeptides of interest or fragments thereof. The polypeptides of interest include CRISPR related proteins, e.g., CAS9, dCAS9, and dCAS9-effector domain (activator and /or inhibitor domain) fusion proteins. CRISPR related proteins are described in more detail herein.
[0060] A polypeptide of interest may include, but is not limited to, whole
polypeptides, a plurality of polypeptides or fragments of polypeptides, which
independently may be encoded by one or more nucleic acids, a plurality of nucleic acids, fragments of nucleic acids or variants of any of the aforementioned. As used herein, the term "polypeptides of interest" refers to any polypeptides which are selected to be encoded in the primary construct of the present invention. As used herein, "polypeptide" means a polymer of amino acid residues (natural or unnatural) linked together most often by peptide bonds. The term, as used herein, refers to proteins, polypeptides, and peptides of any size, structure, or function. In some instances the polypeptide encoded is smaller than about 50 amino acids and the polypeptide is then termed a peptide. If the polypeptide is a peptide, it will be at least about 2, 3, 4, or at least 5 amino acid residues long. Thus, polypeptides include gene products, naturally occurring polypeptides, synthetic polypeptides, homologs, orthologs, paralogs, fragments and other equivalents, variants, and analogs of the foregoing. A polypeptide may be a single molecule or may be a multi- molecular complex such as a dimer, trimer or tetramer. They may also comprise single chain or multichain polypeptides such as antibodies or insulin and may be associated or linked. Most commonly disulfide linkages are found in multichain polypeptides. The term polypeptide may also apply to amino acid polymers in which one or more amino acid residues are an artificial chemical analogue of a corresponding naturally occurring amino acid. [0061] The term "polypeptide variant" refers to molecules which differ in their amino acid sequence from a native or reference sequence. The amino acid sequence variants may possess substitutions, deletions, and/or insertions at certain positions within the amino acid sequence, as compared to a native or reference sequence. Ordinarily, variants will possess at least about 50% identity (homology) to a native or reference sequence, and preferably, they will be at least about 80%, more preferably at least about 90% identical (homologous) to a native or reference sequence.
[0062] In some embodiments "variant mimics" are provided. As used herein, the term "variant mimic" is one which contains one or more amino acids which would mimic an activated sequence. For example, glutamate may serve as a mimic for phosphoro- threonine and/or phosphoro-serine. Alternatively, variant mimics may result in deactivation or in an inactivated product containing the mimic, e.g., phenylalanine may act as an inactivating substitution for tyrosine; or alanine may act as an inactivating substitution for serine.
[0063] "Homology" as it applies to amino acid sequences is defined as the percentage of residues in the candidate amino acid sequence that are identical with the residues in the amino acid sequence of a second sequence after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent homology. Methods and computer programs for the alignment are well known in the art. It is understood that homology depends on a calculation of percent identity but may differ in value due to gaps and penalties introduced in the calculation.
[0064] By "homologs" as it applies to polypeptide sequences means the corresponding sequence of other species having substantial identity to a second sequence of a second species.
[0065] "Analogs" is meant to include polypeptide variants which differ by one or more amino acid alterations, e.g., substitutions, additions or deletions of amino acid residues that still maintain one or more of the properties of the parent or starting polypeptide.
[0066] The present invention contemplates several types of compositions which are polypeptide based including variants and derivatives. These include substitutional, insertional, deletion and covalent variants and derivatives. The term "derivative" is used synonymously with the term "variant" but generally refers to a molecule that has been modified and/or changed in any way relative to a reference molecule or starting molecule. [0067] As such, mmRNA encoding polypeptides containing substitutions, insertions and/or additions, deletions and covalent modifications with respect to reference sequences, in particular the polypeptide sequences disclosed herein, are included within the scope of this invention. For example, sequence tags or amino acids, such as one or more lysines, can be added to the peptide sequences of the invention (e.g., at the N- terminal or C-terminal ends). Sequence tags can be used for peptide purification or localization. Lysines can be used to increase peptide solubility or to allow for biotinylation. Alternatively, amino acid residues located at the carboxy and amino terminal regions of the amino acid sequence of a peptide or protein may optionally be deleted providing for truncated sequences. Certain amino acids (e.g., C-terminal or N- terminal residues) may alternatively be deleted depending on the use of the sequence, as for example, expression of the sequence as part of a larger sequence which is soluble, or linked to a solid support.
[0068] "Substitutional variants" when referring to polypeptides are those that have at least one amino acid residue in a native or starting sequence removed and a different amino acid inserted in its place at the same position. The substitutions may be single, where only one amino acid in the molecule has been substituted, or they may be multiple, where two or more amino acids have been substituted in the same molecule.
[0069] As used herein the term "conservative amino acid substitution" refers to the substitution of an amino acid that is normally present in the sequence with a different amino acid of similar size, charge, or polarity. Examples of conservative substitutions include the substitution of a non-polar (hydrophobic) residue such as isoleucine, valine and leucine for another non-polar residue. Likewise, examples of conservative substitutions include the substitution of one polar (hydrophilic) residue for another such as between arginine and lysine, between glutamine and asparagine, and between glycine and serine. Additionally, the substitution of a basic residue such as lysine, arginine or histidine for another, or the substitution of one acidic residue such as aspartic acid or glutamic acid for another acidic residue are additional examples of conservative substitutions. Examples of non-conservative substitutions include the substitution of a non-polar (hydrophobic) amino acid residue such as isoleucine, valine, leucine, alanine, methionine for a polar (hydrophilic) residue such as cysteine, glutamine, glutamic acid or lysine and/or a polar residue for a non-polar residue.
[0070] "Insertional variants" when referring to polypeptides are those with one or more amino acids inserted immediately adjacent to an amino acid at a particular position in a native or starting sequence. "Immediately adjacent" to an amino acid means connected to either the alpha-carboxy or alpha-amino functional group of the amino acid.
[0071] "Deletional variants" when referring to polypeptides are those with one or more amino acids in the native or starting amino acid sequence removed. Ordinarily, deletional variants will have one or more amino acids deleted in a particular region of the molecule.
[0072] "Covalent derivatives" when referring to polypeptides include modifications of a native or starting protein with an organic proteinaceous or non-proteinaceous derivatizing agent, and/or post-translational modifications. Covalent modifications are traditionally introduced by reacting targeted amino acid residues of the protein with an organic derivatizing agent that is capable of reacting with selected side-chains or terminal residues, or by harnessing mechanisms of post-translational modifications that function in selected recombinant host cells. The resultant covalent derivatives are useful in programs directed at identifying residues important for biological activity, for immunoassays, or for the preparation of anti-protein antibodies for immunoaffinity purification of the recombinant glycoprotein. Such modifications are within the ordinary skill in the art and are performed without undue experimentation.
[0073] Certain post-translational modifications are the result of the action of recombinant host cells on the expressed polypeptide. Glutaminyl and asparaginyl residues are frequently post-translationally deamidated to the corresponding glutamyl and aspartyl residues. Alternatively, these residues are deamidated under mildly acidic conditions. Either form of these residues may be present in the polypeptides produced in accordance with the present invention.
[0074] Other post-translational modifications include hydroxylation of proline and lysine, phosphorylation of hydroxyl groups of seryl or threonyl residues, methylation of the alpha-amino groups of lysine, arginine, and histidine side chains (T. E. Creighton, Proteins: Structure and Molecular Properties, W.H. Freeman & Co., San Francisco, pp. 79-86 (1983)).
[0075] "Features" when referring to polypeptides are defined as distinct amino acid sequence-based components of a molecule. Features of the polypeptides encoded by the mmRNA of the present invention include surface manifestations, local conformational shape, folds, loops, half-loops, domains, half-domains, sites, termini or any combination thereof. [0076] As used herein when referring to polypeptides the term "surface manifestation" refers to a polypeptide based component of a protein appearing on an outermost surface.
[0077] As used herein when referring to polypeptides the term "local conformational shape" means a polypeptide based structural manifestation of a protein which is located within a definable space of the protein.
[0078] As used herein when referring to polypeptides the term "fold" refers to the resultant conformation of an amino acid sequence upon energy minimization. A fold may occur at the secondary or tertiary level of the folding process. Examples of secondary level folds include beta sheets and alpha helices. Examples of tertiary folds include domains and regions formed due to aggregation or separation of energetic forces. Regions formed in this way include hydrophobic and hydrophilic pockets, and the like.
[0079] As used herein the term "turn" as it relates to protein conformation means a bend which alters the direction of the backbone of a peptide or polypeptide and may involve one, two, three or more amino acid residues.
[0080] As used herein when referring to polypeptides the term "loop" refers to a structural feature of a polypeptide which may serve to reverse the direction of the backbone of a peptide or polypeptide. Where the loop is found in a polypeptide and only alters the direction of the backbone, it may comprise four or more amino acid residues. Oliva et al. have identified at least 5 classes of protein loops (J. Mol Biol 266 (4): 814- 830; 1997). Loops may be open or closed. Closed loops or "cyclic" loops may comprise 2, 3, 4, 5, 6, 7, 8, 9, 10 or more amino acids between the bridging moieties. Such bridging moieties may comprise a cysteine-cysteine bridge (Cys-Cys) typical in polypeptides having disulfide bridges or alternatively bridging moieties may be non-protein based such as the dibromozylyl agents used herein.
[0081] As used herein when referring to polypeptides the term "half-loop" refers to a portion of an identified loop having at least half the number of amino acid resides as the loop from which it is derived. It is understood that loops may not always contain an even number of amino acid residues. Therefore, in those cases where a loop contains or is identified to comprise an odd number of amino acids, a half-loop of the odd-numbered loop will comprise the whole number portion or next whole number portion of the loop (number of amino acids of the loop/2+/-0.5 amino acids). For example, a loop identified as a 7 amino acid loop could produce half-loops of 3 amino acids or 4 amino acids (7/2=3.5+7-0.5 being 3 or 4). [0082] As used herein when referring to polypeptides the term "domain" refers to a motif of a polypeptide having one or more identifiable structural or functional characteristics or properties (e.g., binding capacity, serving as a site for protein-protein interactions).
[0083] As used herein when referring to polypeptides the term "half-domain" means a portion of an identified domain having at least half the number of amino acid resides as the domain from which it is derived. It is understood that domains may not always contain an even number of amino acid residues. Therefore, in those cases where a domain contains or is identified to comprise an odd number of amino acids, a half-domain of the odd-numbered domain will comprise the whole number portion or next whole number portion of the domain (number of amino acids of the domain/2+/-0.5 amino acids). For example, a domain identified as a 7 amino acid domain could produce half-domains of 3 amino acids or 4 amino acids (7/2=3.5+/-0.5 being 3 or 4). It is also understood that sub- domains may be identified within domains or half-domains, these subdomains possessing less than all of the structural or functional properties identified in the domains or half domains from which they were derived. It is also understood that the amino acids that comprise any of the domain types herein need not be contiguous along the backbone of the polypeptide (i.e., nonadjacent amino acids may fold structurally to produce a domain, half-domain or subdomain).
[0084] As used herein when referring to polypeptides the terms "site" as it pertains to amino acid based embodiments is used synonymously with "amino acid residue" and "amino acid side chain." A site represents a position within a peptide or polypeptide that may be modified, manipulated, altered, derivatized or varied within the polypeptide based molecules of the present invention.
[0085] As used herein the terms "termini" or "terminus" when referring to polypeptides refers to an extremity of a peptide or polypeptide. Such extremity is not limited only to the first or final site of the peptide or polypeptide but may include additional amino acids in the terminal regions. The polypeptide based molecules of the present invention may be characterized as having both an N-terminus (terminated by an amino acid with a free amino group (NH2)) and a C-terminus (terminated by an amino acid with a free carboxyl group (COOH)). Proteins of the invention are in some cases made up of multiple polypeptide chains brought together by disulfide bonds or by non- covalent forces (multimers, oligomers). These sorts of proteins will have multiple N- and C-termini. Alternatively, the termini of the polypeptides may be modified such that they begin or end, as the case may be, with a non-polypeptide based moiety such as an organic conjugate.
[0086] Once any of the features have been identified or defined as a desired component of a polypeptide to be encoded by the primary construct or mmRNA of the invention, any of several manipulations and/or modifications of these features may be performed by moving, swapping, inverting, deleting, randomizing or duplicating.
Furthermore, it is understood that manipulation of features may result in the same outcome as a modification to the molecules of the invention. For example, a manipulation which involved deleting a domain would result in the alteration of the length of a molecule just as modification of a nucleic acid to encode less than a full length molecule would.
[0087] Modifications and manipulations can be accomplished by methods known in the art such as, but not limited to, site directed mutagenesis. The resulting modified molecules may then be tested for activity using in vitro or in vivo assays such as those described herein or any other suitable screening assay known in the art.
[0088] According to the present invention, the polypeptides may comprise a consensus sequence which is discovered through rounds of experimentation. As used herein a "consensus" sequence is a single sequence which represents a collective population of sequences allowing for variability at one or more sites.
[0089] As recognized by those skilled in the art, protein fragments, functional protein domains, and homologous proteins are also considered to be within the scope of polypeptides of interest of this invention. For example, provided herein is any protein fragment (meaning a polypeptide sequence at least one amino acid residue shorter than a reference polypeptide sequence but otherwise identical) of a reference protein 10, 20, 30, 40, 50, 60, 70, 80, 90, 100 or greater than 100 amino acids in length. In another example, any protein that includes a stretch of about 20, about 30, about 40, about 50, or about 100 amino acids which are about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, about 95%, or about 100% identical to any of the sequences described herein can be utilized in accordance with the invention. In certain embodiments, a polypeptide to be utilized in accordance with the invention includes 2, 3, 4, 5, 6, 7, 8, 9, 10, or more mutations as shown in any of the sequences provided or referenced herein. Variant Polypeptides of Interest
[0090] In one embodiment, synthetic polypeptides of the invention may encode variant polypeptides, e.g., variant CRISPR related proteins which have a certain identity with a reference polypeptide sequence. As used herein, a "reference polypeptide sequence" refers to a starting polypeptide sequence. Reference sequences may be wild type sequences or any sequence to which reference is made in the design of another sequence. A "reference polypeptide sequence" may be, e.g., any encoding CAS9, dCAS9, a dCAS9- activator domain fusion protein, a dCAS9-inhibitor domain fusion protein, and/or variants thereof.
[0091] The term "identity" as known in the art, refers to a relationship between the sequences of two or more peptides, as determined by comparing the sequences. In the art, identity also means the degree of sequence relatedness between peptides, as determined by the number of matches between strings of two or more amino acid residues. Identity measures the percent of identical matches between the smaller of two or more sequences with gap alignments (if any) addressed by a particular mathematical model or computer program (i.e., "algorithms"). Identity of related peptides can be readily calculated by known methods. Such methods include, but are not limited to, those described in
Computational Molecular Biology, Lesk, A. M., ed., Oxford University Press, New York, 1988; Biocomputing: Informatics and Genome Projects, Smith, D. W., ed., Academic Press, New York, 1993; Computer Analysis of Sequence Data, Part 1, Griffin, A. M., and Griffin, H. G., eds., Humana Press, New Jersey, 1994; Sequence Analysis in Molecular Biology, von Heinje, G., Academic Press, 1987; Sequence Analysis Primer, Gribskov, M. and Devereux, J., eds., M. Stockton Press, New York, 1991; and Carillo et al, SIAM J. Applied Math. 48, 1073 (1988).
[0092] In some embodiments, the polypeptide variant may have the same or a similar activity as the reference polypeptide. Alternatively, the variant may have an altered activity (e.g., increased or decreased) relative to a reference polypeptide. Generally, variants of a particular polynucleotide or polypeptide of the invention will have at least about 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% but less than 100% sequence identity to that particular reference polynucleotide or polypeptide as determined by sequence alignment programs and parameters described herein and known to those skilled in the art. Such tools for alignment include those of the BLAST suite (Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402.) Other tools are described herein, specifically in the definition of "Identity."
[0093] Default parameters in the BLAST algorithm include, for example, an expect threshold of 10, Word size of 28, Match/Mismatch Scores 1, -2, Gap costs Linear. Any filter can be applied as well as a selection for species specific repeats, e.g., Homo sapiens.
Flanking Regions: Untranslated Regions (UTRs)
[0094] As described herein, the synthetic polynucleotides of the invention include untranslated regions. Untranslated regions (UTRs) of a gene are transcribed but not translated. The 5'UTR starts at the transcription start site and continues to the start codon but does not include the start codon; whereas, the 3'UTR starts immediately following the stop codon and continues until the transcriptional termination signal. There is growing body of evidence about the regulatory roles played by the UTRs in terms of stability of the nucleic acid molecule and translation. The regulatory features of a UTR can be incorporated into the polynucleotides, primary constructs and/or mmRNA of the present invention to enhance the stability of the molecule. The specific features can also be incorporated to ensure controlled down-regulation of the transcript in case they are misdirected to undesired organs sites.
[0095] Examples of UTRs include but are not limited to those found in the Tables below.
[0096] Tables 2 and 3 of co-pending U.S. Provisional Patent Application No
61/737,130 filed December 14, 2012 provide a listing of exemplary UTRs which may be utilized in the primary construct of the present invention as flanking regions. Variants of 5 ' or 3 'UTRs may be utilized wherein one or more nucleotides are added or removed to the termini, including A, T, C or G.
[0097] It should be understood that those listed are examples and that any UTR from any gene may be incorporated into the respective first or second flanking region of the primary construct. Furthermore, multiple wild-type UTRs of any known gene may be utilized. It is also within the scope of the present invention to provide artificial UTRs which are not variants of wild type genes. These UTRs or portions thereof may be placed in the same orientation as in the transcript from which they were selected or may be altered in orientation or location. Hence a 5' or 3' UTR may be inverted, shortened, lengthened, made chimeric with one or more other 5' UTRs or 3' UTRs. As used herein, the term "altered" as it relates to a UTR sequence, means that the UTR has been changed in some way in relation to a reference sequence. For example, a 3' or 5' UTR may be altered relative to a wild type or native UTR by the change in orientation or location as taught above or may be altered by the inclusion of additional nucleotides, deletion of nucleotides, swapping or transposition of nucleotides. Any of these changes producing an "altered" UTR (whether 3' or 5') comprise a variant UTR.
[0098] In one embodiment, the UTR may be selected from the UTRs described in Lengthy Table 21 in co-pending US Provisional Application No. US 61/775,509, filed March 9, 2013, entitled Heterologous Untranslated Regions for mRNA and in Lengthy Table 21 and in Table 22 in co-pending US Provisional Application No. US 61/829,372, filed May 31, 2013, entitled Heterologous Untranslated Regions for mRNA; each of which is herein incorporated by reference in its entirety.
[0099] In one embodiment, a double, triple or quadruple UTR such as a 5' or 3' UTR may be used. As used herein, a "double" UTR is one in which two copies of the same UTR are encoded either in series or substantially in series. For example, a double beta- globin 3' UTR may be used as described in US Patent publication 20100129877, the contents of which are incorporated herein by reference in its entirety.
[00100] It is also within the scope of the present invention to have patterned UTRs. As used herein "patterned UTRs" are those UTRs which reflect a repeating or alternating pattern, such as ABABAB or AABBAABBAABB or ABCABCABC or variants thereof repeated once, twice, or more than 3 times. In these patterns, each letter, A, B, or C represent a different UTR at the nucleotide level.
[00101] In one embodiment, flanking regions are selected from a family of transcripts whose proteins share a common function, structure, feature of property. For example, polypeptides of interest may belong to a family of proteins which are expressed in a particular cell, tissue or at some time during development. The UTRs from any of these genes may be swapped for any other UTR of the same or different family of proteins to create a new chimeric primary transcript. As used herein, a "family of proteins" is used in the broadest sense to refer to a group of two or more polypeptides of interest which share at least one function, structure, feature, localization, origin, or expression pattern.
[00102] In one embodiment, the synthetic polynucleotides of the invention may comprise an untranslated region that is not heterologous to the encoded protein of interest. As a non-limiting example, the untranslated region may comprise all or a portion or fragment thereof of one or more of the untranslated regions described in co-pending US Provisional Application No. US 61/775,509, filed March 9, 2013, entitled Heterologous Untranslated Regions for mRNA and US Provisional Application No. US 61/829,372, filed March 15, 2013, entitled Heterologous Untranslated Regions for mRNA, each of which is herein incorporated by reference in its entirety.
5' UTR and Translation Initiation
[00103] The synthetic polynucleotides of the invention typically include a 5' UTR. Natural 5'UTRs bear features which play roles in for translation initiation. They harbor signatures like Kozak sequences which are commonly known to be involved in the process by which the ribosome initiates translation of many genes. Kozak sequences have the consensus CCR(A/G)CCAUGG (SEQ ID NO: 126), where R is a purine (adenine or guanine) three bases upstream of the start codon (AUG), which is followed by another 'G'. 5 'UTR also have been known to form secondary structures which are involved in elongation factor binding.
[00104] By engineering the features typically found in abundantly expressed genes of specific target organs, one can enhance the stability and protein production of the synthetic polynucleotides, primary constructs or mmRNA of the invention. For example, introduction of 5' UTR of liver-expressed mRNA, such as albumin, serum amyloid A, Apolipoprotein A/B/E, transferrin, alpha fetoprotein, erythropoietin, or Factor VIII, could be used to enhance expression of a nucleic acid molecule, such as a mmRNA, in hepatic cell lines or liver. Likewise, use of 5' UTR from other tissue-specific mRNA to improve expression in that tissue is possible - for muscle (MyoD, Myosin, Myoglobin, Myogenin, Herculin), for endothelial cells (Tie-1, CD36), for myeloid cells (C/EBP, AML1, G-CSF, GM-CSF, CD1 lb, MSR, Fr-1, i-NOS), for leukocytes (CD45, CD18), for adipose tissue (CD36, GLUT4, ACRP30, adiponectin) and for lung epithelial cells (SP-A/B/C/D).
[00105] Other non-UTR sequences may be incorporated into the 5' (or 3' UTR) UTRs. For example, introns or portions of introns sequences may be incorporated into the flanking regions of the polynucleotides, primary constructs or mmRNA of the invention. Incorporation of intronic sequences may increase protein production as well as mRNA levels.
[00106] The 5 'UTR may selected for use in the present invention may be a structured UTR such as, but not limited to, 5'UTRs to control translation. As a non-limiting example, a structured 5 'UTR may be beneficial when using any of the terminal modifications described in copending U.S. Provisional Application No. 61/758,921 filed January 31, 2013, entitled Differential Targeting Using RNA Constructs; U.S. Provisional Application No. 61/781,139 filed March 14, 2013, entitled Differential Targeting Using RNA Constructs; U.S. Provisional Application No. 61/729,933, filed November 26, 2012 entitled Terminally Optimized RNAs; U.S. Provisional Application No 61/737,224 filed December 14, 2012 entitled Terminally Optimized RNAs and U.S. Provisional
Application No 61/829,359 filed May 31, 2013 entitled Terminally Optimized RNAs, each of which is herein incorporated by reference in their entirety.
3' UTR and the AU Rich Elements
[00107] The synthetic polynucleotides of the invention typically include a 3 ' UTR. 3'UTRs are known to have stretches of Adenosines and Uridines embedded in them. These AU rich signatures are particularly prevalent in genes with high rates of turnover. Based on their sequence features and functional properties, the AU rich elements (AREs) can be separated into three classes (Chen et al, 1995): Class I AREs contain several dispersed copies of an AUUUA motif within U-rich regions. C-Myc and MyoD contain class I AREs. Class II AREs possess two or more overlapping UUAUUUA(U/A)(U/A) nonamers. Molecules containing this type of AREs include GM-CSF and TNF-a. Class III ARES are less well defined. These U rich regions do not contain an AUUUA motif, c- Jun and Myogenin are two well-studied examples of this class. Most proteins binding to the AREs are known to destabilize the messenger, whereas members of the ELAV family, most notably HuR, have been documented to increase the stability of mRNA. HuR binds to AREs of all the three classes. Engineering the HuR specific binding sites into the 3' UTR of nucleic acid molecules will lead to HuR binding and thus, stabilization of the message in vivo.
[00108] Introduction, removal or modification of 3' UTR AU rich elements (AREs) can be used to modulate the stability of polynucleotides, primary constructs or mmRNA of the invention. When engineering specific polynucleotides, primary constructs or mmRNA, one or more copies of an ARE can be introduced to make polynucleotides, primary constructs or mmRNA of the invention less stable and thereby curtail translation and decrease production of the resultant protein. Likewise, AREs can be identified and removed or mutated to increase the intracellular stability and thus increase translation and production of the resultant protein. Transfection experiments can be conducted in relevant cell lines, using polynucleotides, primary constructs or mmRNA of the invention and protein production can be assayed at various time points post-transfection. For example, cells can be transfected with different ARE-engineering molecules and by using an ELISA kit to the relevant protein and assaying protein produced at 6 hr, 12 hr, 24 hr, 48 hr, and 7 days post-transfection.
3' UTR and microRNA Binding Sites
[00109] In some embodiments, the synthetic polynucleotides of the invention include a miRNA binding site in the 3 'UTR. A microRNA (or miRNA) is a 19-25 nucleotide long noncoding RNA that binds to the 3 'UTR of nucleic acid molecules and down-regulate gene expression either by reducing nucleic acid molecule stability or by inhibiting translation. The polynucleotides, primary constructs or mmRNA of the invention may comprise one or more microRNA target sequences, microRNA sequences, microRNA binding sites, or microRNA seeds. Such sequences may correspond to any known microRNA such as those taught in US Publication US2005/0261218 and US Publication US2005/0059005, or those listed in Table 7 of co-pending application USSN 61/758,921 filed January 31, 2013 (Attorney Docket Number 2030.1039), the contents of which are incorporated herein by reference in their entirety.
[00110] Examples of 3'UTRs containing miRNA binding sites include but are not limited to those found in the Tables below.
[00111] A microRNA sequence comprises a "seed" region, i.e., a sequence in the region of positions 2-8 of the mature microRNA, which sequence has perfect Watson- Crick complementarity to the miRNA target sequence. A microRNA seed may comprise positions 2-8 or 2-7 of the mature microRNA. In some embodiments, a microRNA seed may comprise 7 nucleotides (e.g., nucleotides 2-8 of the mature microRNA), wherein the seed-complementary site in the corresponding miRNA target is flanked by an adenine (A) opposed to microRNA position 1. In some embodiments, a microRNA seed may comprise 6 nucleotides (e.g., nucleotides 2-7 of the mature microRNA), wherein the seed- complementary site in the corresponding miRNA target is flanked by an adenine (A) opposed to microRNA position 1. See for example, Grimson A, Farh KK, Johnston WK, Garrett-Engele P, Lim LP, Bartel DP; Mol Cell. 2007 Jul 6;27(1):91-105. The bases of the microRNA seed have complete complementarity with the target sequence. By engineering microRNA target sequences into the 3 'UTR of polynucleotides, primary constructs or mmRNA of the invention one can target the molecule for degradation or reduced translation, provided the microRNA in question is available. This process will reduce the hazard of off target effects upon nucleic acid molecule delivery. Identification of microRNA, microRNA target regions, and their expression patterns and role in biology have been reported (Bonauer et al, Curr Drug Targets 2010 11 :943-949; Anand and Cheresh Curr Opin Hematol 2011 18: 171-176; Contreras and Rao Leukemia 2012 26:404-413 (201 1 Dec 20. doi: 10.1038/leu.201 1.356); Bartel Cell 2009 136:215- 233; Landgraf et al, Cell, 2007 129: 1401-1414).
[00112] For example, if the nucleic acid molecule is an mRNA and is not intended to be delivered to the liver but ends up there, then miR-122, a microRNA abundant in liver, can inhibit the expression of the gene of interest if one or multiple target sites of miR-122 are engineered into the 3 'UTR of the polynucleotides, primary constructs or mmRNA.
Introduction of one or multiple binding sites for different microRNA can be engineered to further decrease the longevity, stability, and protein translation of a polynucleotides, primary constructs or mmRNA.
[00113] As used herein, the term "microRNA site" refers to a microRNA target site or a microRNA recognition site, or any nucleotide sequence to which a microRNA binds or associates. It should be understood that "binding" may follow traditional Watson-Crick hybridization rules or may reflect any stable association of the microRNA with the target sequence at or adjacent to the microRNA site.
[00114] Conversely, for the purposes of the polynucleotides, primary constructs or mmRNA of the present invention, microRNA binding sites can be engineered out of (i.e. removed from) sequences in which they naturally occur in order to increase protein expression in specific tissues. For example, miR-122 binding sites may be removed to improve protein expression in the liver. Regulation of expression in multiple tissues can be accomplished through introduction or removal or one or several microRNA binding sites.
[00115] Examples of tissues where microRNA are known to regulate mRNA, and thereby protein expression, include, but are not limited to, liver (miR-122), muscle (miR- 133, miR-206, miR-208), endothelial cells (miR- 17-92, miR-126), nervous system (mir- 124a, miR-9), pluripotent cells ( miR-302, miR-367, miR-290, miR-371, miR-373), pancreatic islet cells (miR-375), myeloid cells (miR-142-3p, miR-142-5p, miR- 16, miR- 21, miR-223, miR-24, miR-27), adipose tissue (let-7, miR-30c), heart (miR-ld, miR-149), kidney (miR-192, miR-194, miR-204), and lung epithelial cells (let-7, miR-133, miR- 126).
[00116] MicroRNA can also regulate complex biological processes such as angiogenesis (miR-132) (Anand and Cheresh Curr Opin Hematol 2011 18: 171-176). In the polynucleotides, primary constructs or mmRNA of the invention, binding sites for microRNAs that are involved in such processes may be removed or introduced, in order to tailor the expression of the polynucleotides, primary constructs or mmRNA expression to biologically relevant cell types or to the context of relevant biological processes.
[00117] MicroRNAs are also known to be expressed in the immune cells (also called hematopoietic cells), for example, the antigen presenting cells (e.g. dendritic cells and macrophage). Immune cell specific microRNAs are involved in immunogenicity, autoimmunity, the immune -response to infection, inflammation, as well as unwanted immune response after gene therapy and tissue/organ transplantation. For example, miR- 142 and miR-146 are exclusively expressed in the immune cells, particularly abundant in myeloid dendritic cells. Introducing the miR-142 binding site into the 3 '-UTR of a polynucleotide or a gene delivery construct can selectively suppress the gene expression in the antigen presenting cells through miR-142 mediated mRNA degradation, limiting antigen presentation in professional APCs (e.g. dendritic cells) and thereby preventing antigen-mediated immune response after gene delivery (see, Annoni A et al, blood, 2009, 114, 5152-5161, the content of which is herein incorporated by reference in its entirety.). In the polynucleotides, primary constructs or mmRNA of the present invention, binding sites for microRNAs that are involved in such processes may be introduced, in order to reduce the expression of the polynucleotides, primary constructs or mmRNA of the present invention in APCs and to subdue the antigen mediated immune response.
[00118] Lastly, through an understanding of the expression patterns of microRNA in different cell types, polynucleotides, primary constructs or mmRNA can be engineered for more targeted expression in specific cell types or only under specific biological conditions. Through introduction of tissue-specific microRNA binding sites,
polynucleotides, primary constructs or mmRNA could be designed that would be optimal for protein expression in a tissue or in the context of a biological condition.
[00119] Transfection experiments can be conducted in relevant cell lines, using engineered polynucleotides, primary constructs or mmRNA and protein production can be assayed at various time points post-transfection. For example, cells can be transfected with different microRNA binding site-engineering polynucleotides, primary constructs or mmRNA and by using an ELISA kit to the relevant protein and assaying protein produced at 6 hr, 12 hr, 24 hr, 48 hr, 72 hr and 7 days post-transfection. In vivo experiments can also be conducted using microRNA-binding site-engineered molecules to examine changes in tissue-specific expression of formulated polynucleotides, primary constructs or mmRNA.
Viral Sequences
[00120] Additional viral sequences such as, but not limited to, the translation enhancer sequence of the barley yellow dwarf virus (BYDV-PAV) can be engineered and inserted in the 3' UTR of the synthetic polynucleotides, polynucleotides, primary constructs or mmRNA of the invention and can stimulate the translation of the construct in vitro and in vivo. Transfection experiments can be conducted in relevant cell lines at and protein production can be assayed by ELISA at 12hr, 24hr, 48hr, 72 hr and day 7 post- transfection.
[00121]
5' Capping
[00122] The synthetic polynucleotides of the invention can include a 5' capping region or 5' cap. The 5' cap structure of an mRNA is involved in nuclear export, increasing mRNA stability and binds the mRNA Cap Binding Protein (CBP), which is responsible for mRNA stability in the cell and translation competency through the association of CBP with poly(A) binding protein to form the mature cyclic mRNA species. The cap further assists the removal of 5' proximal introns removal during mRNA splicing.
[00123] Endogenous mRNA molecules may be 5'-end capped generating a 5'-ppp-5'- triphosphate linkage between a terminal guanosine cap residue and the 5 '-terminal transcribed sense nucleotide of the mRNA molecule. This 5'-guanylate cap may then be methylated to generate an N7-methyl-guanylate residue. The ribose sugars of the terminal and/or anteterminal transcribed nucleotides of the 5' end of the mRNA may optionally also be 2'-0-methylated. 5'-decapping through hydrolysis and cleavage of the guanylate cap structure may target a nucleic acid molecule, such as an mRNA molecule, for degradation.
[00124] Modifications to the polynucleotides, primary constructs, and mmRNA of the present invention may generate a non-hydrolyzable cap structure preventing decapping and thus increasing mRNA half-life. Because cap structure hydrolysis requires cleavage of 5'-ppp-5' phosphorodiester linkages, modified nucleotides may be used during the capping reaction. For example, a Vaccinia Capping Enzyme from New England Biolabs (Ipswich, MA) may be used with a-thio-guanosine nucleotides according to the manufacturer's instructions to create a phosphorothioate linkage in the 5'-ppp-5' cap. Additional modified guanosine nucleotides may be used such as a-methyl-phosphonate and seleno-phosphate nucleotides.
[00125] Additional modifications include, but are not limited to, 2'-0-methylation of the ribose sugars of 5'-terminal and/or 5'-anteterminal nucleotides of the mRNA (as mentioned above) on the 2'-hydroxyl group of the sugar ring. Multiple distinct 5 '-cap structures can be used to generate the 5 '-cap of a nucleic acid molecule, such as an mRNA molecule.
[00126] Cap analogs, which herein are also referred to as synthetic cap analogs, chemical caps, chemical cap analogs, or structural or functional cap analogs, differ from natural (i.e. endogenous, wild-type or physiological) 5 '-caps in their chemical structure, while retaining cap function. Cap analogs may be chemically (i.e. non-enzymatically) or enzymatically synthesized and/linked to a nucleic acid molecule.
[00127] For example, the Anti-Reverse Cap Analog (ARCA) cap contains two guanines linked by a 5 '-5 '-triphosphate group, wherein one guanine contains an N7 methyl group as well as a 3'-0-methyl group (i.e., N7,3'-0-dimethyl-guanosine-5'-triphosphate-5'- guanosine (m7G-3 'mppp-G; which may equivalently be designated 3' O-Me- m7G(5')ppp(5')G). The 3'-0 atom of the other, unmodified, guanine becomes linked to the 5'-terminal nucleotide of the capped nucleic acid molecule (e.g. an mRNA or mmRNA). The N7- and 3 '-O-methlyated guanine provides the terminal moiety of the capped nucleic acid molecule (e.g. mRNA or mmRNA).
[00128] Another exemplary cap is mCAP, which is similar to ARCA but has a 2'-0- methyl group on guanosine (i.e., N7,2'-0-dimethyl-guanosine-5'-triphosphate-5'- guanosine, m7Gm-ppp-G).
[00129] While cap analogs allow for the concomitant capping of a nucleic acid molecule in an in vitro transcription reaction, up to 20% of transcripts remain uncapped. This, as well as the structural differences of a cap analog from an endogenous 5 '-cap structures of nucleic acids produced by the endogenous, cellular transcription machinery, may lead to reduced translational competency and reduced cellular stability.
[00130] Polynucleotides, primary constructs and mmRNA of the invention may also be capped post-transcriptionally, using enzymes, in order to generate more authentic 5 '-cap structures. As used herein, the phrase "more authentic" refers to a feature that closely mirrors or mimics, either structurally or functionally, an endogenous or wild type feature. That is, a "more authentic" feature is better representative of an endogenous, wild-type, natural or physiological cellular function and/or structure as compared to synthetic features or analogs, etc., of the prior art, or which outperforms the corresponding endogenous, wild-type, natural or physiological feature in one or more respects. Non- limiting examples of more authentic 5'cap structures of the present invention are those which, among other things, have enhanced binding of cap binding proteins, increased half life, reduced susceptibility to 5' endonucleases and/or reduced 5'decapping, as compared to synthetic 5'cap structures known in the art (or to a wild-type, natural or physiological 5'cap structure). For example, recombinant Vaccinia Virus Capping Enzyme and recombinant 2'-0-methyltransferase enzyme can create a canonical 5 '-5 '-triphosphate linkage between the 5 '-terminal nucleotide of an mRNA and a guanine cap nucleotide wherein the cap guanine contains an N7 methylation and the 5 '-terminal nucleotide of the mRNA contains a 2'-0-methyl. Such a structure is termed the Capl structure. This cap results in a higher translational-competency and cellular stability and a reduced activation of cellular pro-inflammatory cytokines, as compared, e.g., to other 5'cap analog structures known in the art. Cap structures include 7mG(5')ppp(5')N,pN2p (cap 0),
7mG(5')ppp(5')NlmpNp (cap 1), and 7mG(5')-ppp(5')NlmpN2mp (cap 2).
[00131] Because the polynucleotides, primary constructs or mmRNA may be capped post-transcriptionally, and because this process is more efficient, nearly 100% of the polynucleotides, primary constructs or mmRNA may be capped. This is in contrast to -80% when a cap analog is linked to an mRNA in the course of an in vitro transcription reaction.
[00132] According to the present invention, 5' terminal caps may include endogenous caps or cap analogs. According to the present invention, a 5' terminal cap may comprise a guanine analog. Useful guanine analogs include inosine, Nl-methyl-guanosine, 2'fluoro-guanosine, 7-deaza-guanosine, 8-oxo-guanosine, 2-amino-guanosine, LNA- guanosine, and 2-azido-guanosine.
IRES Sequences
[00133] Further, provided are synthetic polynucleotides, primary constructs or mmRNA which may contain an internal ribosome entry site (IRES). First identified as a feature Picorna virus RNA, IRES plays an important role in initiating protein synthesis in absence of the 5' cap structure. An IRES may act as the sole ribosome binding site, or may serve as one of multiple ribosome binding sites of an mRNA. Synthetic
polynucleotides, primary constructs or mmRNA containing more than one functional ribosome binding site may encode several peptides or polypeptides that are translated independently by the ribosomes ("multicistronic nucleic acid molecules"). When polynucleotides, primary constructs or mmRNA are provided with an IRES, further optionally provided is a second translatable region. Examples of IRES sequences that can be used according to the invention include without limitation, those from picornaviruses (e.g. FMDV), pest viruses (CFFV), polio viruses (PV), encephalomyocarditis viruses (ECMV), foot-and-mouth disease viruses (FMDV), hepatitis C viruses (HCV), classical swine fever viruses (CSFV), murine leukemia virus (MLV), simian immune deficiency viruses (SIV) or cricket paralysis viruses (CrPV).
Stop Codons
[00134] In one embodiment, the primary constructs of the present invention may include at least two stop codons before the 3' untranslated region (UTR). The stop codon may be selected from TGA, TAA and TAG. In one embodiment, the primary constructs of the present invention include the stop codon TGA and one additional stop codon. In a further embodiment the addition stop codon may be TAA.
[00135] In another embodiment, the primary constructs of the present invention may include three stop codons before the 3 ' untranslated region (UTR).
Signal Sequences
[00136] The primary constructs or mmRNA may also encode additional features which facilitate trafficking of the polypeptides to therapeutically relevant sites. One such feature which aids in protein trafficking is the signal sequence. As used herein, a "signal sequence" or "signal peptide" is a polynucleotide or polypeptide, respectively, which is from about 9 to 200 nucleotides (3-60 amino acids) in length which is incorporated at the 5' (or N-terminus) of the coding region or polypeptide encoded, respectively. Addition of these sequences result in trafficking of the encoded polypeptide to the endoplasmic reticulum through one or more secretory pathways. Some signal peptides are cleaved from the protein by signal peptidase after the proteins are transported.
[00137] Signal sequences may be selected from any of those listed in co-pending patent applications: U.S. Provisional Patent Application No 61/618,862, filed April 2, 2012, entitled Modified Polynucleotides for the Production of Biologies; U.S. Provisional Patent Application No 61/681,645, filed August 10, 2012, entitled Modified
Polynucleotides for the Production of Biologies; U.S. Provisional Patent Application No 61/737, 130, filed December 14, 2012, entitled Modified Polynucleotides for the
Production of Biologies; U.S. Provisional Patent Application No 61/618,866, filed April 2, 2012, entitled Modified Polynucleotides for the Production of Antibodies; U.S.
Provisional Patent Application No 61/681,647, filed August 10, 2012, entitled Modified Polynucleotides for the Production of Antibodies; U.S. Provisional Patent Application No 61/737,134, filed December 14, 2012, entitled Modified Polynucleotides for the
Production of Antibodies; U.S. Provisional Patent Application No 61/618,868, filed April 2, 2012, entitled Modified Polynucleotides for the Production of Vaccines; U.S.
Provisional Patent Application No 61/681,648, filed August 10, 2012, entitled Modified Polynucleotides for the Production of Vaccines; U.S. Provisional Patent Application No 61/737,135, filed December 14, 2012, entitled Modified Polynucleotides for the
Production of Vaccines; U.S. Provisional Patent Application No 61/618,870, filed April 2, 2012, entitled Modified Polynucleotides for the Production of Therapeutic Proteins and Peptides; U.S. Provisional Patent Application No 61/681,649, filed August 10, 2012, entitled Modified Polynucleotides for the Production of Therapeutic Proteins and Peptides; U.S. Provisional Patent Application No 61/737, 139, filed December 14, 2012, Modified Polynucleotides for the Production of Therapeutic Proteins and Peptides; U.S. Provisional Patent Application No 61/618,873, filed April 2, 2012, entitled Modified Polynucleotides for the Production of Secreted Proteins; U.S. Provisional Patent
Application No 61/681,650, filed August 10, 2012, entitled Modified Polynucleotides for the Production of Secreted Proteins; U.S. Provisional Patent Application No 61/737,147, filed December 14, 2012, entitled Modified Polynucleotides for the Production of Secreted Proteins; U.S. Provisional Patent Application No 61/618,878, filed April 2, 2012, entitled Modified Polynucleotides for the Production of Plasma Membrane Proteins; U.S. Provisional Patent Application No 61/681,654, filed August 10, 2012, entitled Modified Polynucleotides for the Production of Plasma Membrane Proteins; U.S. Provisional Patent Application No 61/737, 152, filed December 14, 2012, entitled Modified Polynucleotides for the Production of Plasma Membrane Proteins; U.S.
Provisional Patent Application No 61/618,885, filed April 2, 2012, entitled Modified Polynucleotides for the Production of Cytoplasmic and Cytoskeletal Proteins; U.S.
Provisional Patent Application No 61/681,658, filed August 10, 2012, entitled Modified Polynucleotides for the Production of Cytoplasmic and Cytoskeletal Proteins; U.S.
Provisional Patent Application No 61/737, 155, filed December 14, 2012, entitled Modified Polynucleotides for the Production of Cytoplasmic and Cytoskeletal Proteins; U.S. Provisional Patent Application No 61/618,896, filed April 2, 2012, entitled Modified Polynucleotides for the Production of Intracellular Membrane Bound Proteins; U.S. Provisional Patent Application No 61/668, 157, filed July 5, 2012, entitled Modified Polynucleotides for the Production of Intracellular Membrane Bound Proteins; U.S. Provisional Patent Application No 61/681,661, filed August 10, 2012, entitled Modified Polynucleotides for the Production of Intracellular Membrane Bound Proteins; U.S. Provisional Patent Application No 61/737, 160, filed December 14, 2012, entitled Modified Polynucleotides for the Production of Intracellular Membrane Bound Proteins; U.S. Provisional Patent Application No 61/618,911, filed April 2, 2012, entitled Modified Polynucleotides for the Production of Nuclear Proteins; U.S. Provisional Patent
Application No 61/681,667, filed August 10, 2012, entitled Modified Polynucleotides for the Production of Nuclear Proteins; U.S. Provisional Patent Application No 61/737, 168, filed December 14, 2012, entitled Modified Polynucleotides for the Production of Nuclear Proteins; U.S. Provisional Patent Application No 61/618,922, filed April 2, 2012, entitled Modified Polynucleotides for the Production of Proteins; U.S. Provisional Patent Application No 61/681,675, filed August 10, 2012, entitled Modified Polynucleotides for the Production of Proteins; U.S. Provisional Patent Application No 61/737, 174, filed December 14, 2012, entitled Modified Polynucleotides for the Production of Proteins; U.S. Provisional Patent Application No 61/618,935, filed April 2, 2012, entitled Modified Polynucleotides for the Production of Proteins Associated with Human Disease; U.S. Provisional Patent Application No 61/681,687, filed August 10, 2012, entitled Modified Polynucleotides for the Production of Proteins Associated with Human Disease; U.S. Provisional Patent Application No 61/737, 184, filed December 14, 2012, entitled Modified Polynucleotides for the Production of Proteins Associated with Human Disease; U.S. Provisional Patent Application No 61/618,945, filed April 2, 2012, entitled Modified Polynucleotides for the Production of Proteins Associated with Human Disease; U.S. Provisional Patent Application No 61/681,696, filed August 10, 2012, entitled Modified Polynucleotides for the Production of Proteins Associated with Human Disease; U.S. Provisional Patent Application No 61/737, 191, filed December 14, 2012, entitled Modified Polynucleotides for the Production of Proteins Associated with Human Disease; U.S. Provisional Patent Application No 61/618,953, filed April 2, 2012, entitled Modified Polynucleotides for the Production of Proteins Associated with Human Disease; U.S. Provisional Patent Application No 61/681,704, filed August 10, 2012, entitled Modified Polynucleotides for the Production of Proteins Associated with Human Disease; U.S. Provisional Patent Application No 61/737,203, filed December 14, 2012, entitled Modified Polynucleotides for the Production of Proteins Associated with Human Disease, International Application No PCT/US2013/030062, filed March 9, 2013, entitled
Modified Polynucleotides for the Production of Biologies and Proteins Associated with Human Disease; International Application No PCT/US2013/030063, filed March 9, 2013, entitled Modified Polynucleotides; International Application No. PCT/US2013/030064, entitled Modified Polynucleotides for the Production of Secreted Proteins; International Application No PCT/US2013/030059, filed March 9, 2013, entitled Modified
Polynucleotides for the Production of Membrane Proteins; International Application No. PCT/US2013/030066, filed March 9, 2013, entitled Modified Polynucleotides for the Production of Cytoplasmic and Cytoskeletal Proteins; International Application No. PCT/US2013/030067, filed March 9, 2013, entitled Modified Polynucleotides for the Production of Nuclear Proteins; International Application No. PCT/US2013/030060, filed March 9, 2013, entitled Modified Polynucleotides for the Production of Proteins;
International Application No. PCT/US2013/030061, filed March 9, 2013, entitled Modified Polynucleotides for the Production of Proteins Associated with Human Disease; International Application No. PCT/US2013/030068, filed March 9, 2013, entitled Modified Polynucleotides for the Production of Cosmetic Proteins and Peptides; and International Application No. PCT/US2013/030070, filed March 9, 2013, entitled Modified Polynucleotides for the Production of Oncology -Related Proteins and Peptides; International Patent Application No. PCT/US2013/031821, filed March 15, 2013, entitled In Vivo Production of Proteins, the contents of which are incorporated herein by reference. Protein signal sequences which may be incorporated for encoding by the polynucleotides, primary constructs or mmRNA of the invention include signal sequences from a- 1 -antitrypsin, G-CSF, Factor IX, Prolactin, Albumin, HMMSP38, ornithine carbamoyltransferase, Cytochrome C Oxidase subunit 8A, Type III, bacterial, viral, secretion signals, Vrg-6, PhoA, OmpA, STI, STII, Amylase, Alpha Factor,
Endoglucanase V, Secretion signal, fungal, fibronectin and interleukins (e.g., IL12).
[00138] In the table of the co-pending patent applications, SS is secretion signal and MLS is mitochondrial leader signal. The primary constructs or mmRNA of the present invention may be designed to encode any of the signal sequences or fragments or variants thereof. These sequences may be included at the beginning of the polypeptide coding region, in the middle or at the terminus or alternatively into a flanking region.
[00139] Additional signal sequences which may be utilized in the present invention include those taught in, for example, databases such as those found at
http://www.signalpeptide.de/ or http://proline.bic.nus.edu.sg/spdb/. Those described in US Patents 8, 124,379; 7,413,875 and 7,385,034 are also within the scope of the invention and the contents of each are incorporated herein by reference in their entirety.
Protein Cleavage Signals and Sites
[00140] In one embodiment, the polypeptides of the present invention may include at least one protein cleavage signal containing at least one protein cleavage site. The protein cleavage site may be located at the N-terminus, the C-terminus, at any space between the N- and the C- termini such as, but not limited to, half-way between the N- and C-termini, between the N-terminus and the half way point, between the half way point and the C- terminus, and combinations thereof.
[00141] The polypeptides of the present invention may include, but is not limited to, a proprotein convertase (or prohormone convertase), thrombin or Factor Xa protein cleavage signal. Proprotein convertases are a family of nine proteinases, comprising seven basic amino acid-specific subtilisin-like serine proteinases related to yeast kexin, known as prohormone convertase 1/3 (PC 1/3), PC2, furin, PC4, PC5/6, paired basic amino-acid cleaving enzyme 4 (PACE4) and PC7, and two other subtilases that cleave at non-basic residues, called subtilisin kexin isozyme 1 (SKI-1) and proproteinconvertase subtilisin kexin 9 (PCSK9).
[00142] In one embodiment, the primary constructs and mmRNA of the present invention may be engineered such that the primary construct or mmRNA contains at least one encoded protein cleavage signal. The encoded protein cleavage signal may be located before the start codon, after the start codon, before the coding region, within the coding region such as, but not limited to, half way in the coding region, between the start codon and the halfway point, between the half way point and the stop codon, after the coding region, before the stop codon, between two stop codons, after the stop codon and combinations thereof.
[00143] In one embodiment, the primary constructs or mmRNA of the present invention may include at least one encoded protein cleavage signal containing at least one protein cleavage site. The encoded protein cleavage signal may include, but is not limited to, a proprotein convertase (or prohormone convertase), thrombin and/or Factor Xa protein cleavage signal. One of skill in the art may use Table 1 below or other known methods to determine the appropriate encoded protein cleavage signal to include in the primary constructs or mmRNA of the present invention. For example, starting with a signal sequence and considering the codons of Table 1 one can design a signal for the primary construct which can produce a protein signal in the resulting polypeptide.
[00144] In one embodiment, the polypeptides of the present invention include at least one protein cleavage signal and/or site.
[00145] As a non-limiting example, U.S. Pat. No. 7,374,930 and U.S. Pub. No.
20090227660, herein incorporated by reference in their entireties, use a furin cleavage site to cleave the N-terminal methionine of GLP-1 in the expression product from the Golgi apparatus of the cells. In one embodiment, the polypeptides of the present invention include at least one protein cleavage signal and/or site with the proviso that the polypeptide is not GLP-1.
[00146] In one embodiment, the primary constructs or mmRNA of the present invention includes at least one encoded protein cleavage signal and/or site.
[00147] In one embodiment, the primary constructs or mmRNA of the present invention includes at least one encoded protein cleavage signal and/or site with the proviso that the primary construct or mmRNA does not encode GLP- 1.
[00148] In one embodiment, the primary constructs or mmRNA of the present invention may include more than one coding region. Where multiple coding regions are present in the primary construct or mmRNA of the present invention, the multiple coding regions may be separated by encoded protein cleavage sites. As a non-limiting example, the primary construct or mmRNA may be signed in an ordered pattern. On such pattern follows AXBY form where A and B are coding regions which may be the same or different coding regions and/or may encode the same or different polypeptides, and X and
Y are encoded protein cleavage signals which may encode the same or different protein cleavage signals. A second such pattern follows the form AXYBZ where A and B are coding regions which may be the same or different coding regions and/or may encode the same or different polypeptides, and X, Y and Z are encoded protein cleavage signals which may encode the same or different protein cleavage signals. A third pattern follows the form ABXCY where A, B and C are coding regions which may be the same or different coding regions and/or may encode the same or different polypeptides, and X and
Y are encoded protein cleavage signals which may encode the same or different protein cleavage signals.
[00149] In one embodiment, the polypeptides, primary constructs and mmRNA can also contain sequences that encode protein cleavage sites so that the polypeptides, primary constructs and mmRNA can be released from a carrier region or a fusion partner by treatment with a specific protease for said protein cleavage site.
Poly-A tails
[00150] The synthetic polynucleotides of the invention typically include a 3 ' tailing sequences, e.g., a poly -A tail. During RNA processing, a long chain of adenine nucleotides (poly -A tail) may be added to a polynucleotide such as an mR A molecules in order to increase stability. Immediately after transcription, the 3' end of the transcript may be cleaved to free a 3' hydroxyl. Then poly -A polymerase adds a chain of adenine nucleotides to the RNA. The process, called polyadenylation, adds a poly-A tail that can be between 100 and 250 residues long.
[00151] It has been discovered that unique poly-A tail lengths provide certain advantages to the polynucleotides, primary constructs or mmRNA of the present invention.
[00152] Generally, the length of a poly-A tail of the present invention is greater than 30 nucleotides in length. In another embodiment, the poly-A tail is greater than 35 nucleotides in length (e.g., at least or greater than about 35, 40, 45, 50, 55, 60, 70, 80, 90, 100, 120, 140, 160, 180, 200, 250, 300, 350, 400, 450, 500, 600, 700, 800, 900, 1,000, 1, 100, 1,200, 1,300, 1,400, 1,500, 1,600, 1,700, 1,800, 1,900, 2,000, 2,500, and 3,000 nucleotides). In some embodiments, the polynucleotide, primary construct, or mmRNA includes from about 30 to about 3,000 nucleotides (e.g., from 30 to 50, from 30 to 100, from 30 to 250, from 30 to 500, from 30 to 750, from 30 to 1,000, from 30 to 1,500, from 30 to 2,000, from 30 to 2,500, from 50 to 100, from 50 to 250, from 50 to 500, from 50 to 750, from 50 to 1,000, from 50 to 1,500, from 50 to 2,000, from 50 to 2,500, from 50 to 3,000, from 100 to 500, from 100 to 750, from 100 to 1,000, from 100 to 1,500, from 100 to 2,000, from 100 to 2,500, from 100 to 3,000, from 500 to 750, from 500 to 1,000, from 500 to 1,500, from 500 to 2,000, from 500 to 2,500, from 500 to 3,000, from 1,000 to 1,500, from 1,000 to 2,000, from 1,000 to 2,500, from 1,000 to 3,000, from 1,500 to 2,000, from 1,500 to 2,500, from 1,500 to 3,000, from 2,000 to 3,000, from 2,000 to 2,500, and from 2,500 to 3,000).
[00153] In one embodiment, the poly-A tail is designed relative to the length of the overall polynucleotides, primary constructs or mmRNA. This design may be based on the length of the coding region, the length of a particular feature or region (such as the first or flanking regions), or based on the length of the ultimate product expressed from the polynucleotides, primary constructs or mmRNA.
[00154] In this context the poly-A tail may be 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100% greater in length than the polynucleotides, primary constructs or mmRNA or feature thereof. The poly-A tail may also be designed as a fraction of polynucleotides, primary constructs or mmRNA to which it belongs. In this context, the poly-A tail may be 10, 20, 30, 40, 50, 60, 70, 80, or 90% or more of the total length of the construct or the total length of the construct minus the poly-A tail. Further, engineered binding sites and conjugation of polynucleotides, primary constructs or mmRNA for Poly-A binding protein may enhance expression.
[00155] Additionally, multiple distinct polynucleotides, primary constructs or mmRNA may be linked together to the PABP (Poly-A binding protein) through the 3 '-end using modified nucleotides at the 3 '-terminus of the poly-A tail. Transfection experiments can be conducted in relevant cell lines at and protein production can be assayed by ELISA at 12hr, 24hr, 48hr, 72 hr and day 7 post-transfection.
[00156] In one embodiment, the polynucleotide primary constructs of the present invention are designed to include a polyA-G Quartet. The G-quartet is a cyclic hydrogen bonded array of four guanine nucleotides that can be formed by G-rich sequences in both DNA and RNA. In this embodiment, the G-quartet is incorporated at the end of the poly- A tail. The resultant mmRNA construct is assayed for stability, protein production and other parameters including half-life at various time points. It has been discovered that the polyA-G quartet results in protein production equivalent to at least 75% of that seen using a poly-A tail of 120 nucleotides alone.
ynthetic small guide RNAs (sgRNA)
[00157] The invention also includes synthetic small guide RNAs or sgRNAs. A synthetic sgRNA targets a gene of interest, e.g., a gene where modulation of transcription is desired. A synthetic sgRNA includes a sequence, typically 20-25 nucleotides long, that is complementary to one strand of the 5'UTR of the gene of interest upstream of the transcription start site. The synthetic sgRNA also includes a guide scaffold sequence. A typical guide scaffold sequence is as follows:
GTTTTAGAGCTAGAAATAGCAAGTTAAAATAAGGCTAGTCC GTTATCAACTTGAAAAAGTGGCACCGAGTCGGTGGTGC
(SEQ ID NO:100) [00158] A description of sgRNA design can be found at, e.g., Mali et al. Science. 2013. 339:823-826.
[00159] Examples of sgRNA sequences can be found in the Tables below.
Genes of interest
[00160] The sgRNA target a gene of interest, directing the CRISPR related protein encoded by the synthetic polynucleotide to interact with the gene of interest. The gene of interest is selected depending on the application. Examples genes of interest include VEGF, TPO, and/or genes apoptosis or senescence genes.
III. Design and synthesis of synthetic polynucleotides and sgRNAs
[00161] Synthetic polynucleotides and sgRNAs of the invention may be prepared according to any available technique including, but not limited to chemical synthesis; enzymatic synthesis, which is generally termed in vitro transcription (IVT); or enzymatic or chemical cleavage of a longer precursor, etc. Methods of synthesizing RNAs are known in the art (see, e.g., Gait, M.J. (ed.) Oligonucleotide synthesis: a practical approach, Oxford [Oxfordshire], Washington, DC: IRL Press, 1984; and Herdewijn, P. (ed.) Oligonucleotide synthesis: methods and applications, Methods in Molecular Biology, v. 288 (Clifton, N.J.) Totowa, N.J.: Humana Press, 2005; both of which are incorporated herein by reference).
[00162] The process of design and synthesis of the primary constructs, e.g. synthetic polynucleotides encoding a CRISPR related protein or synthetic sgRNA, of the invention generally includes the steps of gene construction, synthetic mRNA production (either with or without modifications) and purification. In the enzymatic synthesis method, a polynucleotide sequence encoding the CRISPR related protein or sgRNA is first selected for incorporation into a vector which will be amplified to produce a cDNA template. Optionally, the CRISPR related protein polynucleotide sequence and/or any flanking sequences may be codon optimized. The cDNA template is then used to produce mRNA or sgRNA through in vitro transcription (IVT). After production, the mRNA or sgRNA may undergo purification and clean-up processes. The steps of which are provided in more detail below. Gene Construction of the Synthetic Polynucleotide encoding a CRISPR related protein
[00163] The step of gene construction may include, but is not limited to gene synthesis, vector amplification, plasmid purification, plasmid linearization and clean-up, and cDNA template synthesis and clean-up.
[00164] Once a polypeptide of interest, e.g., a CRISPR related protein, e.g., dCAS9 or a dCAS9-effector domain fusion protein, is selected for production, a primary construct is designed. Within the primary construct, a first region of linked nucleosides encoding the polypeptide of interest may be constructed using an open reading frame (ORF) of a selected nucleic acid (DNA or RNA) transcript. The ORF may comprise the wild type ORF, an isoform, variant or a fragment thereof. As used herein, an "open reading frame" or "ORF" is meant to refer to a nucleic acid sequence (DNA or RNA) which is capable of encoding a polypeptide of interest. ORFs often begin with the start codon, ATG and end with a nonsense or termination codon or signal.
[00165] Further, the nucleotide sequence of the first region may be codon optimized. Codon optimization methods are known in the art and may be useful in efforts to achieve one or more of several goals. These goals include to match codon frequencies in target and host organisms to ensure proper folding, bias GC content to increase mRNA stability or reduce secondary structures, minimize tandem repeat codons or base runs that may impair gene construction or expression, customize transcriptional and translational control regions, insert or remove protein trafficking sequences, remove/add post translation modification sites in encoded protein (e.g. glycosylation sites), add, remove or shuffle protein domains, insert or delete restriction sites, modify ribosome binding sites and mRNA degradation sites, to adjust translational rates to allow the various domains of the protein to fold properly, or to reduce or eliminate problem secondary structures within the mRNA. Codon optimization tools, algorithms and services are known in the art, non- limiting examples include services from GeneArt (Life Technologies) and/or DNA2.0 (Menlo Park CA). In one embodiment, the ORF sequence is optimized using optimization algorithms. Codon options for each amino acid are given in Table 1.
Table 1. Codon Options
Figure imgf000041_0001
Methionine M ATG
Cysteine C TGT, TGC
Alanine A GCT, GCC, GCA, GCG
Glycine G GGT, GGC, GGA, GGG
Proline P CCT, CCC, CCA, CCG
Threonine T ACT, ACC, ACA, ACG
Serine s TCT, TCC, TCA, TCG, AGT, AGC
Tyrosine Y TAT, TAC
Tryptophan w TGG
Glutamine Q CAA, CAG
Asparagine N AAT, AAC
Histidine H CAT, CAC
Glutamic acid E GAA, GAG
Aspartic acid D GAT, GAC
Lysine K AAA, AAG
Arginine R CGT, CGC, CGA, CGG, AGA, AGG
Selenocysteine Sec UGA in mRNA in presence of
Selenocystein insertion element (SECIS)
Stop codons Stop TAA, TAG, TGA
[00166] After a sequence has been codon optimized it may be further evaluated for regions containing restriction sites. At least one nucleotide within the restriction site regions may be replaced with another nucleotide in order to remove the restriction site from the sequence but the replacement of nucleotides does alter the amino acid sequence which is encoded by the codon optimized nucleotide sequence.
[00167] In some embodiments and as described in more detail herein, a 5' UTR and/or a 3' UTR may be provided as flanking regions. Multiple 5' or 3' UTRs may be included in the flanking regions and may be the same or of different sequences. Any portion of the flanking regions, including none, may be codon optimized and any may independently contain one or more different structural or chemical modifications, before and/or after codon optimization. Combinations of features may be included in the first and second flanking regions and may be contained within other features. For example, the ORF may be flanked by a 5' UTR which may contain a strong Kozak trans lational initiation signal and/or a 3' UTR which may include an oligo(dT) sequence for templated addition of a poly-A tail.
[00168] After optimization (if desired), the primary construct components are reconstituted and transformed into a vector such as, but not limited to, plasmids, viruses, cosmids, and artificial chromosomes. For example, the optimized construct may be reconstituted and transformed into chemically competent E. coli, yeast, neurospora, maize, drosophila, etc. where high copy plasmid-like or chromosome structures occur by methods described herein. Vector Amplification
[00169] The vector containing the primary construct, encoding either the synthetic polynucleotide encoding a CRISPR related protein or the sgRNA, is then amplified and the plasmid isolated and purified using methods known in the art such as, but not limited to, a maxi prep using the Invitrogen PURELI K™ HiPure Maxiprep Kit (Carlsbad, CA).
Plasmid Linearization
[00170] The plasmid may then be linearized using methods known in the art such as, but not limited to, the use of restriction enzymes and buffers. The linearization reaction may be purified using methods including, for example Invitrogen's PURELINK™ PCR Micro Kit (Carlsbad, CA), and HPLC based purification methods such as, but not limited to, strong anion exchange HPLC, weak anion exchange HPLC, reverse phase HPLC (RP- HPLC), and hydrophobic interaction HPLC (HIC-HPLC) and Invitrogen's standard PURELINK™ PCR Kit (Carlsbad, CA). The purification method may be modified depending on the size of the linearization reaction which was conducted. The linearized plasmid is then used to generate cDNA for in vitro transcription (IVT) reactions.
cDNA Template Synthesis
[00171] A cDNA template may be synthesized by having a linearized plasmid undergo polymerase chain reaction (PCR). Table 4 of U.S. Patent Application No 13/791,922 filed March 9, 2013 provides a listing of primers and probes that may be usefully in the PCR reactions of the present invention. It should be understood that the listing is not exhaustive and that primer-probe design for any amplification is within the skill of those in the art. Probes may also contain chemically modified bases to increase base-pairing fidelity to the target molecule and base-pairing strength.
[00172] In one embodiment, the cDNA may be submitted for sequencing analysis before undergoing transcription.
mRNA Production
[00173] The process of synthetic polynucleotide or sgRNA production may include, but is not limited to, in vitro transcription, cDNA template removal and RNA clean-up, and RNA capping and/or tailing reactions. Alternatively the synthetic polynucleotide or sgRNA can be chemically synthesized.
In Vitro Transcription
[00174] The cDNA produced in the previous step may be transcribed using an in vitro transcription (IVT) system. The system typically comprises a transcription buffer, nucleotide triphosphates (NTPs), an RNase inhibitor and a polymerase. The NTPs may be manufactured in house, may be selected from a supplier, or may be synthesized as described herein. The NTPs may be selected from, but are not limited to, those described herein including natural and unnatural (modified) NTPs. The polymerase may be selected from, but is not limited to, T7 RNA polymerase, T3 RNA polymerase and mutant polymerases such as, but not limited to, polymerases able to incorporate modified nucleic acids. Inorganic pyrophosphatase can be included in the transcription system.
RNA Polymerases
[00175] Any number of RNA polymerases or variants may be used in the design of the primary constructs of the present invention.
[00176] RNA polymerases may be modified by inserting or deleting amino acids of the RNA polymerase sequence. As a non-limiting example, the RNA polymerase may be modified to exhibit an increased ability to incorporate a 2 '-modified nucleotide triphosphate compared to an unmodified RNA polymerase (see International Publication WO2008078180 and U.S. Patent 8, 101,385; herein incorporated by reference in their entireties).
[00177] Variants may be obtained by evolving an RNA polymerase, optimizing the RNA polymerase amino acid and/or nucleic acid sequence and/or by using other methods known in the art. As a non-limiting example, T7 RNA polymerase variants may be evolved using the continuous directed evolution system set out by Esvelt et al. (Nature (2011) 472(7344):499-503; herein incorporated by reference in its entirety) where clones of T7 RNA polymerase may encode at least one mutation such as, but not limited to, lysine at position 93 substituted for threonine (K93T), I4M, A7T, E63V, V64D, A65E, D66Y, T76N, C125R, S 128R, A136T, N165S, G175R, H176L, Y178H, F 182L, L196F, G198V, D208Y, E222K, S228A, Q239R, T243N, G259D, M267I, G280C, H300R, D351A, A354S, E356D, L360P, A383V, Y385C, D388Y, S397R, M401T, N410S, K450R, P451T, G452V, E484A, H523L, H524N, G542V, E565K, K577E, K577M, N601 S, S684Y, L699I, K713E, N748D, Q754R, E775K, A827V, D851N or L864F. As another non-limiting example, T7 RNA polymerase variants may encode at least mutation as described in U.S. Pub. Nos. 20100120024 and 200701 17112; herein incorporated by reference in their entireties. Variants of RNA polymerase may also include, but are not limited to, substitutional variants, conservative amino acid substitution, insertional variants, deletional variants and/or covalent derivatives. [00178] In one embodiment, the primary construct may be designed to be recognized by the wild type or variant RNA polymerases. In doing so, the primary construct may be modified to contain sites or regions of sequence changes from the wild type or parent primary construct.
[00179] In one embodiment, the primary construct may be designed to include at least one substitution and/or insertion upstream of an RNA polymerase binding or recognition site, downstream of the RNA polymerase binding or recognition site, upstream of the TATA box sequence, downstream of the TATA box sequence of the primary construct but upstream of the coding region of the primary construct, within the 5'UTR, before the 5'UTR and/or after the 5'UTR.
[00180] In one embodiment, the 5'UTR of the primary construct may be replaced by the insertion of at least one region and/or string of nucleotides of the same base. The region and/or string of nucleotides may include, but is not limited to, at least 3, at least 4, at least 5, at least 6, at least 7 or at least 8 nucleotides and the nucleotides may be natural and/or unnatural. As a non-limiting example, the group of nucleotides may include 5-8 adenine, cytosine, thymine, a string of any of the other nucleotides disclosed herein and/or combinations thereof.
[00181] In one embodiment, the 5'UTR of the primary construct may be replaced by the insertion of at least two regions and/or strings of nucleotides of two different bases such as, but not limited to, adenine, cytosine, thymine, any of the other nucleotides disclosed herein and/or combinations thereof. For example, the 5'UTR may be replaced by inserting 5-8 adenine bases followed by the insertion of 5-8 cytosine bases. In another example, the 5'UTR may be replaced by inserting 5-8 cytosine bases followed by the insertion of 5-8 adenine bases.
[00182] In one embodiment, the primary construct may include at least one substitution and/or insertion downstream of the transcription start site which may be recognized by an RNA polymerase. As a non-limiting example, at least one substitution and/or insertion may occur downstream the transcription start site by substituting at least one nucleic acid in the region just downstream of the transcription start site (such as, but not limited to, +1 to +6). Changes to region of nucleotides just downstream of the transcription start site may affect initiation rates, increase apparent nucleotide triphosphate (NTP) reaction constant values, and increase the dissociation of short transcripts from the transcription complex curing initial transcription (Brieba et al, Biochemistry (2002) 41 : 5144-5149; herein incorporated by reference in its entirety). The modification, substitution and/or insertion of at least one nucleic acid may cause a silent mutation of the nucleic acid sequence or may cause a mutation in the amino acid sequence.
[00183] In one embodiment, the primary construct may include the substitution of at least 1, at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12 or at least 13 guanine bases downstream of the transcription start site.
[00184] In one embodiment, the primary construct may include the substitution of at least 1, at least 2, at least 3, at least 4, at least 5 or at least 6 guanine bases in the region just downstream of the transcription start site. As a non-limiting example, if the nucleotides in the region are GGGAGA (SEQ ID NO: 127) the guanine bases may be substituted by at least 1, at least 2, at least 3 or at least 4 adenine nucleotides. In another non-limiting example, if the nucleotides in the region are GGGAGA (SEQ ID NO: 127) the guanine bases may be substituted by at least 1, at least 2, at least 3 or at least 4 cytosine bases. In another non-limiting example, if the nucleotides in the region are GGGAGA (SEQ ID NO: 127) the guanine bases may be substituted by at least 1, at least 2, at least 3 or at least 4 thymine, and/or any of the nucleotides described herein.
[00185] In one embodiment, the primary construct may include at least one substitution and/or insertion upstream of the start codon. For the purpose of clarity, one of skill in the art would appreciate that the start codon is the first codon of the protein coding region whereas the transcription start site is the site where transcription begins. The primary construct may include, but is not limited to, at least 1, at least 2, at least 3, at least 4, at least 5, at least 6, at least 7 or at least 8 substitutions and/or insertions of nucleotide bases. The nucleotide bases may be inserted or substituted at 1, at least 1, at least 2, at least 3, at least 4 or at least 5 locations upstream of the start codon. The nucleotides inserted and/or substituted may be the same base (e.g., all A or all C or all T or all G), two different bases (e.g., A and C, A and T, or C and T), three different bases (e.g., A, C and T or A, C and T) or at least four different bases. As a non-limiting example, the guanine base upstream of the coding region in the primary construct may be substituted with adenine, cytosine, thymine, or any of the nucleotides described herein. In another non-limiting example the substitution of guanine bases in the primary construct may be designed so as to leave one guanine base in the region downstream of the transcription start site and before the start codon (see Esvelt et al. Nature (2011) 472(7344):499-503; herein incorporated by reference in its entirety). As a non-limiting example, at least 5 nucleotides may be inserted at 1 location downstream of the transcription start site but upstream of the start codon and the at least 5 nucleotides may be the same base type.
cDNA Template Removal and Clean-Up
[00186] The cDNA template may be removed using methods known in the art such as, but not limited to, treatment with Deoxyribonuclease I (DNase I). RNA clean-up may also include a purification method such as, but not limited to, AGENCOURT®
CLEANSEQ® system from Beckman Coulter (Danvers, MA), HPLC based purification methods such as, but not limited to, strong anion exchange HPLC, weak anion exchange HPLC, reverse phase HPLC (RP-HPLC), and hydrophobic interaction HPLC (HIC- HPLC) .
Capping and/or Tailing Reactions
[00187] The primary construct or mmRNA may also undergo capping and/or tailing reactions. A capping reaction may be performed by methods known in the art to add a 5' cap to the 5' end of the primary construct. Methods for capping include, but are not limited to, using a Vaccinia Capping enzyme (New England Biolabs, Ipswich, MA).
[00188] A poly-A tailing reaction may be performed by methods known in the art, such as, but not limited to, 2' O-methyltransferase and by methods as described herein. If the primary construct generated from cDNA does not include a poly-T, it may be beneficial to perform the poly-A-tailing reaction before the primary construct is cleaned.
[00189] Samples undergoing capping reactions may have varying amounts of 5' capped structures ranging from 0 to 100%. In some embodiments, the sample comprises 0, 5, 10, 20, 30, 40, 50, 60, 70, 80, 90, 95, 99, or 100% 5' capped RNA.
Synthetic polynucleotide and sgRNA Purification
[00190] Purification of the synthetic polynucleotide or sgRNA may include, but is not limited to, RNA clean-up, quality assurance and quality control. RNA clean-up may be performed by methods known in the arts such as, but not limited to, AGENCOURT® beads (Beckman Coulter Genomics, Danvers, MA), poly-T beads, LNA™ oligo-T capture probes (EXIQON® Inc, Vedbaek, Denmark), HPLC based purification methods such as, but not limited to, strong anion exchange HPLC, weak anion exchange HPLC, reverse phase HPLC (RP-HPLC), and hydrophobic interaction HPLC (HIC-HPLC) or RNAse III treatment (a non-limiting example of treating mRNA with RNAse III is described by Meis et al. in International Publication No. WO2013102203, herein incorporated by reference in its entirety). The term "purified" when used in relation to a polynucleotide such as a "purified RNA" refers to one that is separated from at least one contaminant. As used herein, a "contaminant" is any substance which makes another unfit, impure or inferior. Thus, a purified polynucleotide (e.g., DNA and RNA) is present in a form or setting different from that in which it is found in nature, or a form or setting different from that which existed prior to subjecting it to a treatment or purification method.
[00191] A quality assurance and/or quality control check may be conducted using methods such as, but not limited to, gel electrophoresis, UV absorbance, or analytical HPLC.
[00192] In another embodiment, the RNA may be sequenced by methods including, but not limited to reverse-transcriptase-PCR.
[00193] In one embodiment, the mRNA or mmRNA may be quantified using methods such as, but not limited to, ultraviolet visible spectroscopy (UV/Vis). A non-limiting example of a UV/Vis spectrometer is a NANODROP® spectrometer (ThermoFisher, Waltham, MA). The quantified mRNA or mmRNA may be analyzed in order to determine if the mRNA or mmRNA may be of proper size, check that no degradation of the mRNA or mmRNA has occurred. Degradation of the mRNA and/or mmRNA may be checked by methods such as, but not limited to, agarose gel electrophoresis, HPLC based purification methods such as, but not limited to, strong anion exchange HPLC, weak anion exchange HPLC, reverse phase HPLC (RP-HPLC), and hydrophobic interaction HPLC (HIC-HPLC), liquid chromatography-mass spectrometry (LCMS), capillary electrophoresis (CE) and capillary gel electrophoresis (CGE).
IV. Modified synthetic polynucleotides and sgRNAs
[00194] The synthetic polynucleotides and sgRNAs of the invention are typically modified. Herein, in a polynucleotide (such as synthetic polynucleotide or sgRNA), the terms "modification" or, as appropriate, "modified" refer to modification with respect to A, G, U or C ribonucleotides. Generally, herein, these terms are not intended to refer to the ribonucleotide modifications in naturally occurring 5'-terminal mRNA cap moieties. Examples of modifications can be found in US patent application no. 13/644,072, filed 03-Oct-2012 and published as US201301 15272, .e.g, the contents of which are incorporated by reference for all purposes.
[00195] The modifications may be various distinct modifications. In some
embodiments, the coding region, the flanking regions and/or the terminal regions may contain one, two, or more (optionally different) nucleoside or nucleotide modifications. In some embodiments, a modified polynucleotide, primary construct, or mmRNA introduced to a cell may exhibit reduced degradation in the cell, as compared to an unmodified polynucleotide, primary construct, or mmRNA.
[00196] The polynucleotides, primary constructs, and mmRNA can include any useful modification, such as to the sugar, the nucleobase, or the intemucleoside linkage (e.g. to a linking phosphate / to a phosphodiester linkage / to the phosphodiester backbone). One or more atoms of a pyrimidine nucleobase may be replaced or substituted with optionally substituted amino, optionally substituted thiol, optionally substituted alkyl (e.g., methyl or ethyl), or halo (e.g., chloro or fluoro). In certain embodiments, modifications (e.g., one or more modifications) are present in each of the sugar and the intemucleoside linkage. Modifications according to the present invention may be modifications of ribonucleic acids (RNAs) to deoxyribonucleic acids (DNAs), threose nucleic acids (TNAs), glycol nucleic acids (GNAs), peptide nucleic acids (PNAs), locked nucleic acids (LNAs) or hybrids thereof). Additional modifications are described herein.
[00197] As described herein, the polynucleotides, primary constructs, and mmRNA of the invention do not substantially induce an innate immune response of a cell into which the mRNA is introduced. Features of an induced innate immune response include 1) increased expression of pro-inflammatory cytokines, 2) activation of intracellular PRRs (RIG-I, MDA5, etc, and/or 3) termination or reduction in protein translation.
[00198] In certain embodiments, it may desirable to intracellularly degrade a modified nucleic acid molecule introduced into the cell. For example, degradation of a modified nucleic acid molecule may be preferable if precise timing of protein production is desired. Thus, in some embodiments, the invention provides a modified nucleic acid molecule containing a degradation domain, which is capable of being acted on in a directed manner within a cell.
[00199] The polynucleotides, primary constructs, and mmRNA can optionally include other agents (e.g., RNAi-inducing agents, RNAi agents, siRNAs, shRNAs, miRNAs, antisense RNAs, ribozymes, catalytic DNA, tRNA, RNAs that induce triple helix formation, aptamers, vectors, etc.).
[00200] In some embodiments, the polynucleotide, primary construct, or mmRNA (e.g., the first region, first flanking region, or second flanking region) includes n number of linked nucleosides having any base, sugar, backbone, building block or other structure or formula, including but not limited to those of Formulas I through IX or any substructures thereof as described in International Publication No WO2013052523 filed October 3, 2012, entitled Modified Nucleosides, Nucleotides, and Nucleic Acids, and Uses Thereof , the contents of which are incorporated herein by reference in their entirety. Such structures include modifications to the sugar, nucleobase, internucleoside linkage, or combinations thereof.
[00201] Combinations of chemical modifications include those taught in including but not limited to those described in International Publication No WO2013052523 filed October 3, 2012, entitled Modified Nucleosides, Nucleotides, and Nucleic Acids, and Uses Thereof , the contents of which are incorporated herein by reference in their entirety.
[00202] The synthesis of polynucleotides, primary constructs or mmRNA of the present invention may be according to the methods described in International Publication No WO2013052523 filed October 3, 2012, entitled Modified Nucleosides, Nucleotides, and Nucleic Acids, and Uses Thereof , the contents of which are incorporated herein by reference in their entirety.
[00203] In some embodiments, the nucleobase selected from the group consisting of cytosine, guanine, adenine, and uracil.
[00204] In some embodiments, the modified nucleobase is a modified uracil.
Exemplary nucleobases and nucleosides having a modified uracil include pseudouridine (ψ), pyridin-4-one ribonucleoside, 5-aza-uridine, 6-aza-uridine, 2-thio-5-aza-uridine, 2- thio-uridine (s2U), 4-thio-uridine (s4U), 4-thio-pseudouridine, 2-thio-pseudouridine, 5- hydroxy-uridine (ho5U), 5-aminoallyl-uridine, 5-halo-uridine (e.g., 5-iodo-uridine or 5- bromo-uridine), 3-methyl-uridine (m3U), 5-carboxymethyl-uridine (cm5U), 1- carboxymethyl-pseudouridine, 5-carboxyhydroxymethyl-uridine (chm5U), 5- carboxyhydroxymethyl-uridine methyl ester (mchm5U), 5-methoxycarbonylmethyl- uridine (mcm5U), 5-methoxycarbonylmethyl-2-thio-uridine (mcmVU), 5-aminomethyl- 2-thio-uridine (nmVU), 5-methylaminomethyl-uridine (mnm5U), 5-methylaminomethyl- 2-thio-uridine (mnmVU), 5-methylaminomethyl-2-seleno-uridine (mnm5se2U), 5- carbamoylmethyl-uridine (ncm5U), 5-carboxymethylaminomethyl-uridine (cmnm5U), 5- carboxymethylaminomethyl-2-thio-uridine (cmnmVU), 5-propynyl-uridine, 1-propynyl- pseudouridine, 5-taurinomethyl-uridine (tm5U), 1-taurinomethyl-pseudouridine, 5- taurinomethyl-2-thio-uridine(xm5s2U), 1 -taurinomethyl-4-thio-pseudouridine, 5-methyl- uridine (m5U, i.e., having the nucleobase deoxythymine), 1 -methyl-pseudouridine (m ), 5-methyl-2-thio-uridine (m5s2U), l-methyl-4-thio-pseudouridine (m1sV)) 4-thio-l- methyl-pseudouridine, 3 -methyl-pseudouridine (m3\|/), 2-thio-l -methyl-pseudouridine, 1- methyl- 1 -deaza-pseudouridine, 2-thio- 1 -methyl- 1 -deaza-pseudouridine, dihydrouridine (D), dihydropseudouridine, 5,6-dihydrouridine, 5-methyl-dihydrouridine (m5D), 2-thio- dihydrouridine, 2-thio-dihydropseudouridine, 2-methoxy-uridine, 2-methoxy-4-thio- uridine, 4-methoxy -pseudouridine, 4-methoxy-2-thio-pseudouridine, N 1-methylpseudouridine, 3-(3-amino-3-carboxypropyl)uridine (acp3U), l-methyl-3-(3-amino-3- carboxypropyl)pseudouridine (acp3 ψ), 5-(isopentenylaminomethyl)uridine (inm5U), 5- (isopentenylaminomethyl)-2-thio-uridine (inm5s2U), a-thio-uridine, 2'-0-methyl-uridine (Um), 5,2'-0-dimethyl-uridine (m5Um), 2'-0-methyl-pseudouridine (ψηι), 2-thio-2'-0- methyl-uridine (s2Um), 5-methoxycarbonylmethyl-2'-0-methyl-uridine (mcm5Um), 5- carbamoylmethyl-2'-0-methyl-uridine (ncm5Um), 5-carboxymethylaminomethyl-2'-0- methyl-uridine (cmnm5Um), 3,2'-0-dimethyl-uridine (m3Um), 5- (isopentenylaminomethyl)-2'-0-methyl-uridine (inm5Um), 1-thio-uridine,
deoxythymidine, 2'-F-ara-uridine, 2'-F-uridine, 2'-OH-ara-uridine,
5-(2-carbomethoxyvinyl) uridine, and 5-[3-(l-E-propenylamino)uridine.
[00205] In some embodiments, the modified nucleobase is a modified cytosine.
Exemplary nucleobases and nucleosides having a modified cytosine include 5-aza- cytidine, 6-aza-cytidine, pseudoisocytidine, 3-methyl-cytidine (m3C), N4-acetyl-cytidine (ac4C), 5-formyl-cytidine (f5C), N4-methyl-cytidine (m4C), 5-methyl-cytidine (m5C), 5- halo-cytidine (e.g., 5-iodo-cytidine), 5-hydroxymethyl-cytidine (hm5C), 1-methyl- pseudoisocytidine, pyrrolo-cytidine, pyrrolo-pseudoisocytidine, 2-thio-cytidine (s2C), 2- thio-5-methyl-cytidine, 4-thio-pseudoisocytidine, 4-thio-l-methyl-pseudoisocytidine, 4- thio- 1 -methyl- 1 -deaza-pseudoisocytidine, 1 -methyl- 1 -deaza-pseudoisocytidine, zebularine, 5-aza-zebularine, 5-methyl-zebularine, 5-aza-2-thio-zebularine, 2-thio- zebularine, 2-methoxy-cytidine, 2-methoxy-5-methyl-cytidine, 4-methoxy- pseudoisocytidine, 4-methoxy- 1 -methyl-pseudoisocytidine, lysidine (k2C), a-thio- cytidine, 2'-0-methyl-cytidine (Cm), 5,2'-0-dimethyl-cytidine (m5Cm), N4-acetyl-2'-0- methyl-cytidine (ac4Cm), N4,2'-0-dimethyl-cytidine (m4Cm), 5-formyl-2'-0-methyl- cytidine (f5Cm), N4,N4,2'-0-trimethyl-cytidine (m4 2Cm), 1-thio-cytidine,
2'-F-ara-cytidine, 2'-F-cytidine, and 2'-OH-ara-cytidine.
[00206] In exemplary embodiments, the modified nucleobase is a modified uracil selected from pseudouridine (ψ) and 1-methylpseudouridine. In some embodiments, the modified nucleobase is a modified uracil in combination with a modified cytosine, e.g., 5- methylcytosine. [00207] In some embodiments, a polynucleotide of the invention is fully modified with pseudouridine (ψ), optionally in combination with 5-methylcytosine. In some embodiments, a polynucleotide of the invention is fully modified with 1- methylpseudouridine (m ), optionally in combination with 5-methylcytosine.
[00208] In some embodiments, the mRNA molecules are codon optimized.
[00209] In some embodiments, the modified nucleobase is a modified adenine.
Exemplary nucleobases and nucleosides having a modified adenine include 2-amino- purine, 2, 6-diaminopurine, 2-amino-6-halo-purine (e.g., 2-amino-6-chloro-purine), 6- halo-purine (e.g., 6-chloro-purine), 2-amino-6-methyl-purine, 8-azido-adenosine, 7- deaza-adenine, 7-deaza-8-aza-adenine, 7-deaza-2-amino-purine, 7-deaza-8-aza-2-amino- purine, 7-deaza-2, 6-diaminopurine, 7-deaza-8-aza-2,6-diaminopurine, 1-methyl- adenosine (rr^A), 2-methyl-adenine (m2A), N6-methyl-adenosine (m6A), 2-methylthio- N6-methyl-adenosine (ms2m6A), N6-isopentenyl-adenosine (i6A), 2-methylthio-N6- isopentenyl-adenosine (ms2i6A), N6-(cis-hydroxyisopentenyl)adenosine (io6A), 2- methylthio-N6-(cis-hydroxyisopentenyl)adenosine (ms2io6A), N6-glycinylcarbamoyl- adenosine (g6A), N6-threonylcarbamoyl-adenosine (t6A), N6-methyl-N6- threonylcarbamoyl-adenosine (m6t6A), 2-methylthio-N6-threonylcarbamoyl-adenosine (ms2g6A), N6,N6-dimethyl-adenosine (m6 2A), N6-hydroxynorvalylcarbamoyl-adenosine (hn6A), 2-methylthio-N6-hydroxynorvalylcarbamoyl-adenosine (ms2hn6A), N6-acetyl- adenosine (ac6A), 7-methyl-adenine, 2-methylthio-adenine, 2-methoxy-adenine, a-thio- adenosine, 2'-0-methyl-adenosine (Am), N6,2'-0-dimethyl-adenosine (m6Am),
N6,N6,2'-0-trimethyl-adenosine (m62Am), l,2'-0-dimethyl-adenosine (rr^Am), 2'-0- ribosyladenosine (phosphate) (Ar(p)), 2-amino-N6-methyl-purine, 1 -thio-adenosine, 8- azido-adenosine, 2'-F-ara-adenosine, 2'-F-adenosine, 2'-OH-ara-adenosine, and
N6-(19-amino-pentaoxanonadecyl)-adenosine.
[00210] In some embodiments, the modified nucleobase is a modified guanine.
Exemplary nucleobases and nucleosides having a modified guanine include inosine (I), 1- methyl-inosine (m1!), wyosine (imG), methylwyosine (mimG), 4-demethyl-wyosine (imG-14), isowyosine (imG2), wybutosine (yW), peroxywybutosine (o2yW),
hydroxywybutosine (OHyW), undermodified hydroxy wybutosine (OHyW*), 7-deaza- guanosine, queuosine (Q), epoxyqueuosine (oQ), galactosyl-queuosine (galQ), mannosyl- queuosine (manQ), 7-cyano-7-deaza-guanosine (preQo), 7-aminomethyl-7-deaza- guanosine (preQi), archaeosine (G+), 7-deaza-8-aza-guanosine, 6-thio-guanosine, 6-thio- 7-deaza-guanosine, 6-thio-7-deaza-8-aza-guanosine, 7-methyl-guanosine (m7G), 6-thio-7- methyl-guanosine, 7-methyl-inosine, 6-methoxy-guanosine, 1 -methyl-guanosine (rr^G), N2-methyl-guanosine (m2G), N2,N2-dimethyl-guanosine (m2 2G), N2,7-dimethyl- guanosine (m ' G), N2, N2,7-dimethyl-guanosine (m ' ' G), 8-oxo-guanosine, 7-methyl-8- oxo-guanosine, l-methyl-6-thio-guanosine, N2-methyl-6-thio-guanosine, N2,N2- dimethyl-6-thio-guanosine, a-thio-guanosine, 2'-0-methyl-guanosine (Gm), N2-methyl- 2'-0-methyl-guanosine (m2Gm), N2,N2-dimethyl-2'-0-methyl-guanosine (m2 2Gm), 1- methyl-2'-0-methyl-guanosine ( Gm), N2,7-dimethyl-2'-0-methyl-guanosine
(m2'7Gm), 2'-0-methyl-inosine (Im), l,2'-0-dimethyl-inosine (n^Im), and 2'-0- ribosylguanosine (phosphate) (Gr(p)).
[00211] The nucleobase of the nucleotide can be independently selected from a purine, a pyrimidine, a purine or pyrimidine analog. For example, the nucleobase can each be independently selected from adenine, cytosine, guanine, uracil, or hypoxanthine. In another embodiment, the nucleobase can also include, for example, naturally-occurring and synthetic derivatives of a base, including pyrazolo[3,4-d]pyrimidines, 5- methylcytosine (5-me-C), 5-hydroxymethyl cytosine, xanthine, hypoxanthine, 2- aminoadenine, 6-methyl and other alkyl derivatives of adenine and guanine, 2-propyl and other alkyl derivatives of adenine and guanine, 2-thiouracil, 2-thiothymine and 2- thiocytosine, 5-propynyl uracil and cytosine, 6-azo uracil, cytosine and thymine, 5-uracil (pseudouracil), 4-thiouracil, 8-halo (e.g., 8-bromo), 8-amino, 8-thiol, 8-thioalkyl, 8- hydroxyl and other 8-substituted adenines and guanines, 5-halo particularly 5-bromo, 5- trifluoromethyl and other 5-substituted uracils and cytosines, 7-methylguanine and 7- methyladenine, 8-azaguanine and 8-azaadenine, deazaguanine, 7-deazaguanine, 3- deazaguanine, deazaadenine, 7-deazaadenine, 3-deazaadenine, pyrazolo[3,4- d]pyrimidine, imidazo[l,5-a] l,3,5 triazinones, 9-deazapurines, imidazo[4,5-d]pyrazines, thiazolo[4,5-d]pyrimidines, pyrazin-2-ones, 1,2,4-triazine, pyridazine; and 1,3,5 triazine. When the nucleotides are depicted using the shorthand A, G, C, T or U, each letter refers to the representative base and/or derivatives thereof, e.g., A includes adenine or adenine analogs, e.g., 7-deaza adenine).
[00212] Modified nucleosides and nucleotides (e.g., building block molecules) can be prepared according to the synthetic methods described in Ogata et al., J. Org. Chem. 74:2585-2588 (2009); Purmal et al, Nucl. Acids Res. 22(1): 72-78, (1994); Fukuhara et al, Biochemistry, 1(4): 563-568 (1962); and Xu et al, Tetrahedron, 48(9): 1729-1740 (1992), each of which are incorporated by reference in their entirety. [00213] The polypeptides, primary constructs, and mmRNA of the invention may or may not be uniformly modified along the entire length of the molecule. For example, one or more or all types of nucleotide (e.g., purine or pyrimidine, or any one or more or all of A, G, U, C) may or may not be uniformly modified in a polynucleotide of the invention, or in a given predetermined sequence region thereof (e.g. one or more of the sequence regions represented in Figure 1). In some embodiments, all nucleotides X in a polynucleotide of the invention (or in a given sequence region thereof) are modified, wherein X may any one of nucleotides A, G, U, C, or any one of the combinations A+G, A+U, A+C, G+U, G+C, U+C, A+G+U, A+G+C, G+U+C or A+G+C.
[00214] Different sugar modifications, nucleotide modifications, and/or internucleoside linkages (e.g., backbone structures) may exist at various positions in the polynucleotide, primary construct, or mmRNA. One of ordinary skill in the art will appreciate that the nucleotide analogs or other modification(s) may be located at any position(s) of a polynucleotide, primary construct, or mmRNA such that the function of the
polynucleotide, primary construct, or mmRNA is not substantially decreased. A modification may also be a 5' or 3' terminal modification. The polynucleotide, primary construct, or mmRNA may contain from about 1% to about 100% modified nucleotides (either in relation to overall nucleotide content, or in relation to one or more types of nucleotide, i.e. any one or more of A, G, U or C) or any intervening percentage (e.g., from 1% to 20%, from 1% to 25%, from 1% to 50%, from 1% to 60%, from 1% to 70%, from 1% to 80%, from 1% to 90%, from 1% to 95%, from 10% to 20%, from 10% to 25%, from 10% to 50%, from 10% to 60%, from 10% to 70%, from 10% to 80%, from 10% to 90%, from 10% to 95%, from 10% to 100%, from 20% to 25%, from 20% to 50%, from 20% to 60%, from 20% to 70%, from 20% to 80%, from 20% to 90%, from 20% to 95%, from 20% to 100%, from 50% to 60%, from 50% to 70%, from 50% to 80%, from 50% to 90%, from 50% to 95%, from 50% to 100%, from 70% to 80%, from 70% to 90%, from 70% to 95%, from 70% to 100%, from 80% to 90%, from 80% to 95%, from 80% to 100%, from 90% to 95%, from 90% to 100%, and from 95% to 100%).
[00215] In some embodiments, the polynucleotide, primary construct, or mmRNA includes a modified pyrimidine (e.g., a modified uracil/uridine/U or modified cytosine/cytidine/C). In some embodiments, the uracil or uridine (generally: U) in the polynucleotide, primary construct, or mmRNA molecule may be replaced with from about 1% to about 100% of a modified uracil or modified uridine (e.g., from 1% to 20%, from 1% to 25%, from 1% to 50%, from 1% to 60%, from 1% to 70%, from 1% to 80%, from 1% to 90%, from 1% to 95%, from 10% to 20%, from 10% to 25%, from 10% to 50%, from 10% to 60%, from 10% to 70%, from 10% to 80%, from 10% to 90%, from 10% to 95%, from 10% to 100%, from 20% to 25%, from 20% to 50%, from 20% to 60%, from 20% to 70%, from 20% to 80%, from 20% to 90%, from 20% to 95%, from 20% to 100%, from 50% to 60%, from 50% to 70%, from 50% to 80%, from 50% to 90%, from 50% to 95%, from 50% to 100%, from 70% to 80%, from 70% to 90%, from 70% to 95%, from 70% to 100%, from 80% to 90%, from 80% to 95%, from 80% to 100%, from 90% to 95%, from 90% to 100%, and from 95% to 100% of a modified uracil or modified uridine). The modified uracil or uridine can be replaced by a compound having a single unique structure or by a plurality of compounds having different structures (e.g., 2, 3, 4 or more unique structures, as described herein).
[00216] In some embodiments, the cytosine or cytidine (generally: C) in the polynucleotide, primary construct, or mmRNA molecule may be replaced with from about 1% to about 100% of a modified cytosine or modified cytidine (e.g., from 1% to 20%, from 1% to 25%, from 1% to 50%, from 1% to 60%, from 1% to 70%, from 1% to 80%, from 1% to 90%, from 1% to 95%, from 10% to 20%, from 10% to 25%, from 10% to 50%, from 10% to 60%, from 10% to 70%, from 10% to 80%, from 10% to 90%, from 10% to 95%, from 10% to 100%, from 20% to 25%, from 20% to 50%, from 20% to 60%, from 20% to 70%, from 20% to 80%, from 20% to 90%, from 20% to 95%, from 20% to 100%, from 50% to 60%, from 50% to 70%, from 50% to 80%, from 50% to 90%, from 50% to 95%, from 50% to 100%, from 70% to 80%, from 70% to 90%, from 70% to 95%, from 70% to 100%, from 80% to 90%, from 80% to 95%, from 80% to 100%, from 90% to 95%, from 90% to 100%, and from 95% to 100% of a modified cytosine or modified cytidine). The modified cytosine or cytidine can be replaced by a compound having a single unique structure or by a plurality of compounds having different structures (e.g., 2, 3, 4 or more unique structures, as described herein).
[00217] In some embodiments, at least 25% of the cytosines are replaced by a compound of Formula (bl0)-(bl4) (e.g., at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or about 100%).
[00218] In some embodiments, at least 25% of the uracils are replaced by a compound of Formula (bl)-(b9) (e.g., at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or about 100%).
[00219] In some embodiments, at least 25% of the cytosines are replaced by a compound of Formula (bl0)-(bl4), and at least 25% of the uracils are replaced by a compound of Formula (bl)-(b9) (e.g., at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or about 100%).
[00220] In one embodiment, the synthetic polynucleotide and/or sgRNA includes a terminal modification. The terminal modification may be a modification described in US Provisional Application No. US 61/729,933, filed November 26, 2012, entitled
Terminally Optimized RNAs; US Provisional Application No. US 61/737,224, filed December 14, 2012, entitled Terminally Optimized RNAs; US Provisional Application No. US61/758.921, filed January 31, 2013, entitled Differential Targeting Using RNA Constructs; US Provisional Application No. US 61/781, 139, filed March 14, 2013, entitled Differential Targeting Using RNA Constructs; US Provisional Application No. US 61/829,359, filed May 31, 2013, entitled Differential Targeting Using RNA
Constructs; US Provisional Application No. US 61/839,903, filed June 27, 2013, entitled Differential Targeting Using RNA Constructs; US Provisional Application No.
61/842,709, filed July 3, 2013, entitled Differential Targeting Using RNA Constructs; each of which is herein incorporated by reference in its entirety.
[00221] In another embodiment, the chemical modification may be a modification described in International Publication No. WO2013052523, herein incorporated by reference in its entirety.
harmaceutical Compositions: Formulation, Administration, Delivery and Dosing
[00222] In one embodiment, the invention includes synthetic polynucleotide and/or sgRNA compositions and complexes in combination with one or more pharmaceutically acceptable excipients. Pharmaceutical compositions may optionally comprise one or more additional active substances, e.g. therapeutically and/or prophylactically active substances. General considerations in the formulation and/or manufacture of
pharmaceutical agents may be found, for example, in Remington: The Science and Practice of Pharmacy 2 ed., Lippincott Williams & Wilkins, 2005 (incorporated herein by reference in its entirety), synthetic polynucleotides and/or synthetic sgRNAs
[00223] In one embodiment, the synthetic polynucleotide and/or sgRNA are formulated. As a non-limiting example the synthetic polynucleotides and/or synthetic sgRNAs may be formulated by the methods described in International Publication No. WO2013090648 and/or co-pending US Provisional Application No. US 61/821,406, filed March 14, 2013, entitled Formulation and Delivery of Modified Nucleoside, Nucleotide, and Nucleic Acid Compositions, US Provisional Application No. US 61/821,406, filed May 9, 2013, entitled Formulation and Delivery of Modified Nucleoside, Nucleotide, and Nucleic Acid Compositions and US Provisional Application No. US 61/840,510, filed June 28, 2013, entitled Formulation and Delivery of Modified Nucleoside, Nucleotide, and Nucleic Acid Compositions, each of which is herein incorporated by reference in its entirety.
[00224] Although the descriptions of pharmaceutical compositions provided herein are principally directed to pharmaceutical compositions which are suitable for administration to humans, it will be understood by the skilled artisan that such compositions are generally suitable for administration to any other animal, e.g., to non-human animals, e.g. non-human mammals. Modification of pharmaceutical compositions suitable for administration to humans in order to render the compositions suitable for administration to various animals is well understood, and the ordinarily skilled veterinary
pharmacologist can design and/or perform such modification with merely ordinary, if any, experimentation. Subjects to which administration of the pharmaceutical compositions is contemplated include, but are not limited to, humans and/or other primates; mammals, including commercially relevant mammals such as cattle, pigs, horses, sheep, cats, dogs, mice, and/or rats; and/or birds, including commercially relevant birds such as poultry, chickens, ducks, geese, and/or turkeys.
[00225] Formulations of the pharmaceutical compositions described herein may be prepared by any method known or hereafter developed in the art of pharmacology. In general, such preparatory methods include the step of bringing the active ingredient into association with an excipient and/or one or more other accessory ingredients, and then, if necessary and/or desirable, dividing, shaping and/or packaging the product into a desired single- or multi-dose unit.
[00226] A pharmaceutical composition in accordance with the invention may be prepared, packaged, and/or sold in bulk, as a single unit dose, and/or as a plurality of single unit doses. As used herein, a "unit dose" is discrete amount of the pharmaceutical composition comprising a predetermined amount of the active ingredient. The amount of the active ingredient is generally equal to the dosage of the active ingredient which would be administered to a subject and/or a convenient fraction of such a dosage such as, for example, one-half or one-third of such a dosage.
[00227] Relative amounts of the active ingredient, the pharmaceutically acceptable excipient, and/or any additional ingredients in a pharmaceutical composition in accordance with the invention will vary, depending upon the identity, size, and/or condition of the subject treated and further depending upon the route by which the composition is to be administered. By way of example, the composition may comprise between 0.1% and 100%, e.g., between .5 and 50%, between 1-30%, between 5-80%, at least 80% (w/w) active ingredient
Formulations
[00228] The synthetic polynucleotides and/or synthetic sgR As of the invention can be formulated using one or more excipients to: (1) increase stability; (2) increase cell transfection; (3) permit the sustained or delayed release (e.g., from a depot formulation of the polynucleotide, primary construct, or mmR A); (4) alter the biodistribution (e.g., target the polynucleotide, primary construct, or mmRNA to specific tissues or cell types); (5) increase the translation of encoded protein in vivo; and/or (6) alter the release profile of encoded protein in vivo. In addition to traditional excipients such as any and all solvents, dispersion media, diluents, or other liquid vehicles, dispersion or suspension aids, surface active agents, isotonic agents, thickening or emulsifying agents, preservatives, excipients of the present invention can include, without limitation, lipidoids, liposomes, lipid nanoparticles, polymers, lipoplexes, core-shell nanoparticles, peptides, proteins, cells transfected with polynucleotide, primary construct, or mmRNA (e.g., for transplantation into a subject), hyaluronidase, nanoparticle mimics and combinations thereof. Accordingly, the formulations of the invention can include one or more excipients, each in an amount that together increases the stability of the
polynucleotide, primary construct, or mmRNA, increases cell transfection by the polynucleotide, primary construct, or mmRNA, increases the expression of
polynucleotide, primary construct, or mmRNA encoded protein, and/or alters the release profile of polynucleotide, primary construct, or mmRNA encoded proteins. Further, the primary construct and mmRNA of the present invention may be formulated using self- assembled nucleic acid nanoparticles.
[00229] Formulations of the pharmaceutical compositions described herein may be prepared by any method known or hereafter developed in the art of pharmacology. In general, such preparatory methods include the step of associating the active ingredient with an excipient and/or one or more other accessory ingredients.
[00230] A pharmaceutical composition in accordance with the present disclosure may be prepared, packaged, and/or sold in bulk, as a single unit dose, and/or as a plurality of single unit doses. As used herein, a "unit dose" refers to a discrete amount of the pharmaceutical composition comprising a predetermined amount of the active ingredient. The amount of the active ingredient may generally be equal to the dosage of the active ingredient which would be administered to a subject and/or a convenient fraction of such a dosage including, but not limited to, one-half or one-third of such a dosage.
[00231] Relative amounts of the active ingredient, the pharmaceutically acceptable excipient, and/or any additional ingredients in a pharmaceutical composition in accordance with the present disclosure may vary, depending upon the identity, size, and/or condition of the subject being treated and further depending upon the route by which the composition is to be administered. For example, the composition may comprise between 0.1% and 99% (w/w) of the active ingredient.
[00232] In some embodiments, the formulations described herein may contain at least one synthetic polynucleotide. As a non-limiting example, the formulations may contain 1, 2, 3, 4 or 5 mmRNA. In one embodiment the formulation may contain modified mRNA encoding proteins selected from categories such as, but not limited to, human proteins, veterinary proteins, bacterial proteins, biological proteins, antibodies, immunogenic proteins, therapeutic peptides and proteins, secreted proteins, plasma membrane proteins, cytoplasmic and cytoskeletal proteins, intracellular membrane bound proteins, nuclear proteins, proteins associated with human disease and/or proteins associated with non-human diseases. In one embodiment, the formulation contains at least three modified mRNA encoding proteins. In one embodiment, the formulation contains at least five modified mRNA encoding proteins.
[00233] Pharmaceutical formulations may additionally comprise a pharmaceutically acceptable excipient, which, as used herein, includes, but is not limited to, any and all solvents, dispersion media, diluents, or other liquid vehicles, dispersion or suspension aids, surface active agents, isotonic agents, thickening or emulsifying agents, preservatives, and the like, as suited to the particular dosage form desired. Various excipients for formulating pharmaceutical compositions and techniques for preparing the composition are known in the art (see Remington: The Science and Practice of Pharmacy, 21st Edition, A. R. Gennaro, Lippincott, Williams & Wilkins, Baltimore, MD, 2006; incorporated herein by reference). The use of a conventional excipient medium may be contemplated within the scope of the present disclosure, except insofar as any
conventional excipient medium may be incompatible with a substance or its derivatives, such as by producing any undesirable biological effect or otherwise interacting in a deleterious manner with any other component(s) of the pharmaceutical composition.
[00234] In some embodiments, the particle size of the lipid nanoparticle may be increased and/or decreased. The change in particle size may be able to help counter biological reaction such as, but not limited to, inflammation or may increase the biological effect of the modified mRNA delivered to mammals.
[00235] Pharmaceutically acceptable excipients used in the manufacture of
pharmaceutical compositions include, but are not limited to, inert diluents, surface active agents and/or emulsifiers, preservatives, buffering agents, lubricating agents, and/or oils. Such excipients may optionally be included in the pharmaceutical formulations of the invention.
Lipidoids
[00236] The synthesis of lipidoids has been extensively described and formulations containing these compounds are particularly suited for delivery of polynucleotides, primary constructs or mmRNA (see Mahon et al., Bioconjug Chem. 2010 21 : 1448-1454; Schroeder et al., J Intern Med. 2010 267:9-21; Akinc et al, Nat Biotechnol. 2008 26:561- 569; Love et al, Proc Natl Acad Sci U S A. 2010 107: 1864-1869; Siegwart et al., Proc Natl Acad Sci U S A. 201 1 108: 12996-3001; all of which are incorporated herein in their entireties).
[00237] While these lipidoids have been used to effectively deliver double stranded small interfering RNA molecules in rodents and non-human primates (see Akinc et al, Nat Biotechnol. 2008 26:561-569; Frank-Kamenetsky et al., Proc Natl Acad Sci U S A. 2008 105: 1 1915-11920; Akinc et al., Mol Ther. 2009 17:872-879; Love et al, Proc Natl Acad Sci U S A. 2010 107: 1864-1869; Leuschner et al., Nat Biotechnol. 2011 29: 1005- 1010; all of which is incorporated herein in their entirety), the present disclosure describes their formulation and use in delivering single stranded polynucleotides, primary constructs, or mmRNA. Complexes, micelles, liposomes or particles can be prepared containing these lipidoids and therefore, can result in an effective delivery of the polynucleotide, primary construct, or mmRNA, as judged by the production of an encoded protein, following the injection of a lipidoid formulation via localized and/or systemic routes of administration. Lipidoid complexes of polynucleotides, primary constructs, or mmRNA can be administered by various means including, but not limited to, intravenous, intramuscular, or subcutaneous routes.
[00238] In vivo delivery of nucleic acids may be affected by many parameters, including, but not limited to, the formulation composition, nature of particle PEGylation, degree of loading, oligonucleotide to lipid ratio, and biophysical parameters such as particle size (Akinc et al, Mol Ther. 2009 17:872-879; herein incorporated by reference in its entirety). As an example, small changes in the anchor chain length of poly(ethylene glycol) (PEG) lipids may result in significant effects on in vivo efficacy. Formulations with the different lipidoids, including, but not limited to penta[3-(l- laurylaminopropionyl)]-triethylenetetramine hydrochloride (TETA-5LAP; aka 98N12-5, see Murugaiah et al., Analytical Biochemistry, 401 :61 (2010)), CI 2-200 (including derivatives and variants), and MD1, can be tested for in vivo activity.
[00239] The lipidoid referred to herein as "98N12-5" is disclosed by Akinc et al, Mol Ther. 2009 17:872-879 and is incorporated by reference in its entirety. (See Figure 2)
[00240] The lipidoid referred to herein as "C12-200" is disclosed by Love et al, Proc Natl Acad Sci U S A. 2010 107: 1864-1869 (see Figure 2) and Liu and Huang, Molecular Therapy. 2010 669-670 (see Figure 2); both of which are herein incorporated by reference in their entirety. The lipidoid formulations can include particles comprising either 3 or 4 or more components in addition to polynucleotide, primary construct, or mmRNA. As an example, formulations with certain lipidoids, include, but are not limited to, 98N12-5 and may contain 42% lipidoid, 48% cholesterol and 10% PEG (C14 alkyl chain length). As another example, formulations with certain lipidoids, include, but are not limited to, C12- 200 and may contain 50% lipidoid, 10% disteroylphosphatidyl choline, 38.5%
cholesterol, and 1.5% PEG-DMG.
[00241] In one embodiment, a polynucleotide, primary construct, or mmRNA formulated with a lipidoid for systemic intravenous administration can target the liver. For example, a final optimized intravenous formulation using polynucleotide, primary construct, or mmRNA, and comprising a lipid molar composition of 42% 98N12-5, 48% cholesterol, and 10% PEG-lipid with a final weight ratio of about 7.5 to 1 total lipid to polynucleotide, primary construct, or mmRNA, and a C14 alkyl chain length on the PEG lipid, with a mean particle size of roughly 50-60 nm, can result in the distribution of the formulation to be greater than 90% to the liver (see, Akinc et al, Mol Ther. 2009 17:872- 879; herein incorporated in its entirety). In another example, an intravenous formulation using a C12-200 (see US provisional application 61/175,770 and published international application WO2010129709, each of which is herein incorporated by reference in their entirety) lipidoid may have a molar ratio of 50/10/38.5/1.5 of C12- 200/disteroylphosphatidyl choline/cholesterol/PEG-DMG, with a weight ratio of 7 to 1 total lipid to polynucleotide, primary construct, or mmRNA, and a mean particle size of 80 nm may be effective to deliver polynucleotide, primary construct, or mmRNA to hepatocytes (see, Love et al, Proc Natl Acad Sci U S A. 2010 107: 1864-1869 herein incorporated by reference). In another embodiment, an MD1 lipidoid-containing formulation may be used to effectively deliver polynucleotide, primary construct, or mmRNA to hepatocytes in vivo. The characteristics of optimized lipidoid formulations for intramuscular or subcutaneous routes may vary significantly depending on the target cell type and the ability of formulations to diffuse through the extracellular matrix into the blood stream. While a particle size of less than 150 nm may be desired for effective hepatocyte delivery due to the size of the endothelial fenestrae (see, Akinc et al, Mol Ther. 2009 17:872-879 herein incorporated by reference), use of a lipidoid-formulated polynucleotide, primary construct, or mmRNA to deliver the formulation to other cells types including, but not limited to, endothelial cells, myeloid cells, and muscle cells may not be similarly size-limited. Use of lipidoid formulations to deliver siRNA in vivo to other non-hepatocyte cells such as myeloid cells and endothelium has been reported (see Akinc et al., Nat Biotechnol. 2008 26:561-569; Leuschner et al, Nat Biotechnol. 2011 29: 1005-1010; Cho et al. Adv. Funct. Mater. 2009 19:31 12-3118; 8th International Judah Folkman Conference, Cambridge, MA October 8-9, 2010 herein incorporated by reference in its entirety). Effective delivery to myeloid cells, such as monocytes, lipidoid formulations may have a similar component molar ratio. Different ratios of lipidoids and other components including, but not limited to, disteroylphosphatidyl choline, cholesterol and PEG-DMG, may be used to optimize the formulation of the polynucleotide, primary construct, or mmRNA for delivery to different cell types including, but not limited to, hepatocytes, myeloid cells, muscle cells, etc. For example, the component molar ratio may include, but is not limited to, 50% C12-200, 10% disteroylphosphatidyl choline, 38.5% cholesterol, and %1.5 PEG-DMG (see Leuschner et al, Nat Biotechnol 2011 29: 1005-1010; herein incorporated by reference in its entirety). The use of lipidoid formulations for the localized delivery of nucleic acids to cells (such as, but not limited to, adipose cells and muscle cells) via either subcutaneous or intramuscular delivery, may not require all of the formulation components desired for systemic delivery, and as such may comprise only the lipidoid and the polynucleotide, primary construct, or mmRNA.
[00242] Combinations of different lipidoids may be used to improve the efficacy of polynucleotide, primary construct, or mmRNA directed protein production as the lipidoids may be able to increase cell transfection by the polynucleotide, primary construct, or mmRNA; and/or increase the translation of encoded protein (see Whitehead et al, Mol. Ther. 201 1, 19: 1688-1694, herein incorporated by reference in its entirety).
Liposomes, Lipoplexes, and Lipid Nanoparticles
[00243] The polynucleotide, primary construct, and mmRNA of the invention can be formulated using one or more liposomes, lipoplexes, or lipid nanoparticles. In one embodiment, pharmaceutical compositions of polynucleotide, primary construct, or mmRNA include liposomes. Liposomes are artificially -prepared vesicles which may primarily be composed of a lipid bilayer and may be used as a delivery vehicle for the administration of nutrients and pharmaceutical formulations. Liposomes can be of different sizes such as, but not limited to, a multilamellar vesicle (MLV) which may be hundreds of nanometers in diameter and may contain a series of concentric bilayers separated by narrow aqueous compartments, a small unicellular vesicle (SUV) which may be smaller than 50 nm in diameter, and a large unilamellar vesicle (LUV) which may be between 50 and 500 nm in diameter. Liposome design may include, but is not limited to, opsonins or ligands in order to improve the attachment of liposomes to unhealthy tissue or to activate events such as, but not limited to, endocytosis. Liposomes may contain a low or a high pH in order to improve the delivery of the pharmaceutical formulations.
[00244] The formation of liposomes may depend on the physicochemical characteristics such as, but not limited to, the pharmaceutical formulation entrapped and the liposomal ingredients , the nature of the medium in which the lipid vesicles are dispersed, the effective concentration of the entrapped substance and its potential toxicity, any additional processes involved during the application and/or delivery of the vesicles, the optimization size, polydispersity and the shelf-life of the vesicles for the intended application, and the batch-to-batch reproducibility and possibility of large-scale production of safe and efficient liposomal products. [00245] In one embodiment, pharmaceutical compositions described herein may include, without limitation, liposomes such as those formed from l,2-dioleyloxy-N,N- dimethylaminopropane (DODMA) liposomes, DiLa2 liposomes from Marina Biotech (Bothell, WA), l,2-dilinoleyloxy-3-dimethylaminopropane (DLin-DMA), 2,2-dilinoleyl- 4-(2-dimethylaminoethyl)-[l,3]-dioxolane (DLin-KC2-DMA), and MC3
(US20100324120; herein incorporated by reference in its entirety) and liposomes which may deliver small molecule drugs such as, but not limited to, DOXIL® from Janssen Biotech, Inc. (Horsham, PA).
[00246] In one embodiment, pharmaceutical compositions described herein may include, without limitation, liposomes such as those formed from the synthesis of stabilized plasmid-lipid particles (SPLP) or stabilized nucleic acid lipid particle (SNALP) that have been previously described and shown to be suitable for oligonucleotide delivery in vitro and in vivo (see Wheeler et al. Gene Therapy. 1999 6:271-281; Zhang et al. Gene Therapy. 1999 6: 1438-1447; Jeffs et al. Pharm Res. 2005 22:362-372; Morrissey et al, Nat Biotechnol. 2005 2: 1002-1007; Zimmermann et al, Nature. 2006 441 : 1 11-1 14; Heyes et al. J Contr Rel. 2005 107:276-287; Semple et al. Nature Biotech. 2010 28: 172- 176; Judge et al. J Clin Invest. 2009 1 19:661-673; deFougerolles Hum Gene Ther. 2008 19: 125-132; all of which are incorporated herein in their entireties). The original manufacture method by Wheeler et al. was a detergent dialysis method, which was later improved by Jeffs et al. and is referred to as the spontaneous vesicle formation method. The liposome formulations are composed of 3 to 4 lipid components in addition to the polynucleotide, primary construct, or mmRNA. As an example a liposome can contain, but is not limited to, 55% cholesterol, 20% disteroylphosphatidyl choline (DSPC), 10% PEG-S-DSG, and 15% l,2-dioleyloxy-N,N-dimethylaminopropane (DODMA), as described by Jeffs et al. As another example, certain liposome formulations may contain, but are not limited to, 48% cholesterol, 20% DSPC, 2% PEG-c-DMA, and 30% cationic lipid, where the cationic lipid can be l,2-distearloxy-N,N-dimethylaminopropane (DSDMA), DODMA, DLin-DMA, or l,2-dilinolenyloxy-3-dimethylaminopropane (DLenDMA), as described by Heyes et al.
[00247] In one embodiment, the polynucleotides, primary constructs and/or mmRNA may be formulated in a lipid vesicle which may have crosslinks between functionalized lipid bilayers.
[00248] In one embodiment, the polynucleotides, primary constructs and/or mmRNA may be formulated in a lipid-polycation complex. The formation of the lipid-polycation complex may be accomplished by methods known in the art and/or as described in U.S. Pub. No. 20120178702, herein incorporated by reference in its entirety. As a non- limiting example, the polycation may include a cationic peptide or a polypeptide such as, but not limited to, polylysine, polyomithine and/or polyarginine. In another embodiment, the polynucleotides, primary constructs and/or mmRNA may be formulated in a lipid- polycation complex which may further include a neutral lipid such as, but not limited to, cholesterol or dioleoyl phosphatidylethanolamine (DOPE).
[00249] The liposome formulation may be influenced by, but not limited to, the selection of the cationic lipid component, the degree of cationic lipid saturation, the nature of the PEGylation, ratio of all components and biophysical parameters such as size. In one example by Semple et al. (Semple et al. Nature Biotech. 2010 28: 172-176), the liposome formulation was composed of 57.1 % cationic lipid, 7.1%
dipalmitoylphosphatidylcholine, 34.3 % cholesterol, and 1.4% PEG-c-DMA. As another example, changing the composition of the cationic lipid could more effectively deliver siRNA to various antigen presenting cells (Basha et al. Mol Ther. 201 1 19:2186-2200; herein incorporated by reference in its entirety).
[00250] In some embodiments, the ratio of PEG in the LNP formulations may be increased or decreased and/or the carbon chain length of the PEG lipid may be modified from C14 to CI 8 to alter the pharmacokinetics and/or biodistribution of the LNP formulations. As a non-limiting example, LNP formulations may contain 1-5% of the lipid molar ratio of PEG-c-DOMG as compared to the cationic lipid, DSPC and cholesterol. In another embodiment the PEG-c-DOMG may be replaced with a PEG lipid such as, but not limited to, PEG- DSG (1,2-Distearoyl-sn-glycerol, methoxypolyethylene glycol) or PEG-DPG (1,2-Dipalmitoyl-sn-glycerol, methoxypolyethylene glycol). The cationic lipid may be selected from any lipid known in the art such as, but not limited to, DLin-MC3 -DMA, DLin-DMA, CI 2-200 and DLin-KC2-DMA.
[00251] In one embodiment, the cationic lipid may be selected from, but not limited to, a cationic lipid described in International Publication Nos. WO2012040184,
WO2011 153120, WO201 1149733, WO2011090965, WO201 1043913, WO2011022460, WO2012061259, WO2012054365, WO2012044638, WO2010080724, WO201021865 and WO2008103276, US Patent Nos. 7,893,302 and 7,404,969 and US Patent Publication No. US201000361 15; each of which is herein incorporated by reference in their entirety. In another embodiment, the cationic lipid may be selected from, but not limited to, formula A described in International Publication Nos. WO2012040184, WO2011 153120, WO2011 149733, WO201 1090965, WO2011043913, WO201 1022460, WO2012061259, WO2012054365 and WO2012044638; each of which is herein incorporated by reference in their entirety. In yet another embodiment, the cationic lipid may be selected from, but not limited to, formula CLI-CLXXIX of International Publication No. WO2008103276, formula CLI-CLXXIX of US Patent No. 7,893,302, formula CLI-CLXXXXII of US Patent No. 7,404,969 and formula I-VI of US Patent Publication No. US201000361 15; each of which is herein incorporated by reference in their entirety. As a non-limiting example, the cationic lipid may be selected from (20Z,23Z)-N,N-dimethylnonacosa- 20,23-dien-10-amine, (17Z,20Z)-N,N-dimemylhexacosa-17,20-dien-9-amine, (1 Z, 19Z)- N5N~dimethylpentacosa~l 6, 19-dien-8-amine, (13Z, 16Z)-N,N-dimethyldocosa-13J16- dien-5-amine, ( 12Z, 15Z)-NJN-dimethylhenicosa- 12, 15 -dien-4-amine, ( 14Z, 17Z)-N,N- dimethyltricosa- 14, 17-dien-6-amine, ( 15Z, 18Z)-N,N-dimethyltetracosa- 15, 18-dien-7- amine, ( 18Z,21 Z)-N,N-dimethylheptacosa- 18,21 -dien- 10-amine, ( 15Z, 18Z)-N,N- dimethyltetracosa- 15, 18-dien-5 -amine, ( 14Z, 17Z)-N,N-dimethyltricosa- 14, 17-dien-4- amine, (19Z,22Z)-N,N-dimeihyloctacosa-19,22-dien-9-amine, (18Z,21 Z)-N ,N- dimethylheptacosa- 18 ,21 -dien-8 -amine, (17Z,20Z)-N,N-dimethylhexacosa- 17„20- dien-7-amine, ( 16Z; 19Z)-N,N-dimethylpentacosa- 16, 19-dien-6-amine, (22Z,25Z)-N,N- dimethylhentriaconta-22,25-dien- 10-amine, (21 Z ,24Z)-N;N-dimethyltriaconta-21 ,24- dien-9-amine, (18Z)-N,N-dimetylheptacos-18-en- 10-amine, (17Z)-N,N-dimethylhexacos- 17-en-9-amine, (19Z,22Z)-NJN-dimethyloctacosa- 19,22-dien-7-amine, N,N- dimethylheptacosan- 10-amine, (20Z,23Z)-N-ethyl-N-methylnonacosa-20J23-dien-l 0- amine, 1-[(1 lZ, 14Z)-l-nonylicosa-l 1, 14-dien-l-yl] pyrrolidine, (20Z)-N,N- dimethylheptacos-20-en-l 0-amine, (15Z)-N,N-dimethyl eptacos-15-en-l 0-amine, (14Z)- N,N-dimethylnonacos-14-en-l 0-amine, (17Z)-N,N-dimethylnonacos-17-en-l 0-amine, (24Z)-N,N-dimethyltritriacont-24-en-l 0-amine, (20Z)-N,N-dimethylnonacos-20-en-l 0- amine, (22Z)-N,N-dimethylhentriacont-22-en-l 0-amine, (16Z)-N,N-dimethylpentacos- 16-en-8-amine, (12Z, 15Z)-N,N-dimethyl-2-nonylhenico sa- 12 , 15 -dien- 1 -amine, (13Z, 16Z)-N,N-dimethyl-3-nonyldocosa-l 3, 16-dien-l -amine, N,N-dimethyl-l-[(l S,2R)- 2-octylcyclopropyl] eptadecan-8-amine, 1 -[(1 S,2R)-2-hexylcyclopropyl]-N,N- dimethylnonadecan- 10-amine, Ν,Ν-dimethyl- 1 - [( 1 S ,2R)-2- octylcyclopropyl]nonadecan- 10-amine, N,N-dimethyl-2 l~[(lS,2R)-2- octylcyclopropyl]henicosan-l 0-amine, Ν,Ν-dimethyl- 1 -[(1 S ,2S)-2- { [( lR,2R)-2- pentylcycIopropyl]methyl} cyclopropyl]nonadecan- 10-amine, Ν,Ν-dimethyl- 1 -[(1 S,2R)-2-octylcyclopropyl]hexadecan-8-amine, Ν,Ν-dimethyH -[(lR,2S)-2- undecyIcyclopropyl]tetradecan-5-amine, N,N-dimethyl-3- {7-[( 1 S,2R)-2- octylcyclopropyl]heptyl} dodecan- 1 -amine, 1 - [( 1 R,2 S)-2-hepty lcyclopropy 1] -N,N- dimethyloctadecan-9 -amine, 1-[(1 S,2R)-2-decylcyclopropyl]-N,N-dimethylpentadecan- 6-amine, N,N-dimethyl-l-[(lS,2R)-2-octylcyclopropyl]pentadecan-8-amine, R -N,N- dimethyl- 1 - [(9Z, 12Z)-octadeca-9, 12-dien- 1 -yloxy] -3 -(octyloxy)propan-2-amine, S -N,N- dimethyl- 1 - [(9Z, 12Z)-octadeca-9, 12-dien- 1 -yloxy] -3 -(octyloxy)propan-2-amine, 1 - {2- [(9Z,12Z)-octadeca-9, 12-dien-l -yloxy]- l-[(octyloxy) methyl]ethyl}pyrrolidine, (2S)- Ν,Ν-dimethyl- 1 -[(9Z, 12Z)-octadeca-9, 12-dien- 1 -yloxy]-3-[(5Z)-oct -5-en- 1 - yloxy]propan-2-amine, l- {2-[(9Z, 12Z)-octadeca-9, 12-dien-l-yloxy]-l-[(octyloxy) methyl]ethyl}azetidine, (2S)-l-(hexyloxy)-N,N-dimethyl-3-[(9Z,12Z)-octadeca-9, 12- dien-l-yloxy]propan-2-amine, (2S)-l-(heptyloxy)-N,N-dimethyl-3-[(9Z,12Z)-octadeca- 9,12-dien- l-yloxy]propan-2-amine, N,N-dimethyl-l-(nonyloxy)-3-[(9Z, 12Z)-octadeca- 9, 12-dien- 1 -yloxy]propan-2-amine, Ν,Ν-dimethyl- 1 -[(9Z)-octadec-9-en- 1 -yloxy]-3 - (octyloxy)propan-2-amine (Compound 9); (2S)-N,N-dimethyl-l-[(6Z,9Z, 12Z)-octadeca- 6,9, 12-trien- 1 -yloxy]-3 -(octyloxy)propan-2-amine, (2S)- 1 -[( 11 Z, 14Z)-icosa- 1 1, 14-dien- l-yloxy]-N,N-dimethyl-3-(pentyloxy)propan-2-amine, (2S)-l-(hexyloxy)-3-[(l 1Z, 14Z)- icosa-1 l, 14-dien-l-yloxy]-N,N-dimethylpropan-2-amine, 1-[(1 lZ,14Z)-icosa-l 1, 14-dien- 1 -yloxy]-N,N-dimethy 1 -3 -(octyloxy)propan-2-amine, 1 -[( 13 Z, 16Z)-docosa-13 , 16-dien-l- yloxy] -N,N-dimethyl-3 -(octyloxy)propan-2-amine, (2 S)- 1 - [( 13Z, 16Z)-docosa- 13, 16- dien- 1 -yloxy]-3 -(hexyloxy)-N,N-dimethylpropan-2-amine, (2S)- 1 -[(13Z)-docos- 13-en- 1 - yloxy] -3 -(hexyloxy)-N,N-dimethylpropan-2-amine, 1 - [( 13 Z)-docos- 13 -en- 1 -yloxy] -N,N- dimethyl-3-(octyloxy)propan-2-amine, l-[(9Z)-hexadec-9-en-l-yloxy]-N,N-dimethyl-3- (octyloxy)propan-2-amine, (2R)-N,N-dimethyl-H(l-metoylo ctyl)oxy]-3-[(9Z, 12Z)- octadeca-9,12-dien- l-yloxy]propan-2-amine, (2R)-l-[(3,7-dimethyloctyl)oxy]-N,N- dimethyl-3 - [(9Z, 12Z)-octadeca-9, 12-dien- 1 -yloxy]propan-2-amine, Ν,Ν-dimethyl- 1 - (octyloxy)-3-({8-[(lS,2S)-2- {[(lR,2R)-2- pentylcyclopropyl]methyl} cyclopropyl]octyl} oxy)propan-2 -amine, Ν,Ν-dimethyl- 1 - { [8- (2-oclylcyclopropyl)octyl]oxy}-3-(octyloxy)propan-2-amine and (11E,20Z,23Z)-N;N- dimethylnonacosa-ll,20,2-trien-10-amine or a pharmaceutically acceptable salt or stereoisomer thereof.
[00252] In one embodiment, the cationic lipid may be synthesized by methods known in the art and/or as described in International Publication Nos. WO2012040184,
WO2011 153120, WO201 1149733, WO2011090965, WO201 1043913, WO2011022460, WO2012061259, WO2012054365, WO2012044638, WO2010080724 and
WO201021865; each of which is herein incorporated by reference in their entirety.
[00253] In one embodiment, the LNP formulations of the polynucleotides, primary constructs and/or mmRNA may contain PEG-c-DOMG 3% lipid molar ratio. In another embodiment, the LNP formulations of the polynucleotides, primary constructs and/or mmRNA may contain PEG-c-DOMG 1.5% lipid molar ratio.
[00254] In one embodiment, the pharmaceutical compositions of the polynucleotides, primary constructs and/or mmRNA may include at least one of the PEGylated lipids described in International Publication No. 2012099755, herein incorporated by reference.
[00255] In one embodiment, the LNP formulation may contain PEG-DMG 2000 (1,2- dimyristoyl-sn-glycero-3-phophoethanolamine-N-[methoxy(polyethylene glycol)-2000). In one embodiment, the LNP formulation may contain PEG-DMG 2000, a cationic lipid known in the art and at least one other component. In another embodiment, the LNP formulation may contain PEG-DMG 2000, a cationic lipid known in the art, DSPC and cholesterol. As a non-limiting example, the LNP formulation may contain PEG-DMG 2000, DLin-DMA, DSPC and cholesterol. As another non-limiting example the LNP formulation may contain PEG-DMG 2000, DLin-DMA, DSPC and cholesterol in a molar ratio of 2:40: 10:48 (see Geall et al, Nonviral delivery of self-amplifying RNA vaccines, PNAS 2012; PMID: 22908294).
[00256] In one embodiment, the LNP formulation may be formulated by the methods described in International Publication Nos. WO2011 127255 or WO2008103276, each of which is herein incorporated by reference in their entirety. As a non-limiting example, modified RNA described herein may be encapsulated in LNP formulations as described in WO2011 127255 and/or WO2008103276; each of which is herein incorporated by reference in their entirety.
[00257] In one embodiment, LNP formulations described herein may comprise a polycationic composition. As a non-limiting example, the polycationic composition may be selected from formula 1-60 of US Patent Publication No. US20050222064; herein incorporated by reference in its entirety. In another embodiment, the LNP formulations comprising a polycationic composition may be used for the delivery of the modified RNA described herein in vivo and/or in vitro.
[00258] In one embodiment, the LNP formulations described herein may additionally comprise a permeability enhancer molecule. Non-limiting permeability enhancer molecules are described in US Patent Publication No. US20050222064; herein incorporated by reference in its entirety.
[00259] In one embodiment, the pharmaceutical compositions may be formulated in liposomes such as, but not limited to, DiLa2 liposomes (Marina Biotech, Bothell, WA), SMARTICLES® (Marina Biotech, Bothell, WA), neutral DOPC (1,2-dioleoyl-sn- glycero-3-phosphocholine) based liposomes (e.g., siRNA delivery for ovarian cancer (Landen et al. Cancer Biology & Therapy 2006 5(12)1708-1713)) and hyaluronan-coated liposomes (Quiet Therapeutics, Israel).
[00260] Lipid nanoparticle formulations may be improved by replacing the cationic lipid with a biodegradable cationic lipid which is known as a rapidly eliminated lipid nanoparticle (reLNP). Ionizable cationic lipids, such as, but not limited to, DLinDMA, DLin-KC2-DMA, and DLin-MC3-DMA, have been shown to accumulate in plasma and tissues over time and may be a potential source of toxicity. The rapid metabolism of the rapidly eliminated lipids can improve the tolerability and therapeutic index of the lipid nanoparticles by an order of magnitude from a 1 mg/kg dose to a 10 mg/kg dose in rat. Inclusion of an enzymatically degraded ester linkage can improve the degradation and metabolism profile of the cationic component, while still maintaining the activity of the reLNP formulation. The ester linkage can be internally located within the lipid chain or it may be terminally located at the terminal end of the lipid chain. The internal ester linkage may replace any carbon in the lipid chain.
[00261] In one embodiment, the internal ester linkage may be located on either side of the saturated carbon. Non-limitin examples of reLNPs include,
Figure imgf000069_0001
A
Figure imgf000069_0002
[00262] In one embodiment, an immune response may be elicited by delivering a lipid nanoparticle which may include a nanospecies, a polymer and an immunogen. (U.S. Publication No. 20120189700 and International Publication No. WO2012099805; each of which is herein incorporated by reference in their entirety). The polymer may
encapsulate the nanospecies or partially encapsulate the nanospecies.
[00263] Lipid nanoparticles may be engineered to alter the surface properties of particles so the lipid nanoparticles may penetrate the mucosal barrier. Mucus is located on mucosal tissue such as, but not limited to, oral (e.g., the buccal and esophageal membranes and tonsil tissue), ophthalmic, gastrointestinal (e.g., stomach, small intestine, large intestine, colon, rectum), nasal, respiratory (e.g., nasal, pharyngeal, tracheal and bronchial membranes), genital (e.g., vaginal, cervical and urethral membranes).
Nanoparticles larger than 10-200 nm which are preferred for higher drug encapsulation efficiency and the ability to provide the sustained delivery of a wide array of drugs have been thought to be too large to rapidly diffuse through mucosal barriers. Mucus is continuously secreted, shed, discarded or digested and recycled so most of the trapped particles may be removed from the mucosal tissue within seconds or within a few hours. Large polymeric nanoparticles (200nm -500nm in diameter) which have been coated densely with a low molecular weight polyethylene glycol (PEG) diffused through mucus only 4 to 6-fold lower than the same particles diffusing in water (Lai et al. PNAS 2007 104(5): 1482-487; Lai et al. Adv Drug Deliv Rev. 2009 61(2): 158-171 ; each of which is herein incorporated by reference in their entirety). The transport of nanoparticles may be determined using rates of permeation and/or fluorescent microscopy techniques including, but not limited to, fluorescence recovery after photobleaching (FRAP) and high resolution multiple particle tracking (MPT).
[00264] The lipid nanoparticle engineered to penetrate mucus may comprise a polymeric material (i.e. a polymeric core) and/or a polymer-vitamin conjugate and/or a tri-block co-polymer. The polymeric material may include, but is not limited to, polyamines, polyethers, polyamides, polyesters, polycarbamates, polyureas,
polycarbonates, poly(styrenes), polyimides, polysulfones, polyurethanes, polyacetylenes, polyethylenes, polyethyeneimines, polyisocyanates, polyacrylates, polymethacrylates, polyacrylonitriles, and polyarylates. The polymeric material may be biodegradable and/or biocompatible. Non-limiting examples of specific polymers include poly(caprolactone) (PCL), ethylene vinyl acetate polymer (EVA), poly(lactic acid) (PLA), poly(L-lactic acid) (PLLA), poly(glycolic acid) (PGA), poly(lactic acid-co-glycolic acid) (PLGA), poly(L- lactic acid-co-glycolic acid) (PLLGA), poly(D,L-lactide) (PDLA), poly(L-lactide) (PLLA), poly(D,L-lactide-co-caprolactone), poly(D,L-lactide-co-caprolactone-co- glycolide), poly(D,L-lactide-co-PEO-co-D,L-lactide), poly(D,L-lactide-co-PPO-co-D,L- lactide), polyalkyl cyanoacralate, polyurethane, poly-L-lysine (PLL), hydroxypropyl methacrylate (HPMA), polyethyleneglycol, poly-L-glutamic acid, poly(hydroxy acids), polyanhydrides, polyorthoesters, poly(ester amides), polyamides, poly(ester ethers), polycarbonates, polyalkylenes such as polyethylene and polypropylene, polyalkylene glycols such as poly(ethylene glycol) (PEG), polyalkylene oxides (PEO), polyalkylene terephthalates such as poly(ethylene terephthalate), polyvinyl alcohols (PVA), polyvinyl ethers, polyvinyl esters such as poly(vinyl acetate), polyvinyl halides such as poly(vinyl chloride) (PVC), polyvinylpyrrolidone, polysiloxanes, polystyrene (PS), polyurethanes, derivatized celluloses such as alkyl celluloses, hydroxyalkyl celluloses, cellulose ethers, cellulose esters, nitro celluloses, hydroxypropylcellulose, carboxymethylcellulose, polymers of acrylic acids, such as poly(methyl(meth)acrylate) (PMMA),
poly(ethyl(meth)acrylate), poly(butyl(meth)acrylate), poly(isobutyl(meth)acrylate), poly(hexyl(meth)acrylate), poly(isodecyl(meth)acrylate), poly(lauryl(meth)acrylate), poly(phenyl(meth)acrylate), poly(methyl acrylate), poly(isopropyl acrylate), poly(isobutyl acrylate), poly(octadecyl acrylate) and copolymers and mixtures thereof, polydioxanone and its copolymers, polyhydroxyalkanoates, polypropylene fumarate, polyoxymethylene, poloxamers, poly(ortho)esters, poly(butyric acid), poly(valeric acid), poly(lactide-co- caprolactone), and trimethylene carbonate, polyvinylpyrrolidone.The lipid nanoparticle may be coated or associated with a co-polymer such as, but not limited to, a block copolymer, and (poly(ethylene glycol))-(poly(propylene oxide))-(poly(ethylene glycol)) triblock copolymer (see US Publication 20120121718 and US Publication 20100003337; each of which is herein incorporated by reference in their entirety). The co-polymer may be a polymer that is generally regarded as safe (GRAS) and the formation of the lipid nanoparticle may be in such a way that no new chemical entities are created. For example, the lipid nanoparticle may comprise poloxamers coating PLGA nanoparticles without forming new chemical entities which are still able to rapidly penetrate human mucus (Yang et al. Angew. Chem. Int. Ed. 201 1 50:2597-2600; herein incorporated by reference in its entirety).
[00265] The vitamin of the polymer- vitamin conjugate may be vitamin E. The vitamin portion of the conjugate may be substituted with other suitable components such as, but not limited to, vitamin A, vitamin E, other vitamins, cholesterol, a hydrophobic moiety, or a hydrophobic component of other surfactants (e.g., sterol chains, fatty acids, hydrocarbon chains and alkylene oxide chains).
[00266] The lipid nanoparticle engineered to penetrate mucus may include surface altering agents such as, but not limited to, mmRNA, anionic protein (e.g., bovine serum albumin), surfactants (e.g., cationic surfactants such as for example dimethyldioctadecyl- ammonium bromide), sugars or sugar derivatives (e.g., cyclodextrin), nucleic acids, polymers (e.g., heparin, polyethylene glycol and poloxamer), mucolytic agents (e.g., N- acetylcysteine, mugwort, bromelain, papain, clerodendrum, acetylcysteine, bromhexine, carbocisteine, eprazinone, mesna, ambroxol, sobrerol, domiodol, letosteine, stepronin, tiopronin, gelsolin, thymosin β4 dornase alfa, neltenexine, erdosteine) and various DNases including rhDNase. The surface altering agent may be embedded or enmeshed in the particle's surface or disposed (e.g., by coating, adsorption, covalent linkage, or other process) on the surface of the lipid nanoparticle. (see US Publication 20100215580 and US Publication 20080166414; each of which is herein incorporated by reference in their entirety).
[00267] The mucus penetrating lipid nanoparticles may comprise at least one mmRNA described herein. The mmRNA may be encapsulated in the lipid nanoparticle and/or disposed on the surface of the particle. The mmRNA may be covalently coupled to the lipid nanoparticle. Formulations of mucus penetrating lipid nanoparticles may comprise a plurality of nanoparticles. Further, the formulations may contain particles which may interact with the mucus and alter the structural and/or adhesive properties of the surrounding mucus to decrease mucoadhesion which may increase the delivery of the mucus penetrating lipid nanoparticles to the mucosal tissue.
[00268] In one embodiment, the polynucleotide, primary construct, or mmRNA is formulated as a lipoplex, such as, without limitation, the ATUPLEX™ system, the DACC system, the DBTC system and other siRNA-lipoplex technology from Silence
Therapeutics (London, United Kingdom), STEMFECT™ from STEMGENT®
(Cambridge, MA), and polyethylenimine (PEI) or protamine-based targeted and non- targeted delivery of nucleic acids (Aleku et al. Cancer Res. 2008 68:9788-9798;
Strumberg et al. Int J Clin Pharmacol Ther 2012 50:76-78; Santel et al, Gene Ther 2006 13: 1222-1234; Santel et al, Gene Ther 2006 13 : 1360-1370; Gutbier et al, Pulm
Pharmacol. Ther. 2010 23:334-344; Kaufmann et al. Microvasc Res 2010 80:286- 293Weide et al. J Immunother. 2009 32:498-507; Weide et al. J Immunother. 2008 31 : 180-188; Pascolo Expert Opin. Biol. Ther. 4: 1285-1294; Fotin-Mleczek et al, 2011 J. Immunother. 34: 1-15; Song et al., Nature Biotechnol. 2005, 23:709-717; Peer et al, Proc Natl Acad Sci U S A. 2007 6; 104:4095-4100; deFougerolles Hum Gene Ther. 2008 19: 125-132; all of which are incorporated herein by reference in its entirety).
[00269] In one embodiment such formulations may also be constructed or compositions altered such that they passively or actively are directed to different cell types in vivo, including but not limited to hepatocytes, immune cells, tumor cells, endothelial cells, antigen presenting cells, and leukocytes (Akinc et al. Mol Ther. 2010 18: 1357-1364; Song et al, Nat Biotechnol. 2005 23 :709-717; Judge et al, J Clin Invest. 2009 119:661- 673; Kaufmann et al., Microvasc Res 2010 80:286-293; Santel et al, Gene Ther 2006 13 : 1222-1234; Santel et al, Gene Ther 2006 13 : 1360-1370; Gutbier et al, Pulm
Pharmacol. Ther. 2010 23 :334-344; Basha et al, Mol. Ther. 2011 19:2186-2200; Fenske and Cullis, Expert Opin Drug Deliv. 2008 5:25-44; Peer et al, Science. 2008 319:627- 630; Peer and Lieberman, Gene Ther. 201 1 18: 1 127-1133; all ofwhich are incorporated herein by reference in its entirety). One example of passive targeting of formulations to liver cells includes the DLin-DMA, DLin-KC2-DMA and MC3 -based lipid nanoparticle formulations which have been shown to bind to apolipoprotein E and promote binding and uptake of these formulations into hepatocytes in vivo (Akinc et al. Mol Ther. 2010 18: 1357-1364; herein incorporated by reference in its entirety). Formulations can also be selectively targeted through expression of different ligands on their surface as exemplified by, but not limited by, folate, transferrin, N-acetylgalactosamine (GalNAc), and antibody targeted approaches (Kolhatkar et al., Curr Drug Discov Technol. 201 1 8: 197-206; Musacchio and Torchilin, Front Biosci. 201 1 16: 1388-1412; Yu et al, Mol Membr Biol. 2010 27:286-298; Patil et al, Crit Rev Ther Drug Carrier Syst. 2008 25: 1- 61 ; Benoit et al, Biomacromolecules. 201 1 12:2708-2714Zhao et al, Expert Opin Drug Deliv. 2008 5:309-319; Akinc et al, Mol Ther. 2010 18: 1357-1364; Srinivasan et al, Methods Mol Biol. 2012 820: 105-116; Ben-Arie et al, Methods Mol Biol. 2012 757:497- 507; Peer 2010 J Control Release. 20:63-68; Peer et al, Proc Natl Acad Sci U S A. 2007 104:4095-4100; Kim et al, Methods Mol Biol. 201 1 721 :339-353; Subramanya et al., Mol Ther. 2010 18:2028-2037; Song et al, Nat Biotechnol. 2005 23 :709-717; Peer et al, Science. 2008 319:627-630; Peer and Lieberman, Gene Ther. 2011 18: 1 127-1 133; all of which are incorporated herein by reference in its entirety)..
[00270] In one embodiment, the polynucleotide, primary construct, or mmRNA is formulated as a solid lipid nanoparticle. A solid lipid nanoparticle (SLN) may be spherical with an average diameter between 10 to 1000 nm. SLN possess a solid lipid core matrix that can solubilize lipophilic molecules and may be stabilized with surfactants and/or emulsifiers. In a further embodiment, the lipid nanoparticle may be a self-assembly lipid-polymer nanoparticle (see Zhang et al, ACS Nano, 2008, 2 (8), pp 1696-1702; herein incorporated by reference in its entirety).
[00271] Liposomes, lipoplexes, or lipid nanoparticles may be used to improve the efficacy of polynucleotide, primary construct, or mmRNA directed protein production as these formulations may be able to increase cell transfection by the polynucleotide, primary construct, or mmRNA; and/or increase the translation of encoded protein. One such example involves the use of lipid encapsulation to enable the effective systemic delivery of polyplex plasmid DNA (Heyes et al, Mol Ther. 2007 15:713-720; herein incorporated by reference in its entirety). The liposomes, lipoplexes, or lipid nanoparticles may also be used to increase the stability of the polynucleotide, primary construct, or mmRNA.
[00272] In one embodiment, the polynucleotides, primary constructs, and/or the mmRNA of the present invention can be formulated for controlled release and/or targeted delivery. As used herein, "controlled release" refers to a pharmaceutical composition or compound release profile that conforms to a particular pattern of release to effect a therapeutic outcome. In one embodiment, the polynucleotides, primary constructs or the mmRNA may be encapsulated into a delivery agent described herein and/or known in the art for controlled release and/or targeted delivery. As used herein, the term "encapsulate" means to enclose, surround or encase. As it relates to the formulation of the compounds of the invention, encapsulation may be substantial, complete or partial. The term
"substantially encapsulated" means that at least greater than 50, 60, 70, 80, 85, 90, 95, 96, 97, 98, 99, 99.9, 99.9 or greater than 99.999% of the pharmaceutical composition or compound of the invention may be enclosed, surrounded or encased within the delivery agent. "Partially encapsulation" means that less than 10, 10, 20, 30, 40 50 or less of the pharmaceutical composition or compound of the invention may be enclosed, surrounded or encased within the delivery agent. Advantageously, encapsulation may be determined by measuring the escape or the activity of the pharmaceutical composition or compound of the invention using fluorescence and/or electron micrograph. For example, at least 1, 5, 10, 20, 30, 40, 50, 60, 70, 80, 85, 90, 95, 96, 97, 98, 99, 99.9, 99.99 or greater than 99.99% of the pharmaceutical composition or compound of the invention are
encapsulated in the delivery agent. [00273] In another embodiment, the polynucleotides, primary constructs, or the mmRNA may be encapsulated into a lipid nanoparticle or a rapidly eliminating lipid nanoparticle and the lipid nanoparticles or a rapidly eliminating lipid nanoparticle may then be encapsulated into a polymer, hydrogel and/or surgical sealant described herein and/or known in the art. As a non-limiting example, the polymer, hydrogel or surgical sealant may be PLGA, ethylene vinyl acetate (EVAc), poloxamer, GELSITE®
(Nanotherapeutics, Inc. Alachua, FL), HYLENEX® (Halozyme Therapeutics, San Diego CA), surgical sealants such as fibrinogen polymers (Ethicon Inc. Cornelia, GA), TISSELL® (Baxter International, Inc Deerfield, IL), PEG-based sealants, and COSEAL® (Baxter International, Inc Deerfield, IL).
[00274] In one embodiment, the lipid nanoparticle may be encapsulated into any polymer or hydrogel known in the art which may form a gel when injected into a subject. As another non-limiting example, the lipid nanoparticle may be encapsulated into a polymer matrix which may be biodegradable.
[00275] In one embodiment, the polynucleotide, primary construct, or mmRNA formulation for controlled release and/or targeted delivery may also include at least one controlled release coating. Controlled release coatings include, but are not limited to, OPADRY®, polyvinylpyrrolidone/vinyl acetate copolymer, polyvinylpyrrolidone, hydroxypropyl methylcellulose, hydroxypropyl cellulose, hydroxyethyl cellulose, EUDRAGIT RL®, EUDRAGIT RS® and cellulose derivatives such as ethylcellulose aqueous dispersions (AQUACOAT® and SURELEASE®).
[00276] In one embodiment, the controlled release and/or targeted delivery formulation may comprise at least one degradable polyester which may contain polycationic side chains. Degradable polyesters include, but are not limited to, poly(serine ester), poly(L- lactide-co-L-lysine), poly(4-hydroxy-L-proline ester), and combinations thereof. In another embodiment, the degradable polyesters may include a PEG conjugation to form a PEGylated polymer.
[00277] In one embodiment, the polynucleotides, primary constructs, and/or the mmRNA of the present invention may be encapsulated in a therapeutic nanoparticle. Therapeutic nanoparticles may be formulated by methods described herein and known in the art such as, but not limited to, International Pub Nos. WO2010005740,
WO2010030763, WO2010005721, WO2010005723, WO2012054923, US Pub. Nos. US201 10262491, US20100104645, US20100087337, US20100068285,
US201 10274759, US20100068286, and US Pat No. 8,206,747; each of which is herein incorporated by reference in their entirety. In another embodiment, therapeutic polymer nanoparticles may be identified by the methods described in US Pub No.
US20120140790, herein incorporated by reference in its entirety.
[00278] In one embodiment, the therapeutic nanoparticle of may be formulated for sustained release. As used herein, "sustained release" refers to a pharmaceutical composition or compound that conforms to a release rate over a specific period of time. The period of time may include, but is not limited to, hours, days, weeks, months and years. As a non-limiting example, the sustained release nanoparticle may comprise a polymer and a therapeutic agent such as, but not limited to, the polynucleotides, primary constructs, and mmRNA of the present invention (see International Pub No. 2010075072 and US Pub No. US20100216804 and US201 10217377, each of which is herein incorporated by reference in their entirety).
[00279] In one embodiment, the therapeutic nanoparticles may be formulated to be target specific. As a non-limiting example, the therapeutic nanoparticles may include a corticosteroid (see International Pub. No. WO2011084518). In one embodiment, the therapeutic nanoparticles may be formulated to be cancer specific. As a non-limiting example, the therapeutic nanoparticles may be formulated in nanoparticles described in International Pub No. WO2008121949, WO2010005726, WO2010005725,
WO2011084521 and US Pub No. US20100069426, US20120004293 and
US20100104655, each of which is herein incorporated by reference in their entirety.
[00280] In one embodiment, the nanoparticles of the present invention may comprise a polymeric matrix. As a non-limiting example, the nanoparticle may comprise two or more polymers such as, but not limited to, polyethylenes, polycarbonates,
polyanhydrides, polyhydroxyacids, polypropylfumerates, polycaprolactones, polyamides, polyacetals, polyethers, polyesters, poly(orthoesters), polycyanoacrylates, polyvinyl alcohols, polyurethanes, polyphosphazenes, polyacrylates, polymethacrylates, polycyanoacrylates, polyureas, polystyrenes, polyamines, polylysine, poly(ethylene imine), poly(serine ester), poly(L-lactide-co-L-lysine), poly(4-hydroxy-L-proline ester) or combinations thereof.
[00281] In one embodiment, the diblock copolymer may include PEG in combination with a polymer such as, but not limited to, polyethylenes, polycarbonates,
polyanhydrides, polyhydroxyacids, polypropylfumerates, polycaprolactones, polyamides, polyacetals, polyethers, polyesters, poly(orthoesters), polycyanoacrylates, polyvinyl alcohols, polyurethanes, polyphosphazenes, polyacrylates, polymethacrylates, polycyanoacrylates, polyureas, polystyrenes, polyamines, polylysine, poly(ethylene imine), poly(serine ester), poly(L-lactide-co-L-lysine), poly(4-hydroxy-L-proline ester) or combinations thereof.
[00282] In one embodiment, the therapeutic nanoparticle comprises a diblock copolymer. As a non-limiting example the therapeutic nanoparticle comprises a PLGA- PEG block copolymer (see US Pub. No. US20120004293 and US Pat No. 8,236,330, herein incorporated by reference in their entireties). In another non-limiting example, the therapeutic nanoparticle is a stealth nanoparticle comprising a diblock copolymer of PEG and PLA or PEG and PLGA (see US Pat No 8,246,968, each of which is herein incorporated by reference in its entirety).
[00283] In one embodiment, the therapeutic nanoparticle may comprise at least one acrylic polymer. Acrylic polymers include but are not limited to, acrylic acid, methacrylic acid, acrylic acid and methacrylic acid copolymers, methyl methacrylate copolymers, ethoxyethyl methacrylates, cyanoethyl methacrylate, amino alkyl methacrylate copolymer, poly(acrylic acid), poly(methacrylic acid), polycyanoacrylates and combinations thereof.
[00284] In one embodiment, the therapeutic nanoparticles may comprise at least one cationic polymer described herein and/or known in the art.
[00285] In one embodiment, the therapeutic nanoparticles may comprise at least one amine-containing polymer such as, but not limited to polylysine, polyethylene imine, poly(amidoamine) dendrimers and combinations thereof.
[00286] In one embodiment, the therapeutic nanoparticles may comprise at least one degradable polyester which may contain polycationic side chains. Degradable polyesters include, but are not limited to, poly(serine ester), poly(L-lactide-co-L-lysine), poly(4- hydroxy-L-proline ester), and combinations thereof. In another embodiment, the degradable polyesters may include a PEG conjugation to form a PEGylated polymer.
[00287] In another embodiment, the therapeutic nanoparticle may include a conjugation of at least one targeting ligand.
[00288] In one embodiment, the therapeutic nanoparticle may be formulated in an aqueous solution which may be used to target cancer (see International Pub No.
WO201 1084513 and US Pub No. US201 10294717, each of which is herein incorporated by reference in their entirety).
[00289] In one embodiment, the polynucleotides, primary constructs, or mmRNA may be encapsulated in, linked to and/or associated with synthetic nanocarriers. The synthetic nanocarriers may be formulated using methods known in the art and/or described herein. As a non-limiting example, the synthetic nanocarriers may be formulated by the methods described in International Pub Nos. WO2010005740, WO2010030763 and US Pub. Nos. US20110262491, US20100104645 and US20100087337, each of which is herein incorporated by reference in their entirety. In another embodiment, the synthetic nanocarrier formulations may be lyophilized by methods described in International Pub. No. WO2011072218 and US Pat No. 8,21 1,473; each of which is herein incorporated by reference in their entireties.
[00290] In one embodiment, the synthetic nanocarriers may contain reactive groups to release the polynucleotides, primary constructs and/or mmRNA described herein (see International Pub. No. WO20120952552 and US Pub No. US20120171229, each of which is herein incorporated by reference in their entirety).
[00291] In one embodiment, the synthetic nanocarriers may contain an
immunostimulatory agent to enhance the immune response from delivery of the synthetic nanocarrier. As a non-limiting example, the synthetic nanocarrier may comprise a Thl immunostimulatory agent which may enhance a Thl -based response of the immune system (see International Pub No. WO2010123569 and US Pub. No. US20110223201, each of which is herein incorporated by reference in its entirety).
[00292] In one embodiment, the synthetic nanocarriers may be formulated for targeted release. In one embodiment, the synthetic nanocarrier is formulated to release the polynucleotides, primary constructs and/or mmRNA at a specified pH and/or after a desired time interval. As a non-limiting example, the synthetic nanoparticle may be formulated to release the polynucleotides, primary constructs and/or mmRNA after 24 hours and/or at a pH of 4.5 (see International Pub. Nos. WO2010138193 and
WO2010138194 and US Pub Nos. US201 10020388 and US20110027217, each of which is herein incorporated by reference in their entireties).
[00293] In one embodiment, the synthetic nanocarriers may be formulated for controlled and/or sustained release of the polynucleotides, primary constructs and/or mmRNA described herein. As a non-limiting example, the synthetic nanocarriers for sustained release may be formulated by methods known in the art, described herein and/or as described in International Pub No. WO2010138192 and US Pub No. 20100303850, each of which is herein incorporated by reference in their entireties.
[00294] Polymers, Biodegradable Nanoparticles, and Core-Shell Nanoparticles [00295] The polynucleotide, primary construct, and mmRNA of the invention can be formulated using natural and/or synthetic polymers. Non-limiting examples of polymers which may be used for delivery include, but are not limited to, Dynamic
POLYCONJUGATE™ formulations from MIRUS® Bio (Madison, WI) and Roche Madison (Madison, WI), PHASERX™ polymer formulations such as, without limitation, SMARTT POLYMER TECHNOLOGY™ (Seattle, WA), DMRLDOPE, poloxamer, VAXFECTIN® adjuvant from Vical (San Diego, CA), chitosan, cyclodextrin from Calando Pharmaceuticals (Pasadena, CA), dendrimers and poly(lactic-co-glycolic acid) (PLGA) polymers. RONDEL™ (RNAi/Oligonucleotide Nanoparticle Delivery) polymers (Arrowhead Research Corporation, Pasadena, CA) and pH responsive co-block polymers such as, but not limited to, PHASERX™ (Seattle, WA).
[00296] A non-limiting example of PLGA formulations include, but are not limited to, PLGA injectable depots (e.g., ELIGARD® which is formed by dissolving PLGA in 66% N-methyl-2-pyrrolidone (NMP) and the remainder being aqueous solvent and leuprolide. Once injected, the PLGA and leuprolide peptide precipitates into the subcutaneous space).
[00297] Many of these polymer approaches have demonstrated efficacy in delivering oligonucleotides in vivo into the cell cytoplasm (reviewed in deFougerolles Hum Gene Ther. 2008 19: 125-132; herein incorporated by reference in its entirety). Two polymer approaches that have yielded robust in vivo delivery of nucleic acids, in this case with small interfering RNA (siRNA), are dynamic polyconjugates and cyclodextrin-based nanoparticles. The first of these delivery approaches uses dynamic polyconjugates and has been shown in vivo in mice to effectively deliver siRNA and silence endogenous target mRNA in hepatocytes (Rozema et al, Proc Natl Acad Sci U S A. 2007 104: 12982- 12887). This particular approach is a multicomponent polymer system whose key features include a membrane-active polymer to which nucleic acid, in this case siRNA, is covalently coupled via a disulfide bond and where both PEG (for charge masking) and N- acetylgalactosamine (for hepatocyte targeting) groups are linked via pH-sensitive bonds (Rozema et al, Proc Natl Acad Sci U S A. 2007 104: 12982-12887). On binding to the hepatocyte and entry into the endosome, the polymer complex disassembles in the low- pH environment, with the polymer exposing its positive charge, leading to endosomal escape and cytoplasmic release of the siRNA from the polymer. Through replacement of the N-acetylgalactosamine group with a mannose group, it was shown one could alter targeting from asialoglycoprotein receptor-expressing hepatocytes to sinusoidal endothelium and Kupffer cells. Another polymer approach involves using transferrin- targeted cyclodextrin-containing polycation nanoparticles. These nanoparticles have demonstrated targeted silencing of the EWS-FLI1 gene product in transferrin receptor- expressing Ewing's sarcoma tumor cells (Hu-Lieskovan et ah, Cancer Res.2005 65: 8984-8982) and siRNA formulated in these nanoparticles was well tolerated in non- human primates (Heidel et ah, Proc Natl Acad Sci USA 2007 104:5715-21). Both of these delivery strategies incorporate rational approaches using both targeted delivery and endosomal escape mechanisms.
[00298] The polymer formulation can permit the sustained or delayed release of the polynucleotide, primary construct, or mmRNA (e.g., following intramuscular or subcutaneous injection). The altered release profile for the polynucleotide, primary construct, or mmRNA can result in, for example, translation of an encoded protein over an extended period of time. The polymer formulation may also be used to increase the stability of the polynucleotide, primary construct, or mmRNA. Biodegradable polymers have been previously used to protect nucleic acids other than mmRNA from degradation and been shown to result in sustained release of payloads in vivo (Rozema et al., Proc Natl Acad Sci U S A. 2007 104: 12982-12887; Sullivan et al, Expert Opin Drug Deliv. 2010 7: 1433-1446; Convertine et al, Biomacromolecules. 2010 Oct 1 ; Chu et al., Acc Chem Res. 2012 Jan 13; Manganiello et al, Biomaterials. 2012 33 :2301-2309; Benoit et al, Biomacromolecules. 201 1 12:2708-2714; Singha et al, Nucleic Acid Ther. 2011 2: 133-147; deFougerolles Hum Gene Ther. 2008 19: 125-132; Schaffert and Wagner, Gene Ther. 2008 16: 1 131-1 138; Chaturvedi et al, Expert Opin Drug Deliv. 2011 8: 1455- 1468; Davis, Mol Pharm. 2009 6:659-668; Davis, Nature 2010 464: 1067-1070; each of which is herein incorporated by reference in its entirety).
[00299] In one embodiment, the pharmaceutical compositions may be sustained release formulations. In a further embodiment, the sustained release formulations may be for subcutaneous delivery. Sustained release formulations may include, but are not limited to, PLGA microspheres, ethylene vinyl acetate (EVAc), poloxamer, GELSITE®
(Nanotherapeutics, Inc. Alachua, FL), HYLENEX® (Halozyme Therapeutics, San Diego CA), surgical sealants such as fibrinogen polymers (Ethicon Inc. Cornelia, GA), TISSELL® (Baxter International, Inc Deerfield, IL), PEG-based sealants, and COSEAL® (Baxter International, Inc Deerfield, IL).
[00300] As a non-limiting example modified mRNA may be formulated in PLGA microspheres by preparing the PLGA microspheres with tunable release rates (e.g., days and weeks) and encapsulating the modified mRNA in the PLGA microspheres while maintaining the integrity of the modified mRNA during the encapsulation process. EVAc are non-biodegradable, biocompatible polymers which are used extensively in pre-clinical sustained release implant applications (e.g., extended release products Ocusert a pilocarpine ophthalmic insert for glaucoma or progestasert a sustained release progesterone intrauterine device; transdermal delivery systems Testoderm, Duragesic and Selegiline; catheters). Poloxamer F-407 NF is a hydrophilic, non-ionic surfactant triblock copolymer of poly oxyethylene-polyoxypropylene-polyoxy ethylene having a low viscosity at temperatures less than 5°C and forms a solid gel at temperatures greater than 15°C. PEG-based surgical sealants comprise two synthetic PEG components mixed in a delivery device which can be prepared in one minute, seals in 3 minutes and is reabsorbed within 30 days. GELSITE® and natural polymers are capable of in-situ gelation at the site of administration. They have been shown to interact with protein and peptide therapeutic candidates through ionic interaction to provide a stabilizing effect.
[00301] Polymer formulations can also be selectively targeted through expression of different ligands as exemplified by, but not limited by, folate, transferrin, and N- acetylgalactosamine (GalNAc) (Benoit et al, Biomacromolecules. 201 1 12:2708-2714; Rozema et al, Proc Natl Acad Sci U S A. 2007 104: 12982-12887; Davis, Mol Pharm. 2009 6:659-668; Davis, Nature 2010 464: 1067-1070; each of which is herein
incorporated by reference in its entirety).
[00302] The polynucleotides, primary constructs and/or mmRNA of the invention may be formulated with or in a polymeric compound. The polymer may include at least one polymer such as, but not limited to, polyethenes, polyethylene glycol (PEG), poly(l- lysine)(PLL), PEG grafted to PLL, cationic lipopolymer, biodegradable cationic lipopolymer, polyethyleneimine (PEI), cross-linked branched poly(alkylene imines), a polyamine derivative, a modified poloxamer, a biodegradable polymer, biodegradable block copolymer, biodegradable random copolymer, biodegradable polyester copolymer, biodegradable polyester block copolymer, biodegradable polyester block random copolymer, linear biodegradable copolymer, poly[a-(4-aminobutyl)-L-glycolic acid) (PAGA), biodegradable cross-linked cationic multi-block copolymers, polycarbonates, polyanhydrides, polyhydroxyacids, polypropylfumerates, polycaprolactones, polyamides, polyacetals, polyethers, polyesters, poly(orthoesters), polycyanoacrylates, polyvinyl alcohols, polyurethanes, polyphosphazenes, polyacrylates, polymethacrylates, polycyanoacrylates, polyureas, polystyrenes, polyamines, polylysine, poly(ethylene imine), poly(serine ester), poly(L-lactide-co-L-lysine), poly(4-hydroxy-L-proline ester), acrylic polymers, amine-containing polymers or combinations thereof .
[00303] As a non-limiting example, the polynucleotides, primary constructs and/or mmRNA of the invention may be formulated with the polymeric compound of PEG grafted with PLL as described in U.S. Pat. No. 6,177,274 herein incorporated by reference in its entirety. The formulation may be used for transfecting cells in vitro or for in vivo delivery of the polynucleotides, primary constructs and/or mmRNA. In another example, the polynucleotides, primary constructs and/or mmRNA may be suspended in a solution or medium with a cationic polymer, in a dry pharmaceutical composition or in a solution that is capable of being dried as described in U.S. Pub. Nos. 20090042829 and 20090042825 each of which are herein incorporated by reference in their entireties.
[00304] As another non-limiting example the polynucleotides, primary constructs or mmRNA of the invention may be formulated with a PLGA-PEG block copolymer (see US Pub. No. US20120004293 and US Pat No. 8,236,330, each of which is herein incorporated by reference in their entireties). As a non-limiting example, the
polynucleotides, primary constructs or mmRNA of the invention may be formulated with a diblock copolymer of PEG and PLA or PEG and PLGA (see US Pat No 8,246,968, herein incorporated by reference in its entirety).
[00305] A polyamine derivative may be used to deliver nucleic acids or to treat and/or prevent a disease or to be included in an implantable or injectable device (U.S. Pub. No. 20100260817 herein incorporated by reference in its entirety). As a non-limiting example, a pharmaceutical composition may include the modified nucleic acids and mmRNA and the polyamine derivative described in U.S. Pub. No. 20100260817 (the contents of which are incorporated herein by reference in its entirety.
[00306] The polynucleotides, primary constructs or mmRNA of the invention may be formulated with at least one acrylic polymer. Acrylic polymers include but are not limited to, acrylic acid, methacrylic acid, acrylic acid and methacrylic acid copolymers, methyl methacrylate copolymers, ethoxyethyl methacrylates, cyanoethyl methacrylate, amino alkyl methacrylate copolymer, poly(acrylic acid), poly(methacrylic acid), polycyanoacrylates and combinations thereof.
[00307] In one embodiment, the polynucleotides, primary constructs or mmRNA of the present invention may be formulated with at least one polymer described in International Publication Nos. WO20111 15862, WO2012082574 and WO2012068187, each of which is herein incorporated by reference in their entireties. In another embodiment the polynucleotides, primary constructs or mmRNA of the present invention may be formulated with a polymer of formula Z as described in WO2011 115862, herein incorporated by reference in its entirety. In yet another embodiment, the polynucleotides, primary constructs or mmRNA may be formulated with a polymer of formula Z, Z' or Z" as described in WO2012082574 or WO2012068187, each of which are herein incorporated by reference in their entireties. The polymers formulated with the modified RNA of the present invention may be synthesized by the methods described in
WO2012082574 or WO2012068187, each of which is herein incorporated by reference in their entireties.
[00308] Formulations of polynucleotides, primary constructs or mmRNA of the invention may include at least one amine-containing polymer such as, but not limited to polylysine, polyethylene imine, poly(amidoamine) dendrimers or combinations thereof.
[00309] For example, the polynucleotides, primary constructs and/or mmRNA of the invention may be formulated in a pharmaceutical compound including a poly(alkylene imine), a biodegradable cationic lipopolymer, a biodegradable block copolymer, a biodegradable polymer, or a biodegradable random copolymer, a biodegradable polyester block copolymer, a biodegradable polyester polymer, a biodegradable polyester random copolymer, a linear biodegradable copolymer, PAGA, a biodegradable cross-linked cationic multi-block copolymer or combinations thereof. The biodegradable cationic lipopolymer may be made my methods known in the art and/or described in U.S. Pat. No. 6,696,038, U.S. App. Nos. 20030073619 and 20040142474 each of which is herein incorporated by reference in their entireties. The poly(alkylene imine) may be made using methods known in the art and/or as described in U.S. Pub. No. 20100004315, herein incorporated by reference in its entirety. The biodegradable polymer, biodegradable block copolymer, the biodegradable random copolymer, biodegradable polyester block copolymer, biodegradable polyester polymer, or biodegradable polyester random copolymer may be made using methods known in the art and/or as described in U.S. Pat. Nos. 6,517,869 and 6,267,987, the contents of which are each incorporated herein by reference in its entirety. The linear biodegradable copolymer may be made using methods known in the art and/or as described in U.S. Pat. No. 6,652,886. The PAGA polymer may be made using methods known in the art and/or as described in U.S. Pat. Nos. 6,217,912 herein incorporated by reference in its entirety. The PAGA polymer may be copolymerized to form a copolymer or block copolymer with polymers such as but not limited to, poly-L-lysine, polyarginine, polyornithine, histones, avidin, protamines, polylactides and poly(lactide-co-glycolides). The biodegradable cross-linked cationic multi-block copolymers may be made my methods known in the art and/or as described in U.S. Pat. No. 8,057,821 or U.S. Pub. No. 2012009145 each of which is herein incorporated by reference in their entireties. For example, the multi-block copolymers may be synthesized using linear polyethyleneimine (LPEI) blocks which have distinct patterns as compared to branched polyethyleneimines. Further, the composition or pharmaceutical composition may be made by the methods known in the art, described herein, or as described in U.S. Pub. No. 20100004315 or U.S. Pat. Nos. 6,267,987 and 6,217,912 each of which is herein incorporated by reference in their entireties.
[00310] The polynucleotides, primary constructs, and mmRNA of the invention may be formulated with at least one degradable polyester which may contain polycationic side chains. Degradable polyesters include, but are not limited to, poly(serine ester), poly(L- lactide-co-L-lysine), poly(4-hydroxy-L-proline ester), and combinations thereof. In another embodiment, the degradable polyesters may include a PEG conjugation to form a PEGylated polymer.
[00311] In one embodiment, the polymers described herein may be conjugated to a lipid-terminating PEG. As a non-limiting example, PLGA may be conjugated to a lipid- terminating PEG forming PLGA-DSPE-PEG. As another non-limiting example, PEG conjugates for use with the present invention are described in International Publication No. WO2008103276, herein incorporated by reference in its entirety.
[00312] In one embodiment, the polynucleotides, primary constructs and/or mmRNA described herein may be conjugated with another compound. Non-limiting examples of conjugates are described in US Patent Nos. 7,964,578 and 7,833,992, each of which are herein incorporated by reference in their entireties. In another embodiment, , the polynucleotides, primary constructs and/or mmRNA of the present invention may be conjugated with conjugates of formula 1-122 as described in US Patent Nos. 7,964,578 and 7,833,992, each of which are herein incorporated by reference in their entireties.
[00313] As described in U.S. Pub. No. 20100004313, herein incorporated by reference in its entirety, a gene delivery composition may include a nucleotide sequence and a poloxamer. For example, the polynucleotide, primary construct and/or mmRNA of the present invention may be used in a gene delivery composition with the poloxamer described in U.S. Pub. No. 20100004313.
[00314] In one embodiment, the polymer formulation of the present invention may be stabilized by contacting the polymer formulation, which may include a cationic carrier, with a cationic lipopolymer which may be covalently linked to cholesterol and polyethylene glycol groups. The polymer formulation may be contacted with a cationic lipopolymer using the methods described in U.S. Pub. No. 20090042829 herein incorporated by reference in its entirety. The cationic carrier may include, but is not limited to, polyethylenimine, poly(trimethylenimine), poly(tetramethylenimine), polypropylenimine, aminoglycoside-polyamine, dideoxy-diamino-b-cyclodextrin, spermine, spermidine, poly(2-dimethylamino)ethyl methacrylate, poly(lysine), poly(histidine), poly(arginine), cationized gelatin, dendrimers, chitosan, l,2-Dioleoyl-3- Trimethylammonium-Propane(DOTAP), N-[l-(2,3-dioleoyloxy)propyl]-N,N,N- trimethylammonium chloride (DOTMA), l-[2-(oleoyloxy)ethyl]-2-oleyl-3-(2- hydroxyethyl)imidazolinium chloride (DOTIM), 2,3-dioleyloxy-N- [2(sperminecarboxamido)ethyl]-N,N-dimethyl-l-propanaminium trifluoroacetate (DOSPA), 3B-[N— (N',N'-Dimethylaminoethane)-carbamoyl]Cholesterol Hydrochloride (DC-Cholesterol HCl) diheptadecylamidoglycyl spermidine (DOGS), N,N-distearyl-N,N- dimethylammonium bromide (DDAB), N-(l,2-dimyristyloxyprop-3-yl)-N,N-dimethyl-N- hydroxyethyl ammonium bromide (DMRIE), N,N-dioleyl-N,N-dimethylammonium chloride DODAC) and combinations thereof.
[00315] The polynucleotide, primary construct, and mmRNA of the invention can also be formulated as a nanoparticle using a combination of polymers, lipids, and/or other biodegradable agents, such as, but not limited to, calcium phosphate. Components may be combined in a core-shell, hybrid, and/or layer-by-layer architecture, to allow for fine- tuning of the nanoparticle so to delivery of the polynucleotide, primary construct and mmRNA may be enhanced (Wang et al, Nat Mater. 2006 5:791-796; Fuller et al, Biomaterials. 2008 29: 1526-1532; DeKoker et al, Adv Drug Deliv Rev. 201 1 63:748- 761 ; Endres et al., Biomaterials. 2011 32:7721-7731 ; Su et al., Mol Pharm. 2011 Jun 6;8(3):774-87; herein incorporated by reference in its entirety).
[00316] Biodegradable calcium phosphate nanoparticles in combination with lipids and/or polymers have been shown to deliver polynucleotides, primary constructs and mmRNA in vivo. In one embodiment, a lipid coated calcium phosphate nanoparticle, which may also contain a targeting ligand such as anisamide, may be used to deliver the polynucleotide, primary construct and mmRNA of the present invention. For example, to effectively deliver siRNA in a mouse metastatic lung model a lipid coated calcium phosphate nanoparticle was used (Li et al, J Contr Rel. 2010 142: 416-421; Li et al, J Contr Rel. 2012 158: 108-114; Yang et al., Mol Ther. 2012 20:609-615). This delivery system combines both a targeted nanoparticle and a component to enhance the endosomal escape, calcium phosphate, in order to improve delivery of the siRNA.
[00317] In one embodiment, calcium phosphate with a PEG-polyanion block copolymer may be used to delivery polynucleotides, primary constructs and mmRNA (Kazikawa et al, J Contr Rel. 2004 97:345-356; Kazikawa et al., J Contr Rel. 2006 11 1 :368-370).
[00318] In one embodiment, a PEG-charge-conversional polymer (Pitella et al, Biomaterials. 2011 32:3106-31 14) may be used to form a nanoparticle to deliver the polynucleotides, primary constructs and mmRNA of the present invention. The PEG- charge-conversional polymer may improve upon the PEG-polyanion block copolymers by being cleaved into a polycation at acidic pH, thus enhancing endosomal escape.
[00319] The use of core-shell nanoparticles has additionally focused on a high- throughput approach to synthesize cationic cross-linked nanogel cores and various shells (Siegwart et al, Proc Natl Acad Sci U S A. 2011 108: 12996-13001). The complexation, delivery, and internalization of the polymeric nanoparticles can be precisely controlled by altering the chemical composition in both the core and shell components of the nanoparticle. For example, the core-shell nanoparticles may efficiently deliver siRNA to mouse hepatocytes after they covalently attach cholesterol to the nanoparticle.
[00320] In one embodiment, a hollow lipid core comprising a middle PLGA layer and an outer neutral lipid layer containing PEG may be used to delivery of the polynucleotide, primary construct and mmRNA of the present invention. As a non-limiting example, in mice bearing a luciferase-expressing tumor, it was determined that the lipid-polymer-lipid hybrid nanoparticle significantly suppressed luciferase expression, as compared to a conventional lipoplex (Shi et al, Angew Chem Int Ed. 2011 50:7027-7031).
Peptides and Proteins
[00321] The synthetic polynucleotides and/or synthetic sgRNAs of the invention can be formulated with peptides and/or proteins in order to increase transfection of cells by the polynucleotide, primary construct, or mmRNA. In one embodiment, peptides such as, but not limited to, cell penetrating peptides and proteins and peptides that enable intracellular delivery may be used to deliver pharmaceutical formulations. A non-limiting example of a cell penetrating peptide which may be used with the pharmaceutical formulations of the present invention includes a cell-penetrating peptide sequence attached to polycations that facilitates delivery to the intracellular space, e.g., HIV-derived TAT peptide, penetratins, transportans, or hCT derived cell-penetrating peptides (see, e.g., Caron et al, Mol. Ther. 3(3):310-8 (2001); Langel, Cell-Penetrating Peptides: Processes and
Applications (CRC Press, Boca Raton FL, 2002); El-Andaloussi et al, Curr. Pharm. Des. 1 1(28):3597-611 (2003); and Deshayes et al, Cell. Mol. Life Sci. 62(16): 1839-49 (2005), all of which are incorporated herein by reference). The compositions can also be formulated to include a cell penetrating agent, e.g., liposomes, which enhance delivery of the compositions to the intracellular space, polynucleotides, primary constructs, and mmRNA of the invention may be complexed to peptides and/or proteins such as, but not limited to, peptides and/or proteins from Aileron Therapeutics (Cambridge, MA) and Permeon Biologies (Cambridge, MA) in order to enable intracellular delivery (Cronican et al, ACS Chem. Biol. 2010 5:747-752; McNaughton et al, Proc. Natl. Acad. Sci. USA 2009 106:61 11-61 16; Sawyer, Chem Biol Drug Des. 2009 73:3-6; Verdine and Hilinski, Methods Enzymol. 2012;503 :3-33; all of which are herein incorporated by reference in its entirety).
[00322] In one embodiment, the cell-penetrating polypeptide may comprise a first domain and a second domain. The first domain may comprise a supercharged
polypeptide. The second domain may comprise a protein-binding partner. As used herein, "protein-binding partner" includes, but are not limited to, antibodies and functional fragments thereof, scaffold proteins, or peptides. The cell-penetrating polypeptide may further comprise an intracellular binding partner for the protein-binding partner. The cell- penetrating polypeptide may be capable of being secreted from a cell where the polynucleotide, primary construct, or mmRNA may be introduced.
[00323] Formulations of the including peptides or proteins may be used to increase cell transfection by the polynucleotide, primary construct, or mmRNA, alter the
biodistribution of the polynucleotide, primary construct, or mmRNA (e.g., by targeting specific tissues or cell types), and/or increase the translation of encoded protein.
Cells
[00324] The polynucleotide, primary construct, and mmRNA of the invention can be transfected ex vivo into cells, which are subsequently transplanted into a subject. As non- limiting examples, the pharmaceutical compositions may include red blood cells to deliver modified RNA to liver and myeloid cells, virosomes to deliver modified RNA in virus-like particles (VLPs), and electroporated cells such as, but not limited to, from MAXCYTE® (Gaithersburg, MD) and from ERYTECH® (Lyon, France) to deliver modified RNA. Examples of use of red blood cells, viral particles and electroporated cells to deliver payloads other than mmRNA have been documented (Godfrin et al, Expert Opin Biol Ther. 2012 12: 127-133; Fang et al, Expert Opin Biol Ther. 2012 12:385-389; Hu et al, Proc Natl Acad Sci U S A. 201 1 108: 10980-10985; Lund et al, Pharm Res. 2010 27:400-420; Huckriede et al, J Liposome Res. 2007;17:39-47; Cusi, Hum Vaccin. 2006 2: 1-7; de Jonge et al, Gene Ther. 2006 13 :400-411 ; all ofwhich are herein incorporated by reference in its entirety).
[00325] The polynucleotides, primary constructs and mmRNA may be delivered in synthetic VLPs synthesized by the methods described in International Pub No.
WO2011085231 and US Pub No. 201 10171248, each ofwhich is herein incorporated by reference in their entireties.
[00326] Cell-based formulations of the polynucleotide, primary construct, and mmRNA of the invention may be used to ensure cell transfection (e.g., in the cellular carrier), alter the biodistribution of the polynucleotide, primary construct, or mmRNA (e.g., by targeting the cell carrier to specific tissues or cell types), and/or increase the translation of encoded protein.
[00327] A variety of methods are known in the art and suitable for introduction of nucleic acid into a cell, including viral and non-viral mediated techniques. Examples of typical non-viral mediated techniques include, but are not limited to, electroporation, calcium phosphate mediated transfer, nucleofection, sonoporation, heat shock, magnetofection, liposome mediated transfer, microinjection, microprojectile mediated transfer (nanoparticles), cationic polymer mediated transfer (DEAE-dextran,
polyethylenimine, polyethylene glycol (PEG) and the like) or cell fusion.
[00328] The technique of sonoporation, or cellular sonication, is the use of sound (e.g., ultrasonic frequencies) for modifying the permeability of the cell plasma membrane. Sonoporation methods are known to those in the art and are used to deliver nucleic acids in vivo (Yoon and Park, Expert Opin Drug Deliv. 2010 7:321-330; Postema and Gilja, Curr Pharm Biotechnol. 2007 8:355-361 ; Newman and Bettinger, Gene Ther. 2007 14:465-475; all herein incorporated by reference in their entirety). Sonoporation methods are known in the art and are also taught for example as it relates to bacteria in US Patent Publication 20100196983 and as it relates to other cell types in, for example, US Patent Publication 20100009424, each of which are incorporated herein by reference in their entirety. [00329] Electroporation techniques are also well known in the art and are used to deliver nucleic acids in vivo and clinically (Andre et al, Curr Gene Ther. 2010 10:267- 280; Chiarella et al, Curr Gene Ther. 2010 10:281-286; Hojman, Curr Gene Ther. 2010 10: 128-138; all herein incorporated by reference in their entirety). In one embodiment, polynucleotides, primary constructs or mmRNA may be delivered by electroporation as described in Example 26.
Hyaluronidase
[00330] The intramuscular or subcutaneous localized injection of polynucleotide, primary construct, or mmRNA of the invention can include hyaluronidase, which catalyzes the hydrolysis of hyaluronan. By catalyzing the hydrolysis of hyaluronan, a constituent of the interstitial barrier, hyaluronidase lowers the viscosity of hyaluronan, thereby increasing tissue permeability (Frost, Expert Opin. Drug Deliv. (2007) 4:427-440; herein incorporated by reference in its entirety). It is useful to speed their dispersion and systemic distribution of encoded proteins produced by transfected cells. Alternatively, the hyaluronidase can be used to increase the number of cells exposed to a
polynucleotide, primary construct, or mmRNA of the invention administered
intramuscularly or subcutaneously.
Nanoparticle Mimics
[00331] The polynucleotide, primary construct or mmRNA of the invention may be encapsulated within and/or absorbed to a nanoparticle mimic. A nanoparticle mimic can mimic the delivery function organisms or particles such as, but not limited to, pathogens, viruses, bacteria, fungus, parasites, prions and cells. As a non-limiting example the polynucleotide, primary construct or mmRNA of the invention may be encapsulated in a non-viron particle which can mimic the delivery function of a virus (see International Pub. No. WO2012006376 herein incorporated by reference in its entirety).
Nanotubes
[00332] The polynucleotides, primary constructs or mmRNA of the invention can be attached or otherwise bound to at least one nanotube such as, but not limited to, rosette nanotubes, rosette nanotubes having twin bases with a linker, carbon nanotubes and/or single-walled carbon nanotubes, The polynucleotides, primary constructs or mmRNA may be bound to the nanotubes through forces such as, but not limited to, steric, ionic, covalent and/or other forces. [00333] In one embodiment, the nanotube can release one or more polynucleotides, primary constructs or mmRNA into cells. The size and/or the surface structure of at least one nanotube may be altered so as to govern the interaction of the nanotubes within the body and/or to attach or bind to the polynucleotides, primary constructs or mmRNA disclosed herein. In one embodiment, the building block and/or the functional groups attached to the building block of the at least one nanotube may be altered to adjust the dimensions and/or properties of the nanotube. As a non-limiting example, the length of the nanotubes may be altered to hinder the nanotubes from passing through the holes in the walls of normal blood vessels but still small enough to pass through the larger holes in the blood vessels of tumor tissue.
[00334] In one embodiment, at least one nanotube may also be coated with delivery enhancing compounds including polymers, such as, but not limited to, polyethylene glycol. In another embodiment, at least one nanotube and/or the polynucleotides, primary constructs or mmRNA may be mixed with pharmaceutically acceptable excipients and/or delivery vehicles.
[00335] In one embodiment, the polynucleotides, primary constructs or mmRNA are attached and/or otherwise bound to at least one rosette nanotube. The rosette nanotubes may be formed by a process known in the art and/or by the process described in
International Publication No. WO2012094304, herein incorporated by reference in its entirety. At least one polynucleotide, primary construct and/or mmRNA may be attached and/or otherwise bound to at least one rosette nanotube by a process as described in International Publication No. WO2012094304, herein incorporated by reference in its entirety, where rosette nanotubes or modules forming rosette nanotubes are mixed in aqueous media with at least one polynucleotide, primary construct and/or mmRNA under conditions which may cause at least one polynucleotide, primary construct or mmRNA to attach or otherwise bind to the rosette nanotubes.
Conjugates
[00336] The polynucleotides, primary constructs, and mmRNA of the invention include conjugates, such as a polynucleotide, primary construct, or mmRNA covalently linked to a carrier or targeting group, or including two encoding regions that together produce a fusion protein (e.g., bearing a targeting group and therapeutic protein or peptide).
[00337] The conjugates of the invention include a naturally occurring substance, such as a protein (e.g., human serum albumin (HSA), low-density lipoprotein (LDL), high- density lipoprotein (HDL), or globulin); an carbohydrate (e.g., a dextran, pullulan, chitin, chitosan, inulin, cyclodextrin or hyaluronic acid); or a lipid. The ligand may also be a recombinant or synthetic molecule, such as a synthetic polymer, e.g., a synthetic polyamino acid, an oligonucleotide (e.g. an aptamer). Examples of polyamino acids include polyamino acid is a polylysine (PLL), poly L-aspartic acid, poly L-glutamic acid, styrene-maleic acid anhydride copolymer, poly(L-lactide-co-glycolied) copolymer, divinyl ether-maleic anhydride copolymer, N-(2-hydroxypropyl)methacrylamide copolymer (HMPA), polyethylene glycol (PEG), polyvinyl alcohol (PVA), polyurethane, poly(2-ethylacryllic acid), N-isopropylacrylamide polymers, or polyphosphazine.
Example of polyamines include: polyethylenimine, polylysine (PLL), spermine, spermidine, polyamine, pseudopeptide-polyamine, peptidomimetic polyamine, dendrimer polyamine, arginine, amidine, protamine, cationic lipid, cationic porphyrin, quaternary salt of a polyamine, or an alpha helical peptide.
[00338] Representative U.S. patents that teach the preparation of polynucleotide conjugates, particularly to R A, include, but are not limited to, U.S. Pat. Nos. 4,828,979;
4,948,882 5,218, 105 5,525,465 5,541,313 5,545,730 5,552,538 5,578,717, 5,580,731 5,591,584 5, 109, 124 5, 118,802 5, 138,045 5,414,077 5,486,603 5,512,439 5,578,718 5,608,046 4,587,044 4,605,735 4,667,025 4,762,779 4,789,737 4,824,941 4,835,263 4,876,335 4,904,582 4,958,013 5,082,830 5, 112,963 5,214,136 5,082,830 5, 1 12,963
5,214, 136; 5,245,022 5,254,469; 5,258,506 5,262,536 5,272,250 5,292,873 5,317,098 5,371,241, 5,391,723 5,416,203, 5,451,463; 5,510,475 5,512,667; 5,514,785 5,565,552;
5,567,810; 5,574, 142; 5,585,481 ; 5,587,371 ; 5,595,726; 5,597,696; 5,599,923; 5,599,928 and 5,688,941; 6,294,664; 6,320,017; 6,576,752; 6,783,931 ; 6,900,297; 7,037,646; each of which is herein incorporated by reference in their entireties.
[00339] In one embodiment, the conjugate of the present invention may function as a carrier for the polynucleotides, primary constructs and/or mmRNA of the present invention. The conjugate may comprise a cationic polymer such as, but not limited to, polyamine, polylysine, polyalkylenimine, and polyethylenimine which may be grafted to with poly(ethylene glycol). As a non-limiting example, the conjugate may be similar to the polymeric conjugate and the method of synthesizing the polymeric conjugate described in U.S. Pat. No. 6,586,524 herein incorporated by reference in its entirety.
[00340] The conjugates can also include targeting groups, e.g., a cell or tissue targeting agent, e.g., a lectin, glycoprotein, lipid or protein, e.g., an antibody, that binds to a specified cell type such as a kidney cell. A targeting group can be a thyrotropin, melanotropin, lectin, glycoprotein, surfactant protein A, Mucin carbohydrate, multivalent lactose, multivalent galactose, N-acetyl-galactosamine, N-acetyl-gulucosamine multivalent mannose, multivalent fucose, glycosylated polyaminoacids, multivalent galactose, transferrin, bisphosphonate, polyglutamate, polyaspartate, a lipid, cholesterol, a steroid, bile acid, folate, vitamin B 12, biotin, an RGD peptide, an RGD peptide mimetic or an aptamer.
[00341] Targeting groups can be proteins, e.g., glycoproteins, or peptides, e.g., molecules having a specific affinity for a co-ligand, or antibodies e.g., an antibody, that binds to a specified cell type such as a cancer cell, endothelial cell, or bone cell. Targeting groups may also include hormones and hormone receptors. They can also include non- peptidic species, such as lipids, lectins, carbohydrates, vitamins, cofactors, multivalent lactose, multivalent galactose, N-acetyl-galactosamine, N-acetyl-gulucosamine multivalent mannose, multivalent fucose, or aptamers. The ligand can be, for example, a lipopolysaccharide, or an activator of p38 MAP kinase.
[00342] The targeting group can be any ligand that is capable of targeting a specific receptor. Examples include, without limitation, folate, GalNAc, galactose, mannose, mannose-6P, apatamers, integrin receptor ligands, chemokine receptor ligands, transferrin, biotin, serotonin receptor ligands, PSMA, endothelin, GCPII, somatostatin, LDL, and HDL ligands. In particular embodiments, the targeting group is an aptamer. The aptamer can be unmodified or have any combination of modifications disclosed herein.
[00343] In one embodiment, pharmaceutical compositions of the present invention may include chemical modifications such as, but not limited to, modifications similar to locked nucleic acids.
[00344] Representative U.S. Patents that teach the preparation of locked nucleic acid (LNA) such as those from Santaris, include, but are not limited to, the following: U.S. Pat. Nos. 6,268,490; 6,670,461; 6,794,499; 6,998,484; 7,053,207; 7,084, 125; and 7,399,845, each of which is herein incorporated by reference in its entirety.
[00345] Representative U.S. patents that teach the preparation of PNA compounds include, but are not limited to, U.S. Pat. Nos. 5,539,082; 5,714,331 ; and 5,719,262, each of which is herein incorporated by reference. Further teaching of PNA compounds can be found, for example, in Nielsen et al., Science, 1991, 254, 1497-1500.
[00346] Some embodiments featured in the invention include polynucleotides, primary constructs or mmRNA with phosphorothioate backbones and oligonucleosides with other modified backbones, and in particular -CH2-NH-CH2-, -CH2-N(CH3)-0-CH2- [known as a methylene (methylimino) or MMI backbone],— CH2— O— N(CH3)— CH2— ,— CH2-N(CH3)-N(CH3)--CH2- and -N(CH3)-CH2-CH2-[wherein the native phosphodiester backbone is represented as— O— P(0)2— O— CH2~] of the above- referenced U.S. Pat. No. 5,489,677, and the amide backbones of the above-referenced U.S. Pat. No. 5,602,240. In some embodiments, the polynucleotides featured herein have morpholino backbone structures of the above-referenced U.S. Pat. No. 5,034,506.
[00347] Modifications at the 2' position may also aid in delivery. Preferably, modifications at the 2' position are not located in a polypeptide-coding sequence, i.e., not in a translatable region. Modifications at the 2' position may be located in a 5'UTR, a 3'UTR and/or a tailing region. Modifications at the 2' position can include one of the following at the 2' position: H (i.e., 2'-deoxy); F; 0-, S-, or N-alkyl; 0-, S-, or N-alkenyl; 0-, S- or N-alkynyl; or O-alkyl-O-alkyl, wherein the alkyl, alkenyl and alkynyl may be substituted or unsubstituted Ci to C10 alkyl or C2 to C10 alkenyl and alkynyl. Exemplary suitable modifications include 0[(CH2)nO] mCH3, 0(CH2).nOCH3, 0(CH2)nNH2, 0(CH2) nCH3, 0(CH2)nONH2, and 0(CH2)nON[(CH2)nCH3)]2, where n and m are from 1 to about 10. In other embodiments, the polynucleotides, primary constructs or mmRNA include one of the following at the 2' position: Ci to C10 lower alkyl, substituted lower alkyl, alkaryl, aralkyl, O-alkaryl or O-aralkyl, SH, SCH3, OCN, CI, Br, CN, CF3, OCF3, SOCH3, S02CH3, ON02, N02, N3, NH2, heterocycloalkyl, heterocycloalkaryl, aminoalkylamino, polyalkylamino, substituted silyl, an RNA cleaving group, a reporter group, an intercalator, a group for improving the pharmacokinetic properties, or a group for improving the pharmacodynamic properties, and other substituents having similar properties. In some embodiments, the modification includes a 2'-methoxyethoxy (2'-0— CH2CH2OCH3, also known as 2'-0-(2-methoxyethyl) or 2'-MOE) (Martin et ah, Helv. Chim. Acta, 1995, 78:486-504) i.e., an alkoxy-alkoxy group. Another exemplary modification is 2'-dimethylaminooxyethoxy, i.e., a 0(CH2)2ON(CH3)2 group, also known as 2'-DMAOE, as described in examples herein below, and 2'- dimethylaminoethoxyethoxy (also known in the art as 2'-0-dimethylaminoethoxyethyl or 2'-DMAEOE), i.e., 2'-0-CH2-0-CH2-N(CH2)2, also described in examples herein below. Other modifications include 2'-methoxy (2'-OCH3), 2'-aminopropoxy (2'- OCH2CH2CH2NH2) and 2'-fluoro (2'-F). Similar modifications may also be made at other positions, particularly the 3' position of the sugar on the 3' terminal nucleotide or in 2'-5' linked dsRNAs and the 5' position of 5' terminal nucleotide. Polynucleotides of the invention may also have sugar mimetics such as cyclobutyl moieties in place of the pentofuranosyl sugar. Representative U.S. patents that teach the preparation of such modified sugar structures include, but are not limited to, U.S. Pat. Nos. 4,981,957;
5,1 18,800; 5,319,080; 5,359,044; 5,393,878; 5,446,137; 5,466,786; 5,514,785; 5,519, 134; 5,567,81 1; 5,576,427; 5,591,722; 5,597,909; 5,610,300; 5,627,053; 5,639,873; 5,646,265; 5,658,873; 5,670,633; and 5,700,920 and each of which is herein incorporated by reference.
[00348] In still other embodiments, the polynucleotide, primary construct, or mmRNA is covalently conjugated to a cell penetrating polypeptide. The cell-penetrating peptide may also include a signal sequence. The conjugates of the invention can be designed to have increased stability; increased cell transfection; and/or altered the biodistribution (e.g., targeted to specific tissues or cell types).
Self-Assembled Nucleic Acid Nanoparticles
[00349] Self-assembled nanoparticles have a well-defined size which may be precisely controlled as the nucleic acid strands may be easily reprogrammable. For example, the optimal particle size for a cancer-targeting nanodelivery carrier is 20-100 nm as a diameter greater than 20 nm avoids renal clearance and enhances delivery to certain tumors through enhanced permeability and retention effect. Using self-assembled nucleic acid nanoparticles a single uniform population in size and shape having a precisely controlled spatial orientation and density of cancer-targeting ligands for enhanced delivery. As a non-limiting example, oligonucleotide nanoparticles are prepared using programmable self-assembly of short DNA fragments and therapeutic siRNAs. These nanoparticles are molecularly identical with controllable particle size and target ligand location and density. The DNA fragments and siRNAs self-assembled into a one-step reaction to generate DNA/siRNA tetrahedral nanoparticles for targeted in vivo delivery. (Lee et al, Nature Nanotechnology 2012 7:389-393).
Excipients
[00350] Pharmaceutical formulations may additionally comprise a pharmaceutically acceptable excipient, which, as used herein, includes any and all solvents, dispersion media, diluents, or other liquid vehicles, dispersion or suspension aids, surface active agents, isotonic agents, thickening or emulsifying agents, preservatives, solid binders, lubricants and the like, as suited to the particular dosage form desired. Remington's The Science and Practice of Pharmacy, 21st Edition, A. R. Gennaro (Lippincott, Williams & Wilkins, Baltimore, MD, 2006; incorporated herein by reference) discloses various excipients used in formulating pharmaceutical compositions and known techniques for the preparation thereof. Except insofar as any conventional excipient medium is incompatible with a substance or its derivatives, such as by producing any undesirable biological effect or otherwise interacting in a deleterious manner with any other component(s) of the pharmaceutical composition, its use is contemplated to be within the scope of this invention.
[00351] In some embodiments, a pharmaceutically acceptable excipient is at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% pure. In some
embodiments, an excipient is approved for use in humans and for veterinary use. In some embodiments, an excipient is approved by United States Food and Drug Administration. In some embodiments, an excipient is pharmaceutical grade. In some embodiments, an excipient meets the standards of the United States Pharmacopoeia (USP), the European Pharmacopoeia (EP), the British Pharmacopoeia, and/or the International Pharmacopoeia.
[00352] Pharmaceutically acceptable excipients used in the manufacture of
pharmaceutical compositions include, but are not limited to, inert diluents, dispersing and/or granulating agents, surface active agents and/or emulsifiers, disintegrating agents, binding agents, preservatives, buffering agents, lubricating agents, and/or oils. Such excipients may optionally be included in pharmaceutical compositions.
[00353] Exemplary diluents include, but are not limited to, calcium carbonate, sodium carbonate, calcium phosphate, dicalcium phosphate, calcium sulfate, calcium hydrogen phosphate, sodium phosphate lactose, sucrose, cellulose, microcrystalline cellulose, kaolin, mannitol, sorbitol, inositol, sodium chloride, dry starch, cornstarch, powdered sugar, etc., and/or combinations thereof.
[00354] Exemplary granulating and/or dispersing agents include, but are not limited to, potato starch, corn starch, tapioca starch, sodium starch glycolate, clays, alginic acid, guar gum, citrus pulp, agar, bentonite, cellulose and wood products, natural sponge, cation- exchange resins, calcium carbonate, silicates, sodium carbonate, cross-linked polyvinylpyrrolidone) (crospovidone), sodium carboxymethyl starch (sodium starch glycolate), carboxymethyl cellulose, cross-linked sodium carboxymethyl cellulose (croscarmellose), methylcellulose, pregelatinized starch (starch 1500), microcrystalline starch, water insoluble starch, calcium carboxymethyl cellulose, magnesium aluminum silicate (VEEGUM®), sodium lauryl sulfate, quaternary ammonium compounds, etc., and/or combinations thereof. [00355] Exemplary surface active agents and/or emulsifiers include, but are not limited to, natural emulsifiers (e.g. acacia, agar, alginic acid, sodium alginate, tragacanth, chondrux, cholesterol, xanthan, pectin, gelatin, egg yolk, casein, wool fat, cholesterol, wax, and lecithin), colloidal clays (e.g. bentonite [aluminum silicate] and VEEGUM® [magnesium aluminum silicate]), long chain amino acid derivatives, high molecular weight alcohols (e.g. stearyl alcohol, cetyl alcohol, oleyl alcohol, triacetin monostearate, ethylene glycol distearate, glyceryl monostearate, and propylene glycol monostearate, polyvinyl alcohol), carbomers (e.g. carboxy polymethylene, polyacrylic acid, acrylic acid polymer, and carboxyvinyl polymer), carrageenan, cellulosic derivatives (e.g.
carboxymethylcellulose sodium, powdered cellulose, hydroxymethyl cellulose, hydroxypropyl cellulose, hydroxypropyl methylcellulose, methylcellulose), sorbitan fatty acid esters (e.g. polyoxyethylene sorbitan monolaurate [TWEEN®20], polyoxyethylene sorbitan [TWEENn®60], polyoxyethylene sorbitan monooleate [TWEEN®80], sorbitan monopalmitate [SPAN® 40], sorbitan monostearate [Span®60], sorbitan tristearate
[Span®65], glyceryl monooleate, sorbitan monooleate [SPAN®80]), polyoxyethylene esters (e.g. polyoxyethylene monostearate [MYRJ®45], polyoxyethylene hydrogenated castor oil, polyethoxylated castor oil, polyoxymethylene stearate, and SOLUTOL®), sucrose fatty acid esters, polyethylene glycol fatty acid esters (e.g. CREMOPHOR®), polyoxyethylene ethers, (e.g. polyoxyethylene lauryl ether [BRIJ®30]), polyvinylpyrrolidone), diethylene glycol monolaurate, triethanolamine oleate, sodium oleate, potassium oleate, ethyl oleate, oleic acid, ethyl laurate, sodium lauryl sulfate,
PLUORINC®F 68, POLOXAMER® 188, cetrimonium bromide, cetylpyridinium chloride, benzalkonium chloride, docusate sodium, etc. and/or combinations thereof.
[00356] Exemplary binding agents include, but are not limited to, starch (e.g. cornstarch and starch paste); gelatin; sugars (e.g. sucrose, glucose, dextrose, dextrin, molasses, lactose, lactitol, mannitol,); natural and synthetic gums (e.g. acacia, sodium alginate, extract of Irish moss, panwar gum, ghatti gum, mucilage of isapol husks,
carboxymethylcellulose, methylcellulose, ethylcellulose, hydroxyethylcellulose, hydroxypropyl cellulose, hydroxypropyl methylcellulose, microcrystalline cellulose, cellulose acetate, poly(vinyl-pyrrolidone), magnesium aluminum silicate (Veegum®), and larch arabogalactan); alginates; polyethylene oxide; polyethylene glycol; inorganic calcium salts; silicic acid; polymethacrylates; waxes; water; alcohol; etc. ; and
combinations thereof. [00357] Exemplary preservatives may include, but are not limited to, antioxidants, chelating agents, antimicrobial preservatives, antifungal preservatives, alcohol preservatives, acidic preservatives, and/or other preservatives. Exemplary antioxidants include, but are not limited to, alpha tocopherol, ascorbic acid, acorbyl palmitate, butylated hydroxyanisole, butylated hydroxytoluene, monothioglycerol, potassium metabisulfite, propionic acid, propyl gallate, sodium ascorbate, sodium bisulfite, sodium metabisulfite, and/or sodium sulfite. Exemplary chelating agents include
ethylenediaminetetraacetic acid (EDTA), citric acid monohydrate, disodium edetate, dipotassium edetate, edetic acid, fumaric acid, malic acid, phosphoric acid, sodium edetate, tartaric acid, and/or trisodium edetate. Exemplary antimicrobial preservatives include, but are not limited to, benzalkonium chloride, benzethonium chloride, benzyl alcohol, bronopol, cetrimide, cetylpyridinium chloride, chlorhexidine, chlorobutanol, chlorocresol, chloroxylenol, cresol, ethyl alcohol, glycerin, hexetidine, imidurea, phenol, phenoxyethanol, phenylethyl alcohol, phenylmercuric nitrate, propylene glycol, and/or thimerosal. Exemplary antifungal preservatives include, but are not limited to, butyl paraben, methyl paraben, ethyl paraben, propyl paraben, benzoic acid, hydroxybenzoic acid, potassium benzoate, potassium sorbate, sodium benzoate, sodium propionate, and/or sorbic acid. Exemplary alcohol preservatives include, but are not limited to, ethanol, polyethylene glycol, phenol, phenolic compounds, bisphenol, chlorobutanol,
hydroxybenzoate, and/or phenylethyl alcohol. Exemplary acidic preservatives include, but are not limited to, vitamin A, vitamin C, vitamin E, beta-carotene, citric acid, acetic acid, dehydroacetic acid, ascorbic acid, sorbic acid, and/or phytic acid. Other
preservatives include, but are not limited to, tocopherol, tocopherol acetate, deteroxime mesylate, cetrimide, butylated hydroxyanisol (BHA), butylated hydroxytoluened (BHT), ethylenediamine, sodium lauryl sulfate (SLS), sodium lauryl ether sulfate (SLES), sodium bisulfite, sodium metabisulfite, potassium sulfite, potassium metabisulfite, GLYDANT PLUS®, PHENONIP®, methylparaben, GERMALL®115, GERMABEN®II, NEOLONE™, KATHON™, and/or EUXYL®.
[00358] Exemplary buffering agents include, but are not limited to, citrate buffer solutions, acetate buffer solutions, phosphate buffer solutions, ammonium chloride, calcium carbonate, calcium chloride, calcium citrate, calcium glubionate, calcium gluceptate, calcium gluconate, D-gluconic acid, calcium glycerophosphate, calcium lactate, propanoic acid, calcium levulinate, pentanoic acid, dibasic calcium phosphate, phosphoric acid, tribasic calcium phosphate, calcium hydroxide phosphate, potassium acetate, potassium chloride, potassium gluconate, potassium mixtures, dibasic potassium phosphate, monobasic potassium phosphate, potassium phosphate mixtures, sodium acetate, sodium bicarbonate, sodium chloride, sodium citrate, sodium lactate, dibasic sodium phosphate, monobasic sodium phosphate, sodium phosphate mixtures, tromethamine, magnesium hydroxide, aluminum hydroxide, alginic acid, pyrogen-free water, isotonic saline, Ringer's solution, ethyl alcohol, etc., and/or combinations thereof.
[00359] Exemplary lubricating agents include, but are not limited to, magnesium stearate, calcium stearate, stearic acid, silica, talc, malt, glyceryl behanate, hydrogenated vegetable oils, polyethylene glycol, sodium benzoate, sodium acetate, sodium chloride, leucine, magnesium lauryl sulfate, sodium lauryl sulfate, etc., and combinations thereof.
[00360] Exemplary oils include, but are not limited to, almond, apricot kernel, avocado, babassu, bergamot, black current seed, borage, cade, camomile, canola, caraway, carnauba, castor, cinnamon, cocoa butter, coconut, cod liver, coffee, corn, cotton seed, emu, eucalyptus, evening primrose, fish, flaxseed, geraniol, gourd, grape seed, hazel nut, hyssop, isopropyl myristate, jojoba, kukui nut, lavandin, lavender, lemon, litsea cubeba, macademia nut, mallow, mango seed, meadowfoam seed, mink, nutmeg, olive, orange, orange roughy, palm, palm kernel, peach kernel, peanut, poppy seed, pumpkin seed, rapeseed, rice bran, rosemary, safflower, sandalwood, sasquana, savoury, sea buckthorn, sesame, shea butter, silicone, soybean, sunflower, tea tree, thistle, tsubaki, vetiver, walnut, and wheat germ oils. Exemplary oils include, but are not limited to, butyl stearate, caprylic triglyceride, capric triglyceride, cyclomethicone, diethyl sebacate, dimethicone 360, isopropyl myristate, mineral oil, octyldodecanol, oleyl alcohol, silicone oil, and/or combinations thereof.
[00361] Excipients such as cocoa butter and suppository waxes, coloring agents, coating agents, sweetening, flavoring, and/or perfuming agents can be present in the composition, according to the judgment of the formulator.
Delivery
[00362] The present disclosure encompasses the delivery of polynucleotides, primary constructs or mmRNA for any of therapeutic, pharmaceutical, diagnostic or imaging by any appropriate route taking into consideration likely advances in the sciences of drug delivery. Delivery may be naked or formulated. Naked Delivery
[00363] The polynucleotides, primary constructs or mmRNA of the present invention may be delivered to a cell naked. As used herein in, "naked" refers to delivering polynucleotides, primary constructs or mmRNA free from agents which promote transfection. For example, the polynucleotides, primary constructs or mmRNA delivered to the cell may contain no modifications. The naked polynucleotides, primary constructs or mmRNA may be delivered to the cell using routes of administration known in the art and described herein.
Formulated Delivery
[00364] The polynucleotides, primary constructs or mmRNA of the present invention may be formulated, using the methods described herein. The formulations may contain polynucleotides, primary constructs or mmRNA which may be modified and/or unmodified. The formulations may further include, but are not limited to, cell penetration agents, a pharmaceutically acceptable carrier, a delivery agent, a bioerodible or biocompatible polymer, a solvent, and a sustained-release delivery depot. The formulated polynucleotides, primary constructs or mmRNA may be delivered to the cell using routes of administration known in the art and described herein.
[00365] The compositions may also be formulated for direct delivery to an organ or tissue in any of several ways in the art including, but not limited to, direct soaking or bathing, via a catheter, by gels, powder, ointments, creams, gels, lotions, and/or drops, by using substrates such as fabric or biodegradable materials coated or impregnated with the compositions, and the like.
Administration
[00366] The polynucleotides, primary constructs or mmRNA of the present invention may be administered by any route which results in a therapeutically effective outcome. These include, but are not limited to enteral, gastroenteral, epidural, oral, transdermal, epidural (peridural), intracerebral (into the cerebrum), intracerebroventricular (into the cerebral ventricles), epicutaneous (application onto the skin), intradermal, (into the skin itself), subcutaneous (under the skin), nasal administration (through the nose), intravenous (into a vein), intraarterial (into an artery), intramuscular (into a muscle), intracardiac (into the heart), intraosseous infusion (into the bone marrow), intrathecal (into the spinal canal), intraperitoneal, (infusion or injection into the peritoneum), intravesical infusion, intravitreal, (through the eye), intracavernous injection, ( into the base of the penis), intravaginal administration, intrauterine, extra-amniotic administration, transdermal (diffusion through the intact skin for systemic distribution), transmucosal (diffusion through a mucous membrane), insufflation (snorting), sublingual, sublabial, enema, eye drops (onto the conjunctiva), or in ear drops. In specific embodiments, compositions may be administered in a way which allows them cross the blood-brain barrier, vascular barrier, or other epithelial barrier . on-limiting routes of administration for the polynucleotides, primary constructs or mmRNA of the present invention are described below.
Parenteral and Injectible Administration
[00367] Liquid dosage forms for oral and parenteral administration include, but are not limited to, pharmaceutically acceptable emulsions, microemulsions, solutions, suspensions, syrups, and/or elixirs. In addition to active ingredients, liquid dosage forms may comprise inert diluents commonly used in the art such as, for example, water or other solvents, solubilizing agents and emulsifiers such as ethyl alcohol, isopropyl alcohol, ethyl carbonate, ethyl acetate, benzyl alcohol, benzyl benzoate, propylene glycol, 1,3-butylene glycol, dimethylformamide, oils (in particular, cottonseed, groundnut, corn, germ, olive, castor, and sesame oils), glycerol, tetrahydrofurfuryl alcohol, polyethylene glycols and fatty acid esters of sorbitan, and mixtures thereof. Besides inert diluents, oral compositions can include adjuvants such as wetting agents, emulsifying and suspending agents, sweetening, flavoring, and/or perfuming agents. In certain embodiments for parenteral administration, compositions are mixed with solubilizing agents such as CREMOPHOR®, alcohols, oils, modified oils, glycols, polysorbates, cyclodextrins, polymers, and/or combinations thereof.
[00368] Injectable preparations, for example, sterile injectable aqueous or oleaginous suspensions may be formulated according to the known art using suitable dispersing agents, wetting agents, and/or suspending agents. Sterile injectable preparations may be sterile injectable solutions, suspensions, and/or emulsions in nontoxic parenterally acceptable diluents and/or solvents, for example, as a solution in 1,3-butanediol. Among the acceptable vehicles and solvents that may be employed are water, Ringer's solution, U.S. P., and isotonic sodium chloride solution. Sterile, fixed oils are conventionally employed as a solvent or suspending medium. For this purpose any bland fixed oil can be employed including synthetic mono- or diglycerides. Fatty acids such as oleic acid can be used in the preparation of injectables. [00369] Injectable formulations can be sterilized, for example, by filtration through a bacterial-retaining filter, and/or by incorporating sterilizing agents in the form of sterile solid compositions which can be dissolved or dispersed in sterile water or other sterile injectable medium prior to use.
[00370] In order to prolong the effect of an active ingredient, it is often desirable to slow the absorption of the active ingredient from subcutaneous or intramuscular injection. This may be accomplished by the use of a liquid suspension of crystalline or amorphous material with poor water solubility. The rate of absorption of the drug then depends upon its rate of dissolution which, in turn, may depend upon crystal size and crystalline form. Alternatively, delayed absorption of a parenterally administered drug form is
accomplished by dissolving or suspending the drug in an oil vehicle. Injectable depot forms are made by forming microencapsule matrices of the drug in biodegradable polymers such as polylactide-polyglycolide. Depending upon the ratio of drug to polymer and the nature of the particular polymer employed, the rate of drug release can be controlled. Examples of other biodegradable polymers include poly(orthoesters) and poly(anhydrides). Depot injectable formulations are prepared by entrapping the drug in liposomes or microemulsions which are compatible with body tissues.
Rectal and Vaginal Administration
[00371] Compositions for rectal or vaginal administration are typically suppositories which can be prepared by mixing compositions with suitable non-irritating excipients such as cocoa butter, polyethylene glycol or a suppository wax which are solid at ambient temperature but liquid at body temperature and therefore melt in the rectum or vaginal cavity and release the active ingredient.
Oral Administration
[00372] Solid dosage forms for oral administration include capsules, tablets, pills, powders, and granules. In such solid dosage forms, an active ingredient is mixed with at least one inert, pharmaceutically acceptable excipient such as sodium citrate or dicalcium phosphate and/or fillers or extenders (e.g. starches, lactose, sucrose, glucose, mannitol, and silicic acid), binders (e.g. carboxymethylcellulose, alginates, gelatin,
polyvinylpyrrolidinone, sucrose, and acacia), humectants (e.g. glycerol), disintegrating agents (e.g. agar, calcium carbonate, potato or tapioca starch, alginic acid, certain silicates, and sodium carbonate), solution retarding agents (e.g. paraffin), absorption accelerators (e.g. quaternary ammonium compounds), wetting agents (e.g. cetyl alcohol and glycerol monostearate), absorbents (e.g. kaolin and bentonite clay), and lubricants (e.g. talc, calcium stearate, magnesium stearate, solid polyethylene glycols, sodium lauryl sulfate), and mixtures thereof. In the case of capsules, tablets and pills, the dosage form may comprise buffering agents.
Topical or Transdermal Administration
[00373] As described herein, compositions containing the polynucleotides, primary constructs or mmRNA of the invention may be formulated for administration topically. The skin may be an ideal target site for delivery as it is readily accessible. Gene expression may be restricted not only to the skin, potentially avoiding nonspecific toxicity, but also to specific layers and cell types within the skin.
[00374] The site of cutaneous expression of the delivered compositions will depend on the route of nucleic acid delivery. Three routes are commonly considered to deliver polynucleotides, primary constructs or mmRNA to the skin: (i) topical application (e.g. for local/regional treatment and/or cosmetic applications); (ii) intradermal injection (e.g. for local/regional treatment and/or cosmetic applications); and (iii) systemic delivery (e.g. for treatment of dermatologic diseases that affect both cutaneous and extracutaneous regions), polynucleotides, primary constructs or mmRNA can be delivered to the skin by several different approaches known in the art. Most topical delivery approaches have been shown to work for delivery of DNA, such as but not limited to, topical application of non-cationic liposome-DNA complex, cationic liposome-DNA complex, particle- mediated (gene gun), puncture-mediated gene transfections, and viral delivery approaches. After delivery of the nucleic acid, gene products have been detected in a number of different skin cell types, including, but not limited to, basal keratinocytes, sebaceous gland cells, dermal fibroblasts and dermal macrophages.
[00375] In one embodiment, the invention provides for a variety of dressings (e.g., wound dressings) or bandages (e.g., adhesive bandages) for conveniently and/or effectively carrying out methods of the present invention. Typically dressing or bandages may comprise sufficient amounts of pharmaceutical compositions and/or polynucleotides, primary constructs or mmRNA described herein to allow a user to perform multiple treatments of a subject(s).
[00376] In one embodiment, the invention provides for the polynucleotides, primary constructs or mmRNA compositions to be delivered in more than one injection. [00377] In one embodiment, before topical and/or transdermal administration at least one area of tissue, such as skin, may be subjected to a device and/or solution which may increase permeability. In one embodiment, the tissue may be subjected to an abrasion device to increase the permeability of the skin (see U.S. Patent Publication No.
20080275468, herein incorporated by reference in its entirety). In another embodiment, the tissue may be subjected to an ultrasound enhancement device. An ultrasound enhancement device may include, but is not limited to, the devices described in U.S. Publication No. 20040236268 and U.S. Patent Nos. 6,491,657 and 6,234,990; each of which is herein incorporated by reference in their entireties. Methods of enhancing the permeability of tissue are described in U.S. Publication Nos. 20040171980 and
20040236268 and U.S. Pat. No. 6,190,315; each of which are herein incorporated by reference in their entireties.
[00378] In one embodiment, a device may be used to increase permeability of tissue before delivering formulations of the polynucleotides, primary constructs and mmRNA described herein. The permeability of skin may be measured by methods known in the art and/or described in U.S. Patent No. 6, 190,315, herein incorporated by reference in its entirety. As a non-limiting example, a modified mRNA formulation may be delivered by the drug delivery methods described in U.S. Patent No. 6, 190,315, herein incorporated by reference in its entirety.
[00379] In another non-limiting example tissue may be treated with a eutectic mixture of local anesthetics (EMLA) cream before, during and/or after the tissue may be subjected to a device which may increase permeability. Katz et al. (Anesth Analg (2004); 98:371- 76; herein incorporated by reference in its entirety) showed that using the EMLA cream in combination with a low energy, an onset of superficial cutaneous analgesia was seen as fast as 5 minutes after a pretreatment with a low energy ultrasound.
[00380] In one embodiment, enhancers may be applied to the tissue before, during, and/or after the tissue has been treated to increase permeability. Enhancers include, but are not limited to, transport enhancers, physical enhancers, and cavitation enhancers. Non-limiting examples of enhancers are described in U.S. Patent No. 6,190,315, herein incorporated by reference in its entirety.
[00381] In one embodiment, a device may be used to increase permeability of tissue before delivering formulations of polynucleotides, primary constructs and/or mmRNA described herein, which may further contain a substance that invokes an immune response. In another non-limiting example, a formulation containing a substance to invoke an immune response may be delivered by the methods described in U.S.
Publication Nos. 20040171980 and 20040236268; each of which is herein incorporated by reference in their entirety.
[00382] Dosage forms for topical and/or transdermal administration of a composition may include ointments, pastes, creams, lotions, gels, powders, solutions, sprays, inhalants and/or patches. Generally, an active ingredient is admixed under sterile conditions with a pharmaceutically acceptable excipient and/or any needed preservatives and/or buffers as may be required.
[00383] Additionally, the present invention contemplates the use of transdermal patches, which often have the added advantage of providing controlled delivery of a compound to the body. Such dosage forms may be prepared, for example, by dissolving and/or dispensing the compound in the proper medium. Alternatively or additionally, rate may be controlled by either providing a rate controlling membrane and/or by dispersing the compound in a polymer matrix and/or gel.
[00384] Formulations suitable for topical administration include, but are not limited to, liquid and/or semi liquid preparations such as liniments, lotions, oil in water and/or water in oil emulsions such as creams, ointments and/or pastes, and/or solutions and/or suspensions. Topically-administrable formulations may, for example, comprise from about 0.1% to about 10% (w/w) active ingredient, although the concentration of active ingredient may be as high as the solubility limit of the active ingredient in the solvent. Formulations for topical administration may further comprise one or more of the additional ingredients described herein.
Depot Administration
[00385] As described herein, in some embodiments, the composition is formulated in depots for extended release. Generally, a specific organ or tissue (a "target tissue") is targeted for administration.
[00386] In some aspects of the invention, the polynucleotides, primary constructs or mmRNA are spatially retained within or proximal to a target tissue. Provided are method of providing a composition to a target tissue of a mammalian subject by contacting the target tissue (which contains one or more target cells) with the composition under conditions such that the composition, in particular the nucleic acid component(s) of the composition, is substantially retained in the target tissue, meaning that at least 10, 20, 30, 40, 50, 60, 70, 80, 85, 90, 95, 96, 97, 98, 99, 99.9, 99.99 or greater than 99.99% of the composition is retained in the target tissue. Advantageously, retention is determined by measuring the amount of the nucleic acid present in the composition that enters one or more target cells. For example, at least 1, 5, 10, 20, 30, 40, 50, 60, 70, 80, 85, 90, 95, 96, 97, 98, 99, 99.9, 99.99 or greater than 99.99% of the nucleic acids administered to the subject are present intracellularly at a period of time following administration. For example, intramuscular injection to a mammalian subject is performed using an aqueous composition containing a ribonucleic acid and a transfection reagent, and retention of the composition is determined by measuring the amount of the ribonucleic acid present in the muscle cells.
[00387] Aspects of the invention are directed to methods of providing a composition to a target tissue of a mammalian subject, by contacting the target tissue (containing one or more target cells) with the composition under conditions such that the composition is substantially retained in the target tissue. The composition contains an effective amount of a polynucleotide, primary construct or mmRNA such that the polypeptide of interest is produced in at least one target cell. The compositions generally contain a cell penetration agent, although "naked" nucleic acid (such as nucleic acids without a cell penetration agent or other agent) is also contemplated, and a pharmaceutically acceptable carrier.
[00388] In some circumstances, the amount of a protein produced by cells in a tissue is desirably increased. Preferably, this increase in protein production is spatially restricted to cells within the target tissue. Thus, provided are methods of increasing production of a protein of interest in a tissue of a mammalian subject. A composition is provided that contains polynucleotides, primary constructs or mmRNA characterized in that a unit quantity of composition has been determined to produce the polypeptide of interest in a substantial percentage of cells contained within a predetermined volume of the target tissue.
[00389] In some embodiments, the composition includes a plurality of different polynucleotides, primary constructs or mmRNA, where one or more than one of the polynucleotides, primary constructs or mmRNA encodes a polypeptide of interest.
Optionally, the composition also contains a cell penetration agent to assist in the intracellular delivery of the composition. A determination is made of the dose of the composition required to produce the polypeptide of interest in a substantial percentage of cells contained within the predetermined volume of the target tissue (generally, without inducing significant production of the polypeptide of interest in tissue adjacent to the predetermined volume, or distally to the target tissue). Subsequent to this determination, the determined dose is introduced directly into the tissue of the mammalian subject.
[00390] In one embodiment, the invention provides for the polynucleotides, primary constructs or mmRNA to be delivered in more than one injection or by split dose injections.
[00391] In one embodiment, the invention may be retained near target tissue using a small disposable drug reservoir or patch pump. Non-limiting examples of patch pumps include those manufactured and/or sold by BD® (Franklin Lakes, NJ), Insulet
Corporation (Bedford, MA), SteadyMed Therapeutics (San Francisco, CA), Medtronic (Minneapolis, MN), UniLife (York, PA), Valeritas (Bridgewater, NJ), and SpringLeaf Therapeutics (Boston, MA).
Pulmonary Administration
[00392] A pharmaceutical composition may be prepared, packaged, and/or sold in a formulation suitable for pulmonary administration via the buccal cavity. Such a formulation may comprise dry particles which comprise the active ingredient and which have a diameter in the range from about 0.5 nm to about 7 nm or from about 1 nm to about 6 nm. Such compositions are suitably in the form of dry powders for
administration using a device comprising a dry powder reservoir to which a stream of propellant may be directed to disperse the powder and/or using a self propelling solvent/powder dispensing container such as a device comprising the active ingredient dissolved and/or suspended in a low-boiling propellant in a sealed container. Such powders comprise particles wherein at least 98% of the particles by weight have a diameter greater than 0.5 nm and at least 95% of the particles by number have a diameter less than 7 nm. Alternatively, at least 95% of the particles by weight have a diameter greater than 1 nm and at least 90% of the particles by number have a diameter less than 6 nm. Dry powder compositions may include a solid fine powder diluent such as sugar and are conveniently provided in a unit dose form.
[00393] Low boiling propellants generally include liquid propellants having a boiling point of below 65 °F at atmospheric pressure. Generally the propellant may constitute 50% to 99.9% (w/w) of the composition, and active ingredient may constitute 0.1% to 20% (w/w) of the composition. A propellant may further comprise additional ingredients such as a liquid non-ionic and/or solid anionic surfactant and/or a solid diluent (which may have a particle size of the same order as particles comprising the active ingredient). [00394] Pharmaceutical compositions formulated for pulmonary delivery may provide an active ingredient in the form of droplets of a solution and/or suspension. Such formulations may be prepared, packaged, and/or sold as aqueous and/or dilute alcoholic solutions and/or suspensions, optionally sterile, comprising active ingredient, and may conveniently be administered using any nebulization and/or atomization device. Such formulations may further comprise one or more additional ingredients including, but not limited to, a flavoring agent such as saccharin sodium, a volatile oil, a buffering agent, a surface active agent, and/or a preservative such as methylhydroxybenzoate. Droplets provided by this route of administration may have an average diameter in the range from about 0.1 nm to about 200 nm.
Intranasal, nasal and buccal Administration
[00395] Formulations described herein as being useful for pulmonary delivery are useful for intranasal delivery of a pharmaceutical composition. Another formulation suitable for intranasal administration is a coarse powder comprising the active ingredient and having an average particle from about 0.2 μηι to 500 μιη. Such a formulation is administered in the manner in which snuff is taken, i.e. by rapid inhalation through the nasal passage from a container of the powder held close to the nose.
[00396] Formulations suitable for nasal administration may, for example, comprise from about as little as 0.1% (w/w) and as much as 100% (w/w) of active ingredient, and may comprise one or more of the additional ingredients described herein. A
pharmaceutical composition may be prepared, packaged, and/or sold in a formulation suitable for buccal administration. Such formulations may, for example, be in the form of tablets and/or lozenges made using conventional methods, and may, for example, 0.1% to 20% (w/w) active ingredient, the balance comprising an orally dissolvable and/or degradable composition and, optionally, one or more of the additional ingredients described herein. Alternately, formulations suitable for buccal administration may comprise a powder and/or an aerosolized and/or atomized solution and/or suspension comprising active ingredient. Such powdered, aerosolized, and/or aerosolized formulations, when dispersed, may have an average particle and/or droplet size in the range from about 0.1 nm to about 200 nm, and may further comprise one or more of any additional ingredients described herein. Ophthalmic Administration
[00397] A pharmaceutical composition may be prepared, packaged, and/or sold in a formulation suitable for ophthalmic administration. Such formulations may, for example, be in the form of eye drops including, for example, a 0.1/1.0% (w/w) solution and/or suspension of the active ingredient in an aqueous or oily liquid excipient. Such drops may further comprise buffering agents, salts, and/or one or more other of any additional ingredients described herein. Other ophthalmically-administrable formulations which are useful include those which comprise the active ingredient in microcrystalline form and/or in a liposomal preparation. Ear drops and/or eye drops are contemplated as being within the scope of this invention.
Payload Administration: Detectable Agents and Therapeutic Agents
[00398] The polynucleotides, primary constructs or mmRNA described herein can be used in a number of different scenarios in which delivery of a substance (the "payload") to a biological target is desired, for example delivery of detectable substances for detection of the target, or delivery of a therapeutic agent. Detection methods can include, but are not limited to, both imaging in vitro and in vivo imaging methods, e.g., immunohistochemistry, bioluminescence imaging (BLI), Magnetic Resonance Imaging (MRI), positron emission tomography (PET), electron microscopy, X-ray computed tomography, Raman imaging, optical coherence tomography, absorption imaging, thermal imaging, fluorescence reflectance imaging, fluorescence microscopy, fluorescence molecular tomographic imaging, nuclear magnetic resonance imaging, X-ray imaging, ultrasound imaging, photoacoustic imaging, lab assays, or in any situation where tagging/staining/imaging is required.
[00399] The polynucleotides, primary constructs or mmRNA can be designed to include both a linker and a payload in any useful orientation. For example, a linker having two ends is used to attach one end to the payload and the other end to the nucleobase, such as at the C-7 or C-8 positions of the deaza-adenosine or deaza- guanosine or to the N-3 or C-5 positions of cytosine or uracil. The polynucleotide of the invention can include more than one payload (e.g., a label and a transcription inhibitor), as well as a cleavable linker. In one embodiment, the modified nucleotide is a modified 7-deaza-adenosine triphosphate, where one end of a cleavable linker is attached to the C7 position of 7-deaza-adenine, the other end of the linker is attached to an inhibitor (e.g., to the C5 position of the nucleobase on a cytidine), and a label (e.g., Cy5) is attached to the center of the linker (see, e.g., compound 1 of A*pCp C5 Parg Capless in Fig. 5 and columns 9 and 10 of U.S. Pat. No. 7,994,304, incorporated herein by reference). Upon incorporation of the modified 7-deaza-adenosine triphosphate to an encoding region, the resulting polynucleotide will have a cleavable linker attached to a label and an inhibitor (e.g., a polymerase inhibitor). Upon cleavage of the linker (e.g., with reductive conditions to reduce a linker having a cleavable disulfide moiety), the label and inhibitor are released. Additional linkers and payloads (e.g., therapeutic agents, detectable labels, and cell penetrating payloads) are described herein.
[00400] For example, the polynucleotides, primary constructs or mmRNA described herein can be used in induced pluripotent stem cells (iPS cells), which can directly track cells that are transfected compared to total cells in the cluster. In another example, a drug that may be attached to the polynucleotides, primary constructs or mmRNA via a linker and may be fluorescently labeled can be used to track the drug in vivo, e.g. intracellularly. Other examples include, but are not limited to, the use of a polynucleotide, primary construct or mmRNA in reversible drug delivery into cells.
[00401] The polynucleotides, primary constructs or mmRNA described herein can be used in intracellular targeting of a payload, e.g., detectable or therapeutic agent, to specific organelle. Exemplary intracellular targets can include, but are not limited to, the nuclear localization for advanced mRNA processing, or a nuclear localization sequence (NLS) linked to the mRNA containing an inhibitor.
[00402] In addition, the polynucleotides, primary constructs or mmRNA described herein can be used to deliver therapeutic agents to cells or tissues, e.g., in living animals. For example, the polynucleotides, primary constructs or mmRNA attached to the therapeutic agent through a linker can facilitate member permeation allowing the therapeutic agent to travel into a cell to reach an intracellular target.
[00403] In some embodiments, the payload may be a therapeutic agent such as a cytotoxin, radioactive ion, chemotherapeutic, or other therapeutic agent. A cytotoxin or cytotoxic agent includes any agent that may be detrimental to cells. Examples include, but are not limited to, taxol, cytochalasin B, gramicidin D, ethidium bromide, emetine, mitomycin, etoposide, teniposide, vincristine, vinblastine, colchicine, doxorubicin, daunorubicin, dihydroxyanthracinedione, mitoxantrone, mithramycin, actinomycin D, 1- dehydrotestosterone, glucocorticoids, procaine, tetracaine, lidocaine, propranolol, puromycin, maytansinoids, e.g., maytansinol (see U.S. Pat. No. 5,208,020 incorporated herein in its entirety), rachelmycin (CC-1065, see U.S. Pat. Nos. 5,475,092, 5,585,499, and 5,846,545, all of which are incorporated herein by reference), and analogs or homologs thereof. Radioactive ions include, but are not limited to iodine (e.g., iodine 125 or iodine 131), strontium 89, phosphorous, palladium, cesium, iridium, phosphate, cobalt, yttrium 90, samarium 153, and praseodymium. Other therapeutic agents include, but are not limited to, antimetabolites (e.g., methotrexate, 6-mercaptopurine, 6-thioguanine, cytarabine, 5-fluorouracil decarbazine), alkylating agents (e.g., mechlorethamine, thiotepa chlorambucil, rachelmycin (CC-1065), melphalan, carmustine (BS U), lomustine (CCNU), cyclophosphamide, busulfan, dibromomannitol, streptozotocin, mitomycin C, and cis-dichlorodiamine platinum (II) (DDP) cisplatin), anthracyclines (e.g., daunorubicin (formerly daunomycin) and doxorubicin), antibiotics (e.g., dactinomycin (formerly actinomycin), bleomycin, mithramycin, and anthramycin (AMC)), and anti-mitotic agents (e.g., vincristine, vinblastine, taxol and maytansinoids).
[00404] In some embodiments, the payload may be a detectable agent, such as various organic small molecules, inorganic compounds, nanoparticles, enzymes or enzyme substrates, fluorescent materials, luminescent materials (e.g., luminol), bioluminescent materials (e.g., luciferase, luciferin, and aequorin), chemiluminescent materials, radioactive materials (e.g., 18F, 67Ga, 81mKr, 82Rb, mIn, 123I, 133Xe, 201T1, 1251, 35S, 14C, 3H, or 99mTc (e.g., as pertechnetate (technetate(VII), Tc04 ~)), and contrast agents (e.g., gold (e.g., gold nanoparticles), gadolinium (e.g., chelated Gd), iron oxides (e.g.,
superparamagnetic iron oxide (SPIO), monocrystalline iron oxide nanoparticles (MIONs), and ultrasmall superparamagnetic iron oxide (USPIO)), manganese chelates (e.g., Mn- DPDP), barium sulfate, iodinated contrast media (iohexol), microbubbles, or
perfluorocarbons). Such optically-detectable labels include for example, without limitation, 4-acetamido-4'-isothiocyanatostilbene-2,2'disulfonic acid; acridine and derivatives (e.g., acridine and acridine isothiocyanate); 5-(2'- aminoethyl)aminonaphthalene- 1 -sulfonic acid (EDANS); 4-amino-N-[3- vinylsulfonyl)phenyl]naphthalimide-3,5 disulfonate; N-(4-anilino-l-naphthyl)maleimide; anthranilamide; BODIPY; Brilliant Yellow; coumarin and derivatives (e.g., coumarin, 7- amino-4-methylcoumarin (AMC, Coumarin 120), and 7-amino-4- trifluoromethylcoumarin (Coumarin 151)); cyanine dyes; cyanosine; 4',6-diaminidino-2- phenylindole (DAPI); 5' 5"-dibromopyrogallol-sulfonaphthalein (Bromopyrogallol Red); 7-diethylamino-3-(4'-isothiocyanatophenyl)-4-methylcoumarin; diethylenetriamine pentaacetate; 4,4'-diisothiocyanatodihydro-stilbene-2,2'-disulfonic acid; 4,4'- diisothiocyanatostilbene-2,2'-disulfonic acid; 5-[dimethylamino]-naphthalene-l-sulfonyl chloride (DNS, dansylchloride); 4-dimethylaminophenylazophenyl-4' -isothiocyanate (DABITC); eosin and derivatives (e.g., eosin and eosin isothiocyanate); erythrosin and derivatives (e.g., erythrosin B and erythrosin isothiocyanate); ethidium; fluorescein and derivatives (e.g., 5-carboxyfluorescein (FAM), 5-(4,6-dichlorotriazin-2- yl)aminofluorescein (DTAF), 2',7'-dimethoxy-4'5'-dichloro-6-carboxyfluorescein, fluorescein, fluorescein isothiocyanate, X-rhodamine-5-(and-6)-isothiocyanate (QFITC or XRITC), and fluorescamine); 2-[2-[3-[[l,3-dihydro-l, l-dimethyl-3-(3-sulfopropyl)-2H- benz[e]indol-2-ylidene]ethylidene]-2-[4-(ethoxycarbonyl)-l-piperazinyl]-l-cyclopenten- l-yl]ethenyl]-l, l-dimethyl-3-(3-sulforpropyl)-lH-benz[e]indolium hydroxide, inner salt, compound with n,n-diethylethanamine(l : l) (IR144); 5-chloro-2-[2-[3-[(5-chloro-3-ethyl- 2(3H)-benzothiazol- ylidene)ethylidene]-2-(diphenylamino)-l-cyclopenten-l-yl]ethenyl]- 3-ethyl benzothiazolium perchlorate (IR140); Malachite Green isothiocyanate; 4- methylumbelliferone orthocresolphthalein; nitrotyrosine; pararosaniline; Phenol Red; B- phycoerythrin; o-phthaldialdehyde; pyrene and derivatives(e.g., pyrene, pyrene butyrate, and succinimidyl 1 -pyrene); butyrate quantum dots; Reactive Red 4
(CIBACRON™ Brilliant Red 3B-A); rhodamine and derivatives (e.g., 6-carboxy-X- rhodamine (ROX), 6-carboxyrhodamine (R6G), lissamine rhodamine B sulfonyl chloride rhodamine (Rhod), rhodamine B, rhodamine 123, rhodamine X
isothiocyanate, sulforhodamine B, sulforhodamine 101, sulfonyl chloride derivative of sulforhodamine 101 (Texas Red), Ν,Ν,Ν ',Ν 'tetramethyl-6-carboxyrhodamine (TAMRA) tetramethyl rhodamine, and tetramethyl rhodamine isothiocyanate (TRITC)); riboflavin; rosolic acid; terbium chelate derivatives; Cyanine-3 (Cy3); Cyanine-5 (Cy5); cyanine-5.5 (Cy5.5), Cyanine-7 (Cy7); IRD 700; IRD 800; Alexa 647; La Jolta Blue; phthalo cyanine; and naphthalo cyanine.
[00405] In some embodiments, the detectable agent may be a non-detectable pre-cursor that becomes detectable upon activation (e.g., fluorogenic tetrazine-fluorophore constructs (e.g., tetrazine-BODIPY FL, tetrazine-Oregon Green 488, or tetrazine- BODIPY TMR-X) or enzyme activatable fluorogenic agents (e.g., PROSENSE® (VisEn Medical))). In vitro assays in which the enzyme labeled compositions can be used include, but are not limited to, enzyme linked immunosorbent assays (ELISAs), immunoprecipitation assays, immunofluorescence, enzyme immunoassays (EIA), radioimmunoassays (RLA), and Western blot analysis. Combinations
[00406] The polynucleotides, primary constructs or mmRNA may be used in combination with one or more other therapeutic, prophylactic, diagnostic, or imaging agents. By "in combination with," it is not intended to imply that the agents must be administered at the same time and/or formulated for delivery together, although these methods of delivery are within the scope of the present disclosure. Compositions can be administered concurrently with, prior to, or subsequent to, one or more other desired therapeutics or medical procedures. In general, each agent will be administered at a dose and/or on a time schedule determined for that agent. In some embodiments, the present disclosure encompasses the delivery of pharmaceutical, prophylactic, diagnostic, or imaging compositions in combination with agents that may improve their bioavailability, reduce and/or modify their metabolism, inhibit their excretion, and/or modify their distribution within the body. As a non-limiting example, the polynucleotides, primary constructs and/or mmRNA may be used in combination with a pharmaceutical agent for the treatment of cancer or to control hyperproliferative cells. In U.S. Pat. No. 7,964,571, herein incorporated by reference in its entirety, a combination therapy for the treatment of solid primary or metastasized tumor is described using a pharmaceutical composition including a DNA plasmid encoding for interleukin-12 with a lipopolymer and also administering at least one anticancer agent or chemotherapeutic. Further, the
polynucleotides, primary constructs and/or mmRNA of the present invention that encodes anti-proliferative molecules may be in a pharmaceutical composition with a lipopolymer (see e.g., U.S. Pub. No. 20110218231, herein incorporated by reference in its entirety, claiming a pharmaceutical composition comprising a DNA plasmid encoding an antiproliferative molecule and a lipopolymer) which may be administered with at least one chemotherapeutic or anticancer agent.
Dosing
[00407] The present invention provides methods comprising administering
polynucleotides, primary constructs and/or mmRNA and their encoded proteins or complexes in accordance with the invention to a subject in need thereof, nucleic acids, proteins or complexes, or pharmaceutical, imaging, diagnostic, or prophylactic compositions thereof, may be administered to a subject using any amount and any route of administration effective for preventing, treating, diagnosing, or imaging a disease, disorder, and/or condition (e.g., a disease, disorder, and/or condition relating to working memory deficits). The exact amount required will vary from subject to subject, depending on the species, age, and general condition of the subject, the severity of the disease, the particular composition, its mode of administration, its mode of activity, and the like. Compositions in accordance with the invention are typically formulated in dosage unit form for ease of administration and uniformity of dosage. It will be understood, however, that the total daily usage of the compositions of the present invention may be decided by the attending physician within the scope of sound medical judgment. The specific therapeutically effective, prophylactically effective, or appropriate imaging dose level for any particular patient will depend upon a variety of factors including the disorder being treated and the severity of the disorder; the activity of the specific compound employed; the specific composition employed; the age, body weight, general health, sex and diet of the patient; the time of administration, route of administration, and rate of excretion of the specific compound employed; the duration of the treatment; drugs used in combination or coincidental with the specific compound employed; and like factors well known in the medical arts.
[00408] In certain embodiments, compositions in accordance with the present invention may be administered at dosage levels sufficient to deliver from about 0.0001 mg/kg to about 100 mg/kg, from about 0.001 mg/kg to about 0.05 mg/kg, from about 0.005 mg/kg to about 0.05 mg/kg, from about 0.001 mg/kg to about 0.005 mg/kg, from about 0.05 mg/kg to about 0.5 mg/kg, from about 0.01 mg/kg to about 50 mg/kg, from about 0.1 mg/kg to about 40 mg/kg, from about 0.5 mg/kg to about 30 mg/kg, from about 0.01 mg/kg to about 10 mg/kg, from about 0.1 mg/kg to about 10 mg/kg, or from about 1 mg/kg to about 25 mg/kg, of subject body weight per day, one or more times a day, to obtain the desired therapeutic, diagnostic, prophylactic, or imaging effect. The desired dosage may be delivered three times a day, two times a day, once a day, every other day, every third day, every week, every two weeks, every three weeks, or every four weeks. In certain embodiments, the desired dosage may be delivered using multiple
administrations (e.g., two, three, four, five, six, seven, eight, nine, ten, eleven, twelve, thirteen, fourteen, or more administrations).
[00409] According to the present invention, it has been discovered that administration of mmRNA in split-dose regimens produce higher levels of proteins in mammalian subjects. As used herein, a "split dose" is the division of single unit dose or total daily dose into two or more doses, e.g., two or more administrations of the single unit dose. As used herein, a "single unit dose" is a dose of any therapeutic administered in one dose/at one time/single route/single point of contact, i.e., single administration event. As used herein, a "total daily dose" is an amount given or prescribed in 24 hr period. It may be administered as a single unit dose. In one embodiment, the mmRNA of the present invention are administered to a subject in split doses. The mmRNA may be formulated in buffer only or in a formulation described herein.
Dosage Forms
[00410] A pharmaceutical composition described herein can be formulated into a dosage form described herein, such as a topical, intranasal, intratracheal, or injectable (e.g., intravenous, intraocular, intravitreal, intramuscular, intracardiac, intraperitoneal, subcutaneous).
Liquid dosage forms
[00411] Liquid dosage forms for parenteral administration include, but are not limited to, pharmaceutically acceptable emulsions, microemulsions, solutions, suspensions, syrups, and/or elixirs. In addition to active ingredients, liquid dosage forms may comprise inert diluents commonly used in the art including, but not limited to, water or other solvents, solubilizing agents and emulsifiers such as ethyl alcohol, isopropyl alcohol, ethyl carbonate, ethyl acetate, benzyl alcohol, benzyl benzoate, propylene glycol, 1,3- butylene glycol, dimethylformamide, oils (in particular, cottonseed, groundnut, corn, germ, olive, castor, and sesame oils), glycerol, tetrahydrofurfuryl alcohol, polyethylene glycols and fatty acid esters of sorbitan, and mixtures thereof. In certain embodiments for parenteral administration, compositions may be mixed with solubilizing agents such as CREMOPHOR®, alcohols, oils, modified oils, glycols, polysorbates, cyclodextrins, polymers, and/or combinations thereof.
Injectable
[00412] Injectable preparations, for example, sterile injectable aqueous or oleaginous suspensions may be formulated according to the known art and may include suitable dispersing agents, wetting agents, and/or suspending agents. Sterile injectable preparations may be sterile injectable solutions, suspensions, and/or emulsions in nontoxic parenterally acceptable diluents and/or solvents, for example, a solution in 1,3- butanediol. Among the acceptable vehicles and solvents that may be employed include, but are not limited to, are water, Ringer's solution, U.S.P., and isotonic sodium chloride solution. Sterile, fixed oils are conventionally employed as a solvent or suspending medium. For this purpose any bland fixed oil can be employed including synthetic mono- or diglycerides. Fatty acids such as oleic acid can be used in the preparation of injectables.
[00413] Injectable formulations can be sterilized, for example, by filtration through a bacterial-retaining filter, and/or by incorporating sterilizing agents in the form of sterile solid compositions which can be dissolved or dispersed in sterile water or other sterile injectable medium prior to use.
[00414] In order to prolong the effect of an active ingredient, it may be desirable to slow the absorption of the active ingredient from subcutaneous or intramuscular injection. This may be accomplished by the use of a liquid suspension of crystalline or amorphous material with poor water solubility. The rate of absorption of the polynucleotide, primary construct or mmRNA then depends upon its rate of dissolution which, in turn, may depend upon crystal size and crystalline form. Alternatively, delayed absorption of a parenterally administered polynucleotide, primary construct or mmRNA may be accomplished by dissolving or suspending the polynucleotide, primary construct or mmRNA in an oil vehicle. Injectable depot forms are made by forming microencapsule matrices of the polynucleotide, primary construct or mmRNA in biodegradable polymers such as polylactide-polyglycolide. Depending upon the ratio of polynucleotide, primary construct or mmRNA to polymer and the nature of the particular polymer employed, the rate of polynucleotide, primary construct or mmRNA release can be controlled. Examples of other biodegradable polymers include, but are not limited to, poly(orthoesters) and poly(anhydrides). Depot injectable formulations may be prepared by entrapping the polynucleotide, primary construct or mmRNA in liposomes or microemulsions which are compatible with body tissues.
Pulmonary
[00415] Formulations described herein as being useful for pulmonary delivery may also be use for intranasal delivery of a pharmaceutical composition. Another formulation suitable for intranasal administration may be a coarse powder comprising the active ingredient and having an average particle from about 0.2 μιη to 500 μιη. Such a formulation may be administered in the manner in which snuff is taken, i.e. by rapid inhalation through the nasal passage from a container of the powder held close to the nose.
[00416] Formulations suitable for nasal administration may, for example, comprise from about as little as 0.1% (w/w) and as much as 100% (w/w) of active ingredient, and may comprise one or more of the additional ingredients described herein. A
pharmaceutical composition may be prepared, packaged, and/or sold in a formulation suitable for buccal administration. Such formulations may, for example, be in the form of tablets and/or lozenges made using conventional methods, and may, for example, contain about 0.1% to 20% (w/w) active ingredient, where the balance may comprise an orally dissolvable and/or degradable composition and, optionally, one or more of the additional ingredients described herein. Alternately, formulations suitable for buccal administration may comprise a powder and/or an aerosolized and/or atomized solution and/or suspension comprising active ingredient. Such powdered, aerosolized, and/or aerosolized
formulations, when dispersed, may have an average particle and/or droplet size in the range from about 0.1 nm to about 200 nm, and may further comprise one or more of any additional ingredients described herein.
[00417] General considerations in the formulation and/or manufacture of
pharmaceutical agents may be found, for example, in Remington: The Science and Practice of Pharmacy 21st ed., Lippincott Williams & Wilkins, 2005 (incorporated herein by reference).
Coatings or Shells
[00418] Solid dosage forms of tablets, dragees, capsules, pills, and granules can be prepared with coatings and shells such as enteric coatings and other coatings well known in the pharmaceutical formulating art. They may optionally comprise opacifying agents and can be of a composition that they release the active ingredient(s) only, or
preferentially, in a certain part of the intestinal tract, optionally, in a delayed manner. Examples of embedding compositions which can be used include polymeric substances and waxes. Solid compositions of a similar type may be employed as fillers in soft and hard-filled gelatin capsules using such excipients as lactose or milk sugar as well as high molecular weight polyethylene glycols and the like.
Properties of Pharmaceutical Compositions
[00419] The pharmaceutical compositions described herein can be characterized by one or more of bioavailability, therapeutic window and/or volume of distribution.
Bioavailability
[00420] The polynucleotides, primary constructs or mmRNA, when formulated into a composition with a delivery agent as described herein, can exhibit an increase in bioavailability as compared to a composition lacking a delivery agent as described herein. As used herein, the term "bioavailability" refers to the systemic availability of a given amount of polynucleotides, primary constructs or mmRNA administered to a mammal. Bioavailability can be assessed by measuring the area under the curve (AUC) or the maximum serum or plasma concentration (Cmax) of the unchanged form of a compound following administration of the compound to a mammal. AUC is a determination of the area under the curve plotting the serum or plasma concentration of a compound along the ordinate (Y-axis) against time along the abscissa (X-axis). Generally, the AUC for a particular compound can be calculated using methods known to those of ordinary skill in the art and as described in G. S. Banker, Modern Pharmaceutics, Drugs and the
Pharmaceutical Sciences, v. 72, Marcel Dekker, New York, Inc., 1996, herein incorporated by reference.
[00421] The Cmax value is the maximum concentration of the compound achieved in the serum or plasma of a mammal following administration of the compound to the mammal. The Cmax value of a particular compound can be measured using methods known to those of ordinary skill in the art. The phrases "increasing bioavailability" or "improving the pharmacokinetics," as used herein mean that the systemic availability of a first polynucleotide, primary construct or mmRNA, measured as AUC, Cmax, or Cmin in a mammal is greater, when co-administered with a delivery agent as described herein, than when such co-administration does not take place. In some embodiments, the
bioavailability of the polynucleotide, primary construct or mmRNA can increase by at least about 2%, at least about 5%, at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or about 100%.
Therapeutic Window
[00422] The polynucleotides, primary constructs or mmRNA, when formulated into a composition with a delivery agent as described herein, can exhibit an increase in the therapeutic window of the administered polynucleotide, primary construct or mmRNA composition as compared to the therapeutic window of the administered polynucleotide, primary construct or mmRNA composition lacking a delivery agent as described herein. As used herein "therapeutic window" refers to the range of plasma concentrations, or the range of levels of therapeutically active substance at the site of action, with a high probability of eliciting a therapeutic effect. In some embodiments, the therapeutic window of the polynucleotide, primary construct or mmRNA when co-administered with a delivery agent as described herein can increase by at least about 2%, at least about 5%, at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or about 100%.
Volume of Distribution
[00423] The polynucleotides, primary constructs or mmRNA, when formulated into a composition with a delivery agent as described herein, can exhibit an improved volume of distribution (Vdist), e.g., reduced or targeted, relative to a composition lacking a delivery agent as described herein. The volume of distribution (Vdist) relates the amount of the drug in the body to the concentration of the drug in the blood or plasma. As used herein, the term "volume of distribution" refers to the fluid volume that would be required to contain the total amount of the drug in the body at the same concentration as in the blood or plasma: Vdist equals the amount of drug in the body/concentration of drug in blood or plasma. For example, for a 10 mg dose and a plasma concentration of 10 mg/L, the volume of distribution would be 1 liter. The volume of distribution reflects the extent to which the drug is present in the extravascular tissue. A large volume of distribution reflects the tendency of a compound to bind to the tissue components compared with plasma protein binding. In a clinical setting, Vdist can be used to determine a loading dose to achieve a steady state concentration. In some embodiments, the volume of distribution of the polynucleotide, primary construct or mmRNA when co-administered with a delivery agent as described herein can decrease at least about 2%, at least about 5%, at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%.
Biological Effect
[00424] In one embodiment, the biological effect of the modified mRNA delivered to the animals may be categorized by analyzing the protein expression in the animals. The reprogrammed protein expression may be determined from analyzing a biological sample collected from a mammal administered the modified mRNA of the present invention. In one embodiment, the expression protein encoded by the modified mRNA administered to the mammal of at least 50 pg/ml may be preferred. For example, a protein expression of 50-200 pg/ml for the protein encoded by the modified mRNA delivered to the mammal may be seen as a therapeutically effective amount of protein in the mammal.
Quantification
[00425] In one embodiment, the polynucleotides, primary constructs or mmRNA of the present invention may be quantified in exosomes derived from one or more bodily fluid. As used herein "bodily fluids" include peripheral blood, serum, plasma, ascites, urine, cerebrospinal fluid (CSF), sputum, saliva, bone marrow, synovial fluid, aqueous humor, amniotic fluid, cerumen, breast milk, broncheoalveolar lavage fluid, semen, prostatic fluid, cowper's fluid or pre-ejaculatory fluid, sweat, fecal matter, hair, tears, cyst fluid, pleural and peritoneal fluid, pericardial fluid, lymph, chyme, chyle, bile, interstitial fluid, menses, pus, sebum, vomit, vaginal secretions, mucosal secretion, stool water, pancreatic juice, lavage fluids from sinus cavities, bronchopulmonary aspirates, blastocyl cavity fluid, and umbilical cord blood. Alternatively, exosomes may be retrieved from an organ selected from the group consisting of lung, heart, pancreas, stomach, intestine, bladder, kidney, ovary, testis, skin, colon, breast, prostate, brain, esophagus, liver, and placenta.
[00426] In the quantification method, a sample of not more than 2mL is obtained from the subject and the exosomes isolated by size exclusion chromatography, density gradient centrifugation, differential centrifugation, nanomembrane ultrafiltration,
immunoabsorbent capture, affinity purification, microfluidic separation, or combinations thereof. In the analysis, the level or concentration of a polynucleotide, primary construct or mmRNA may be an expression level, presence, absence, truncation or alteration of the administered construct. It is advantageous to correlate the level with one or more clinical phenotypes or with an assay for a human disease biomarker. The assay may be performed using construct specific probes, cytometry, qRT-PCR, real-time PCR, PCR, flow cytometry, electrophoresis, mass spectrometry, or combinations thereof while the exosomes may be isolated using immunohistochemical methods such as enzyme linked immunosorbent assay (ELISA) methods. Exosomes may also be isolated by size exclusion chromatography, density gradient centrifugation, differential centrifugation, nanomembrane ultrafiltration, immunoabsorbent capture, affinity purification, microfluidic separation, or combinations thereof. [00427] These methods afford the investigator the ability to monitor, in real time, the level of polynucleotides, primary constructs or mmRNA remaining or delivered. This is possible because the polynucleotides, primary constructs or mmRNA of the present invention differ from the endogenous forms due to the structural or chemical
modifications.
[00428]
Detection of Modified Polynucleotides by Mass Spectrometry
[00429] Mass spectrometry (MS) is an analytical technique that can provide structural and molecular mass/concentration information on molecules after their conversion to ions. The molecules are first ionized to acquire positive or negative charges and then they travel through the mass analyzer to arrive at different areas of the detector according to their mass/charge (m/z) ratio.
[00430] Mass spectrometry is performed using a mass spectrometer which includes an ion source for ionizing the fractionated sample and creating charged molecules for further analysis. For example ionization of the sample may be performed by electrospray ionization (ESI), atmospheric pressure chemical ionization (APCI), photoionization, electron ionization, fast atom bombardment (FAB)/liquid secondary ionization (LSIMS), matrix assisted laser desorption/ionization (MALDI), field ionization, field desorption, thermospray/plasmaspray ionization, and particle beam ionization. The skilled artisan will understand that the choice of ionization method can be determined based on the analyte to be measured, type of sample, the type of detector, the choice of positive versus negative mode, etc.
[00431] After the sample has been ionized, the positively charged or negatively charged ions thereby created may be analyzed to determine a mass-to-charge ratio (i.e., m/z). Suitable analyzers for determining mass-to-charge ratios include quadropole analyzers, ion traps analyzers, and time-of-flight analyzers. The ions may be detected using several detection modes. For example, selected ions may be detected (i.e., using a selective ion monitoring mode (SIM)), or alternatively, ions may be detected using a scanning mode, e.g., multiple reaction monitoring (MRM) or selected reaction monitoring (SRM).
[00432] Liquid chromatography-multiple reaction monitoring (LC-MS/MRM) coupled with stable isotope labeled dilution of peptide standards has been shown to be an effective method for protein verification (e.g., Keshishian et al, Mol Cell Proteomics 2009 8: 2339-2349; Kuhn et al, Clin Chem 2009 55: 1 108-11 17; Lopez et al, Clin Chem 2010 56:281-290). Unlike untargeted mass spectrometry frequently used in biomarker discovery studies, targeted MS methods are peptide sequence-based modes of MS that focus the full analytical capacity of the instrument on tens to hundreds of selected peptides in a complex mixture. By restricting detection and fragmentation to only those peptides derived from proteins of interest, sensitivity and reproducibility are improved dramatically compared to discovery-mode MS methods. This method of mass spectrometry-based multiple reaction monitoring (MRM) quantitation of proteins can dramatically impact the discovery and quantitation of biomarkers via rapid, targeted, multiplexed protein expression profiling of clinical samples.
[00433] In one embodiment, a biological sample which may contain at least one protein encoded by at least one modified mRNA of the present invention may be analyzed by the method of MRM-MS. The quantification of the biological sample may further include, but is not limited to, isotopically labeled peptides or proteins as internal standards.
[00434] According to the present invention, the biological sample, once obtained from the subject, may be subjected to enzyme digestion. As used herein, the term "digest" means to break apart into shorter peptides. As used herein, the phrase "treating a sample to digest proteins" means manipulating a sample in such a way as to break down proteins in a sample. These enzymes include, but are not limited to, trypsin, endoproteinase Glu-C and chymotrypsin. In one embodiment, a biological sample which may contain at least one protein encoded by at least one modified mRNA of the present invention may be digested using enzymes.
[00435] In one embodiment, a biological sample which may contain protein encoded by modified mRNA of the present invention may be analyzed for protein using electrospray ionization. Electrospray ionization (ESI) mass spectrometry (ESIMS) uses electrical energy to aid in the transfer of ions from the solution to the gaseous phase before they are analyzed by mass spectrometry. Samples may be analyzed using methods known in the art (e.g., Ho et al., Clin Biochem Rev. 2003 24(1):3-12). The ionic species contained in solution may be transferred into the gas phase by dispersing a fine spray of charge droplets, evaporating the solvent and ejecting the ions from the charged droplets to generate a mist of highly charged droplets. The mist of highly charged droplets may be analyzed using at least 1, at least 2, at least 3 or at least 4 mass analyzers such as, but not limited to, a quadropole mass analyzer. Further, the mass spectrometry method may include a purification step. As a non-limiting example, the first quadrapole may be set to select a single m/z ratio so it may filter out other molecular ions having a different m/z ratio which may eliminate complicated and time-consuming sample purification procedures prior to MS analysis.
[00436] In one embodiment, a biological sample which may contain protein encoded by modified mRNA of the present invention may be analyzed for protein in a tandem ESIMS system (e.g., MS/MS). As non-limiting examples, the droplets may be analyzed using a product scan (or daughter scan) a precursor scan (parent scan) a neutral loss or a multiple reaction monitoring.
[00437] In one embodiment, a biological sample which may contain protein encoded by modified mRNA of the present invention may be analyzed using matrix-assisted laser desorption/ionization (MALDI) mass spectrometry (MALDIMS). MALDI provides for the nondestructive vaporization and ionization of both large and small molecules, such as proteins. In MALDI analysis, the analyte is first co-crystallized with a large molar excess of a matrix compound, which may also include, but is not limited to, an ultraviolet absorbing weak organic acid. Non-limiting examples of matrices used in MALDI are a- cyano-4-hydroxycinnamic acid, 3,5-dimethoxy-4-hydroxycinnamic acid and 2,5- dihydroxybenzoic acid. Laser radiation of the analyte- matrix mixture may result in the vaporization of the matrix and the analyte. The laser induced desorption provides high ion yields of the intact analyte and allows for measurement of compounds with high accuracy. Samples may be analyzed using methods known in the art (e.g., Lewis, Wei and Siuzdak, Encyclopedia of Analytical Chemistry 2000:5880-5894). As non-limiting examples, mass analyzers used in the MALDI analysis may include a linear time-of-flight (TOF), a TOF reflectron or a Fourier transform mass analyzer.
[00438] In one embodiment, the analyte-matrix mixture may be formed using the dried- droplet method. A biologic sample is mixed with a matrix to create a saturated matrix solution where the matrix-to-sample ratio is approximately 5000: 1. An aliquot
(approximately 0.5-2.0 uL) of the saturated matrix solution is then allowed to dry to form the analyte-matrix mixture.
[00439] In one embodiment, the analyte-matrix mixture may be formed using the thin- layer method. A matrix homogeneous film is first formed and then the sample is then applied and may be absorbed by the matrix to form the analyte-matrix mixture.
[00440] In one embodiment, the analyte-matrix mixture may be formed using the thick- layer method. A matrix homogeneous film is formed with a nitro-cellulose matrix additive. Once the uniform nitro-cellulose matrix layer is obtained the sample is applied and absorbed into the matrix to form the analyte-matrix mixture. [00441] In one embodiment, the analyte-matrix mixture may be formed using the sandwich method. A thin layer of matrix crystals is prepared as in the thin-layer method followed by the addition of droplets of aqueous trifluoroacetic acid, the sample and matrix. The sample is then absorbed into the matrix to form the analyte-matrix mixture. Uses of synthetic polynucleotides and/or synthetic sgRNAs
[00442] The synthetic polynucleotides and/or synthetic sgRNAs of the present invention may be used to alter the phenotype of cells. The polynucleotides, primary constructs and mmRNA of the invention may encode peptides, polypeptides or multiple proteins to produce polypeptides of interest. The polypeptides of interest may be used in therapeutics and/or clinical and research settings. As a non-limiting example, the polypeptides of interest may include reprogramming factors, differentiation factors and de-differentiation factors.
Therapeutic Agents
[00443] The polynucleotides, primary constructs or mmRNA of the present invention, such as modified nucleic acids and modified RNAs, and the proteins translated from them described herein can be used as therapeutic or prophylactic agents. They are provided for use in medicine, therapy and preventative treatments. For example, a polynucleotide, primary construct or mmRNA described herein (e.g. , a modified mRNA encoding a CRISPR-related polypeptide or protein) can be administered to a subject, wherein the polynucleotide, primary construct or mmRNA is translated in vivo to produce a therapeutic or prophylactic polypeptide in the subject. Likewise, and optionally in combination with the above, a polynucleotide, primary construct or mmRNA described herein (e.g., a modified sgRNA or plurality of same) can be administered to a subject, wherein the polynucleotide, primary construct or mmRNA guides gene-editing by a CRISPR-related polypeptide or protein.) Provided are compositions, methods, kits, and reagents for diagnosis, treatment or prevention of a disease or condition in humans and other mammals. The active therapeutic agents of the invention include polynucleotides, primary constructs or mmRNA, cells containing the polynucleotides, primary constructs or mmRNA or polypeptides translated from the polynucleotides, primary constructs or mmRNA.
[00444] In certain embodiments, provided herein are combination therapeutics containing one or more polynucleotide, primary construct or mmRNA containing translatable regions that encode for a protein or proteins. In certain embodiments, provided herein are combination therapeutics containing one or more polynucleotide, primary construct or mmRNA containing non-translatable regions, for example, regions complementary to target gene sequences, e.g., sgRNAs.
[00445] Provided herein are methods of inducing translation of a recombinant polypeptide in a cell population using the polynucleotide, primary construct or mmRNA described herein. Such translation can be in vivo, ex vivo, in culture, or in vitro. The cell population is contacted with an effective amount of a composition containing a nucleic acid that has at least one nucleoside modification, and a translatable region encoding the recombinant polypeptide. The cell population is optionally also contacted with an effective amount of a composition containing a nucleic acid that has at least one nucleoside modification, and has complementarity to a target gene sequence, e.g., a sgRNA. The population is contacted under conditions such that the nucleic acid is localized into one or more cells of the cell population and the recombinant polypeptide is translated in the cell from the nucleic acid and or the sgRNA (or plurality thereof) is also is localized into one or more cells of the cell population.
[00446] An "effective amount" of the composition is provided based, at least in part, on the target tissue, target cell type, means of administration, physical characteristics of the nucleic acid (e.g., size, and extent of modified nucleosides), and other determinants. In general, an effective amount of the composition provides efficient protein production in the cell, preferably more efficient than a composition containing a corresponding unmodified nucleic acid. Increased efficiency may be demonstrated by increased cell transfection (i.e., the percentage of cells transfected with the nucleic acid), increased protein translation from the nucleic acid, decreased nucleic acid degradation (as demonstrated, e.g., by increased duration of protein translation from a modified nucleic acid), or reduced innate immune response of the host cell.
[00447] Aspects of the invention are directed to methods of inducing in vivo translation of a recombinant polypeptide in a mammalian subject in need thereof, e.g., a recombinant CRISPR-related protein. Further aspects of the invention are directed to methods of inducing egne editing in vivo in a mammalian subject in need thereof. Therein, an effective amount of a composition containing a nucleic acid that has at least one structural or chemical modification and a translatable region encoding the recombinant polypeptide, optionally in combination with an effective amount of a composition containing one or more nucleic acids having at least one structural or chemical modification and/or having sequence complementarity to a target gene, e.g., one or more sgRNAs, is administered to the subject using the delivery methods described herein. The nucleic acid is provided in an amount and under other conditions such that the nucleic acid is localized into a cell of the subject and (1) the recombinant polypeptide is translated in the cell from the nucleic acid and/or (2) the sgRNA(s) bind complementary sequences within target genes. The cell in which a nucleic acid of the invention is localized, or the tissue in which the cell is present, may be targeted with one or more than one rounds of nucleic acid administration.
[00448] In certain embodiments, the administered polynucleotide, primary construct or mmRNA directs production of one or more recombinant polypeptides and/or regulatory RNA, e.g., sgRNA, that provides a functional activity which is substantially absent in the cell, tissue or organism in which the recombinant polypeptide is translated, e.g., a gene editing activity. In certain embodiments, an administered polynucleotide, primary construct or mmRNA directs production of one or more recombinant polypeptides and/or regulatory RNA, e.g., sgRNA, involved in gene editing, and is administered in combination with oen or more additional polynucleotide, primary construct or mmRNA that directs production of one or more additional recombinant polypeptides having therapeutic utility, e.g., providing a functional activity which is substantially absent in the cell, tissue or organism in which the recombinant polypeptide is translated. For example, the missing functional activity may be enzymatic, structural, or gene regulatory in nature. In related embodiments, the administered polynucleotide, primary construct or mmRNA directs production of one or more recombinant polypeptides that increases (e.g., synergistically) a functional activity which is present but substantially deficient in the cell in which the recombinant polypeptide is translated.
[00449] In other embodiments, the administered polynucleotide, primary construct or mmRNA directs production of one or more recombinant polypeptides that replace a polypeptide (or multiple polypeptides) that is substantially absent in the cell in which the recombinant polypeptide is translated. Such absence may be due to genetic mutation of the encoding gene or regulatory pathway thereof. In some embodiments, the recombinant polypeptide increases the level of an endogenous protein in the cell to a desirable level; such an increase may bring the level of the endogenous protein from a subnormal level to a normal level or from a normal level to a super-normal level.
[00450] Alternatively, the recombinant polypeptide functions to antagonize the activity of an endogenous protein present in, on the surface of, or secreted from the cell. Usually, the activity of the endogenous protein is deleterious to the subject; for example, due to mutation of the endogenous protein resulting in altered activity or localization. Additionally, the recombinant polypeptide antagonizes, directly or indirectly, the activity of a biological moiety present in, on the surface of, or secreted from the cell. Examples of antagonized biological moieties include lipids (e.g., cholesterol), a lipoprotein (e.g., low density lipoprotein), a nucleic acid, a carbohydrate, a metabolite (e.g. bilirubin), a protein toxin such as shiga and tetanus toxins, or a small molecule toxin such as botulinum, cholera, and diphtheria toxins. Additionally, the antagonized biological molecule may be an endogenous protein that exhibits an undesirable activity, such as a cytotoxic or cytostatic activity.
[00451] Without being bound in theory, it is proposed that the CRISPR gene-editing process can reverse disease symptoms in vivo. As such, this methodology has potential for treating many genetic disorders.
In certain embodiments, a mmRNA encoding a CRISPR-related polypeptide or protein is administered in combination with one or more sgRNAs, optionally in combination with a corrected DNA template. The DNA template includes a correct sequence of corresponding to a mutated gene associated with a disease. Exemplary DNA templates correspond to single-mutation disease causing genes. A cell into which the requisite components are introduced repairs the damaged gene using the CRISPER-related protein. In doing so, it copies from the template, introducing new genetic material into the genome.
[00452] The data presented herein demonstrate effective liver delivery of components of the invention. As such, the methodology described herein is particularly suited to treatment of metabolic disease, e.g., metabolic disease caused by inborn genetic errors, .e.g., ornithine transcarbamylase deficiency-related diseases. The methods of the invention can also serve to attenuate disease progression. It is also proposed that intramuscular delivery, e.g., via multiple muscle injection, can serve to treat muscle diseases, for example, muscular dustrophy, by inclusion of appropriate corrected DNA templates. In yet other embodiments, ex vivo approaches are envisioned involving, for example, administration of agents to hematopoetic cells ex vivo (e,g,, via electroporation), followed optionally by selection of cells expressing the proper components, followed by administration of treated cells, where recolonization can subsequently occur.
[00453] The recombinant proteins, mmRNAs encoding same, and/or sgRNAs, described herein may be engineered for localization within the cell, potentially within a specific compartment such as the nucleus, or are engineered for secretion from the cell or translocation to the plasma membrane of the cell. In exemplary embodiments, the recombinant proteins, mmRNAs encoding same, and/or sgR As, are engineered for nuclear localization.
[00454] Other aspects of the present disclosure relate to transplantation of cells containing polynucleotide, primary construct, or mmRNA to a mammalian subject.
Administration of cells to mammalian subjects is known to those of ordinary skill in the art, and include, but is not limited to, local implantation (e.g., topical or subcutaneous administration), organ delivery or systemic injection (e.g., intravenous injection or inhalation), and the formulation of cells in pharmaceutically acceptable carrier. Such compositions containing polynucleotide, primary construct, or mmRNA can be formulated for administration intramuscularly, transarterially, intraperitoneally, intravenously, intranasally, subcutaneously, endoscopically, transdermally, or intrathecally. In some embodiments, the composition may be formulated for extended release.
[00455] The subject to whom the therapeutic agent may be administered suffers from or may be at risk of developing a disease, disorder, or deleterious condition. Provided are methods of identifying, diagnosing, and classifying subjects on these bases, which may include clinical diagnosis, biomarker levels, genome-wide association studies (GWAS), and other methods known in the art.
VII. Kits and Devices
[00456] The invention provides a variety of kits for conveniently and/or effectively carrying out methods of the present invention. Typically kits will comprise sufficient amounts and/or numbers of components to allow a user to perform multiple treatments of a subject(s) and/or to perform multiple experiments, and contact cells and/or a population of cells at least once.
[00457] In one aspect, the present invention provides kits comprising the molecules (polynucleotides, primary constructs or mmRNA) of the invention. In one embodiment, the kit comprises one or more functional antibodies or function fragments thereof.
[00458] Kits and devices useful in combination with the polynucleotides, primary constructs or mmRNA) of the invention include those disclosed in co-pending U.S.
Provisional Patent Application No 61/737, 130 filed December 14, 2012, the contents of which are incorporated herein by reference in their entirety. VIII. Definitions
[00459] At various places in the present specification, substituents of compounds of the present disclosure are disclosed in groups or in ranges. It is specifically intended that the present disclosure include each and every individual subcombination of the members of such groups and ranges. For example, the term "Ci_6 alkyl" is specifically intended to individually disclose methyl, ethyl, C3 alkyl, C4 alkyl, C5 alkyl, and Ce alkyl.
[00460] About: As used herein, the term "about" means +/- 10% of the recited value.
[00461] Administered in combination: As used herein, the term "administered in combination" or "combined administration" means that two or more agents are administered to a subject at the same time or within an interval such that there may be an overlap of an effect of each agent on the patient. In some embodiments, they are administered within about 60, 30, 15, 10, 5, or 1 minute of one another. In some embodiments, the administrations of the agents are spaced sufficiently closely together such that a combinatorial (e.g., a synergistic) effect is achieved.
[00462] Animal: As used herein, the term "animal" refers to any member of the animal kingdom. In some embodiments, "animal" refers to humans at any stage of development. In some embodiments, "animal" refers to non-human animals at any stage of
development. In certain embodiments, the non-human animal is a mammal (e.g., a rodent, a mouse, a rat, a rabbit, a monkey, a dog, a cat, a sheep, cattle, a primate, or a pig). In some embodiments, animals include, but are not limited to, mammals, birds, reptiles, amphibians, fish, and worms. In some embodiments, the animal is a transgenic animal, genetically-engineered animal, or a clone.
[00463] Approximately: As used herein, the term "approximately" or "about," as applied to one or more values of interest, refers to a value that is similar to a stated reference value. In certain embodiments, the term "approximately" or "about" refers to a range of values that fall within 25%, 20%, 19%, 18%, 17%, 16%, 15%, 14%, 13%, 12%, 11%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, or less in either direction (greater than or less than) of the stated reference value unless otherwise stated or otherwise evident from the context (except where such number would exceed 100% of a possible value).
[00464] Associated with: As used herein, the terms "associated with," "conjugated," "linked," "attached," and "tethered," when used with respect to two or more moieties, means that the moieties are physically associated or connected with one another, either directly or via one or more additional moieties that serves as a linking agent, to form a structure that is sufficiently stable so that the moieties remain physically associated under the conditions in which the structure is used, e.g., physiological conditions. An
"association" need not be strictly through direct covalent chemical bonding. It may also suggest ionic or hydrogen bonding or a hybridization based connectivity sufficiently stable such that the "associated" entities remain physically associated.
[00465] Bifunctional: As used herein, the term "bifunctional" refers to any substance, molecule or moiety which is capable of or maintains at least two functions. The functions may affect the same outcome or a different outcome. The structure that produces the function may be the same or different. For example, bifunctional modified RNAs of the present invention may encode a cytotoxic peptide (a first function) while those nucleosides which comprise the encoding RNA are, in and of themselves, cytotoxic (second function). In this example, delivery of the bifunctional modified RNA to a cancer cell would produce not only a peptide or protein molecule which may ameliorate or treat the cancer but would also deliver a cytotoxic payload of nucleosides to the cell should degradation, instead of translation of the modified RNA, occur.
[00466] Biocompatible: As used herein, the term "biocompatible" means compatible with living cells, tissues, organs or systems posing little to no risk of injury, toxicity or rejection by the immune system.
[00467] Biodegradable: As used herein, the term "biodegradable" means capable of being broken down into innocuous products by the action of living things.
[00468] Biologically active: As used herein, the phrase "biologically active" refers to a characteristic of any substance that has activity in a biological system and/or organism. For instance, a substance that, when administered to an organism, has a biological effect on that organism, is considered to be biologically active. In particular embodiments, a polynucleotide, primary construct or mmRNA of the present invention may be considered biologically active if even a portion of the polynucleotide, primary construct or mmRNA is biologically active or mimics an activity considered biologically relevant.
[00469] Cancer stem cells: As used herein, "cancer stem cells" are cells that can undergo self-renewal and/or abnormal proliferation and differentiation to form a tumor.
[00470] Chemical terms: Chemical terms not otherwise defined herein, will conform to the chemical term definitions provided in co-pending U.S. Provisional Patent Application No 61/737,130 filed December 14, 2012, the contents of which are incorporated herein by reference in their entirety. [00471] The term "diastereomer," as used herein means stereoisomers that are not mirror images of one another and are non-superimposable on one another.
[00472] The term "effective amount" of an agent, as used herein, is that amount sufficient to effect beneficial or desired results, for example, clinical results, and, as such, an "effective amount" depends upon the context in which it is being applied. For example, in the context of administering an agent that treats cancer, an effective amount of an agent is, for example, an amount sufficient to achieve treatment, as defined herein, of cancer, as compared to the response obtained without administration of the agent.
[00473] The term "enantiomer," as used herein, means each individual optically active form of a compound of the invention, having an optical purity or enantiomeric excess (as determined by methods standard in the art) of at least 80% (i.e., at least 90% of one enantiomer and at most 10% of the other enantiomer), preferably at least 90% and more preferably at least 98%.
[00474] The term "isomer," as used herein, means any tautomer, stereoisomer, enantiomer, or diastereomer of any compound of the invention. It is recognized that the compounds of the invention can have one or more chiral centers and/or double bonds and, therefore, exist as stereoisomers, such as double-bond isomers (i.e., geometric E/Z isomers) or diastereomers (e.g., enantiomers (i.e., (+) or (-)) or cis/trans isomers).
According to the invention, the chemical structures depicted herein, and therefore the compounds of the invention, encompass all of the corresponding stereoisomers, that is, both the stereomerically pure form (e.g., geometrically pure, enantiomerically pure, or diastereomerically pure) and enantiomeric and stereoisomeric mixtures, e.g., racemates. Enantiomeric and stereoisomeric mixtures of compounds of the invention can typically be resolved into their component enantiomers or stereoisomers by well-known methods, such as chiral-phase gas chromatography, chiral-phase high performance liquid chromatography, crystallizing the compound as a chiral salt complex, or crystallizing the compound in a chiral solvent. Enantiomers and stereoisomers can also be obtained from stereomerically or enantiomerically pure intermediates, reagents, and catalysts by well- known asymmetric synthetic methods.
[00475] The term "stereoisomer," as used herein, refers to all possible different isomeric as well as conformational forms which a compound may possess (e.g., a compound of any formula described herein), in particular all possible stereochemically and conformationally isomeric forms, all diastereomers, enantiomers and/or conformers of the basic molecular structure. Some compounds of the present invention may exist in different tautomeric forms, all of the latter being included within the scope of the present invention.
[00476] Compound: As used herein, the term "compound," is meant to include all stereoisomers, geometric isomers, tautomers, and isotopes of the structures depicted.
[00477] The compounds described herein can be asymmetric (e.g., having one or more stereocenters). All stereoisomers, such as enantiomers and diastereomers, are intended unless otherwise indicated. Compounds of the present disclosure that contain
asymmetrically substituted carbon atoms can be isolated in optically active or racemic forms. Methods on how to prepare optically active forms from optically active starting materials are known in the art, such as by resolution of racemic mixtures or by stereoselective synthesis. Many geometric isomers of olefins, C=N double bonds, and the like can also be present in the compounds described herein, and all such stable isomers are contemplated in the present disclosure. Cis and trans geometric isomers of the compounds of the present disclosure are described and may be isolated as a mixture of isomers or as separated isomeric forms.
[00478] Compounds of the present disclosure also include tautomeric forms.
Tautomeric forms result from the swapping of a single bond with an adjacent double bond and the concomitant migration of a proton. Tautomeric forms include prototropic tautomers which are isomeric protonation states having the same empirical formula and total charge. Examples prototropic tautomers include ketone - enol pairs, amide - imidic acid pairs, lactam - lactim pairs, amide - imidic acid pairs, enamine - imine pairs, and annular forms where a proton can occupy two or more positions of a heterocyclic system, such as, 1H- and 3H-imidazole, 1H-, 2H- and 4H- 1,2,4-triazole, 1H- and 2H- isoindole, and 1H- and 2H-pyrazole. Tautomeric forms can be in equilibrium or sterically locked into one form by appropriate substitution.
[00479] Compounds of the present disclosure also include all of the isotopes of the atoms occurring in the intermediate or final compounds. "Isotopes" refers to atoms having the same atomic number but different mass numbers resulting from a different number of neutrons in the nuclei. For example, isotopes of hydrogen include tritium and deuterium.
[00480] The compounds and salts of the present disclosure can be prepared in combination with solvent or water molecules to form solvates and hydrates by routine methods. [00481] Committed: As used herein, the term "committed" means, when referring to a cell, when the cell is far enough into the differentiation pathway where, under normal circumstances, it will continue to differentiate into a specific cell type or subset of cell type instead of into a different cell type or reverting to a lesser differentiated cell type.
[00482] Conserved: As used herein, the term "conserved" refers to nucleotides or amino acid residues of a polynucleotide sequence or polypeptide sequence, respectively, that are those that occur unaltered in the same position of two or more sequences being compared. Nucleotides or amino acids that are relatively conserved are those that are conserved amongst more related sequences than nucleotides or amino acids appearing elsewhere in the sequences.
[00483] In some embodiments, two or more sequences are said to be "completely conserved" if they are 100% identical to one another. In some embodiments, two or more sequences are said to be "highly conserved" if they are at least 70% identical, at least 80% identical, at least 90% identical, or at least 95% identical to one another. In some embodiments, two or more sequences are said to be "highly conserved" if they are about 70% identical, about 80% identical, about 90% identical, about 95%, about 98%, or about 99% identical to one another. In some embodiments, two or more sequences are said to be "conserved" if they are at least 30% identical, at least 40% identical, at least 50% identical, at least 60% identical, at least 70% identical, at least 80% identical, at least 90% identical, or at least 95% identical to one another. In some embodiments, two or more sequences are said to be "conserved" if they are about 30% identical, about 40% identical, about 50% identical, about 60% identical, about 70% identical, about 80% identical, about 90% identical, about 95% identical, about 98% identical, or about 99% identical to one another. Conservation of sequence may apply to the entire length of an
oligonucleotide or polypeptide or may apply to a portion, region or feature thereof.
[00484] Controlled Release: As used herein, the term "controlled release" refers to a pharmaceutical composition or compound release profile that conforms to a particular pattern of release to effect a therapeutic outcome.
[00485] Cyclic or Cyclized: As used herein, the term "cyclic" refers to the presence of a continuous loop. Cyclic molecules need not be circular, only joined to form an unbroken chain of subunits. Cyclic molecules such as the engineered RNA or mRNA of the present invention may be single units or multimers or comprise one or more components of a complex or higher order structure. [00486] Cytostatic: As used herein, "cytostatic" refers to inhibiting, reducing, suppressing the growth, division, or multiplication of a cell (e.g., a mammalian cell (e.g., a human cell)), bacterium, virus, fungus, protozoan, parasite, prion, or a combination thereof.
[00487] Cytotoxic: As used herein, "cytotoxic" refers to killing or causing injurious, toxic, or deadly effect on a cell (e.g., a mammalian cell (e.g., a human cell)), bacterium, virus, fungus, protozoan, parasite, prion, or a combination thereof.
[00488] Delivery: As used herein, "delivery" refers to the act or manner of delivering a compound, substance, entity, moiety, cargo or payload.
[00489] Delivery Agent: As used herein, "delivery agent" refers to any substance which facilitates, at least in part, the in vivo delivery of a polynucleotide, primary construct or mmRNA to targeted cells.
[00490] Destabilized: As used herein, the term "destable," "destabilize," or
"destabilizing region" means a region or molecule that is less stable than a starting, wild- type or native form of the same region or molecule.
[00491] Detectable label: As used herein, "detectable label" refers to one or more markers, signals, or moieties which are attached, incorporated or associated with another entity that is readily detected by methods known in the art including radiography, fluorescence, chemiluminescence, enzymatic activity, absorbance and the like. Detectable labels include radioisotopes, fluorophores, chromophores, enzymes, dyes, metal ions, ligands such as biotin, avidin, streptavidin and haptens, quantum dots, and the like.
Detectable labels may be located at any position in the peptides or proteins disclosed herein. They may be within the amino acids, the peptides, or proteins, or located at the N- or C- termini.
[00492] Developmental Potential: As used herein, "developmental potential" or "developmental potency" refers to the total of all developmental cell fates or cell types that can be achieved by a cell upon differentiation.
[00493] Developmental Potential Altering Factor: As used herein, "developmental potential altering factor" refers to a protein or RNA which can alter the developmental potential of a cell.
[00494] Digest: As used herein, the term "digest" means to break apart into smaller pieces or components. When referring to polypeptides or proteins, digestion results in the production of peptides. [00495] Differentiated cell: As used herein, the term "differentiated cell" refers to any somatic cell that is not, in its native form, pluripotent. Differentiated cell also encompasses cells that are partially differentiated.
[00496] Differentiation: As used herein, the term "differentiation factor" refers to a developmental potential altering factor such as a protein, RNA or small molecule that can induce a cell to differentiate to a desired cell-type.
[00497] Differentiate: As used herein, "differentiate" refers to the process where an uncommitted or less committed cell acquires the features of a committed cell.
[00498] Disease: As used herein, the term "disease" refers to an abnormal condition affecting the body of an organism often showing specific bodily symptoms.
[00499] Disorder: As used herein, the term "disorder, "refers to a disruption of or an interference with normal functions or established systems of the body.
[00500] Distal: As used herein, the term "distal" means situated away from the center or away from a point or region of interest.
[00501] Dose splitting factor (DSF) -ratio of PUD of dose split treatment divided by PUD of total daily dose or single unit dose. The value is derived from comparison of dosing regimens groups.
[00502] Embryonic stem cell: As used herein, the term "embryonic stem cell" refers to naturally occurring pluripotent stem cells of the inner cell mass of the embryonic blastocyst.
[00503] Encapsulate: As used herein, the term "encapsulate" means to enclose, surround or encase.
[00504] Encoded protein cleavage signal: As used herein, "encoded protein cleavage signal" refers to the nucleotide sequence which encodes a protein cleavage signal.
[00505] Engineered: As used herein, embodiments of the invention are "engineered" when they are designed to have a feature or property, whether structural or chemical, that varies from a starting point, wild type or native molecule.
[00506] Exosome: As used herein, "exosome" is a vesicle secreted by mammalian cells or a complex involved in RNA degradation.
[00507] Expression: As used herein, "expression" of a nucleic acid sequence refers to one or more of the following events: (1) production of an RNA template from a DNA sequence (e.g., by transcription); (2) processing of an RNA transcript (e.g., by splicing, editing, 5' cap formation, and/or 3' end processing); (3) translation of an RNA into a polypeptide or protein; and (4) post-translational modification of a polypeptide or protein. [00508] Feature: As used herein, a "feature" refers to a characteristic, a property, or a distinctive element.
[00509] Formulation: As used herein, a "formulation" includes at least a
polynucleotide, primary construct or mmRNA and a delivery agent.
[00510] Fragment: A "fragment," as used herein, refers to a portion. For example, fragments of proteins may comprise polypeptides obtained by digesting full-length protein isolated from cultured cells.
[00511] Functional: As used herein, a "functional" biological molecule is a biological molecule in a form in which it exhibits a property and/or activity by which it is characterized.
[00512] Homology: As used herein, the term "homology" refers to the overall relatedness between polymeric molecules, e.g. between nucleic acid molecules (e.g. DNA molecules and/or RNA molecules) and/or between polypeptide molecules. In some embodiments, polymeric molecules are considered to be "homologous" to one another if their sequences are at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical or similar. The term "homologous" necessarily refers to a comparison between at least two sequences (polynucleotide or polypeptide sequences). In accordance with the invention, two polynucleotide sequences are considered to be homologous if the polypeptides they encode are at least about 50%, 60%, 70%, 80%, 90%, 95%, or even 99% for at least one stretch of at least about 20 amino acids. In some embodiments, homologous polynucleotide sequences are characterized by the ability to encode a stretch of at least 4-5 uniquely specified amino acids. For polynucleotide sequences less than 60 nucleotides in length, homology is determined by the ability to encode a stretch of at least 4-5 uniquely specified amino acids. In accordance with the invention, two protein sequences are considered to be homologous if the proteins are at least about 50%, 60%, 70%, 80%, or 90% identical for at least one stretch of at least about 20 amino acids.
[00513] Identity: As used herein, the term "identity" refers to the overall relatedness between polymeric molecules, e.g., between oligonucleotide molecules (e.g. DNA molecules and/or RNA molecules) and/or between polypeptide molecules. Calculation of the percent identity of two polynucleotide sequences, for example, can be performed by aligning the two sequences for optimal comparison purposes (e.g., gaps can be introduced in one or both of a first and a second nucleic acid sequences for optimal alignment and non-identical sequences can be disregarded for comparison purposes). In certain embodiments, the length of a sequence aligned for comparison purposes is at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or 100% of the length of the reference sequence. The nucleotides at corresponding nucleotide positions are then compared. When a position in the first sequence is occupied by the same nucleotide as the corresponding position in the second sequence, then the molecules are identical at that position. The percent identity between the two sequences is a function of the number of identical positions shared by the sequences, taking into account the number of gaps, and the length of each gap, which needs to be introduced for optimal alignment of the two sequences. The comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm. For example, the percent identity between two nucleotide sequences can be determined using methods such as those described in Computational Molecular Biology, Lesk, A. M., ed., Oxford University Press, New York, 1988; Biocomputing: Informatics and Genome Projects, Smith, D. W., ed., Academic Press, New York, 1993; Sequence Analysis in Molecular Biology, von Heinje, G., Academic Press, 1987; Computer Analysis of Sequence Data, Part I, Griffin, A. M., and Griffin, H. G., eds., Humana Press, New Jersey, 1994; and Sequence Analysis Primer, Gribskov, M. and Devereux, J., eds., M Stockton Press, New York, 1991 ; each of which is incorporated herein by reference. For example, the percent identity between two nucleotide sequences can be determined using the algorithm of Meyers and Miller (CABIOS, 1989, 4: 1 1-17), which has been incorporated into the ALIGN program (version 2.0) using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4. The percent identity between two nucleotide sequences can, alternatively, be determined using the GAP program in the GCG software package using an NWSgapdna.CMP matrix. Methods commonly employed to determine percent identity between sequences include, but are not limited to those disclosed in Carillo, FL, and Lipman, D., SIAM J Applied Math., 48: 1073 (1988); incorporated herein by reference. Techniques for determining identity are codified in publicly available computer programs. Exemplary computer software to determine homology between two sequences include, but are not limited to, GCG program package, Devereux, J., et al, Nucleic Acids Research, 12(1), 387 (1984)), BLASTP, BLASTN, and FASTA Altschul, S. F. et al, J. Molec. Biol, 215, 403 (1990)).
[00514] Inhibit expression of a gene: As used herein, the phrase "inhibit expression of a gene" means to cause a reduction in the amount of an expression product of the gene. The expression product can be an RNA transcribed from the gene (e.g., an mRNA) or a polypeptide translated from an mRNA transcribed from the gene. Typically a reduction in the level of an mRNA results in a reduction in the level of a polypeptide translated therefrom. The level of expression may be determined using standard techniques for measuring mRNA or protein.
[00515] In vitro: As used herein, the term "in vitro" refers to events that occur in an artificial environment, e.g., in a test tube or reaction vessel, in cell culture, in a Petri dish, etc., rather than within an organism (e.g., animal, plant, or microbe).
[00516] In vivo: As used herein, the term "in vivo" refers to events that occur within an organism (e.g., animal, plant, or microbe or cell or tissue thereof).
[00517] Isolated: As used herein, the term "isolated" refers to a substance or entity that has been separated from at least some of the components with which it was associated (whether in nature or in an experimental setting). Isolated substances may have varying levels of purity in reference to the substances from which they have been associated. Isolated substances and/or entities may be separated from at least about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, or more of the other components with which they were initially associated. In some embodiments, isolated agents are more than about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99%, or more than about 99% pure. As used herein, a substance is "pure" if it is substantially free of other components.
[00518] Substantially isolated: By "substantially isolated" is meant that the compound is substantially separated from the environment in which it was formed or detected. Partial separation can include, for example, a composition enriched in the compound of the present disclosure. Substantial separation can include compositions containing at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, at least about 97%, or at least about 99% by weight of the compound of the present disclosure, or salt thereof. Methods for isolating compounds and their salts are routine in the art.
[00519] Linker: As used herein, a linker refers to a group of atoms, e.g., 10-1,000 atoms, and can be comprised of the atoms or groups such as, but not limited to, carbon, amino, alkylamino, oxygen, sulfur, sulfoxide, sulfonyl, carbonyl, and imine. The linker can be attached to a modified nucleoside or nucleotide on the nucleobase or sugar moiety at a first end, and to a payload, e.g., a detectable or therapeutic agent, at a second end. The linker may be of sufficient length as to not interfere with incorporation into a nucleic acid sequence. The linker can be used for any useful purpose, such as to form mmRNA multimers (e.g., through linkage of two or more polynucleotides, primary constructs, or mmRNA molecules) or mmRNA conjugates, as well as to administer a payload, as described herein. Examples of chemical groups that can be incorporated into the linker include, but are not limited to, alkyl, alkenyl, alkynyl, amido, amino, ether, thioether, ester, alkylene, heteroalkylene, aryl, or heterocyclyl, each of which can be optionally substituted, as described herein. Examples of linkers include, but are not limited to, unsaturated alkanes, polyethylene glycols (e.g., ethylene or propylene glycol monomeric units, e.g., diethylene glycol, dipropylene glycol, triethylene glycol, tripropylene glycol, tetraethylene glycol, or tetraethylene glycol), and dextran polymers, Other examples include, but are not limited to, cleavable moieties within the linker, such as, for example, a disulfide bond (-S-S-) or an azo bond (-N=N-), which can be cleaved using a reducing agent or photolysis. Non-limiting examples of a selectively cleavable bond include an amido bond can be cleaved for example by the use of tris(2-carboxyethyl)phosphine (TCEP), or other reducing agents, and/or photolysis, as well as an ester bond can be cleaved for example by acidic or basic hydrolysis.
[00520] MicroRNA (miRNA) binding site: As used herein, a microRNA (miRNA) binding site represents a nucleotide location or region of a nucleic acid transcript to which at least the "seed" region of a miRNA binds.
[00521] Modified: As used herein "modified" refers to a changed state or structure of a molecule of the invention. Molecules may be modified in many ways including chemically, structurally, and functionally. In one embodiment, the mRNA molecules of the present invention are modified by the introduction of non-natural nucleosides and/or nucleotides, e.g., as it relates to the natural ribonucleotides A, U, G, and C. Noncanonical nucleotides such as the cap structures are not considered "modified" although they differ from the chemical structure of the A, C, G, U ribonucleotides.
[00522] Mucus: As used herein, "mucus" refers to the natural substance that is viscous and comprises mucin glycoproteins.
[00523] Multipotent: As used herein, "multipotent" or "partially differentiated cell" when referring to a cell refers to a cell that has a developmental potential to differentiate into cells of one or more germ layers, but not all three germ layers.
[00524] Naturally occurring: As used herein, "naturally occurring" means existing in nature without artificial aid. [00525] Non-human vertebrate: As used herein, a "non human vertebrate" includes all vertebrates except Homo sapiens, including wild and domesticated species. Examples of non-human vertebrates include, but are not limited to, mammals, such as alpaca, banteng, bison, camel, cat, cattle, deer, dog, donkey, gayal, goat, guinea pig, horse, llama, mule, pig, rabbit, reindeer, sheep water buffalo, and yak.
[00526] Off-target: As used herein, "off target" refers to any unintended effect on any one or more target, gene, or cellular transcript.
[00527] Oligopotent: As used herein, "oligopotent" when referring to a cell means to give rise to a more restricted subset of cell lineages than multipotent stem cells..
[00528] Open reading frame: As used herein, "open reading frame" or "ORE" refers to a sequence which does not contain a stop codon in a given reading frame.
[00529] Operably linked: As used herein, the phrase "operably linked" refers to a functional connection between two or more molecules, constructs, transcripts, entities, moieties or the like.
[00530] Optionally substituted: Herein a phrase of the form "optionally substituted X"
(e.g., optionally substituted alkyl) is intended to be equivalent to "X, wherein X is optionally substituted" (e.g., "alkyl, wherein said alkyl is optionally substituted"). It is not intended to mean that the feature "X" (e.g. alkyl) per se is optional.
[00531] Peptide: As used herein, "peptide" is less than or equal to 50 amino acids long, e.g., about 5, 10, 15, 20, 25, 30, 35, 40, 45, or 50 amino acids long.
[00532] Paratope: As used herein, a "paratope" refers to the antigen-binding site of an antibody.
[00533] Patient: As used herein, "patient" refers to a subject who may seek or be in need of treatment, requires treatment, is receiving treatment, will receive treatment, or a subject who is under care by a trained professional for a particular disease or condition.
[00534] Pharmaceutically acceptable: The phrase "pharmaceutically acceptable" is employed herein to refer to those compounds, materials, compositions, and/or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio.
[00535] Pharmaceutically acceptable excipients: The phrase "pharmaceutically acceptable excipient," as used herein, refers any ingredient other than the compounds described herein (for example, a vehicle capable of suspending or dissolving the active compound) and having the properties of being substantially nontoxic and noninflammatory in a patient. Excipients may include, for example: antiadherents, antioxidants, binders, coatings, compression aids, dis integrants, dyes (colors), emollients, emulsifiers, fillers (diluents), film formers or coatings, flavors, fragrances, glidants (flow enhancers), lubricants, preservatives, printing inks, sorbents, suspensing or dispersing agents, sweeteners, and waters of hydration. Exemplary excipients include, but are not limited to: butylated hydroxytoluene (BHT), calcium carbonate, calcium phosphate (dibasic), calcium stearate, croscarmellose, crosslinked polyvinyl pyrrolidone, citric acid, crospovidone, cysteine, ethylcellulose, gelatin, hydroxypropyl cellulose, hydroxypropyl methylcellulose, lactose, magnesium stearate, maltitol, mannitol, methionine, methylcellulose, methyl paraben, microcrystalline cellulose, polyethylene glycol, polyvinyl pyrrolidone, povidone, pregelatinized starch, propyl paraben, retinyl palmitate, shellac, silicon dioxide, sodium carboxymethyl cellulose, sodium citrate, sodium starch glycolate, sorbitol, starch (corn), stearic acid, sucrose, talc, titanium dioxide, vitamin A, vitamin E, vitamin C, and xylitol.
[00536] Pharmaceutically acceptable salts: The present disclosure also includes pharmaceutically acceptable salts of the compounds described herein. As used herein, "pharmaceutically acceptable salts" refers to derivatives of the disclosed compounds wherein the parent compound is modified by converting an existing acid or base moiety to its salt form (e.g., by reacting the free base group with a suitable organic acid).
Examples of pharmaceutically acceptable salts include, but are not limited to, mineral or organic acid salts of basic residues such as amines; alkali or organic salts of acidic residues such as carboxylic acids; and the like. Representative acid addition salts include acetate, adipate, alginate, ascorbate, aspartate, benzenesulfonate, benzoate, bisulfate, borate, butyrate, camphorate, camphorsulfonate, citrate, cyclopentanepropionate, digluconate, dodecylsulfate, ethanesulfonate, fumarate, glucoheptonate,
glycerophosphate, hemisulfate, heptonate, hexanoate, hydrobromide, hydrochloride, hydroiodide, 2-hydroxy-ethanesulfonate, lactobionate, lactate, laurate, lauryl sulfate, malate, maleate, malonate, methanesulfonate, 2-naphthalenesulfonate, nicotinate, nitrate, oleate, oxalate, palmitate, pamoate, pectinate, persulfate, 3-phenylpropionate, phosphate, picrate, pivalate, propionate, stearate, succinate, sulfate, tartrate, thiocyanate, toluenesulfonate, undecanoate, valerate salts, and the like. Representative alkali or alkaline earth metal salts include sodium, lithium, potassium, calcium, magnesium, and the like, as well as nontoxic ammonium, quaternary ammonium, and amine cations, including, but not limited to ammonium, tetramethylammonium, tetraethylammonium, methylamine, dimethylamine, trimethylamine, triethylamine, ethylamine, and the like. The pharmaceutically acceptable salts of the present disclosure include the conventional non-toxic salts of the parent compound formed, for example, from non-toxic inorganic or organic acids. The pharmaceutically acceptable salts of the present disclosure can be synthesized from the parent compound which contains a basic or acidic moiety by conventional chemical methods. Generally, such salts can be prepared by reacting the free acid or base forms of these compounds with a stoichiometric amount of the appropriate base or acid in water or in an organic solvent, or in a mixture of the two; generally, nonaqueous media like ether, ethyl acetate, ethanol, isopropanol, or acetonitrile are preferred. Lists of suitable salts are found in Remington 's Pharmaceutical Sciences, 17th ed., Mack Publishing Company, Easton, Pa., 1985, p. 1418, Pharmaceutical Salts: Properties, Selection, and Use, P.H. Stahl and C.G. Wermuth (eds.), Wiley-VCH, 2008, and Berge et al, Journal of Pharmaceutical Science, 66, 1-19 (1977), each of which is incorporated herein by reference in its entirety.
[00537] Pharmacokinetic: As used herein, "pharmacokinetic" refers to any one or more properties of a molecule or compound as it relates to the determination of the fate of substances administered to a living organism. Pharmacokinetics is divided into several areas including the extent and rate of absorption, distribution, metabolism and excretion. This is commonly referred to as ADME where: (A) Absorption is the process of a substance entering the blood circulation; (D) Distribution is the dispersion or
dissemination of substances throughout the fluids and tissues of the body; (M)
Metabolism (or Biotransformation) is the irreversible transformation of parent compounds into daughter metabolites; and (E) Excretion (or Elimination) refers to the elimination of the substances from the body. In rare cases, some drugs irreversibly accumulate in body tissue.
[00538] Pharmaceutically acceptable solvate: The term "pharmaceutically acceptable solvate," as used herein, means a compound of the invention wherein molecules of a suitable solvent are incorporated in the crystal lattice. A suitable solvent is
physiologically tolerable at the dosage administered. For example, solvates may be prepared by crystallization, recrystallization, or precipitation from a solution that includes organic solvents, water, or a mixture thereof. Examples of suitable solvents are ethanol, water (for example, mono-, di-, and tri-hydrates), N-methylpyrrolidinone (ΝΜΡ), dimethyl sulfoxide (DMSO), N,N'-dimethylformamide (DMF), N,N'-dimethylacetamide (DMAC), l,3-dimethyl-2-imidazolidinone (DMEU), l,3-dimethyl-3,4,5,6-tetrahydro-2- (lH)-pyrimidinone (DMPU), acetonitrile (ACN), propylene glycol, ethyl acetate, benzyl alcohol, 2-pyrrolidone, benzyl benzoate, and the like. When water is the solvent, the solvate is referred to as a "hydrate."
[00539] Physicochemical: As used herein, "physicochemical" means of or relating to a physical and/or chemical property.
[00540] Pluripotent: As used herein, "pluripotent" refers to a cell with the
developmental potential, under different conditions, to differentiate to cell types characteristic of all three germ layers.
[00541] Pluripotency: As used herein, "pluripotency" or "pluripotent state" refers to the developmental potential of a cell where the cell has the ability to differentitate into all three embryonic germ layers (endoderm, mesoderm and ectoderm).
[00542] Preventing: As used herein, the term "preventing" refers to partially or completely delaying onset of an infection, disease, disorder and/or condition; partially or completely delaying onset of one or more symptoms, features, or clinical manifestations of a particular infection, disease, disorder, and/or condition; partially or completely delaying onset of one or more symptoms, features, or manifestations of a particular infection, disease, disorder, and/or condition; partially or completely delaying progression from an infection, a particular disease, disorder and/or condition; and/or decreasing the risk of developing pathology associated with the infection, the disease, disorder, and/or condition.
[00543] Prodrug: The present disclosure also includes prodrugs of the compounds described herein. As used herein, "prodrugs" refer to any substance, molecule or entity which is in a form predicate for that substance, molecule or entity to act as a therapeutic upon chemical or physical alteration. Prodrugs may by covalently bonded or sequestered in some way and which release or are converted into the active drug moiety prior to, upon or after administered to a mammalian subject. Prodrugs can be prepared by modifying functional groups present in the compounds in such a way that the modifications are cleaved, either in routine manipulation or in vivo, to the parent compounds. Prodrugs include compounds wherein hydroxyl, amino, sulfhydryl, or carboxyl groups are bonded to any group that, when administered to a mammalian subject, cleaves to form a free hydroxyl, amino, sulfhydryl, or carboxyl group respectively. Preparation and use of prodrugs is discussed in T. Higuchi and V. Stella, "Pro-drugs as Novel Delivery
Systems," Vol. 14 of the A.C.S. Symposium Series, and in Bioreversible Carriers in Drug Design, ed. Edward B. Roche, American Pharmaceutical Association and Pergamon Press, 1987, both of which are hereby incorporated by reference in their entirety.
[00544] Proliferate: As used herein, the term "proliferate" means to grow, expand or increase or cause to grow, expand or increase rapidly. "Proliferative" means having the ability to proliferate. "Anti-proliferative" means having properties counter to or inapposite to proliferative properties.
[00545] Progenitor cell: As used herein, the term "progenitor cell" refers to cells that have greater developmental potential relative to a cell which it can give rise to by differentiation.
[00546] Protein cleavage site: As used herein, "protein cleavage site" refers to a site where controlled cleavage of the amino acid chain can be accomplished by chemical, enzymatic or photochemical means.
[00547] Protein cleavage signal: As used herein "protein cleavage signal" refers to at least one amino acid that flags or marks a polypeptide for cleavage.
[00548] Protein of interest: As used herein, the terms "proteins of interest" or "desired proteins" include those provided herein and fragments, mutants, variants, and alterations thereof.
[00549] Proximal: As used herein, the term "proximal" means situated nearer to the center or to a point or region of interest.
[00550] Purified: As used herein, "purify," "purified," "purification" means to make substantially pure or clear from unwanted components, material defilement, admixture or imperfection.
[00551] Repeated transfection: As used herein, the term "repeated transfection" refers to transfection of the same cell culture with a polynucleotide, primary construct or mmRNA a plurality of times. The cell culture can be transfected at least twice, at least 3 times, at least 4 times, at least 5 times, at least 6 times, at least 7 times, at least 8 times, at least 9 times, at least 10 times, at least 1 1 times, at least 12 times, at least 13 times, at least 14 times, at least 15 times, at least 16 times, at least 17 times at least 18 times, at least 19 times, at least 20 times, at least 25 times, at least 30 times, at least 35 times, at least 40 times, at least 45 times, at least 50 times or more.
[00552] Reprogramming: As used herein, "reprogramming" refers to a process that reverses the developmental potential of a cell or population of cells.
[00553] Reprogramming factor: As used herein, the term "reprogramming factor" refers to a developmental potential altering factor such as a protein, RNA or small molecule, the expression of which contributes to the reprogramming of a cell to a less differentiated or undifferentiated state.
[00554] Sample: As used herein, the term "sample" or "biological sample" refers to a subset of its tissues, cells or component parts (e.g. body fluids, including but not limited to blood, mucus, lymphatic fluid, synovial fluid, cerebrospinal fluid, saliva, amniotic fluid, amniotic cord blood, urine, vaginal fluid and semen). A sample further may include a homogenate, lysate or extract prepared from a whole organism or a subset of its tissues, cells or component parts, or a fraction or portion thereof, including but not limited to, for example, plasma, serum, spinal fluid, lymph fluid, the external sections of the skin, respiratory, intestinal, and genitourinary tracts, tears, saliva, milk, blood cells, tumors, organs. A sample further refers to a medium, such as a nutrient broth or gel, which may contain cellular components, such as proteins or nucleic acid molecule.
[00555] Signal Sequences: As used herein, the phrase "signal sequences" refers to a sequence which can direct the transport or localization of a protein.
[00556] Single unit dose: As used herein, a "single unit dose" is a dose of any therapeutic administered in one dose/at one time/single route/single point of contact, i.e., single administration event.
[00557] Similarity: As used herein, the term "similarity" refers to the overall relatedness between polymeric molecules, e.g. between polynucleotide molecules (e.g. DNA molecules and/or RNA molecules) and/or between polypeptide molecules.
Calculation of percent similarity of polymeric molecules to one another can be performed in the same manner as a calculation of percent identity, except that calculation of percent similarity takes into account conservative substitutions as is understood in the art.
[00558] Somatic cell: As used herein, "somatic cells" refers to any cell other than a germ cell, a cell present in or obtained from a pre-implantation embryo, or a cell resulting from proliferation of such a cell in vitro.
[00559] Somatic stem cell: As used herein, a "somatic stem cell" refers to any pluripotent or multipotent stem cell derived from non-embryonic tissue including fetal, juvenile and adult tissue.
[00560] Somatic pluripotent cell: As used herein, a "somatic pluripotent cell" refers to a somatic cell that has had its developmental potential altered to that of a pluripotent state.
[00561] Split dose: As used herein, a "split dose" is the division of single unit dose or total daily dose into two or more doses. [00562] Stable: As used herein "stable" refers to a compound that is sufficiently robust to survive isolation to a useful degree of purity from a reaction mixture, and preferably capable of formulation into an efficacious therapeutic agent.
[00563] Stabilized: As used herein, the term "stabilize", "stabilized," "stabilized region" means to make or become stable.
[00564] Stem cell: As used herein, the term "stem cell" refers to a cell in an
undifferentiated or partially differentiated state that has the property of self-renewal and ahs the developmental potential to differentiate into multiple cell types, without a specific developmental potential. A stem cell may be able capable of proliferation and giving rise to more such stem cells while maintaining its developmental potential.
[00565] Subject: As used herein, the term "subject" or "patient" refers to any organism to which a composition in accordance with the invention may be administered, e.g., for experimental, diagnostic, prophylactic, and/or therapeutic purposes. Typical subjects include animals (e.g., mammals such as mice, rats, rabbits, non-human primates, and humans) and/or plants.
[00566] Substantially: As used herein, the term "substantially" refers to the qualitative condition of exhibiting total or near-total extent or degree of a characteristic or property of interest. One of ordinary skill in the biological arts will understand that biological and chemical phenomena rarely, if ever, go to completion and/or proceed to completeness or achieve or avoid an absolute result. The term "substantially" is therefore used herein to capture the potential lack of completeness inherent in many biological and chemical phenomena.
[00567] Substantially equal: As used herein as it relates to time differences between doses, the term means plus/minus 2%.
[00568] Substantially simultaneously: As used herein and as it relates to plurality of doses, the term means within 2 seconds.
[00569] Suffering from: An individual who is "suffering from" a disease, disorder, and/or condition has been diagnosed with or displays one or more symptoms of a disease, disorder, and/or condition.
[00570] Susceptible to: An individual who is "susceptible to" a disease, disorder, and/or condition has not been diagnosed with and/or may not exhibit symptoms of the disease, disorder, and/or condition but harbors a propensity to develop a disease or its symptoms. In some embodiments, an individual who is susceptible to a disease, disorder, and/or condition (for example, cancer) may be characterized by one or more of the following: (1) a genetic mutation associated with development of the disease, disorder, and/or condition; (2) a genetic polymorphism associated with development of the disease, disorder, and/or condition; (3) increased and/or decreased expression and/or activity of a protein and/or nucleic acid associated with the disease, disorder, and/or condition; (4) habits and/or lifestyles associated with development of the disease, disorder, and/or condition; (5) a family history of the disease, disorder, and/or condition; and (6) exposure to and/or infection with a microbe associated with development of the disease, disorder, and/or condition. In some embodiments, an individual who is susceptible to a disease, disorder, and/or condition will develop the disease, disorder, and/or condition. In some embodiments, an individual who is susceptible to a disease, disorder, and/or condition will not develop the disease, disorder, and/or condition.
[00571] Sustained release: As used herein, the term "sustained release" refers to a pharmaceutical composition or compound release profile that conforms to a release rate over a specific period of time.
[00572] Synthetic: The term "synthetic" means produced, prepared, and/or
manufactured by the hand of man. Synthesis of polynucleotides or polypeptides or other molecules of the present invention may be chemical or enzymatic.
[00573] Targeted Cells: As used herein, "targeted cells" refers to any one or more cells of interest. The cells may be found in vitro, in vivo, in situ or in the tissue or organ of an organism. The organism may be an animal, preferably a mammal, more preferably a human and most preferably a patient.
[00574] Therapeutic Agent: The term "therapeutic agent" refers to any agent that, when administered to a subject, has a therapeutic, diagnostic, and/or prophylactic effect and/or elicits a desired biological and/or pharmacological effect.
[00575] Therapeutically effective amount: As used herein, the term "therapeutically effective amount" means an amount of an agent to be delivered (e.g., nucleic acid, drug, therapeutic agent, diagnostic agent, prophylactic agent, etc.) that is sufficient, when administered to a subject suffering from or susceptible to an infection, disease, disorder, and/or condition, to treat, improve symptoms of, diagnose, prevent, and/or delay the onset of the infection, disease, disorder, and/or condition.
[00576] Therapeutically effective outcome: As used herein, the term "therapeutically effective outcome" means an outcome that is sufficient in a subject suffering from or susceptible to an infection, disease, disorder, and/or condition, to treat, improve symptoms of, diagnose, prevent, and/or delay the onset of the infection, disease, disorder, and/or condition.
[00577] Total daily dose: As used herein, a "total daily dose" is an amount given or prescribed in 24 hr period. It may be administered as a single unit dose.
[00578] Totipotency: As used herein, "totipotency" refers to a cell with a developmental potential to make all of the cells found in the adult body as well as the extra-embryonic tissues, including the placenta.
[00579] Transcription factor: As used herein, the term "transcription factor" refers to a DNA-binding protein that regulates transcription of DNA into RNA, for example, by activation or repression of transcription. Some transcription factors effect regulation of transcription alone, while others act in concert with other proteins. Some transcription factor can both activate and repress transcription under certain conditions. In general, transcription factors bind a specific target sequence or sequences highly similar to a specific consensus sequence in a regulatory region of a target gene. Transcription factors may regulate transcription of a target gene alone or in a complex with other molecules.
[00580] Transcription: As used herein, the term "transcription" refers to methods to introduce exogenous nucleic acids into a cell. Methods of transfection include, but are not limited to, chemical methods, plysical treatments and cationic lipids or mixtures.
[00581] Transdifferentiation: As used herein, "trans differentiation" refers to the capacity of differentiated cells of one type to lose identifying characteristics and to change their phenotype to that of other fully differentiated cells.
[00582] Treating: As used herein, the term "treating" refers to partially or completely alleviating, ameliorating, improving, relieving, delaying onset of, inhibiting progression of, reducing severity of, and/or reducing incidence of one or more symptoms or features of a particular infection, disease, disorder, and/or condition. For example, "treating" cancer may refer to inhibiting survival, growth, and/or spread of a tumor. Treatment may be administered to a subject who does not exhibit signs of a disease, disorder, and/or condition and/or to a subject who exhibits only early signs of a disease, disorder, and/or condition for the purpose of decreasing the risk of developing pathology associated with the disease, disorder, and/or condition.
[00583] Unmodified: As used herein, "unmodified" refers to any substance, compound or molecule prior to being changed in any way. Unmodified may, but does not always, refer to the wild type or native form of a biomolecule. Molecules may undergo a series of modifications whereby each modified molecule may serve as the "unmodified" starting molecule for a subsequent modification.
Equivalents and Scope
[00584] Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments in accordance with the invention described herein. The scope of the present invention is not intended to be limited to the above Description, but rather is as set forth in the appended claims.
[00585] In the claims, articles such as "a," "an," and "the" may mean one or more than one unless indicated to the contrary or otherwise evident from the context. Claims or descriptions that include "or" between one or more members of a group are considered satisfied if one, more than one, or all of the group members are present in, employed in, or otherwise relevant to a given product or process unless indicated to the contrary or otherwise evident from the context. The invention includes embodiments in which exactly one member of the group is present in, employed in, or otherwise relevant to a given product or process. The invention includes embodiments in which more than one, or all of the group members are present in, employed in, or otherwise relevant to a given product or process.
[00586] It is also noted that the term "comprising" is intended to be open and permits but does not require the inclusion of additional elements or steps. When the term
"comprising" is used herein, the term "consisting of is thus also encompassed and disclosed.
[00587] Where ranges are given, endpoints are included. Furthermore, it is to be understood that unless otherwise indicated or otherwise evident from the context and understanding of one of ordinary skill in the art, values that are expressed as ranges can assume any specific value or subrange within the stated ranges in different embodiments of the invention, to the tenth of the unit of the lower limit of the range, unless the context clearly dictates otherwise.
[00588] In addition, it is to be understood that any particular embodiment of the present invention that falls within the prior art may be explicitly excluded from any one or more of the claims. Since such embodiments are deemed to be known to one of ordinary skill in the art, they may be excluded even if the exclusion is not set forth explicitly herein. Any particular embodiment of the compositions of the invention (e.g., any nucleic acid or protein encoded thereby; any method of production; any method of use; etc. ) can be excluded from any one or more claims, for any reason, whether or not related to the existence of prior art.
[00589] All cited sources, for example, references, publications, databases, database entries, and art cited herein, are incorporated into this application by reference, even if not expressly stated in the citation. In case of conflicting statements of a cited source and the instant application, the statement in the instant application shall control.
[00590] Section and table headings are not intended to be limiting.
EXAMPLES
Example 1. DNA constructs for Synthetic Polynucleotide and sgRNA Production
[00591] Synthetic polynucleotides and sgRNA of the invention are produced via creation of a DNA construct; PCR amplification of a cDNA template; in-vitro transcription of the cDNA template (using, in some embodiments, modified nucleotides); if necessary, post-in vitro transcription enzymatic poly -A tailing and/or 5' capping; and purification and analysis.
[00592] The DNA construct for the synthetic polynucleotide includes an open reading frame. The open reading frame (ORF) coding for the CRISPR related protein, e.g., dCAS9 or dCAS9-activator fusion protein, may be flanked by a 5' untranslated region (UTR) which may contain a strong Kozak trans lational initiation signal and/or an alpha- globin 3' UTR which may include an oligo(dT) sequence for templated addition of a poly- A tail.
[00593] The ORF may also include various upstream or downstream additions (such as, but not limited to, β-globin, tags, etc.) may be ordered from an optimization service such as, but limited to, DNA2.0 (Menlo Park, CA) and may contain multiple cloning sites which may have Xbal recognition.
[00594] The DNA construct for the sgRNA of the invention is made using similar methods. The plasmid construct includes an insert with a sgRNA sequence including the N(20-25) guides sequence and the guide scaffold sequence flanked on the 5' end with a RNA polymerase specific 5'UTR, e.g., a T7 polymerase 5' UTR.
[00595] The DNA construct for the synthetic polynucleotide and/or the sgRNA is transformed in E. coli. For the present invention, NEB DH5 -alpha Competent E. coli are used. Transformations are performed according to NEB instructions using 100 ng of plasmid. The protocol is as follows: 1. Thaw a tube of NEB 5 -alpha Competent E. coli cells on ice for 10 minutes.
2. Add 1-5 μΐ containing 1 pg-100 ng of plasmid DNA to the cell mixture. Carefully flick the tube 4-5 times to mix cells and DNA. Do not vortex.
3. Place the mixture on ice for 30 minutes. Do not mix.
4. Heat shock at 42°C for exactly 30 seconds. Do not mix.
5. Place on ice for 5 minutes. Do not mix.
6. Pipette 950 μΐ of room temperature SOC into the mixture.
7. Place at 37°C for 60 minutes. Shake vigorously (250 rpm) or rotate.
8. Warm selection plates to 37°C.
9. Mix the cells thoroughly by flicking the tube and inverting.
[00596] Alternatively, incubate at 30°C for 24-36 hours or 25°C for 48 hours.
[00597] A single colony is then used to inoculate 5 ml of LB growth media using the appropriate antibiotic and then allowed to grow (250 RPM, 37° C) for 5 hours. This is then used to inoculate a 200 ml culture medium and allowed to grow overnight under the same conditions.
[00598] To isolate the plasmid (up to 850 μg), a maxi prep is performed using the Invitrogen PURELINK™ HiPure Maxiprep Kit (Carlsbad, CA), following the manufacturer's instructions.
[00599] In order to generate cDNA for In Vitro Transcription (IVT), the plasmid is first linearized using a restriction enzyme such as Xbal. A typical restriction digest with Xbal will comprise the following: Plasmid 1.0 μg; lOx Buffer 1.0 μΐ; Xbal 1.5 μΐ; dH20 up to 10 μΐ; incubated at 37° C for 1 hr. If performing at lab scale (< 5μg), the reaction is cleaned up using Invitrogen' s PURELINK™ PCR Micro Kit (Carlsbad, CA) per manufacturer's instructions. Larger scale purifications may need to be done with a product that has a larger load capacity such as Invitrogen's standard PURELINK™ PCR Kit (Carlsbad, CA). Following the cleanup, the linearized vector is quantified using the NanoDrop and analyzed to confirm linearization using agarose gel electrophoresis.
Example 2. PCR for cDNA Production
[00600] The linearized plasmid (encoding the synthetic polynucleotide encoding the CRISPR related protein or encoding the sgRNA) is amplified using PCR for preparation of cDNA, e.g., a transcription template. PCR procedures for the preparation of cDNA are performed using 2x KAPA HIFI™ HotStart ReadyMix by Kapa Biosystems (Woburn, MA). This system includes 2x KAPA ReadyMixl2.5 μΐ; Forward Primer (10 uM); 0.75 μΐ; Reverse Primer (10 uM) 0.75 μΐ; Template cDNA ; 100 ng; and dH20 diluted to 25.0 μΐ. The reaction conditions are at 95° C for 5 min. and 25 cycles of 98° C for 20 sec, then 58° C for 15 sec, then 72° C for 45 sec, then 72° C for 5 min. then 4° C to termination.
[00601] In some embodiments, the reverse primer of the instant invention incorporates a poly-T o for a poly-A^o in the mRNA. Other reverse primers with longer or shorter poly(T) tracts can be used to adjust the length of the poly(A) tail in the mRNA.
[00602] The reaction is cleaned up using Invitrogen's PURELINK™ PCR Micro Kit (Carlsbad, CA) per manufacturer's instructions (up to 5 μg). Larger reactions will require a cleanup using a product with a larger capacity. Following the cleanup, the cDNA is quantified using the NanoDrop and analyzed by agarose gel electrophoresis to confirm the cDNA is the expected size. The cDNA is then submitted for sequencing analysis before proceeding to the in vitro transcription reaction.
Example 3. In vitro Transcription (IVT)
[00603] The amplified product cDNA is used as a template for in vitro transcription to generate synthetic polynucleotides and/or synthetic sgRNAs. The input nucleotide triphosphate (NTP) mix is made in-house using natural and un-natural NTPs. The in vitro transcription reaction generates modified synthetic polynucleotides and/or sgRNA.
[00604] A typical in vitro transcription reaction includes the following:
Template cDNA 1.0 μg lOx transcription buffer (400 mM Tris-HCl pH 2.0 μΐ
8.0, 190 mM MgC12, 50 mM DTT, 10 mM
Spermidine)
Custom NTPs (25mM each) 7.2 μΐ
RNase Inhibitor 20 U
T7 RNA polymerase 3000 U
dH20 Up to 20.0 μΐ
Incubation at 37° C for 3 hr-5 hrs.
[00605] The synthetic polynucleotide and/or synthetic sgRNA may be modified to reduce the cellular innate immune response. The modifications to reduce the cellular response may include those described herein, e.g., pseudouridine (ψ) and 5-methyl- cytidine (5meC, 5mc or m5C). (See, Kariko K et al. Immunity 23 : 165-75 (2005), Kariko K et al. Mol Ther 16: 1833-40 (2008), Anderson BR et al. NAR (2010); each of which is herein incorporated by reference in their entirety).
[00606] The crude IVT mix may be stored at 4° C overnight for cleanup the next day. 1 U of RNase-free DNase is then used to digest the original template. After 15 minutes of incubation at 37° C, the mRNA is purified using Ambion's MEGACLEAR™ Kit (Austin, TX) following the manufacturer's instructions. This kit can purify up to 500 μg of RNA. Following the cleanup, the RNA is quantified using the NanoDrop and analyzed by agarose gel electrophoresis to confirm the RNA is the proper size and that no degradation of the RNA has occurred.
Example 4. PolyA Tailing Reaction
[00607] In some embodiments, the synthetic polynucleotide is synthesized without a poly -A tail, i.e., the cDNA construct is amplified without a poly-T. Without a poly-T in the cDNA, a poly-A tailing reaction must be performed before cleaning the final product. This is done by mixing Capped IVT RNA (100 μΐ); RNase Inhibitor (20 U); lOx Tailing Buffer (0.5 M Tris-HCl (pH 8.0), 2.5 M NaCl, 100 mM MgCl2)(12.0 μΐ); 20 mM ATP (6.0 μΐ); Poly-A Polymerase (20 U); dH20 up to 123.5 μΐ and incubation at 37° C for 30 min. If the poly-A tail is already in the transcript, then the tailing reaction may be skipped and proceed directly to cleanup with Ambion's MEGACLEAR™ kit (Austin, TX) (up to 500 μg). Poly-A Polymerase is preferably a recombinant enzyme expressed in yeast.
[00608] For studies performed and described herein, the poly-A tail is encoded in the IVT template to comprise 160 nucleotides in length. However, it should be understood that the processivity or integrity of the polyA tailing reaction may not always result in exactly 160 nucleotides. Hence polyA tails of approximately 160 nucleotides, e.g., about 150-165, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164 or 165 are within the scope of the invention.
Example 5. 5' capping of the synthetic polynucleotide
[00609] 5'-capping of the synthetic polynucleotide (modified RNA) may be completed concomitantly during the in vzYro-transcription reaction or alternatively enzymatically capped post-transcription.
[00610] 5'-capping of the synthetic polynucleotide(modified RNA) may be completed concomitantly during the in vzYro-transcription reaction using the following chemical RNA cap analogs to generate the 5'-guanosine cap structure according to manufacturer protocols: 3 '-0-Me-m7G(5')ppp(5') G [the ARCA cap];G(5')ppp(5')A; G(5')ppp(5')G; m7G(5')ppp(5')A; m7G(5')ppp(5')G (New England BioLabs, Ipswich, MA).
[00611] 5'-capping of modified RNA may be completed post-transcriptionally using a Vaccinia Virus Capping Enzyme to generate the "Cap 0" structure: m7G(5')ppp(5')G (New England BioLabs, Ipswich, MA). Cap 1 structure may be generated using both Vaccinia Virus Capping Enzyme and a 2'-0 methyl-trans ferase to generate:
m7G(5')ppp(5')G-2'-0-methyl. Cap 2 structure may be generated from the Cap 1 structure followed by the 2'-0-methylation of the 5 '-antepenultimate nucleotide using a 2'-0 methyl-transferase. Cap 3 structure may be generated from the Cap 2 structure followed by the 2'-0-methylation of the 5'-preantepenultimate nucleotide using a 2'-0 methyl-transferase. Enzymes are preferably derived from a recombinant source.
[00612] Post-transcription capping of the synthetic polynucleotide is performed as follows. The reaction mixture includes: Γν RNA 60 μg-180μg and dH20 up to 72 μΐ. The mixture is incubated at 65° C for 5 minutes to denature RNA, and then is transferred immediately to ice.
[00613] The protocol then involves the mixing of lOx Capping Buffer (0.5 M Tris-HCl (pH 8.0), 60 mM KC1, 12.5 mM MgCl2) (10.0 μΐ); 20 mM GTP (5.0 μΐ); 20 mM S- Adenosyl Methionine (2.5 μΐ); RNase Inhibitor (100 U); 2'-0-Methyltransferase (400U); Vaccinia capping enzyme (Guanylyl transferase) (40 U); dH20 (Up to 28 μΐ); and incubation at 37° C for 30 minutes for 60 μg RNA or up to 2 hours for 180 μg of RNA.
[00614] The capped synthetic polynucleotide is then purified using Ambion's
MEGACLEAR™ Kit (Austin, TX) following the manufacturer's instructions. Following the cleanup, the capped synthetic polynucleotide is quantified using the NANODROP™ (ThermoFisher, Waltham, MA) and analyzed by agarose gel electrophoresis to confirm the RNA is the proper size and that no degradation of the RNA has occurred. The RNA product may also be sequenced by running a reverse-transcription-PCR to generate the cDNA for sequencing.
[00615] The capping efficiency of the synthetic polynucleotide is assayed using a number of experimental techniques. The capped synthetic polynucleotide is transfected into cells and the amount of CRISPR related protein is assayed using, e.g., ELISA.
Higher levels of protein expression correlates with higher capping efficiency. The capped synthetic polynucleotide is run on an agarose-urea gel-electrophoresis; a synthetic polynucleotide with a single, consolidated band by electrophoresis corresponds to a higher purity product compared to a synthetic polynucleotide with multiple bands or streaking bands. The capped synthetic polynucleotide is run on an HPLC column;
synthetic polynucleotide with a single HPLC peak corresponds to a higher purity product. The capped synthetic polynucleotide is transfected into human primary keratinocytes at multiple concentrations. At 6, 12, 24 and 36 hours post-transfection the amount of pro- inflammatory cytokines such as TNF-alpha and IFN-beta secreted into the culture medium are assayed by ELISA. Synthetic mRNAs that secrete higher levels of proinflammatory cytokines into the medium correspond to a synthetic mRNA containing an immune-activating cap structure. The capped synthetic polynucleotide is analyzed for capping reaction efficiency by LC-MS after capped mRNA nuclease treatment. Nuclease treatment of capped mRNAs yields a mixture of free nucleotides and the capped 5'-5- triphosphate cap structure detectable by LC-MS. The amount of capped product on the LC-MS spectra is expressed as a percent of total mRNA from the reaction and would correspond to capping reaction efficiency. The cap structure with higher capping reaction efficiency would have a higher amount of capped product by LC-MS.
Example 6. Methods for Analysis of synthetic polynucleotides and synthetic sgRNA
[00616] Agarose Gel Electrophoresis of Modified RNA or RT PCR Products:
Individual modified RNAs (200-400 ng in a 20 μΐ volume) or reverse transcribed PCR products (200-400 ng) are loaded into a well on a non-denaturing 1.2% Agarose E-Gel (Invitrogen, Carlsbad, CA) and run for 12-15 minutes according to the manufacturer protocol.
[00617] Nanodrop Modified RNA Quantification and UV Spectral Data: Modified RNAs in TE buffer (1 μΐ) are used for Nanodrop UV absorbance readings to quantitate the yield of each modified RNA from an in vitro transcription reaction.
Example 7. Method of Screening for Protein Expression
[00618] After transfection of cells with synthetic polynucleotide encoding a CRISPR related protein, protein expression is analyzed.
A. Electrospray Ionization
[00619] A biological sample which may contain proteins encoded by synthetic polynucleotides administered to the cells or subject is prepared and analyzed according to the manufacturer protocol for electrospray ionization (ESI) using 1, 2, 3 or 4 mass analyzers. A biologic sample may also be analyzed using a tandem ESI mass spectrometry system.
[00620] Patterns of protein fragments, or whole proteins, are compared to known controls for a given protein and identity is determined by comparison.
B. Matrix-Assisted Laser Desorption/Ionization [00621] A biological sample which may contain proteins encoded by synthetic polynucleotides administered to the cells or subject is prepared and analyzed according to the manufacturer protocol for matrix-assisted laser desorption/ionization (MALDI).
[00622] Patterns of protein fragments, or whole proteins, are compared to known controls for a given protein and identity is determined by comparison.
C. Liquid Chromatography-Mass spectrometry-Mass spectrometry
[00623] A biological sample, which may contain proteins encoded by synthetic polynucleotides, may be treated with a trypsin enzyme to digest the proteins contained within. The resulting peptides are analyzed by liquid chromatography-mass
spectrometry-mass spectrometry (LC/MS/MS). The peptides are fragmented in the mass spectrometer to yield diagnostic patterns that can be matched to protein sequence databases via computer algorithms. The digested sample may be diluted to achieve 1 ng or less starting material for a given protein. Biological samples containing a simple buffer background (e.g. water or volatile salts) are amenable to direct in-solution digest; more complex backgrounds (e.g. detergent, non-volatile salts, glycerol) require an additional clean-up step to facilitate the sample analysis.
[00624] Patterns of protein fragments, or whole proteins, are compared to known controls for a given protein and identity is determined by comparison.
Example 8. Microphysiological Systems
[00625] Synthetic polynucleotides encoding CRISPR related proteins are formulated using one of the methods described herein such as in buffer, lipid nanoparticles and PLGA. These formulations are then administered to or contacted with
microphysiological systems created from organ chips as described in International Publication Nos. WO2013086502, WO2013086486 and WO2013086505, the contents of each of which are herein incorporated by reference in its entirety.
Example 9: Design of DNA templates for synthetic polynucleotides encoding Cas9 and dCas9-effector domain fusion proteins
[00626] Plasmids were designed for use as in vitro transcription templates to manufacture chemically synthetic polynucleotides as described herein. Two plasmids were designed to contain codon optimized Cas9 as described by Cong and Mali, respectively (Science (2013) 339:819-23 and Science (2013) 339:823-6.) The first plasmid encoded FLAG-tagged Cas9 and the second plasmid encoded untagged Cas9.
Two plasmids were designed to contain codon optimized dcas9 that is fused to different effector domains (see Cell (2013) 154:442-51 and Nature Methods (2013) 10:977-979). Coding sequences were places under the control of T7 polymerase promoter for in vitro transcription of modified mRNA.
[00627] Sequences of the Cas9, dCAS9 gene and effector domains are found in the Tables below.
[00628] The following 5'UTR and 3'UTR sequences were used:
5 ' UTR
TCAAGCTTTTGGACCCTCGTACAGAAGCTAATACGACTCACTATAGGGAAATAAGAGAGAAA AGAAGAGTAAGAAGAAATATAAGAGCCACC (SEQ ID NO: 71)
3' UTR
TGATAATAGgctg gagcctcggtggccatgctt cttgcccctt gggcctcccc ccagcccctc ctccccttcc tgcacccgtacccccgtggt ctttgaataa
agtctgagtg ggcggc TCTAGA (SEQ ID NO: SI)
[00629] The following constructs were created: (3) dCas9- HA tag-2xSV40NLS- KRAB and (4) dCas9-NLS-FLAG-VP64.
[00630] In other embodiments, the sequence-encoding codon-optimized Streptococcus pyogenes dCas9 gene can be fused with an HA-tag, one or more NLSs (e.g., SV40 NLSs, for example, one or two NLSs, optionally at the N- and/or C-terminus) and/or a detection tag (e.g., HA tag, FLAG tag, tagBFP, or the like). Any of the above can be featured alone or in combination with an effector domain (KRAB, CSD, WRPW, VP64, or p65AD domains) in the Cas9 constructs of the invention, for example, to facilitate up or down- regulation). Sequences of various Cas9, dCAS9 gene and effector domains are found in the Tables below.
[00631] Cas9 or dCas9 expression can be regulated further by engineering of miR regulatory sequences into UTR of the various constructs. Two miR- 122 regulatory sequence-containing constructs are made by replacing the standard 3 ' UTR with a miR- 122 regulatory site-containing 3' UTR. miR- 122 is highly expressed in the hepatocytes and not in other tissues; therefore, translation of mRNA containing miR- 122 regulatory (binding) sites in its 3 ' UTR is selectively down-regulated in hepatocytes but not in other cells.
[00632] The following constructs were designed: (5) dCas9-KRAB-miR-122 and (6) dCas9-NLS-FLAG-VP64-miR- 122).
[00633] Constructs 1-4 (DNA cassettes) were synthesized and inserted into a vector (pJ364 from DNA 2.0, Inc., Menlo Park, CA). The plasmid was transfected into E.coli as described above, plasmid DNA was purified and linearized using a restriction enzyme (Xbal). The linearized plasmid was PCR amplified and used as a template for in vitro transcription to produce the synthetic polynucleotides of the invention.
[00634]
Example 10: Design of DNA templates for synthetic sgRNAs targeting VEGF.
[00635] Four constructs each encoding a sgRNA targeting a gene of interest, i.e., a VEGF gene, were created for use as templates for in vitro transcription.
[00636] The constructs each included a 5'UTR (T7), a GGG, a 20-25 nucleotide sequence complementary to a sequence upstream of the VEGF gene transcriptional start, and a guide R A scaffold sequence. The VEGF sgRNA sequences were based on Maeder et al.
[00637] The following sequence was used as the 5'UTR sequence:
TCAAGCTTTTGGACCCTCGTACAGAAGCTAATACGACTCACTATAGGG (SEQ ID
NO: 72)
[00638] The following four sgRNA constructs were created; the sequences in bold italic are those complementary to the VEGF gene.
VEGF VI sgRNA construct sequence
TCAAGCTTTTGGACCCTCGTACAGAAGCTAATACGACTCACTATAGGG rGrGCAGACGGCAG rCACTAGGGTTTTAGAGCTAGAAATAGCAAGTTAAAATAAGGCTAGTCCGTTATCAACTTGA AAAAGTGGCACCGAGTCGGTGC (SEQ IN NO: 101)
VEGF V2 sgRNA construct sequence
TCAAGCTTTTGGACCCTCGTACAGAAGCTAATACGACTCACTATAGGGAGCAGCGrCrrCGA GAGTGAGGGTTTTAGAGCTAGAAATAGCAAGTTAAAATAAGGCTAGTCCGTTATCAACTTGA AAAAGTGGCACCGAGTCGGTGC (SEQ ID NO: 102)
VEGF V3 sgRNA construct sequence
TCAAGCTTTTGGACCCTCGTACAGAAGCTAATACGACTCACTATAGGGrGAGrGAGrGrGTG CGTGrGGGTTTTAGAGCTAGAAATAGCAAGTTAAAATAAGGCTAGTCCGTTATCAACTTGAA AAAGTGGCACCGAGTCGGTGC (SEQ ID NO: 103)
VEGF V4 sgRNA construct sequence
TCAAGCTTTTGGACCCTCGTACAGAAGCTAATACGACTCACTATAGGGrrGGAGCGGGGAGA AGGCCAGGGTTTTAGAGCTAGAAATAGCAAGTTAAAATAAGGCTAGTCCGTTATCAACTTGA AAAAGTGGCACCGAGTCGGTGC (SEQ ID NO: 104)
[00639] The four constructs (DNA cassettes) were synthesized and inserted into a vector (pJ224 from DNA 2.0, Inc., Menlo Park, CA). The plasmid was transfected into E.coli as described above and plasmid DNA was purified and linearized using a restriction enzyme (Xbal). The linearized plasmid was PCR amplified as described herein and used as a template for in vitro transcription to produce the synthetic sgRNA.
Example 11: Production of synthetic polynucleotides and sgRNAs via in vitro transcription.
[00640] Using the methods described herein the two synthetic polynucleotides encoding Cas9, the two synthetic polynucleotides encoding the dCAS9-effector gene fusion proteins, and the four synthetic sgRNAs targeting VEGF were synthesized using in vitro transcription of the constructs described above. Synthetic polynucleotides and synthetic sgRNAs with the following sequences were synthesized. mRNA sequence of dCas9- HA tag-2xSV40NLS- KRAB
GGGAAAUAAGAGAGAAAAGAAGAGUAAGAAGAAAUAUAAGAGCCACCAUGGACAAGAAAUAC UCAAUCGGACUUGCUAUCGGAACUAACAGCGUGGGAUGGGCCGUCAUUACUGACGAAUACAA GGUGCCCUCAAAGAAGUUCAAGGUCCUGGGAAAUACCGAUAGACACUCCAUCAAAAAGAACC UGAUCGGGGCACUGUUGUUCGACUCGGGAGAGACUGCAGAAGCAACCAGGCUCAAGCGCACU GCGAGGCGCCGGUACACCCGGAGGAAGAACCGCAUCUGCUACCUCCAAGAGAUUUUCAGCAA CGAGAUGGCAAAGGUCGAUGAUUCGUUCUUUCACCGCCUUGAGGAGUCGUUCCUUGUCGAGG AGGACAAAAAGCAUGAAAGACAUCCGAUCUUCGGAAACAUCGUGGACGAAGUCGCAUACCAU GAAAAGUACCCUACCAUCUACCAUCUCAGAAAGAAACUCGUCGAUUCAACUGAUAAGGCCGA CUUGCGGCUGAUCUACCUGGCUCUGGCGCACAUGAUCAAGUUUCGGGGUCACUUUCUCAUCG AGGGUGAUCUCAACCCGGACAAUUCCGACGUUGACAAACUCUUCAUCCAACUGGUCCAGACG UACAACCAGCUGUUCGAAGAAAAUCCGAUCAACGCAAGCGGAGUGGACGCCAAAGCCAUUCU GUCGGCCCGCCUCUCGAAGUCGCGUCGCCUGGAAAAUCUGAUUGCUCAGCUCCCGGGCGAAA AGAAGAAUGGCCUGUUUGGAAACCUCAUCGCACUGUCCCUCGGGCUGACUCCCAACUUCAAA UCGAACUUUGACUUGGCUGAGGAUGCAAAGCUGCAACUCUCCAAAGACACUUACGAUGAUGA CCUGGACAAUCUCCUGGCGCAGAUCGGGGAUCAGUAUGCUGACCUGUUCCUGGCGGCCAAGA ACCUGUCUGAUGCCAUCCUGCUCUCCGAUAUCCUGAGAGUGAACACUGAGAUCACCAAGGCG CCUCUGAGCGCCUCGAUGAUCAAACGCUACGAUGAACACCAUCAGGACCUCACUCUUCUGAA GGCUUUGGUGCGGCAGCAGCUUCCGGAAAAGUACAAAGAGAUCUUCUUCGACCAGUCGAAAA ACGGCUACGCCGGAUACAUUGAUGGCGGCGCAAGCCAGGAGGAAUUCUAUAAGUUUAUCAAA CCGAUCCUGGAGAAGAUGGACGGCACUGAAGAACUUCUGGUCAAGCUGAAUCGAGAGGAUCU GCUCCGGAAGCAGCGGACCUUCGACAAUGGGUCUAUCCCUCACCAAAUCCAUCUCGGCGAGC UGCAUGCGAUUCUGAGGCGCCAGGAGGACUUCUACCCAUUCCUGAAAGACAAUCGGGAGAAA AUCGAAAAGAUUCUGACGUUCCGCAUUCCAUACUACGUCGGGCCACUUGCGCGGGGUAAUUC GAGAUUCGCCUGGAUGACGCGGAAGUCCGAAGAAACCAUCACGCCGUGGAAUUUCGAAGAAG UGGUCGACAAGGGAGCCAGCGCACAGUCCUUCAUUGAGCGCAUGACCAAUUUCGACAAAAAU CUGCCGAACGAGAAGGUCCUGCCGAAGCAUUCACUGCUGUACGAAUACUUUACCGUGUACAA CGAACUGACCAAGGUGAAGUACGUCACCGAGGGAAUGAGAAAGCCUGCUUUCCUGAGCGGAG AACAGAAGAAGGCCAUUGUUGACCUCCUCUUCAAGACUAAUCGCAAAGUGACCGUGAAGCAG CUUAAAGAGGAUUACUUCAAAAAGAUCGAAUGUUUCGACUCCGUGGAAAUCAGCGGCGUGGA GGAUAGAUUCAACGCGUCCCUUGGGACUUACCACGACCUCCUUAAGAUCAUCAAGGAUAAGG AUUUCCUCGACAAUGAGGAAAACGAAGAUAUCCUGGAGGACAUCGUUCUGACUCUGACCCUC UUUGAGGACCGGGAGAUGAUCGAGGAGAGACUCAAGACCUACGCGCACCUGUUUGACGACAA AGUGAUGAAGCAACUUAAACGCAGGCGCUACACCGGCUGGGGCAGACUGUCACGCAAGUUGA UCAACGGAAUUAGAGAUAAACAGUCCGGAAAGACCAUCCUGGACUUCCUGAAGUCCGAUGGA UUCGCCAACCGGAAUUUCAUGCAGCUCAUCCAUGACGACUCAUUGACUUUCAAGGAGGAUAU CCAAAAGGCCCAAGUGAGCGGCCAAGGGGACUCCCUUCACGAACACAUCGCAAAUUUGGCCG GAUCACCAGCGAUUAAGAAGGGAAUCCUGCAGACCGUGAAGGUGGUGGACGAGCUGGUGAAA GUGAUGGGACGGCACAAGCCGGAAAACAUCGUGAUCGAGAUGGCCAGAGAGAACCAGACGAC UCAAAAGGGCCAGAAGAACUCGCGCGAACGCAUGAAGAGAAUAGAAGAGGGAAUUAAGGAAC UGGGAUCGCAGAUCUUGAAGGAGCACCCUGUCGAAAAUACUCAACUCCAGAACGAGAAGCUG UACCUGUACUAUCUUCAAAACGGCAGGGACAUGUAUGUCGACCAAGAGCUCGACAUUAACCG CCUGUCCGAUUAUGACGUGGACGCCAUCGUGCCGCAGAGCUUUCUCAAGGACGAUUCCAUCG ACAACAAAGUGCUCACCCGCAGCGACAAGAAUAGAGGGAAGUCGGAUAACGUCCCUUCGGAA GAGGUGGUGAAAAAGAUGAAGAAUUACUGGCGGCAGCUCCUGAAUGCAAAGCUCAUCACCCA ACGGAAGUUUGACAACCUCACCAAGGCAGAAAGAGGAGGACUGUCGGAAUUGGAUAAGGCCG GUUUCAUCAAGCGACAAUUGGUGGAAACUCGGCAAAUUACCAAGCAUGUGGCACAGAUUCUG GACUCCCGUAUGAACACCAAGUACGACGAGAACGAUAAGCUGAUCCGCGAGGUCAAGGUGAU CACCCUCAAAAGCAAACUUGUGUCAGACUUCCGGAAGGACUUCCAAUUCUACAAGGUCCGCG AAAUCAACAACUACCACCACGCUCAUGACGCAUACCUGAACGCUGUGGUCGGGACUGCCCUC AUCAAGAAGUACCCUAAACUCGAAAGCGAAUUUGUGUACGGCGACUACAAAGUGUACGAUGU CCGGAAGAUGAUCGCGAAAUCCGAGCAGGAGAUCGGAAAGGCGACUGCUAAGUACUUUUUCU ACUCGAACAUCAUGAACUUCUUCAAAACCGAAAUCACCCUGGCUAAUGGCGAGAUCAGAAAG CGCCCGCUGAUCGAAACCAACGGCGAAACCGGUGAAAUCGUGUGGGACAAGGGCCGCGAUUU CGCUACUGUGAGAAAGGUCCUUUCCAUGCCGCAAGUGAAUAUCGUCAAAAAGACUGAGGUGC AGACUGGCGGAUUUUCCAAGGAAUCGAUCCUCCCAAAGAGGAACUCAGAUAAGCUCAUCGCG CGGAAAAAGGAUUGGGACCCUAAGAAGUACGGAGGAUUUGAUAGCCCAACUGUGGCCUACUC UGUGCUCGUGGUGGCCAAAGUCGAGAAAGGAAAGUCGAAGAAGUUGAAAUCCGUGAAAGAAC UCUUGGGAAUCACUAUCAUGGAGCGGUCGUCAUUUGAAAAGAACCCAAUCGACUUCCUGGAA GCCAAGGGAUACAAAGAAGUCAAGAAAGACCUGAUCAUCAAGCUCCCUAAGUACAGCCUGUU CGAACUGGAGAACGGAAGGAAACGGAUGCUGGCUUCCGCCGGCGAACUGCAAAAGGGCAAUG AGCUGGCCCUCCCAUCGAAAUACGUGAACUUCCUCUACCUUGCCUCCCAUUACGAAAAGUUG AAGGGCUCACCCGAGGACAAUGAGCAGAAACAGCUCUUUGUUGAACAACACAAACACUACCU GGACGAAAUCAUCGAACAAAUCAGCGAGUUCAGCAAGCGCGUCAUUCUGGCGGACGCGAACC UGGAUAAAGUGCUGUCCGCGUACAACAAGCACCGCGAUAAGCCGAUACGGGAACAGGCUGAG AACAUCAUUCACCUCUUCACUCUCACUAAUCUGGGAGCCCCCGCCGCCUUCAAGUACUUUGA UACUACCAUCGACCGCAAGAGAUACACGAGCACCAAGGAAGUGCUCGAUGCCACCCUGAUCC ACCAGUCCAUUACUGGUCUGUACGAAACGCGAAUCGAUCUGUCACAGCUCGGAGGAGAUGCG UACCCCUACGAUGUCCCCGACUACGCGUCACUCGGUAGCGGCAGCCCGAAGAAGAAAAGAAA GGUGGAGGACCCGAAGAAAAAGAGGAAGGUUGACGGGAUCGGAAGCGGAUCGAAUGGAUCGU CAGGGGGAGGUGGCGGAGGUAUGGACGCAAAAUCACUUACGGCCUGGUCACGGACCUUGGUG ACCUUUAAAGACGUGUUCGUGGAUUUCACCAGGGAAGAAUGGAAACUGUUGGACACCGCCCA GCAGAUCGUGUACCGGAAUGUGAUGCUGGAGAACUACAAAAACUUGGUGUCCCUGGGGUAUC AACUCACUAAGCCAGAUGUCAUUCUUAGACUGGAAAAGGGAGAAGAACCGUGAUAAUAGGCU GGAGCCUCGGUGGCCAUGCUUCUUGCCCCUUGGGCCUCCCCCCAGCCCCUCCUCCCCUUCCU GCACCCGUACCCCCGUGGUCUUUGAAUAAAGUCUGAGUGGGCGGC+A(140nt) tail (SEQ ID N0:51) mRNA sequence of dCas9-NLS-FLAG-VP64
GGGAAAUAAGAGAGAAAAGAAGAGUAAGAAGAAAUAUAAGAGCCACCAUGGACAAGAAAUAC UCAAUCGGACUUGCUAUCGGAACUAACAGCGUGGGAUGGGCCGUCAUUACUGACGAAUACAA GGUGCCCUCAAAGAAGUUCAAGGUCCUGGGAAAUACCGAUAGACACUCCAUCAAAAAGAACC UGAUCGGGGCACUGUUGUUCGACUCGGGAGAGACUGCAGAAGCAACCAGGCUCAAGCGCACU GCGAGGCGCCGGUACACCCGGAGGAAGAACCGCAUCUGCUACCUCCAAGAGAUUUUCAGCAA CGAGAUGGCAAAGGUCGAUGAUUCGUUCUUUCACCGCCUUGAGGAGUCGUUCCUUGUCGAGG AGGACAAAAAGCAUGAAAGACAUCCGAUCUUCGGAAACAUCGUGGACGAAGUCGCAUACCAU GAAAAGUACCCUACCAUCUACCAUCUCAGAAAGAAACUCGUCGAUUCAACUGAUAAGGCCGA CUUGCGGCUGAUCUACCUGGCUCUGGCGCACAUGAUCAAGUUUCGGGGUCACUUUCUCAUCG AGGGUGAUCUCAACCCGGACAAUUCCGACGUUGACAAACUCUUCAUCCAACUGGUCCAGACG UACAACCAGCUGUUCGAAGAAAAUCCGAUCAACGCAAGCGGAGUGGACGCCAAAGCCAUUCU GUCGGCCCGCCUCUCGAAGUCGCGUCGCCUGGAAAAUCUGAUUGCUCAGCUCCCGGGCGAAA AGAAGAAUGGCCUGUUUGGAAACCUCAUCGCACUGUCCCUCGGGCUGACUCCCAACUUCAAA UCGAACUUUGACUUGGCUGAGGAUGCAAAGCUGCAACUCUCCAAAGACACUUACGAUGAUGA CCUGGACAAUCUCCUGGCGCAGAUCGGGGAUCAGUAUGCUGACCUGUUCCUGGCGGCCAAGA ACCUGUCUGAUGCCAUCCUGCUCUCCGAUAUCCUGAGAGUGAACACUGAGAUCACCAAGGCG CCUCUGAGCGCCUCGAUGAUCAAACGCUACGAUGAACACCAUCAGGACCUCACUCUUCUGAA GGCUUUGGUGCGGCAGCAGCUUCCGGAAAAGUACAAAGAGAUCUUCUUCGACCAGUCGAAAA ACGGCUACGCCGGAUACAUUGAUGGCGGCGCAAGCCAGGAGGAAUUCUAUAAGUUUAUCAAA CCGAUCCUGGAGAAGAUGGACGGCACUGAAGAACUUCUGGUCAAGCUGAAUCGAGAGGAUCU GCUCCGGAAGCAGCGGACCUUCGACAAUGGGUCUAUCCCUCACCAAAUCCAUCUCGGCGAGC UGCAUGCGAUUCUGAGGCGCCAGGAGGACUUCUACCCAUUCCUGAAAGACAAUCGGGAGAAA AUCGAAAAGAUUCUGACGUUCCGCAUUCCAUACUACGUCGGGCCACUUGCGCGGGGUAAUUC GAGAUUCGCCUGGAUGACGCGGAAGUCCGAAGAAACCAUCACGCCGUGGAAUUUCGAAGAAG UGGUCGACAAGGGAGCCAGCGCACAGUCCUUCAUUGAGCGCAUGACCAAUUUCGACAAAAAU CUGCCGAACGAGAAGGUCCUGCCGAAGCAUUCACUGCUGUACGAAUACUUUACCGUGUACAA CGAACUGACCAAGGUGAAGUACGUCACCGAGGGAAUGAGAAAGCCUGCUUUCCUGAGCGGAG AACAGAAGAAGGCCAUUGUUGACCUCCUCUUCAAGACUAAUCGCAAAGUGACCGUGAAGCAG CUUAAAGAGGAUUACUUCAAAAAGAUCGAAUGUUUCGACUCCGUGGAAAUCAGCGGCGUGGA GGAUAGAUUCAACGCGUCCCUUGGGACUUACCACGACCUCCUUAAGAUCAUCAAGGAUAAGG AUUUCCUCGACAAUGAGGAAAACGAAGAUAUCCUGGAGGACAUCGUUCUGACUCUGACCCUC UUUGAGGACCGGGAGAUGAUCGAGGAGAGACUCAAGACCUACGCGCACCUGUUUGACGACAA AGUGAUGAAGCAACUUAAACGCAGGCGCUACACCGGCUGGGGCAGACUGUCACGCAAGUUGA UCAACGGAAUUAGAGAUAAACAGUCCGGAAAGACCAUCCUGGACUUCCUGAAGUCCGAUGGA UUCGCCAACCGGAAUUUCAUGCAGCUCAUCCAUGACGACUCAUUGACUUUCAAGGAGGAUAU CCAAAAGGCCCAAGUGAGCGGCCAAGGGGACUCCCUUCACGAACACAUCGCAAAUUUGGCCG GAUCACCAGCGAUUAAGAAGGGAAUCCUGCAGACCGUGAAGGUGGUGGACGAGCUGGUGAAA GUGAUGGGACGGCACAAGCCGGAAAACAUCGUGAUCGAGAUGGCCAGAGAGAACCAGACGAC UCAAAAGGGCCAGAAGAACUCGCGCGAACGCAUGAAGAGAAUAGAAGAGGGAAUUAAGGAAC UGGGAUCGCAGAUCUUGAAGGAGCACCCUGUCGAAAAUACUCAACUCCAGAACGAGAAGCUG UACCUGUACUAUCUUCAAAACGGCAGGGACAUGUAUGUCGACCAAGAGCUCGACAUUAACCG CCUGUCCGAUUAUGACGUGGACGCCAUCGUGCCGCAGAGCUUUCUCAAGGACGAUUCCAUCG ACAACAAAGUGCUCACCCGCAGCGACAAGAAUAGAGGGAAGUCGGAUAACGUCCCUUCGGAA GAGGUGGUGAAAAAGAUGAAGAAUUACUGGCGGCAGCUCCUGAAUGCAAAGCUCAUCACCCA ACGGAAGUUUGACAACCUCACCAAGGCAGAAAGAGGAGGACUGUCGGAAUUGGAUAAGGCCG GUUUCAUCAAGCGACAAUUGGUGGAAACUCGGCAAAUUACCAAGCAUGUGGCACAGAUUCUG GACUCCCGUAUGAACACCAAGUACGACGAGAACGAUAAGCUGAUCCGCGAGGUCAAGGUGAU CACCCUCAAAAGCAAACUUGUGUCAGACUUCCGGAAGGACUUCCAAUUCUACAAGGUCCGCG AAAUCAACAACUACCACCACGCUCAUGACGCAUACCUGAACGCUGUGGUCGGGACUGCCCUC AUCAAGAAGUACCCUAAACUCGAAAGCGAAUUUGUGUACGGCGACUACAAAGUGUACGAUGU CCGGAAGAUGAUCGCGAAAUCCGAGCAGGAGAUCGGAAAGGCGACUGCUAAGUACUUUUUCU ACUCGAACAUCAUGAACUUCUUCAAAACCGAAAUCACCCUGGCUAAUGGCGAGAUCAGAAAG CGCCCGCUGAUCGAAACCAACGGCGAAACCGGUGAAAUCGUGUGGGACAAGGGCCGCGAUUU CGCUACUGUGAGAAAGGUCCUUUCCAUGCCGCAAGUGAAUAUCGUCAAAAAGACUGAGGUGC AGACUGGCGGAUUUUCCAAGGAAUCGAUCCUCCCAAAGAGGAACUCAGAUAAGCUCAUCGCG CGGAAAAAGGAUUGGGACCCUAAGAAGUACGGAGGAUUUGAUAGCCCAACUGUGGCCUACUC UGUGCUCGUGGUGGCCAAAGUCGAGAAAGGAAAGUCGAAGAAGUUGAAAUCCGUGAAAGAAC UCUUGGGAAUCACUAUCAUGGAGCGGUCGUCAUUUGAAAAGAACCCAAUCGACUUCCUGGAA GCCAAGGGAUACAAAGAAGUCAAGAAAGACCUGAUCAUCAAGCUCCCUAAGUACAGCCUGUU CGAACUGGAGAACGGAAGGAAACGGAUGCUGGCUUCCGCCGGCGAACUGCAAAAGGGCAAUG AGCUGGCCCUCCCAUCGAAAUACGUGAACUUCCUCUACCUUGCCUCCCAUUACGAAAAGUUG AAGGGCUCACCCGAGGACAAUGAGCAGAAACAGCUCUUUGUUGAACAACACAAACACUACCU GGACGAAAUCAUCGAACAAAUCAGCGAGUUCAGCAAGCGCGUCAUUCUGGCGGACGCGAACC UGGAUAAAGUGCUGUCCGCGUACAACAAGCACCGCGAUAAGCCGAUACGGGAACAGGCUGAG AACAUCAUUCACCUCUUCACUCUCACUAAUCUGGGAGCCCCCGCCGCCUUCAAGUACUUUGA UACUACCAUCGACCGCAAGAGAUACACGAGCACCAAGGAAGUGCUCGAUGCCACCCUGAUCC ACCAGUCCAUUACUGGUCUGUACGAAACGCGAAUCGAUCUGUCACAGCUCGGAGGAGAUGGG UCACCGAAAAAGAAACGGAAAGUCAGCUCGGAUUACAAGGAUCACGACGGAGACUACAAGGA CCAUGACAUCGACUAUAAGGACGACGACGACAAGGCCGCUGGAGGCGGUGGAUCGGGACGCG CGGACGCCUUGGAUGACUUCGACCUUGACAUGCUGGGAUCCGACGCACUUGAUGAUUUUGAU CUCGAUAUGCUUGGCAGCGACGCACUGGACGAUUUCGACCUCGACAUGCUCGGAUCGGAUGC GCUCGACGACUUCGAUCUGGAUAUGCUGUGAUAAUAGGCUGGAGCCUCGGUGGCCAUGCUUC UUGCCCCUUGGGCCUCCCCCCAGCCCCUCCUCCCCUUCCUGCACCCGUACCCCCGUGGUCUU UGAAUAAAGUCUGAGUGGGCGGC+A ( 140nt ) tail (SEQ ID NO: 52) mRNA sequence of dCas9-KRAB-m±R122
GGGAAAUAAGAGAGAAAAGAAGAGUAAGAAGAAAUAUAAGAGCCACCAUGGACAAGAAGUAC UCAAUCGGACUCGCAAUCGGAACCAAUUCAGUCGGCUGGGCAGUCAUUACCGAUGAAUACAA GGUGCCGUCGAAGAAGUUCAAAGUCCUGGGUAACACUGACAGACAUUCGAUCAAAAAGAACC UGAUCGGAGCCUUGCUGUUUGAUUCAGGCGAAACCGCCGAAGCUACCCGGUUGAAACGAACU GCUAGACGCCGCUACACGCGCCGCAAGAACCGGAUCUGCUACCUCCAAGAAAUCUUCUCGAA CGAAAUGGCUAAGGUGGACGACUCGUUCUUUCACCGGCUCGAGGAGUCAUUCCUUGUGGAGG AAGAUAAGAAGCACGAAAGACACCCGAUCUUCGGCAACAUCGUGGACGAAGUCGCGUACCAC GAAAAGUACCCGACUAUCUACCAUCUCCGGAAGAAGCUCGUGGAUAGCACCGAUAAGGCCGA UCUGCGACUGAUCUACCUCGCGCUGGCCCAUAUGAUUAAGUUCCGCGGGCACUUCCUCAUCG AAGGGGACCUGAAUCCAGACAACUCGGACGUGGAUAAGCUGUUUAUCCAGCUGGUGCAGACU UACAAUCAAUUGUUUGAAGAAAACCCUAUCAACGCGUCUGGGGUGGACGCAAAGGCCAUCCU GAGCGCGCGGCUGUCAAAAUCCAGACGGCUGGAAAAUCUGAUAGCCCAACUGCCGGGCGAGA AGAAAAACGGCCUGUUUGGAAAUCUUAUCGCCCUGUCCCUGGGACUGACCCCCAACUUCAAG UCGAACUUCGACUUGGCCGAGGAUGCGAAGCUCCAGCUCAGCAAAGACACCUACGACGAUGA CCUCGAUAACCUGUUGGCCCAGAUCGGUGACCAGUAUGCUGAUCUCUUCUUGGCGGCCAAGA ACCUGUCAGACGCAAUUCUGCUCUCCGACAUCCUGCGGGUGAAUACUGAGAUCACUAAAGCC CCAUUGAGCGCGUCGAUGAUCAAAAGAUACGACGAGCACCACCAGGAUCUGACUCUCCUCAA GGCACUGGUCCGCCAACAGCUCCCGGAAAAGUACAAAGAGAUCUUCUUUGACCAAUCCAAAA ACGGAUACGCUGGUUACAUAGACGGCGGAGCGUCACAAGAAGAGUUCUACAAGUUCAUCAAG CCUAUCCUGGAAAAGAUGGACGGGACCGAGGAACUCCUGGUUAAGCUCAAUAGGGAGGAUCU GCUGCGCAAGCAACGCACGUUCGACAAUGGAAGCAUCCCCCAUCAGAUCCACCUGGGGGAGC UCCACGCGAUCCUGAGGCGCCAGGAAGAUUUCUACCCAUUUCUGAAGGACAAUAGAGAGAAA AUCGAAAAGAUCCUGACUUUCCGAAUCCCGUACUACGUGGGCCCGCUCGCACGGGGAAACUC ACGGUUUGCCUGGAUGACUCGCAAAUCCGAAGAAACCAUUACCCCCUGGAAUUUCGAGGAGG UGGUCGAUAAAGGCGCCUCAGCCCAGUCGUUCAUCGAAAGAAUGACCAACUUUGACAAGAAC CUCCCAAAUGAGAAGGUGCUGCCAAAACAUAGCCUGCUGUACGAGUACUUUACUGUGUAUAA CGAACUCACCAAGGUGAAAUACGUGACCGAGGGAAUGCGCAAGCCGGCAUUUCUGUCGGGCG AACAGAAGAAGGCAAUUGUGGACUUGCUGUUCAAAACCAACCGGAAGGUGACCGUGAAACAG CUCAAGGAAGAUUACUUUAAGAAGAUCGAGUGUUUCGAUAGCGUCGAAAUUUCGGGGGUGGA AGAUCGCUUCAAUGCAAGCCUUGGGACGUACCACGAUCUGCUUAAGAUCAUUAAGGACAAGG AUUUCCUUGACAACGAAGAGAACGAGGAUAUUCUCGAGGAUAUCGUCCUGACCCUGACUCUG UUUGAGGAUAGAGAAAUGAUCGAGGAGAGAUUGAAAACUUACGCACACCUCUUCGACGAUAA GGUGAUGAAACAGCUGAAAAGGCGUAGAUACACUGGUUGGGGAAGGCUGUCGAGAAAGCUGA UCAACGGAAUUAGGGACAAGCAGUCCGGAAAAACCAUCCUGGAUUUCCUCAAGUCCGACGGU UUCGCCAACCGCAACUUCAUGCAGCUGAUCCACGAUGAUUCCCUGACGUUCAAAGAGGAUAU CCAGAAGGCACAAGUGUCCGGACAAGGAGACUCACUCCACGAGCAUAUCGCUAAUCUCGCCG GAUCGCCAGCUAUCAAGAAGGGAAUCUUGCAGACUGUCAAGGUGGUGGACGAACUGGUGAAA GUGAUGGGAAGGCAUAAGCCGGAGAAUAUCGUGAUCGAGAUGGCGAGGGAAAACCAGACGAC CCAGAAAGGACAGAAAAACAGCCGGGAACGCAUGAAGCGCAUCGAAGAGGGAAUCAAAGAGC UUGGGAGCCAAAUCCUCAAAGAACACCCUGUGGAAAAUACCCAACUGCAGAAUGAGAAGCUU UACCUGUAUUACCUCCAAAACGGGCGCGACAUGUACGUUGACCAGGAAUUGGACAUUAACCG GCUUUCCGACUACGAUGUGGACGCUAUCGUCCCGCAGUCCUUCCUGAAAGACGAUUCGAUCG ACAAUAAGGUCCUGACUAGAUCAGACAAGAAUCGGGGAAAGUCAGACAACGUGCCUAGCGAA GAGGUCGUUAAGAAGAUGAAGAAUUACUGGCGCCAGCUGCUGAACGCGAAGCUUAUCACUCA GCGCAAGUUCGACAACCUCACCAAGGCAGAAAGAGGCGGAUUGUCGGAGCUCGACAAAGCUG GCUUCAUCAAGCGCCAGCUCGUCGAAACUCGCCAGAUUACUAAGCAUGUGGCGCAGAUCCUG GACAGCCGCAUGAAUACUAAGUAUGAUGAGAAUGACAAGCUCAUCCGGGAGGUGAAGGUCAU CACCCUGAAGUCCAAGCUGGUGUCCGACUUCCGGAAGGACUUCCAAUUCUACAAAGUCAGAG AAAUCAACAAUUACCAUCACGCGCAUGACGCCUACUUGAAUGCAGUGGUGGGUACUGCCCUC AUCAAGAAAUACCCAAAGCUUGAAAGCGAGUUUGUCUACGGAGACUACAAGGUGUACGACGU CCGGAAGAUGAUCGCCAAAUCGGAACAGGAAAUUGGGAAGGCGACCGCUAAGUACUUCUUCU ACUCGAAUAUCAUGAAUUUCUUCAAGACCGAGAUCACGCUUGCAAAUGGCGAAAUCCGGAAG CGGCCCCUCAUCGAAACCAACGGAGAAACCGGAGAAAUCGUGUGGGACAAGGGUCGCGAUUU UGCGACCGUCCGAAAGGUUCUUAGCAUGCCUCAAGUGAACAUCGUCAAGAAAACGGAAGUGC AGACUGGAGGCUUCAGCAAGGAGUCCAUUCUCCCGAAACGCAACUCCGACAAACUGAUCGCA CGCAAGAAAGACUGGGACCCGAAGAAAUACGGAGGCUUCGAUUCGCCGACUGUGGCUUACUC GGUCCUGGUUGUGGCCAAGGUGGAAAAGGGAAAGUCCAAGAAGCUGAAGUCCGUCAAGGAGC UCCUCGGAAUCACCAUCAUGGAACGGUCAAGCUUCGAGAAAAACCCAAUUGACUUCCUGGAG GCAAAGGGGUACAAGGAGGUGAAGAAGGAUCUGAUCAUCAAACUGCCGAAGUACAGCCUCUU UGAGCUCGAAAACGGACGCAAAAGGAUGCUGGCCUCCGCCGGAGAGCUGCAAAAGGGAAACG AGCUUGCCUUGCCUUCCAAGUACGUGAACUUCCUGUACCUGGCAUCCCACUACGAAAAACUG AAGGGAUCGCCGGAGGACAACGAACAGAAGCAGCUGUUUGUGGAACAACACAAGCAUUAUCU GGAUGAAAUCAUCGAACAAAUCAGCGAAUUCUCAAAAAGGGUGAUCUUGGCCGACGCCAACC UGGAUAAAGUGCUUUCCGCCUACAACAAACAUCGCGACAAGCCGAUCCGGGAGCAGGCCGAA AACAUCAUUCACCUGUUUACCCUGACUAAUCUGGGUGCGCCCGCGGCUUUCAAAUACUUCGA UACCACGAUCGACCGGAAGAGAUACACCAGCACCAAAGAGGUGUUGGACGCGACCCUCAUCC ACCAAUCUAUUACCGGCCUCUAUGAAACUAGGAUCGACCUCAGCCAGCUGGGAGGCGAUGCC UACCCUUACGAUGUCCCGGACUACGCCUCGCUGGGAUCCGGAUCUCCGAAGAAGAAGCGGAA GGUCGAGGACCCAAAGAAAAAGCGCAAAGUGGAUGGGAUCGGUAGCGGUUCCAACGGUUCCU CGGGUGGCGGCGGAGGCGGCAUGGAUGCUAAGUCACUUACCGCCUGGUCGCGGACGCUGGUG ACUUUCAAAGAUGUGUUCGUGGAUUUCACUCGUGAGGAAUGGAAAUUGCUGGACACUGCCCA ACAGAUCGUCUACCGCAACGUCAUGCUUGAAAACUACAAAAACCUCGUGUCGCUGGGAUAUC AGCUGACCAAGCCCGACGUGAUUCUGAGACUGGAGAAGGGCGAAGAACCUUGAUAAUAGGCU GGAGCCUCGGUGGCCAUGCUUCUUGCCCCUUGGGCCUCCCCCCAGCCCCUCCUCCCCUUCCU GCACCCGUACCCCCCAAACACCAUUGUCACACUCCAGUGGUCUUUGAAUAAAGUCUGAGUGG GCGGC+A(140nt) tail (SEQ ID NO:53)
mRNA sequence of dCas9-VP64-m±R122 GGGAAAUAAGAGAGAAAAGAAGAGUAAGAAGAAAUAUAAGAGCCACCAUGGACAAGAAGUAC UCAAUCGGACUCGCAAUCGGAACCAAUUCAGUCGGCUGGGCAGUCAUUACCGAUGAAUACAA GGUGCCGUCGAAGAAGUUCAAAGUCCUGGGUAACACUGACAGACAUUCGAUCAAAAAGAACC UGAUCGGAGCCUUGCUGUUUGAUUCAGGCGAAACCGCCGAAGCUACCCGGUUGAAACGAACU GCUAGACGCCGCUACACGCGCCGCAAGAACCGGAUCUGCUACCUCCAAGAAAUCUUCUCGAA CGAAAUGGCUAAGGUGGACGACUCGUUCUUUCACCGGCUCGAGGAGUCAUUCCUUGUGGAGG AAGAUAAGAAGCACGAAAGACACCCGAUCUUCGGCAACAUCGUGGACGAAGUCGCGUACCAC GAAAAGUACCCGACUAUCUACCAUCUCCGGAAGAAGCUCGUGGAUAGCACCGAUAAGGCCGA UCUGCGACUGAUCUACCUCGCGCUGGCCCAUAUGAUUAAGUUCCGCGGGCACUUCCUCAUCG AAGGGGACCUGAAUCCAGACAACUCGGACGUGGAUAAGCUGUUUAUCCAGCUGGUGCAGACU UACAAUCAAUUGUUUGAAGAAAACCCUAUCAACGCGUCUGGGGUGGACGCAAAGGCCAUCCU GAGCGCGCGGCUGUCAAAAUCCAGACGGCUGGAAAAUCUGAUAGCCCAACUGCCGGGCGAGA AGAAAAACGGCCUGUUUGGAAAUCUUAUCGCCCUGUCCCUGGGACUGACCCCCAACUUCAAG UCGAACUUCGACUUGGCCGAGGAUGCGAAGCUCCAGCUCAGCAAAGACACCUACGACGAUGA CCUCGAUAACCUGUUGGCCCAGAUCGGUGACCAGUAUGCUGAUCUCUUCUUGGCGGCCAAGA ACCUGUCAGACGCAAUUCUGCUCUCCGACAUCCUGCGGGUGAAUACUGAGAUCACUAAAGCC CCAUUGAGCGCGUCGAUGAUCAAAAGAUACGACGAGCACCACCAGGAUCUGACUCUCCUCAA GGCACUGGUCCGCCAACAGCUCCCGGAAAAGUACAAAGAGAUCUUCUUUGACCAAUCCAAAA ACGGAUACGCUGGUUACAUAGACGGCGGAGCGUCACAAGAAGAGUUCUACAAGUUCAUCAAG CCUAUCCUGGAAAAGAUGGACGGGACCGAGGAACUCCUGGUUAAGCUCAAUAGGGAGGAUCU GCUGCGCAAGCAACGCACGUUCGACAAUGGAAGCAUCCCCCAUCAGAUCCACCUGGGGGAGC UCCACGCGAUCCUGAGGCGCCAGGAAGAUUUCUACCCAUUUCUGAAGGACAAUAGAGAGAAA AUCGAAAAGAUCCUGACUUUCCGAAUCCCGUACUACGUGGGCCCGCUCGCACGGGGAAACUC ACGGUUUGCCUGGAUGACUCGCAAAUCCGAAGAAACCAUUACCCCCUGGAAUUUCGAGGAGG UGGUCGAUAAAGGCGCCUCAGCCCAGUCGUUCAUCGAAAGAAUGACCAACUUUGACAAGAAC CUCCCAAAUGAGAAGGUGCUGCCAAAACAUAGCCUGCUGUACGAGUACUUUACUGUGUAUAA CGAACUCACCAAGGUGAAAUACGUGACCGAGGGAAUGCGCAAGCCGGCAUUUCUGUCGGGCG AACAGAAGAAGGCAAUUGUGGACUUGCUGUUCAAAACCAACCGGAAGGUGACCGUGAAACAG CUCAAGGAAGAUUACUUUAAGAAGAUCGAGUGUUUCGAUAGCGUCGAAAUUUCGGGGGUGGA AGAUCGCUUCAAUGCAAGCCUUGGGACGUACCACGAUCUGCUUAAGAUCAUUAAGGACAAGG AUUUCCUUGACAACGAAGAGAACGAGGAUAUUCUCGAGGAUAUCGUCCUGACCCUGACUCUG UUUGAGGAUAGAGAAAUGAUCGAGGAGAGAUUGAAAACUUACGCACACCUCUUCGACGAUAA GGUGAUGAAACAGCUGAAAAGGCGUAGAUACACUGGUUGGGGAAGGCUGUCGAGAAAGCUGA UCAACGGAAUUAGGGACAAGCAGUCCGGAAAAACCAUCCUGGAUUUCCUCAAGUCCGACGGU UUCGCCAACCGCAACUUCAUGCAGCUGAUCCACGAUGAUUCCCUGACGUUCAAAGAGGAUAU CCAGAAGGCACAAGUGUCCGGACAAGGAGACUCACUCCACGAGCAUAUCGCUAAUCUCGCCG GAUCGCCAGCUAUCAAGAAGGGAAUCUUGCAGACUGUCAAGGUGGUGGACGAACUGGUGAAA GUGAUGGGAAGGCAUAAGCCGGAGAAUAUCGUGAUCGAGAUGGCGAGGGAAAACCAGACGAC CCAGAAAGGACAGAAAAACAGCCGGGAACGCAUGAAGCGCAUCGAAGAGGGAAUCAAAGAGC UUGGGAGCCAAAUCCUCAAAGAACACCCUGUGGAAAAUACCCAACUGCAGAAUGAGAAGCUU UACCUGUAUUACCUCCAAAACGGGCGCGACAUGUACGUUGACCAGGAAUUGGACAUUAACCG GCUUUCCGACUACGAUGUGGACGCUAUCGUCCCGCAGUCCUUCCUGAAAGACGAUUCGAUCG ACAAUAAGGUCCUGACUAGAUCAGACAAGAAUCGGGGAAAGUCAGACAACGUGCCUAGCGAA GAGGUCGUUAAGAAGAUGAAGAAUUACUGGCGCCAGCUGCUGAACGCGAAGCUUAUCACUCA GCGCAAGUUCGACAACCUCACCAAGGCAGAAAGAGGCGGAUUGUCGGAGCUCGACAAAGCUG GCUUCAUCAAGCGCCAGCUCGUCGAAACUCGCCAGAUUACUAAGCAUGUGGCGCAGAUCCUG GACAGCCGCAUGAAUACUAAGUAUGAUGAGAAUGACAAGCUCAUCCGGGAGGUGAAGGUCAU CACCCUGAAGUCCAAGCUGGUGUCCGACUUCCGGAAGGACUUCCAAUUCUACAAAGUCAGAG AAAUCAACAAUUACCAUCACGCGCAUGACGCCUACUUGAAUGCAGUGGUGGGUACUGCCCUC AUCAAGAAAUACCCAAAGCUUGAAAGCGAGUUUGUCUACGGAGACUACAAGGUGUACGACGU CCGGAAGAUGAUCGCCAAAUCGGAACAGGAAAUUGGGAAGGCGACCGCUAAGUACUUCUUCU ACUCGAAUAUCAUGAAUUUCUUCAAGACCGAGAUCACGCUUGCAAAUGGCGAAAUCCGGAAG CGGCCCCUCAUCGAAACCAACGGAGAAACCGGAGAAAUCGUGUGGGACAAGGGUCGCGAUUU UGCGACCGUCCGAAAGGUUCUUAGCAUGCCUCAAGUGAACAUCGUCAAGAAAACGGAAGUGC AGACUGGAGGCUUCAGCAAGGAGUCCAUUCUCCCGAAACGCAACUCCGACAAACUGAUCGCA CGCAAGAAAGACUGGGACCCGAAGAAAUACGGAGGCUUCGAUUCGCCGACUGUGGCUUACUC GGUCCUGGUUGUGGCCAAGGUGGAAAAGGGAAAGUCCAAGAAGCUGAAGUCCGUCAAGGAGC UCCUCGGAAUCACCAUCAUGGAACGGUCAAGCUUCGAGAAAAACCCAAUUGACUUCCUGGAG GCAAAGGGGUACAAGGAGGUGAAGAAGGAUCUGAUCAUCAAACUGCCGAAGUACAGCCUCUU UGAGCUCGAAAACGGACGCAAAAGGAUGCUGGCCUCCGCCGGAGAGCUGCAAAAGGGAAACG AGCUUGCCUUGCCUUCCAAGUACGUGAACUUCCUGUACCUGGCAUCCCACUACGAAAAACUG AAGGGAUCGCCGGAGGACAACGAACAGAAGCAGCUGUUUGUGGAACAACACAAGCAUUAUCU GGAUGAAAUCAUCGAACAAAUCAGCGAAUUCUCAAAAAGGGUGAUCUUGGCCGACGCCAACC UGGAUAAAGUGCUUUCCGCCUACAACAAACAUCGCGACAAGCCGAUCCGGGAGCAGGCCGAA AACAUCAUUCACCUGUUUACCCUGACUAAUCUGGGUGCGCCCGCGGCUUUCAAAUACUUCGA UACCACGAUCGACCGGAAGAGAUACACCAGCACCAAAGAGGUGUUGGACGCGACCCUCAUCC ACCAAUCUAUUACCGGCCUCUAUGAAACUAGGAUCGACCUCAGCCAGCUGGGAGGCGAUGGA UCCCCAAAGAAGAAGAGAAAAGUGUCCUCCGACUACAAGGAUCAUGAUGGGGACUAUAAAGA UCAUGAUAUUGAUUACAAGGACGACGACGACAAGGCCGCUGGAGGAGGAGGUUCCGGCCGCG CCGAUGCUCUCGACGACUUCGACCUCGACAUGCUGGGAUCCGACGCCCUGGACGACUUUGAU CUGGAUAUGCUGGGCUCGGACGCCCUUGAUGACUUCGAUCUGGACAUGCUGGGGUCGGAUGC ACUGGACGACUUCGACCUUGAUAUGCUGUGAUAAUAGGCUGGAGCCUCGGUGGCCAUGCUUC UUGCCCCUUGGGCCUCCCCCCAGCCCCUCCUCCCCUUCCUGCACCCGUACCCCCCAAACACC AUUGUCACACUCCAGUGGUCUUUGAAUAAAGUCUGAGUGGGCGGC+A ( 14 Ont ) tail (SEQ ID NO:54)
mRNA sequence of Cas9 (Mali)
GGGAAAUAAGAGAGAAAAGAAGAGUAAGAAGAAAUAUAAGAGCCACCAUGGACAAGAAAUAC AGCAUCGGCCUGGAUAUUGGAACUAACAGCGUUGGAUGGGCAGUGAUCACCGACGAGUACAA GGUGCCGAGCAAGAAGUUCAAGGUGCUGGGGAACACUGACCGCCAUUCAAUUAAGAAAAACC UCAUUGGAGCACUGCUUUUUGACUCGGGUGAGACUGCCGAAGCUACCAGGCUCAAACGCACC GCACGCAGACGGUACACCCGCCGCAAGAAUCGCAUCUGCUAUCUGCAAGAGAUCUUUUCCAA CGAGAUGGCGAAGGUUGACGACAGCUUUUUCCACCGGCUGGAAGAGAGCUUCCUCGUGGAAG AGGACAAAAAGCACGAAAGGCAUCCAAUCUUCGGUAACAUCGUGGACGAAGUGGCGUAUCAC GAAAAGUACCCUACCAUCUACCAUCUGCGGAAGAAGCUGGUCGAUUCCACGGAUAAGGCAGA CCUGAGACUGAUCUACCUGGCUUUGGCCCAUAUGAUCAAAUUCCGCGGCCAUUUCCUGAUCG AGGGGGACCUUAACCCGGAUAACUCGGAUGUCGACAAGCUGUUCAUCCAGCUGGUCCAAACG UAUAACCAACUGUUUGAGGAAAAUCCCAUCAACGCUUCGGGGGUGGACGCCAAAGCAAUCCU CUCCGCGCGCCUGAGCAAGUCACGGCGGCUCGAAAACCUGAUCGCGCAGCUGCCGGGAGAAA AGAAAAAUGGACUGUUUGGGAAUCUGAUCGCGCUGUCGCUCGGCCUGACUCCAAACUUUAAG UCAAAUUUCGAUUUGGCCGAAGAUGCCAAGCUGCAGCUGUCAAAGGACACUUACGACGACGA CCUGGACAAUCUGCUGGCCCAGAUUGGGGACCAAUACGCAGACCUGUUCUUGGCCGCGAAGA ACCUGAGCGACGCCAUUCUUCUGUCCGAUAUUCUGAGAGUCAAUACCGAAAUCACUAAGGCU CCGCUGUCCGCUUCAAUGAUCAAGCGCUACGAUGAACACCACCAGGAUCUCACUCUGCUCAA AGCCCUCGUGAGACAACAAUUGCCUGAAAAGUACAAGGAGAUCUUCUUCGACCAGAGCAAAA ACGGCUACGCAGGCUACAUCGAUGGAGGAGCGUCACAAGAAGAGUUCUACAAGUUCAUCAAG CCAAUCUUGGAGAAGAUGGACGGUACUGAAGAACUCCUUGUGAAGCUGAAUAGGGAGGAUUU GCUCAGAAAGCAGCGGACUUUUGACAACGGCUCGAUCCCUCAUCAGAUUCACCUCGGUGAGC UGCAUGCCAUCCUUCGGCGCCAAGAGGAUUUUUACCCCUUCCUGAAGGAUAAUCGCGAGAAA AUCGAAAAGAUCCUGACGUUCAGAAUUCCCUACUACGUGGGACCGCUGGCGCGCGGUAACUC GCGGUUUGCAUGGAUGACUCGCAAGUCAGAGGAAACUAUCACUCCUUGGAAUUUUGAGGAGG UCGUCGAUAAGGGAGCCUCCGCCCAGUCAUUCAUCGAACGCAUGACCAACUUCGACAAGAAU CUUCCGAACGAGAAGGUCCUUCCAAAGCACUCCCUGUUGUACGAAUACUUCACCGUGUACAA UGAGCUGACCAAAGUUAAGUAUGUCACCGAGGGCAUGAGAAAGCCGGCCUUCCUCAGCGGCG AACAAAAGAAGGCCAUCGUCGACCUCCUCUUCAAGACCAACCGGAAGGUGACCGUCAAGCAA CUCAAGGAGGACUACUUCAAGAAGAUCGAAUGCUUUGACUCGGUCGAAAUCAGCGGAGUGGA GGACCGGUUUAACGCGUCACUGGGUACCUACCAUGAUCUCCUGAAAAUCAUCAAAGACAAGG ACUUCCUGGACAACGAAGAAAACGAGGACAUCCUGGAAGAUAUUGUGUUGACCCUGACGCUG UUCGAGGACCGGGAAAUGAUCGAGGAAAGGCUUAAGACCUACGCACACCUCUUCGAUGACAA AGUGAUGAAGCAACUGAAGCGGCGGAGAUAUACUGGCUGGGGGAGGCUCUCCCGGAAGCUCA UUAAUGGAAUCAGAGACAAACAGUCGGGUAAAACUAUCCUCGACUUCCUCAAGUCGGAUGGG UUCGCCAACCGGAACUUCAUGCAGCUGAUCCACGAUGAUUCCUUGACCUUCAAGGAAGAUAU CCAGAAGGCGCAAGUGAGCGGACAGGGAGAUUCGUUGCACGAACAUAUCGCUAAUCUCGCCG GAUCCCCAGCCAUCAAGAAAGGAAUCCUGCAGACCGUGAAGGUGGUGGAUGAACUGGUGAAA GUGAUGGGGCGCCACAAACCAGAGAACAUCGUCAUUGAGAUGGCCCGCGAGAAUCAGACCAC UCAGAAGGGACAAAAGAACUCCAGAGAGCGGAUGAAACGCAUCGAGGAAGGCAUCAAAGAGC UUGGUAGCCAAAUCCUGAAGGAACACCCGGUCGAGAACACCCAGCUCCAGAACGAAAAGCUU UACCUGUACUACCUCCAAAAUGGACGGGACAUGUACGUCGACCAGGAAUUGGACAUCAACAG ACUCAGCGACUACGAUGUGGACCAUAUUGUGCCACAGUCCUUUCUUAAGGACGACAGCAUCG AUAACAAAGUGCUCACUAGAUCAGACAAAAAUCGCGGGAAAUCAGACAAUGUGCCAUCGGAA GAGGUUGUCAAGAAGAUGAAAAACUACUGGAGACAGCUGCUCAAUGCCAAACUUAUCACCCA GCGGAAGUUCGACAACCUUACCAAGGCCGAGCGCGGAGGAUUGUCCGAACUCGACAAGGCCG GCUUCAUCAAAAGGCAGCUGGUGGAAACCCGGCAGAUCACUAAACACGUGGCCCAGAUCCUC GAUUCGCGCAUGAACACUAAAUACGAUGAGAAUGACAAGCUGAUUAGGGAAGUCAAGGUCAU CACUCUGAAGUCGAAACUGGUGUCGGACUUUAGAAAGGAUUUCCAGUUCUACAAAGUCCGCG AGAUUAACAACUACCACCACGCUCAUGACGCCUACCUGAAUGCAGUUGUGGGCACCGCGCUG AUCAAGAAGUAUCCGAAGCUGGAAUCCGAGUUCGUGUACGGAGAUUACAAAGUGUACGACGU GCGCAAGAUGAUCGCCAAGUCGGAACAGGAAAUCGGAAAGGCUACUGCAAAGUACUUCUUCU ACUCAAACAUCAUGAACUUCUUCAAAACGGAGAUCACGCUCGCGAACGGCGAAAUCCGGAAA AGGCCGCUCAUUGAAACCAACGGAGAAACCGGGGAGAUCGUGUGGGACAAGGGAAGGGAUUU UGCGACUGUGAGGAAGGUGUUGUCCAUGCCGCAAGUCAAUAUUGUGAAAAAGACGGAAGUGC AAACCGGAGGAUUCAGCAAAGAAUCCAUCCUCCCAAAGCGCAACUCGGACAAACUCAUCGCG CGCAAGAAGGAUUGGGACCCCAAGAAAUACGGUGGCUUUGACAGCCCUACUGUGGCUUACUC CGUCCUCGUCGUGGCUAAAGUGGAAAAGGGUAAAUCCAAAAAGCUCAAAUCGGUGAAGGAGC UCCUGGGAAUCACGAUCAUGGAGCGGUCGAGCUUCGAAAAGAAUCCUAUUGAUUUCCUGGAG GCGAAGGGCUACAAGGAAGUCAAGAAAGACCUGAUCAUCAAGCUCCCGAAGUACAGCCUCUU CGAGCUCGAAAACGGCAGAAAGAGGAUGCUGGCAUCAGCGGGAGAAUUGCAGAAGGGAAACG AACUGGCACUGCCGUCCAAGUACGUGAAUUUUCUCUAUCUGGCUAGCCACUACGAAAAGCUG AAGGGAUCGCCCGAGGACAACGAGCAAAAACAACUGUUCGUGGAGCAGCACAAGCACUACCU GGAUGAGAUCAUCGAGCAGAUCUCCGAAUUCUCGAAACGCGUGAUCCUUGCCGAUGCCAAUC UGGAUAAAGUGUUGUCGGCUUACAACAAGCAUCGGGAUAAACCGAUCCGCGAACAGGCAGAA AACAUCAUUCAUCUGUUCACUUUGACCAAUCUGGGAGCGCCUGCCGCGUUUAAGUACUUCGA CACCACUAUUGAUAGAAAGCGCUACACCUCGACCAAGGAAGUGCUGGACGCUACCCUGAUCC ACCAGUCCAUCACCGGACUCUACGAAACUCGCAUUGACCUGUCCCAGCUUGGAGGAGAUUCA CGGGCCGAUCCAAAGAAAAAGCGCAAGGUCUGAUAAUAGGCUGGAGCCUCGGUGGCCAUGCU UCUUGCCCCUUGGGCCUCCCCCCAGCCCCUCCUCCCCUUCCUGCACCCGUACCCCCGUGGUC UUUGAAUAAAGUCUGAGUGGGCGGC+A ( 14 Ont ) tail (SEQ ID NO: 55)
mRNA sequence of Cas9 (Cong)
GGGAAAUAAGAGAGAAAAGAAGAGUAAGAAGAAAUAUAAGAGCCACCAUGGACUACAAGGAC CACGACGGAGACUACAAAGACCAUGACAUCGAUUACAAGGAUGACGAUGACAAAAUGGCACC GAAGAAGAAGAGAAAGGUCGGAAUUCACGGGGUGCCGGCCGCGGACAAGAAGUACUCAAUCG GACUGGAUAUCGGCACGAACAGCGUGGGUUGGGCAGUGAUCACCGACGAAUACAAGGUGCCG AGCAAGAAGUUCAAAGUGCUGGGAAAUACCGAUCGCCAUUCGAUCAAGAAAAAUCUGAUUGG CGCGCUCCUGUUCGACUCGGGAGAGACUGCCGAGGCCACUAGACUGAAGAGGACCGCUAGGC GCCGCUACACGAGGCGCAAAAACCGCAUCUGCUAUCUUCAAGAAAUCUUCUCAAACGAGAUG GCCAAGGUGGACGACUCCUUUUUCCAUCGGCUGGAAGAAUCAUUUCUGGUGGAGGAGGACAA GAAGCACGAACGCCAUCCCAUUUUCGGCAACAUUGUCGACGAAGUGGCCUAUCAUGAGAAGU AUCCGACUAUCUACCACUUGAGAAAGAAGCUGGUGGACUCCACUGACAAGGCAGAUCUGCGG UUGAUCUACCUCGCACUGGCCCAUAUGAUCAAAUUCCGGGGACACUUCCUCAUCGAGGGCGA CCUUAAUCCCGACAAUUCCGAUGUGGAUAAGCUUUUCAUCCAGCUGGUCCAGACCUACAACC AACUGUUUGAAGAAAAUCCAAUCAAUGCGAGCGGUGUCGAUGCAAAGGCCAUCCUGAGCGCC CGCCUCUCGAAAAGCAGAAGGCUCGAAAACCUGAUCGCACAGUUGCCUGGAGAGAAGAAGAA CGGCCUCUUCGGCAAUCUCAUCGCAUUGUCCCUGGGACUGACUCCAAACUUCAAAUCCAACU UCGACUUGGCCGAGGACGCCAAACUGCAACUGAGCAAAGAUACCUACGAUGAUGACUUGGAC AAUCUUCUGGCUCAGAUCGGCGACCAGUACGCCGACCUGUUCCUUGCGGCUAAGAACCUGUC GGACGCCAUCCUGCUGUCCGACAUCCUGCGCGUCAAUACCGAAAUUACUAAAGCACCACUCU CGGCAUCCAUGAUCAAGAGAUACGAUGAACACCACCAGGAUCUCACCCUCCUGAAAGCACUG GUGCGGCAGCAGCUCCCUGAGAAAUACAAGGAAAUCUUCUUUGAUCAGUCCAAGAACGGAUA CGCCGGAUACAUCGACGGCGGCGCGAGCCAAGAGGAAUUCUACAAGUUCAUCAAGCCGAUCC UGGAAAAGAUGGAUGGCACGGAAGAACUCCUGGUCAAACUGAAUAGAGAGGAUCUGCUCCGC AAACAACGGACCUUCGAUAACGGAUCGAUCCCGCACCAGAUCCACCUCGGCGAACUGCAUGC CAUCCUGCGGCGGCAGGAGGACUUUUACCCGUUCCUCAAAGACAACAGAGAAAAGAUCGAGA AGAUCUUGACCUUUCGCAUCCCGUACUACGUGGGCCCGCUCGCGAGAGGUAACUCCCGCUUU GCUUGGAUGACUAGAAAGUCAGAGGAAACGAUCACCCCAUGGAACUUCGAAGAGGUGGUUGA CAAAGGAGCGAGCGCCCAAUCGUUCAUCGAACGGAUGACUAACUUCGAUAAGAAUCUGCCGA AUGAGAAGGUCCUGCCUAAGCACUCACUUCUGUAUGAAUACUUUACUGUGUAUAACGAACUC ACCAAAGUCAAAUACGUGACUGAGGGAAUGCGCAAGCCUGCGUUUUUGUCCGGCGAGCAGAA AAAGGCCAUCGUGGACUUGCUGUUCAAAACCAACCGCAAGGUGACUGUUAAGCAACUCAAAG AGGACUACUUUAAGAAGAUCGAAUGCUUUGACUCGGUCGAGAUUUCCGGGGUUGAAGAUAGA UUCAACGCGUCGCUGGGAACCUACCAUGAUCUCCUCAAGAUUAUCAAGGACAAAGACUUCCU GGAUAACGAGGAGAAUGAGGACAUCCUCGAAGAUAUUGUGCUUACCCUGACCCUUUUCGAAG AUCGCGAAAUGAUCGAAGAACGCCUGAAAACCUACGCUCACCUGUUCGACGAUAAGGUGAUG AAACAGUUGAAACGCCGGCGGUACACGGGUUGGGGGCGGCUGUCGCGCAAGCUGAUCAACGG AAUUCGGGACAAACAGAGCGGAAAGACCAUCCUCGAUUUUCUGAAGUCCGAUGGUUUUGCCA ACCGCAACUUCAUGCAGCUCAUCCAUGACGAUUCGCUUACCUUUAAGGAGGAUAUCCAGAAG GCACAAGUGUCGGGACAAGGGGAUUCGCUCCACGAACACAUCGCCAAUCUGGCGGGGUCGCC GGCAAUUAAGAAGGGAAUCCUCCAGACUGUUAAGGUGGUCGACGAGCUGGUGAAGGUGAUGG GGAGACAUAAGCCUGAAAACAUUGUGAUCGAGAUGGCGAGAGAAAAUCAAACUACUCAGAAG GGACAGAAGAAUUCCCGGGAGCGGAUGAAGCGCAUCGAGGAGGGAAUCAAGGAACUGGGCUC CCAAAUCCUGAAAGAGCAUCCCGUGGAAAAUACUCAGCUGCAGAACGAGAAGCUUUACCUGU ACUAUCUUCAAAAUGGCAGGGACAUGUACGUCGACCAAGAACUGGAUAUCAAUCGGCUCUCC GAUUACGACGUCGAUCACAUCGUCCCCCAAUCAUUCCUGAAGGAUGAUAGCAUCGAUAACAA GGUGCUCACUAGAUCAGACAAAAACCGGGGAAAGUCAGAUAACGUCCCCAGCGAAGAAGUCG UGAAGAAGAUGAAGAAUUACUGGAGGCAACUUCUGAACGCCAAACUCAUCACUCAGCGCAAG UUCGACAACCUGACCAAAGCAGAAAGGGGAGGACUCAGCGAGCUGGACAAGGCUGGUUUCAU CAAACGGCAGCUGGUGGAGACUCGCCAAAUCACGAAGCAUGUGGCCCAGAUUCUCGACUCGC GCAUGAAUACUAAGUACGACGAAAACGAUAAGCUGAUCCGGGAGGUGAAGGUGAUCACCCUC AAGAGCAAGCUCGUGUCCGAUUUCCGGAAAGACUUCCAGUUCUACAAGGUGCGGGAGAUUAA CAACUACCAUCACGCUCACGACGCUUACCUCAAUGCUGUGGUGGGGACGGCGUUGAUUAAGA AGUACCCAAAACUGGAGUCCGAAUUCGUCUACGGAGAUUACAAGGUCUACGACGUGCGCAAG AUGAUUGCCAAGUCGGAGCAGGAAAUUGGGAAAGCGACUGCUAAGUACUUCUUCUACUCGAA UAUCAUGAACUUCUUCAAGACCGAAAUCACCCUGGCUAACGGCGAGAUCAGGAAACGGCCGC UGAUCGAAACUAAUGGUGAGACUGGUGAAAUCGUGUGGGAUAAGGGACGGGACUUCGCCACG GUCCGCAAGGUCCUCAGCAUGCCGCAAGUGAAUAUUGUUAAGAAAACCGAAGUGCAGACCGG UGGGUUCUCGAAGGAAUCCAUCCUGCCAAAGCGCAACUCGGAUAAGCUUAUUGCCCGCAAGA AGGAUUGGGACCCGAAAAAGUACGGUGGGUUCGACUCCCCUACCGUGGCGUACUCGGUGUUG GUGGUGGCCAAAGUGGAAAAGGGCAAAUCAAAGAAGCUCAAGAGCGUCAAGGAGCUGCUGGG AAUCACCAUCAUGGAGAGGUCCAGCUUUGAGAAAAACCCGAUCGACUUCUUGGAAGCCAAGG GAUACAAAGAGGUGAAGAAAGACCUGAUCAUCAAACUUCCAAAGUACUCCCUGUUCGAACUC GAAAACGGGAGGAAGCGCAUGCUCGCCUCAGCCGGGGAACUGCAAAAGGGCAACGAACUGGC CCUCCCGUCAAAAUACGUCAACUUCCUGUACUUGGCGUCACACUACGAAAAGCUGAAAGGAU CCCCAGAGGACAACGAACAGAAACAGCUGUUCGUCGAGCAGCACAAGCACUACCUGGACGAG AUCAUCGAACAGAUCUCGGAAUUCAGCAAGAGAGUGAUCUUGGCAGACGCUAACCUUGACAA AGUCCUCUCGGCAUACAAUAAGCAUCGCGACAAGCCGAUCAGAGAACAGGCGGAGAACAUCA UCCACCUGUUCACUCUCACCAACCUGGGCGCGCCAGCGGCUUUUAAGUACUUUGAUACCACC AUUGACCGCAAGAGAUACACCUCAACUAAAGAAGUGCUGGACGCAACCCUGAUCCAUCAAAG CAUCACCGGACUUUAUGAAACUCGGAUCGAUCUCUCACAGCUCGGAGGAGACAAAAGACCGG CUGCCACCAAGAAGGCCGGACAGGCAAAGAAGAAGAAAUGAUAAUAGGCUGGAGCCUCGGUG GCCAUGCUUCUUGCCCCUUGGGCCUCCCCCCAGCCCCUCCUCCCCUUCCUGCACCCGUACCC CCGUGGUCUUUGAAUAAAGUCUGAGUGGGCGGC+A ( 14 Ont ) tail (SEQ ID NO:56)
VEGF VI sgRNA
GGGTGTGCAGACGGCAGTCACTAGGGTTTTAGAGCTAGAAATAGCAAGTTAAAATAAGGCTA GTCCGTTATCAACTTGAAAAAGTGGCACCGAGTCGGTGC (SEQ ID NO: 91)
VEGF V2 sgRNA
GGGTGAGTGAGTGTGTGCGTGTGGGTTTTAGAGCTAGAAATAGCAAGTTAAAATAAGGCTAG TCCGTTATCAACTTGAAAAAGTGGCACCGAGTCGGTGC (SEQ ID NO: 92)
VEGF V3 sgRNA
GGGTGAGTGAGTGTGTGCGTGTGGGTTTTAGAGCTAGAAATAGCAAGTTAAAATAAGGCTAG TCCGTTATCAACTTGAAAAAGTGGCACCGAGTCGGTGC (SEQ ID NO: 93)
VEGF V4 sgRNA
GGGTTGGAGCGGGGAGAAGGCCAGGGTTTTAGAGCTAGAAATAGCAAGTTAAAATAAGGCTA GTCCGTTATCAACTTGAAAAAGTGGCACCGAGTCGGTGC (SEQ ID NO: 94)
In vitro expression of CRISPR-related proteins from mRNA constructs
[00641] HeLa cells were transfected with various tagged dCas9 mRNAs and cellular extracts were subjected to Western, Immunoprecipitation, and LC/MS analysis to detect expression of protein expressed by said RNAs.
[00642] A FLAG tagged Cas9 mRNA constructs containing Cong Cas9 (SEQ ID NO: 55), an untagged Cas9 mRNA construct containing Mali Cas9 (SEQ ID NO: 56), a HA- tagged dCas9 construct containing Gilbert dCas9 (SEQ ID NO: 55), a FLAG-tagged dCas9 construct containing Maeder dCas9 (SEQ ID NO: 52), and and a HA-tagged Trilink Cas9 construct (Trilink) were transfected into HeLa cells according to the following protocol:
[00643] 3 X 106 HeLa cells were plated on 10 cm plates on the day prior to transfection. 30μΕ of Lipofectamine 2000 was diluted into a tube containing 200 μϊ^ Opti-MEM for each sample to be transfected and was held at room temperature for 2-5 minutes. 7.5 ug Cas9 mRNA was diluted into another tube containing 200 μϊ^ Opti-MEM. Then the two dilutions were combined for each sample and mixed. The final solution was allowed to stand at room temperature for 20-25 minutes before the transfection solution was overlayed onto the plated HeLa cells.
[00644] After seven hours post-transfection, cells were lysed with lysis buffer in the presence of lx HALT protease inhibitors (Pierce). Protein from cell lysates was isolated and reserved for western, immunoprecipitation, or LC-MS assays.
[00645] For immunoprecipitation, lysates normalized for protein concentration were added to Sigma M2 agarose beads and washed. Immunoprecipitation was performed at 4°C overnight. Beads were then washed and resuspended in IX LDS protein sample buffer. Samples were then run on a 4-12% Bis-Tris gel with MES biffer (Life
Technologies) using See BluePlus 2™ prestained protein standards (Life Technologies). The nitrocellulose was blocked with 5% milk in PBS for one hour, then blotted with 1 :2000 anti-FLAG (Cell Signaling Technologies) (Figure 2) or 1 : 1000 anti-HA (Covance HA.11 ascites) (Figure 3) in PBS + 0.05% Tween for 4 hours overnight at 4°C.
Membranes were then wahed and incubated with anti-rabbit (Sigma) or anti-mouse (Sigma) conjugated to HRP for 45 minutes at room temperature and detected with Pierce Super Signal West Femto (Pierce) according to the manufacturer's instructions.
[00646] Cong Cas9-FLAG protein was detected in HeLa cells transfected with Cong Cas9-FLAG mRNA (SEQ ID NO: 55) via both direct anti-FLAG western and
immunoprecipitation anti-FLAG western (Figure 2). Maeder Cas9-FLAG protein was detected in HeLA cells transfected with Maeder Cas9-FLAG mRNA (SEQ ID NO: 52) via immunoprecipitation anti-FLAG western (Figure 2). Both Mali Cas9 and Gilbert Cas9-HA did not have a FLAG domain and thus did not show up on the anti-FLAG western or immunoprecipitation (Figure 2). [00647] Gilbert dCas9-HA protein was detected in HeLA cells transfected with Gilbert dCas9-HA mRNA (SEQ ID NO: 51) via direct anti-HA western (Figure 3). Trilink Cas9- HA was used as a positive control for dCas9 expression.
[00648] Protein extracts of HeLa cells transfected with Gilbert dCas9-HA mRNA (SEQ ID NO: 51) and Maeder dCas9-FLAG (SEQ ID NO: 52) were analyzed for protein expression of the Cas9 constructs via LC-PRM peptide quantification and compared to an untreated control HeLa cell protein extracts.
[00649] All solvents were HPLC-grade from Sigma-Aldrich and all chemicals where not stated otherwise were obtained from Sigma-Aldrich.
[00650] Samples were prepared in cell lysis buffer containing 8M urea and 0.1M ammonium bicarbonate. BCA assays to determine total protein content were carried out. Samples with 30 μg of protein were reduced using and digested overnight with trypsin. CI 8 cleanup for mass spectrometry was carried out using MICROSpin™ columns (The Nest Group) according to the manufacturer's instructions. Peptides were dried down redissolved in 30 μΐ to the final concentration of 1 μg/ul in LC solvent A (1% acetonitrile in water with 0.1% formic acid (FA)) containing a controlpeptide mix for retention time calibration.
[00651] Peptides (1 μg per sample) were analyzed on CI 8 chromatography columns on a Thermo Scientific Easy nLC nano-liquid chromatography system for all mass spectrometric analysis. LC solvents were A: 1% acetonitrile in water with 0.1% FA; B: 3% water in acetonitrile with 0.1% FA (gradient elution).
[00652] LC-MS/MS runs for peptide discovery were carried out on a Thermo Scientific Q Exactive™ mass spectrometer equipped with a standard nano-electrospray source.
[00653] LC-PRM for was carried out using a predetermined inclusion list containing target peptides precursor masses on a Thermo Scientific Q Exactive™ mass spectrometer equipped with a standard nano-electrospray source as described before (gradient elution).
[00654] The LC gradient for LC-PRM was 5-35% solvent B in 50 minutes followed by 35-100%B in 2 minutes and 100% B for 8 minutes (total gradient length was 60 minutes).
[00655] LC-MS/MS datasets were analyzed using the MaxQuant software package and searches were performed against the UniProt HUMAN database and other databases. For all peptides of target proteins that were successfully detected in LC-MS/MS, LC-PRM assays were generated using the most intense fragment ions from LC-MS/MS analysis. Top 10 most intense assays were selected. [00656] Data were processed using SpectroDive™ (Biognosys) software for the analysis of LC-MRM and LC-PRM data based on mProphet (Reiter, Rinner et al, Nature Methods 8 (201 1), 430-435). 10 peptides representing housekeeping proteins were quantified in every sample to assess sample loading on the column.
[00657] Relative quantification of peptide segments of Cas9 was carried out for each of the protein extracts via LC-PRM. Quantification of the Cas9 peptide segements:
"GNELALPSK" (SEQ ID NO: 120), "YFDTTIDR" (SEQ ID NO: 121), and
"IPYYVGPLAR" (SEQ ID NO: 122) is shown in Figures 4A, 4B, and 4C, respectively. Table 2 shows relative quantification for each:
Table 2- LC-PRM Cas9 Peptide Quantification in Cell Lysate Samples
Figure imgf000170_0001
In vivo
[00658] Mice (n=l) (8 wk old female BalbC) were administered 350 ul intravenously of 0.04 mg/mL (^g) FLAG-Cas9 Cong mRNA as described as set forth in SEQ ID NO:55_ (polyA tail of approximately 140 nucleotides not shown in sequence; 5'cap, Cap 1 ; fully modified with 1 -methylpseudouridine) formulated in a lipid nanoparticle comprising the lipid DLin-MC3-DMA described in Table 3 or a control of PBS (mock).
Table 3. Lipid Nanoparticle Formulation
Figure imgf000170_0002
[00659] 6 hours after administration the mice were humanely euthanized. Livers were collected from the mice and Cas9 expression was determined by immunoprecipitation as described in detail below.
[00660] Liver tissue was lysed in a Tissue lyser formulation in the presence of protease inhibitors. Protein was extracted and quantitated using a BCA protein assay (Pierce). Samples were normalized by total protein quantification. Approximately 88 mg of protein extract was added to M2 agarose beads (Sigma) for immunoprecipitation. After gently mixing for 3-4 hours at 4°C, beads were apirated and washed with RIPA buffer to remove supernatant. RIPA buffer supplemented with 20C^g / mL 3X FLAG peptide (Sigma) was added to the beads and incubated at 4°C for 30 minutes with shaking at 1 100 rpm in a thermomixer. Peptide elution was then performed by spinning down beads and removing supernatant. Samples were incubated at 72°C for 12 minutes on 4-12% Bis Tris gel using MES running buffer (LifeTech) along with prestained protein standards (LifeTech). The gel was transerd onto nitrocellulose using an iBlot™ apparatus for 6 minutes according to manufacturer's instructions. Membrane was removed and placed in a vessel suitable for blotting and washed 2x with ddH20. Nitrocellulose was then blocked for 45 minutes with 5% nonfat dry milk in PBS. Nitrocellulose was then blotted with anti-M2 HRP at 1 : 15,000 in 1% milk PBS 0.05% Tween for 30 minutes at room temperature. The primary antibody solution was then removed and the nitrocellulose was washed with PBS 00.05% Tween. FLAG-Cas9 peptides were detected with Pierce Super Signal Femto™. The nitrocellulose membrane was then exposed for imaging.
[00661] Results of the immunoprecipitation are shown in Figure 5. As shown in Figure 5, a band is present at 150kD only in the Cas9 LNP sample and not in the PBS control treated sample. These data provide evidence of Cas9 protein expression from LNP formulated synthetic mRNA in vivo in mice dosed with Cas9-LNP.
Example 12: In vitro modulation of transcription with synthetic polynucleotides encoding dCas9-effector fusion proteins and synthetic sgRNA
[00662] VEGF (vascular endothelial growth factor), one of the most potent angiogenic factors, has recently been identified as an inducer of neoangiogenesis in many tumors including gliomas. U-87 MG and A- 172 are two established glioblastoma cell lines.
Basal VEGF expression was an order of magnitude higher in U-87 MG compared to A-
172. (Int J Dev Neurosci. 1999 Aug-Oct; 17(5-6):565-77). This provides a system to test gene regulation by dCas9-KRAB and dCas9-VP64 with sgRNA directed to 5' flanking genomic sequence of VEGF.
Inhibition of transcription with dCas9-KRAB
[00663] Gilbert 2013 described gene down-regulation using dCas9-kRAB fusion protein. KRAB is a category of transcriptional repression domains present in
approximately 400 human zinc finger protein-based transcription factors (KRAB zinc finger proteins) (Huntley 2006). KRAB domains have been shown to be effective repressors of transcription.
[00664] The U-87MG cell line produces endogenous VEGF. The dCas9-kRAB synthetic polynucleotide together with the 4 synthetic sgRNA targeting VEGF described above are used to inhibit transcription of a VEGF gene in U-87MG cells. The following experimental protocol is used.
1. U-87MG are maintained in Dulbecco's modified Eagle medium (DMEM) in 10% FBS, 2 mM glutamine, 100 units/ml streptomycin, and 100 mg/ml penicillin.
2. All transfections are performed in triplicate using Lipofectamine and using
transfection protocol described in U.S. patent publication no. US 2013/0259924 (U.S. patent application no. 13/791,922, filed on March 9, 2013) incorporated by refererence.
3. 160,000 cells are seeded into 24-well plates the day before transfection.
4. Transfect U-87MG cells with lOOng of dCas9-KRAB mRNA and lOOng of VEGF VI -V4 sgRNAs. For synergy experiments, transfect lOOng of dCas9-KRAB mRNA with 25ng each of VEGF VI -V4 sgRNAs (a total of lOOng of four different VEGF sgRNA)
5. Incubate cells for 8 hours and wash cells to remove transfection agent.
6. Continue to incubate cells in DMEM
7. Culture medium of U-87MG transfected with mRNA encoding VEGFA-targeted sgRNA and dCas9-KRAB was collected Oh, 12h, 24h, 48h after transfection
8. VEGFA protein expression is measured by ELISA.
[00665] Introduction of synthetic polynucleotides encoding dCas9-KRAB with sgRNA targeting VEGF genomic sequence inhibits VEGF transcription compared to untreated cells. Activation of transcription with dCas9-VP64
[00666] Maeder 2013 and Perez-Pinera 2013 describe an RNA-guided transcriptional activator, created by fusing dCas9 (D10A, H840A) to the VP64 transactivation domain. dCas9-VP64 recognizes genomic target sites through the hybridization of a sgRNA to a target sequence.
[00667] The HEK293 cell line does not produces endogenous VEGF. The dCas9-VP- 64 synthetic polynucleotide together with the 4 synthetic sgRNA targeting VEGF described above are used to activate transcription of a VEGF gene in HEK293 cells. The following experimental protocol is used.
1. HEK293 are maintained in Dulbecco's modified Eagle medium (DMEM) in 10% FBS, 2 mM glutamine, 100 units/ml streptomycin, and 100 mg/ml penicillin.
2. All transfections are performed in triplicate using Lipofectamine and using
transfection protocol described in U.S. patent publication no. US 2013/0259924 (U.S. patent application no. 13/791,922, filed on March 9, 2013).
3. 160,000 cells were seeded into 24-well plates the day before transfection.
4. HEK293cells are transfected with lOOng of dCas9-VP64 mRNA and lOOng of VEGF V1-V4 sgRNAs. For synergy experiments, transfect lOOng of dCas9-VP64 mRNA with 25ng each of VEGF VI -V4 sgRNAs (a total of lOOng of four different VEGF sgRNA)
5. Incubate cells for 8 hours and wash cells to remove transfection agent.
6. Continue to incubate cells in DMEM.
7. Culture medium of HEK293 transfected with mRNA encoding VEGFA-targeted sgRNA and dCas9-VP64 is collected Oh, 12h, 24h, 48h after transfection
8. VEGFA protein expression is measured by ELISA.
9. VEGFA mRNA is measured by RT-PCR or Taqman or Q-PCR
[00668] Introduction of synthetic polynucleotides encoding dCas9-VP64 with sgRNA targeting VEGF genomic sequence activates VEGF transcription in HEK293 cells compared to untreated cells.
Example 13: Tissue specific modulation of in vitro protein expression
[00669] miR-122 is present in primary human hepatocytes and is not present in hepatocellular carcinoma cell lines such as HepG2, Hep3B, and SK-Hep-1 cells. It has been shown that miR-122 can down-regulate protein production encoded by an mRNA containing miR-122 binding sites in the 3' UTR in primary hepatocytes, but not in HepG2 and Hep3B
[00670] Primary hepatocytes and HepG2 cells are transfected with dCas9-KRAB, dCas9-KRAB-miR 122, dCas9-VP64,dCas9-VP64-miR122 synthetic polynucleotides along with a combination of the four synthetic sgRNA targeting VEGF.
[00671] Transfection of primary hepatocytes is performed as described herein. Table 4 and 5 provide the results.
Table 4: Results of primary hepatocyte transfection.
Figure imgf000174_0001
[00672] Transfection of HEpG2 cells is performed as described herein. The following table provides the results.
Table 5: Results of HEpG2 transfection. dCas9- RAB dCas9-KRAB- dCas9-VP64 dCas9-VP64- Untreated miR122 miR122
VEGF VI sgRNA Potential Potential Potential Potential
decrease in decrease in increase in increase in protein protein protein protein
expression and expression and expression and expression and mRNA mRNA mRNA mRNA
transcript transcript transcript transcript
VEGF V2 sgRNA Potential Potential Potential Potential
decrease in decrease in increase in increase in protein protein protein protein
expression and expression and expression and expression and mRNA mRNA mRNA mRNA
transcript transcript transcript transcript
VEGF V3 sgRNA Potential Potential Potential Potential
decrease in decrease in increase in increase in protein protein protein protein
expression and expression and expression and expression and mRNA mRNA mRNA mRNA
transcript transcript transcript transcript
VEGF V4 sgRNA Potential Potential Potential Potential
decrease in decrease in increase in increase in protein protein protein protein
expression and expression and expression and expression and mRNA mRNA mRNA mRNA
transcript transcript transcript transcript
VEGF VI -V4 Potential Potential Potential Potential
sgRNA decrease in decrease in increase in increase in
protein protein protein protein
expression and expression and expression and expression and mRNA mRNA mRNA mRNA
transcript transcript transcript transcript
Example 14: Modulation of in vivo protein expression with dCas9
[00673] Delivery of synthetic polynucleotides encoding dCAS9-effector fusion proteins and synthetic sgRNA targeting a gene of interest to the liver using lipid-nucleic acid particle formulation is performed following procedures described U.S. patent publication no. US 2013/0259924 (U.S. patent application no. 13/791,922, filed on March 9, 2013). Delivery of synthetic polynucleotides encoding dCAS9-effector fusion proteins and synthetic sgRNA targeting a gene of interest to muscle cells via intramuscular injection is performed as described in U.S. patent publication no. US 2013/0259924 (U.S. patent application no. 13/791,922, filed on March 9, 2013).
a. In vivo inhibition of TPO gene transcription with dCas9-KRAB
[00674] Thrombopoietin (TPO) is produced mainly by the liver. Synthetic
polynucleotides encoding dCas9-KRAB or dCas9-KRAB-miR122 along with sgRNA targeting the 5 ' flanking sequence of thrombopoietin are formulated in an LNP formulation. 0.005mg/kg to 0.5mg/kg of LNP formulated dCas9-KRAB and TPO sgRNA is administered intravenously to mice. Blood and liver samples are collected at 8h, 24hr, 48hr, 72hr post administration. TPO protein level is measured by ELISA and TPO mRNA is measured by RT-PCR or q-PCR.
[00675] With dCas9-KRAB mediated suppression with TPO sgRNA, TPO protein and mRNA expression will decrease. However, because of the presence of miR-122, groups treated with dCas9-KRAB-miR122 TPO sgRNA will not show significant down regulation of TPO protein production and mRNA expression.
b. In vivo inhibition of reporter gene transcription with dCas9-KRAB
[00676] An exogenous DNA plasmid comprising a reporter molecule, such as luciferase, GFP, or human VEGF, and a specific 5' flanking sequence containing VEGF VI -V4 sgRNA sequences and a constitutively active promoter to drive protein expression is co-administered with the synthetic polynucleotide encoding dCas9-KRAB/dCas9- KRAB-miR122 and with the 4 synthetic sgRNA targeting VEGF. Polynucleotides are LNP formulated and administered as described herein.
[00677] There is a decrease in expression of the reporter molecule in groups treated with dCas9-KRAB/VEGF sgRNA. There is not a significant decrease in expression of the reporter molecule in groups treated with dCas9-KRAB-mirl22/VEGF sgRNA.
c. In vivo activation of LDHC gene transcription with dCas9-VP64
[00678] To demonstrate activation of transcription and protein expression using synthetic polynucleotide encoding dCas9-VP64, proteins that are not typically expressed by the liver are targeted. Lactate dehydrogenase C (LDHC) is a testis specific enzyme. Administration of LNP formulated synthetic polynucleotide encoding dCas9-VP64 along with synthetic sgRNA targeting 5' genomic sequence of mouse LDHC induces the expression of LDHC in the liver. The LDHC mRNA transcript is measured by RT-PCR or qPCR and the protein expression is measured by ELISA or western blot.
Administration of LNP formulated synthetic polynucleotide encoding dCas9-VP64- miR122 and sgRNA targeting the 5' genomic sequence of the mouse LDHC does not activate LDHC expression because of the presence of miR-122 in the liver cells.
d. In vivo activation of reporter gene transcription with dCas9-VP64
[00679] An exogenous DNA plasmid comprising a reporter molecule, such as luciferase, GFP, or human VEGF, and a specific 5' flanking sequence containing VEGF VI -V4 sgRNA sequences and a constitutively inactive promoter is co-administered with the synthetic polynucleotide encoding dCas9-VP64/dCas9-VP64-miR122 with and the synthetic sgRNA targeting VEGF. There is an increase in expression of the reporter molecule in groups treated with dCas9-VP64/VEGF sgRNA. There is not a significant increase in expression of the reporter molecule in groups treated with dCas9-VP64- mirl22/VEGF sgRNA.
e. Tissue specific in vivo modulation of LDHC gene transcription
[00680] As described herein, microRNA can provide tissue specificity. To demonstrate tissue selectivity of dCas9 system using microRNA 122, one group of mice is dosed intravenously and another group is dosed intramuscularly with LNP formulated synthetic polynucleotide encoding dCas9-VP64-mirl22 and synthetic sgRNA targeting LDHC. Due to the presence of miR-122 in the liver cells, the synthetic polynucleotide encoding dCas9-VP64 will not be expressed; thus, no dCas9-VP64 mediated activation of LDHC expression. Since muscle cells do not contain miR-122, the group receiving
intramuscular injection of dCas9-VP64-miR122 and LDHC sgRNA will show expression of a testis-specific protein.
f Tissue specific in vivo modulation of reporter gene transcription
[00681] Another example is to co-administer a DNA plasmid described in Gilbert et al as a target for gene suppression of dCas9-KRAB. A formulated LNP carrying 1) SV40- GFP DNA plasmid (described in Gilbert et al), 2) sgGFP-NTl sgRNA (described in Gilbert et al), and 3) mRNA encoding either dCas9-KRAB or dCas9-KRAB-miR122 is administered via IV to the liver, which contain miR-122. The group receiving dCas9- KRAB will show a reduced GFP expression compared to the control group that received no dCas9-KRAB mRNA as measure by flow cytometry or immunohistochemistry because the translation of dCas9-KRAB will not be reduced by miR122. The group receiving dCas9-KRAB-miR122 will show GFP expression similar to the control group receiving no dCas9-KRAB-miR122 mRNA because of the presence of miR-122 in the hepatocytes which inhibits the translation of the dCas9-KRAB-miR122 mRNA. To compared IM delivery to the muscle cells which do not contain miR-122, a formulated LNP carrying 1) SV40-GFP DNA plasmid (described in Gilbert et al), 2) sgGFP-NTl sgRNA (described in Gilbert et al), and 3) mRNA encoding either dCas9-KRAB or dCas9-KRAB-miR122 is administered via IM injection. We expect to see both the dCas9-KRAB and the dCas9-KRAB-miR122 groups to show GPF expression in the muscle cells as measure by flow cytometry or immunohistochemistry. [00682] Another example is to co-administer a DNA plasmid described in Gilbert et al as a target for gene activation of dCas9-VP64. A formulated LNP carrying 1) GAL4 UAS GFP DNA plasmid (described in Gilbert et al), 2) sgGAL4-l sgRNA (described in Gilbert et al), and 3) mRNA encoding eitherdCas9-VP64 or dCas9-VP64-miR122 is administered via IV to the liver. The group receiving dCas9-VP64 mRNA will show GFP expression as measure by flow cytometry or immunohistochemistry whereas the group receiving dCas9-VP64-miR122 will not show GFP expression because of the presence of miR-122 in the hepatocytes suppressing the translation of dCas9-VP64- miR122 mRNA. To compared IM delivery to the muscle cells which do not contain miR- 122, A formulated LNP carrying 1) GAL4 UAS GFP DNA plasmid (described in Gilbert et al), 2) sgGAL4-l sgRNA (described in Gilbert et al), and 3) mRNA encoding eitherdCas9-VP64 or dCas9-VP64-miR12 is administered via IM injection. We expect to see both the dCas9-VP64 and the dCas9-VP64-miR122 groups to activate GPF expression in the muscle cells as measure by flow cytometry or immunohistochemistry.
Example 15: Use of 3 different delivery systems
[00683] A combination of targeting mechanism is used to allow for a significant safety window when administering synthetic polynucleotides encoding a CRISPR related protein and sgRNA.
[00684] First, a synthetic polynucleotide encoding a dCAS9-effecor domain fusion protein is designed using a miR-142.3p targeted 3'UTR to prevent expression in APCs.
[00685] Second, the synthetic polynucleotide is formulated in an ionizable LNP that targets LDL-R mediated uptake into hepatocytes. This leads to expression of the dCAS9- effecor domain fusion protein in the liver.
[00686] Third, the synthetic sgRNA targeting the hepatic gene of interest is conjugated with, e.g., a GalNac conjugate or similar targeting moiety that is preferentially be taken up by hepatocytes. The synthetic sgRNA can be administered separately and after a 2-3 hour delay.
[00687] The combination of targeting mechanisms (in this case 3: mir-3 'UTR, LNP, GalNac) and the absence of DNA would allow for significant safety window.
[00688] The result could be transcriptional activation or inhibition of any protein target (our first in vivo experiments will focus on IHC to confirm localization of dCas9 fusion into the liver and functional read outs using reporters like luciferase and/or GFP. OTHER EMBODIMENTS
[00689] It is to be understood that the words which have been used are words of description rather than limitation, and that changes may be made within the purview of the appended claims without departing from the true scope and spirit of the invention in its broader aspects.
[00690] While the present invention has been described at some length and with some particularity with respect to the several described embodiments, it is not intended that it should be limited to any such particulars or embodiments or any particular embodiment, but it is to be construed with references to the appended claims so as to provide the broadest possible interpretation of such claims in view of the prior art and, therefore, to effectively encompass the intended scope of the invention.
[00691] All publications, patent applications, patents, and other references mentioned herein are incorporated by reference in their entirety. In case of conflict, the present specification, including definitions, will control. In addition, section headings, the materials, methods, and examples are illustrative only and not intended to be limiting.
Sequence Tables
Table 5 : CRISPR related proteins
Figure imgf000180_0001
Description Sequence SEQ
ID
O
augaucaaau uucggggaca cuuccucauc gagggggacc ugaacccaga caacagcgau 540 gucgacaaac ucuuuaucca acugguucag acuuacaauc agcuuuucga agagaacccg 600 aucaacgcau ccggaguuga cgccaaagca auccugagcg cuaggcuguc caaaucccgg 660 cggcucgaaa accucaucgc acagcucccu ggggagaaga agaacggccu guuugguaau 720 cuuaucgccc ugucacucgg gcugaccccc aacuuuaaau cuaacuucga ccuggccgaa 780 gaugccaagc uucaacugag caaagacacc uacgaugaug aucucgacaa ucugcuggcc 840 cagaucggcg accaguacgc agaccuuuuu uuggcggcaa agaaccuguc agacgccauu 900 cugcugagug auauucugcg agugaacacg gagaucacca aagcuccgcu gagcgcuagu 960 augaucaagc gcuaugauga gcaccaccaa gacuugacuu ugcugaaggc ccuugucaga 1020 cagcaacugc cugagaagua caaggaaauu uucuucgauc agucuaaaaa uggcuacgcc 1080 ggauacauug acggcggagc aagccaggag gaauuuuaca aauuuauuaa gcccaucuug 1140 gaaaaaaugg acggcaccga ggagcugcug guaaagcuua acagagaaga ucuguugcgc 1200 aaacagcgca cuuucgacaa uggaagcauc ccccaccaga uucaccuggg cgaacugcac 1260 gcuauccuca ggcggcaaga ggauuucuac cccuuuuuga aagauaacag ggaaaagauu 1320 gagaaaaucc ucacauuucg gauacccuac uauguaggcc cccucgcccg gggaaauucc 1380 agauucgcgu ggaugacucg caaaucagaa gagaccauca cucccuggaa cuucgaggaa 1440 gucguggaua agggggccuc ugcccagucc uucaucgaaa ggaugacuaa cuuugauaaa 1500 aaucugccua acgaaaaggu gcuuccuaaa cacucucugc uguacgagua cuucacaguu 1560 uauaacgagc ucaccaaggu caaauacguc acagaaggga ugagaaagcc agcauuccug 1620 ucuggagagc agaagaaagc uaucguggac cuccucuuca agacgaaccg gaaaguuacc 1680 gugaaacagc ucaaagaaga cuauuucaaa aagauugaau guuucgacuc uguugaaauc 1740 agcggagugg aggaucgcuu caacgcaucc cugggaacgu aucacgaucu ccugaaaauc 1800 auuaaagaca aggacuuccu ggacaaugag gagaacgagg acauucuuga ggacauuguc 1860 cucacccuua cguuguuuga agauagggag augauugaag aacgcuugaa aacuuacgcu 1920 caucucuucg acgacaaagu caugaaacag cucaagaggc gccgauauac aggauggggg 1980 cggcugucaa gaaaacugau caaugggauc cgagacaagc agaguggaaa gacaauccug 2040 gauuuucuua aguccgaugg auuugccaac cggaacuuca ugcaguugau ccaugaugac 2100 ucucucaccu uuaaggagga cauccagaaa gcacaaguuu cuggccaggg ggacagucuu 2160 cacgagcaca ucgcuaaucu ugcagguagc ccagcuauca aaaagggaau acugcagacc 2220 guuaaggucg uggaugaacu cgucaaagua augggaaggc auaagcccga gaauaucguu 2280 aucgagaugg cccgagagaa ccaaacuacc cagaagggac agaagaacag uagggaaagg 2340 augaagagga uugaagaggg uauaaaagaa cugggguccc aaauccuuaa ggaacaccca 2400 guugaaaaca cccagcuuca gaaugagaag cucuaccugu acuaccugca gaacggcagg 2460 gacauguacg uggaucagga acuggacauc aaucggcucu ccgacuacga cguggaucau 2520 aucgugcccc agucuuuucu caaagaugau ucuauugaua auaaaguguu gacaagaucc 2580 gauaaaaaua gagggaagag ugauaacguc cccucagaag aaguugucaa gaaaaugaaa 2640
Description Sequence SEQ
ID
O
aauuauuggc ggcagcugcu gaacgccaaa cugaucacac aacggaaguu cgauaaucug 2700 acuaaggcug aacgaggugg ccugucugag uuggauaaag ccggcuucau caaaaggcag 2760 cuuguugaga cacgccagau caccaagcac guggcccaaa uucucgauuc acgcaugaac 2820 accaaguacg augaaaauga caaacugauu cgagagguga aaguuauuac ucugaagucu 2880 aagcuggucu cagauuucag aaaggacuuu caguuuuaua aggugagaga gaucaacaau 2940 uaccaccaug cgcaugaugc cuaccugaau gcagugguag gcacugcacu uaucaaaaaa 3000 uaucccaagc uugaaucuga auuuguuuac ggagacuaua aaguguacga uguuaggaaa 3060 augaucgcaa agucugagca ggaaauaggc aaggccaccg cuaaguacuu cuuuuacagc 3120 aauauuauga auuuuuucaa gaccgagauu acacuggcca auggagagau ucggaagcga 3180 ccacuuaucg aaacaaacgg agaaacagga gaaaucgugu gggacaaggg uagggauuuc 3240 gcgacagucc ggaagguccu guccaugccg caggugaaca ucguuaaaaa gaccgaagua 3300 cagaccggag gcuucuccaa ggaaaguauc cucccgaaaa ggaacagcga caagcugauc 3360 gcacgcaaaa aagauuggga ccccaagaaa uacggcggau ucgauucucc uacagucgcu 3420 uacaguguac ugguuguggc caaaguggag aaagggaagu cuaaaaaacu caaaagcguc 3480 aaggaacugc ugggcaucac aaucauggag cgaucaagcu ucgaaaaaaa ccccaucgac 3540 uuucucgagg cgaaaggaua uaaagagguc aaaaaagacc ucaucauuaa gcuucccaag 3600 uacucucucu uugagcuuga aaacggccgg aaacgaaugc ucgcuagugc gggcgagcug 3660 cagaaaggua acgagcuggc acugcccucu aaauacguua auuucuugua ucuggccagc 3720 cacuaugaaa agcucaaagg gucucccgaa gauaaugagc agaagcagcu guucguggaa 3780 caacacaaac acuaccuuga ugagaucauc gagcaaauaa gcgaauucuc caaaagagug 3840 auccucgccg acgcuaaccu cgauaaggug cuuucugcuu acaauaagca cagggauaag 3900 cccaucaggg agcaggcaga aaacauuauc cacuuguuua cucugaccaa cuugggcgcg 3960 ccugcagccu ucaaguacuu cgacaccacc auagacagaa agcgguacac cucuacaaag 4020 gagguccugg acgccacacu gauucaucag ucaauuacgg ggcucuauga aacaagaauc 4080 gaccucucuc agcucggugg agacagcagg gcugacccca agaagaagag gaagguguga 4140
CRISPR- MDKKYSIGLDIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGETAE 8 associated ATRLKRTARRRYTRRKNRICYLQEIFSNEMAKVDDSFFHRLEESFLVEEDKKHERHPIFG
endonuclease NIVDEVAYHEKYPTIYHLRKKLVDSTDKADLRLIYLALAHMIKFRGHFLIEGDLNPDNSD
CAS9/Csnl VDKLFIQLVQTYNQLFEENPINASGVDAKAILSARLSKSRRLENLIAQLPGEKKNGLFGN
protein LIALSLGLTPNFKSNFDLAEDAKLQLSKDTYDDDLDNLLAQIGDQYADLFLAAKNLSDAI
LLSDILRVNTEITKAPLSASMIKRYDEHHQDLTLLKALVRQQLPEKYKEIFFDQSKNGYA GYIDGGASQEEFYKFIKPILEKMDGTEELLVKLNREDLLRKQRTFDNGSIPHQIHLGELH AILRRQEDFYPFLKDNREKIEKILTFRIPYYVGPLARGNSRFAWMTRKSEETITPWNFEE VVDKGASAQSFIERMTNFDKNLPNEKVLPKHSLLYEYFTVYNELTKVKYVTEGMRKPAFL SGEQKKAIVDLLFKTNRKVTVKQLKEDYFKKIECFDSVEISGVEDRFNASLGTYHDLLKI
Description Sequence
IKDKDFLDNEENEDILEDIVLTLTLFEDREMIEERLKTYAHLFDDKVMKQLKRRRYTGWG RLSRKLINGIRDKQSGKTILDFLKSDGFANRNFMQLIHDDSLTFKEDIQKAQVSGQGDSL HEHIANLAGSPAIKKGILQTVKVVDELVKVMGRHKPENIVIEMARENQTTQKGQKNSRER MKRIEEGIKELGSQILKEHPVENTQLQNEKLYLYYLQNGRDMYVDQELDINRLSDYDVDH IVPQSFLKDDSIDNKVLTRSDKNRGKSDNVPSEEWKKMKNYWRQLLNAKLITQRKFDNL TKAERGGLSELDKAGFIKRQLVETRQITKHVAQILDSRMNTKYDENDKLIREVKVITLKS KLVSDFRKDFQFYKVREINNYHHAHDAYLNAVVGTALIKKYPKLESEFVYGDYKVYDVRK MIAKSEQEIGKATAKYFFYSNIMNFFKTEITLANGEIRKRPLIETNGETGEIVWDKGRDF ATVRKVLSMPQVNIVKKTEVQTGGFSKESILPKRNSDKLIARKKDWDPKKYGGFDSPTVA YSVLVVAKVEKGKSKKLKSVKELLGITIMERSSFEKNPIDFLEAKGYKEVKKDLI IKLPK YSLFELENGRKRMLASAGELQKGNELALPSKYVNFLYLASHYEKLKGSPEDNEQKQLFVE QHKHYLDEI IEQISEFSKRVILADANLDKVLSAYNKHRDKPIREQAENI IHLFTLTNLGA PAAFKYFDTTIDRKRYTSTKEVLDATLIHQSITGLYETRIDLSQLGGDSRADPKKKRKV
CRISPR- auggacuaua aggaccacga cggagacuac aaggaucaug auauugauua caaagacgau 60 associated gacgauaaga uggccccaaa gaagaagcgg aaggucggua uccacggagu cccagcagcc 120 endonuclease gacaagaagu acagcaucgg ccuggacauc ggcaccaacu cugugggcug ggccgugauc 180
CAS9/Csnl accgacgagu acaaggugcc cagcaagaaa uucaaggugc ugggcaacac cgaccggcac 240 mRNA agcaucaaga agaaccugau cggagcccug cuguucgaca gcggcgaaac agccgaggcc 300 acccggcuga agagaaccgc cagaagaaga uacaccagac ggaagaaccg gaucugcuau 360 cugcaagaga ucuucagcaa cgagauggcc aagguggacg acagcuucuu ccacagacug 420 gaagaguccu uccuggugga agaggauaag aagcacgagc ggcaccccau cuucggcaac 480 aucguggacg agguggccua ccacgagaag uaccccacca ucuaccaccu gagaaagaaa 540 cugguggaca gcaccgacaa ggccgaccug cggcugaucu aucuggcccu ggcccacaug 600 aucaaguucc ggggccacuu ccugaucgag ggcgaccuga accccgacaa cagcgacgug 660 gacaagcugu ucauccagcu ggugcagacc uacaaccagc uguucgagga aaaccccauc 720 aacgccagcg gcguggacgc caaggccauc cugucugcca gacugagcaa gagcagacgg 780 cuggaaaauc ugaucgccca gcugcccggc gagaagaaga auggccuguu cggcaaccug 840 auugcccuga gccugggccu gacccccaac uucaagagca acuucgaccu ggccgaggau 900 gccaaacugc agcugagcaa ggacaccuac gacgacgacc uggacaaccu gcuggcccag 960 aucggcgacc aguacgccga ccuguuucug gccgccaaga accuguccga cgccauccug 1020 cugagcgaca uccugagagu gaacaccgag aucaccaagg ccccccugag cgccucuaug 1080 aucaagagau acgacgagca ccaccaggac cugacccugc ugaaagcucu cgugcggcag 1140 cagcugccug agaaguacaa agagauuuuc uucgaccaga gcaagaacgg cuacgccggc 1200 uacauugacg gcggagccag ccaggaagag uucuacaagu ucaucaagcc cauccuggaa 1260 aagauggacg gcaccgagga acugcucgug aagcugaaca gagaggaccu gcugcggaag 1320
Description Sequence SEQ
ID
O
cagcggaccu ucgacaacgg cagcaucccc caccagaucc accugggaga gcugcacgcc 1380 auucugcggc ggcaggaaga uuuuuaccca uuccugaagg acaaccggga aaagaucgag 1440 aagauccuga ccuuccgcau ccccuacuac gugggcccuc uggccagggg aaacagcaga 1500 uucgccugga ugaccagaaa gagcgaggaa accaucaccc ccuggaacuu cgaggaagug 1560 guggacaagg gcgcuuccgc ccagagcuuc aucgagcgga ugaccaacuu cgauaagaac 1620 cugcccaacg agaaggugcu gcccaagcac agccugcugu acgaguacuu caccguguau 1680 aacgagcuga ccaaagugaa auacgugacc gagggaauga gaaagcccgc cuuccugagc 1740 ggcgagcaga aaaaggccau cguggaccug cuguucaaga ccaaccggaa agugaccgug 1800 aagcagcuga aagaggacua cuucaagaaa aucgagugcu ucgacuccgu ggaaaucucc 1860 ggcguggaag aucgguucaa cgccucccug ggcacauacc acgaucugcu gaaaauuauc 1920 aaggacaagg acuuccugga caaugaggaa aacgaggaca uucuggaaga uaucgugcug 1980 acccugacac uguuugagga cagagagaug aucgaggaac ggcugaaaac cuaugcccac 2040 cuguucgacg acaaagugau gaagcagcug aagcggcgga gauacaccgg cuggggcagg 2100 cugagccgga agcugaucaa cggcauccgg gacaagcagu ccggcaagac aauccuggau 2160 uuccugaagu ccgacggcuu cgccaacaga aacuucaugc agcugaucca cgacgacagc 2220 cugaccuuua aagaggacau ccagaaagcc cagguguccg gccagggcga uagccugcac 2280 gagcacauug ccaaucuggc cggcagcccc gccauuaaga agggcauccu gcagacagug 2340 aagguggugg acgagcucgu gaaagugaug ggccggcaca agcccgagaa caucgugauc 2400 gaaauggcca gagagaacca gaccacccag aagggacaga agaacagccg cgagagaaug 2460 aagcggaucg aagagggcau caaagagcug ggcagccaga uccugaaaga acaccccgug 2520 gaaaacaccc agcugcagaa cgagaagcug uaccuguacu accugcagaa ugggcgggau 2580 auguacgugg accaggaacu ggacaucaac cggcuguccg acuacgaugu ggaccauauc 2640 gugccucaga gcuuucugaa ggacgacucc aucgacaaca aggugcugac cagaagcgac 2700 aagaaccggg gcaagagcga caacgugccc uccgaagagg ucgugaagaa gaugaagaac 2760 uacuggcggc agcugcugaa cgccaagcug auuacccaga gaaaguucga caaucugacc 2820 aaggccgaga gaggcggccu gagcgaacug gauaaggccg gcuucaucaa gagacagcug 2880 guggaaaccc ggcagaucac aaagcacgug gcacagaucc uggacucccg gaugaacacu 2940 aaguacgacg agaaugacaa gcugauccgg gaagugaaag ugaucacccu gaaguccaag 3000 cugguguccg auuuccggaa ggauuuccag uuuuacaaag ugcgcgagau caacaacuac 3060 caccacgccc acgacgccua ccugaacgcc gucgugggaa ccgcccugau caaaaaguac 3120 ccuaagcugg aaagcgaguu cguguacggc gacuacaagg uguacgacgu gcggaagaug 3180 aucgccaaga gcgagcagga aaucggcaag gcuaccgcca aguacuucuu cuacagcaac 3240 aucaugaacu uuuucaagac cgagauuacc cuggccaacg gcgagauccg gaagcggccu 3300 cugaucgaga caaacggcga aaccggggag aucguguggg auaagggccg ggauuuugcc 3360 accgugcgga aagugcugag caugccccaa gugaauaucg ugaaaaagac cgaggugcag 3420 acaggcggcu ucagcaaaga gucuauccug cccaagagga acagcgauaa gcugaucgcc 3480
Description Sequence agaaagaagg acugggaccc uaagaaguac ggcggcuucg acagccccac cguggccuau 3540 ucugugcugg ugguggccaa aguggaaaag ggcaagucca agaaacugaa gagugugaaa 3600 gagcugcugg ggaucaccau cauggaaaga agcagcuucg agaagaaucc caucgacuuu 3660 cuggaagcca agggcuacaa agaagugaaa aaggaccuga ucaucaagcu gccuaaguac 3720 ucccuguucg agcuggaaaa cggccggaag agaaugcugg ccucugccgg cgaacugcag 3780 aagggaaacg aacuggcccu gcccuccaaa uaugugaacu uccuguaccu ggccagccac 3840 uaugagaagc ugaagggcuc ccccgaggau aaugagcaga aacagcuguu uguggaacag 3900 cacaagcacu accuggacga gaucaucgag cagaucagcg aguucuccaa gagagugauc 3960 cuggccgacg cuaaucugga caaagugcug uccgccuaca acaagcaccg ggauaagccc 4020 aucagagagc aggccgagaa uaucauccac cuguuuaccc ugaccaaucu gggagccccu 4080 gccgccuuca aguacuuuga caccaccauc gaccggaaga gguacaccag caccaaagag 4140 gugcuggacg ccacccugau ccaccagagc aucaccggcc uguacgagac acggaucgac 4200 cugucucagc ugggaggcga caagcguccu gcugcuacua agaaagcugg ucaagcuaag 4260 aaaaagaaa 4269
CRISPR- MDYKDHDGDYKDHDIDYKDDDDKMAPKKKRKVGIHGVPAADKKYSIGLDIGTNSVGWAVI associated TDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGETAEATRLKRTARRRYTRRKNRICY endonuclease LQEIFSNEMAKVDDSFFHRLEESFLVEEDKKHERHPIFGNIVDEVAYHEKYPTIYHLRKK
CAS9/Csnl LVDSTDKADLRLIYLALAHMIKFRGHFLIEGDLNPDNSDVDKLFIQLVQTYNQLFEENPI protein NASGVDAKAILSARLSKSRRLENLIAQLPGEKKNGLFGNLIALSLGLTPNFKSNFDLAED
AKLQLSKDTYDDDLDNLLAQIGDQYADLFLAAKNLSDAILLSDILRVNTEITKAPLSASM IKRYDEHHQDLTLLKALVRQQLPEKYKEIFFDQSKNGYAGYIDGGASQEEFYKFIKPILE KMDGTEELLVKLNREDLLRKQRTFDNGSIPHQIHLGELHAILRRQEDFYPFLKDNREKIE KILTFRIPYYVGPLARGNSRFAWMTRKSEETITPWNFEEVVDKGASAQSFIERMTNFDKN LPNEKVLPKHSLLYEYFTVYNELTKVKYVTEGMRKPAFLSGEQKKAIVDLLFKTNRKVTV KQLKEDYFKKIECFDSVEISGVEDRFNASLGTYHDLLKIIKDKDFLDNEENEDILEDIVL TLTLFEDREMIEERLKTYAHLFDDKVMKQLKRRRYTGWGRLSRKLINGIRDKQSGKTILD FLKSDGFANRNFMQLIHDDSLTFKEDIQKAQVSGQGDSLHEHIANLAGSPAIKKGILQTV KWDELVKVMGRHKPENIVIEMARENQTTQKGQKNSRERMKRIEEGIKELGSQILKEHPV ENTQLQNEKLYLYYLQNGRDMYVDQELDINRLSDYDVDHIVPQSFLKDDSIDNKVLTRSD KNRGKSDNVPSEEWKKMKNYWRQLLNAKLITQRKFDNLTKAERGGLSELDKAGFIKRQL VETRQITKHVAQILDSRMNTKYDENDKLIREVKVITLKSKLVSDFRKDFQFYKVREINNY HHAHDAYLNAVVGTALIKKYPKLESEFVYGDYKVYDVRKMIAKSEQEIGKATAKYFFYSN IMNFFKTEITLANGEIRKRPLIETNGETGEIVWDKGRDFATVRKVLSMPQVNIVKKTEVQ TGGFSKESILPKRNSDKLIARKKDWDPKKYGGFDSPTVAYSVLVVAKVEKGKSKKLKSVK ELLGITIMERSSFEKNPIDFLEAKGYKEVKKDLI IKLPKYSLFELENGRKRMLASAGELQ
Description Sequence
KGNELALPSKYVNFLYLASHYEKLKGSPEDNEQKQLFVEQHKHYLDEI IEQISEFSKRVI LADANLDKVLSAYNKHRDKPIREQAENI IHLFTLTNLGAPAAFKYFDTTIDRKRYTSTKE VLDATLIHQSITGLYETRIDLSQLGGDKRPAATKKAGQAKKKK
CRISPR- auggacaaga aguacagcau cggccuggac aucggcacca acucuguggg cugggccgug 60 associated aucaccgacg aguacaaggu gcccagcaag aaauucaagg ugcugggcaa caccgaccgg 120 endonuclease cacagcauca agaagaaccu gaucggcgcc cugcuguucg acagcggaga aacagccgag 180
CAS9/Csnl gccacccggc ugaagagaac cgccagaaga agauacacca gacggaagaa ccggaucugc 240 mRNA uaucugcaag agaucuucag caacgagaug gccaaggugg acgacagcuu cuuccacaga 300 cuggaagagu ccuuccuggu ggaagaggau aagaagcacg agcggcaccc caucuucggc 360 aacaucgugg acgagguggc cuaccacgag aaguacccca ccaucuacca ccugagaaag 420 aaacuggugg acagcaccga caaggccgac cugcggcuga ucuaucuggc ccuggcccac 480 augaucaagu uccggggcca cuuccugauc gagggcgacc ugaaccccga caacagcgac 540 guggacaagc uguucaucca gcuggugcag accuacaacc agcuguucga ggaaaacccc 600 aucaacgcca gcggcgugga cgccaaggcc auccugucug ccagacugag caagagcaga 660 cggcuggaaa aucugaucgc ccagcugccc ggcgagaaga agaauggccu guucggcaac 720 cugauugccc ugagccuggg ccugaccccc aacuucaaga gcaacuucga ccuggccgag 780 gaugccaaac ugcagcugag caaggacacc uacgacgacg accuggacaa ccugcuggcc 840 cagaucggcg accaguacgc cgaccuguuu cuggccgcca agaaccuguc cgacgccauc 900 cugcugagcg acauccugag agugaacacc gagaucacca aggccccccu gagcgccucu 960 augaucaaga gauacgacga gcaccaccag gaccugaccc ugcugaaagc ucucgugcgg 1020 cagcagcugc cugagaagua caaagagauu uucuucgacc agagcaagaa cggcuacgcc 1080 ggcuacaucg auggcggagc cagccaggaa gaguucuaca aguucaucaa gcccauccug 1140 gaaaagaugg acggcaccga ggaacugcuc gugaagcuga acagagagga ccugcugcgg 1200 aagcagcgga ccuucgacaa cggcagcauc ccccaccaga uccaccuggg agagcugcac 1260 gccauucugc ggcggcagga agauuuuuac ccauuccuga aggacaaccg ggaaaagauc 1320 gagaagaucc ugaccuuccg cauccccuac uacgugggcc cucuggccag gggaaacagc 1380 agauucgccu ggaugaccag aaagagcgag gaaaccauca cccccuggaa cuucgaggaa 1440 gugguggaca agggcgccag cgcccagagc uucaucgagc ggaugaccaa cuucgauaag 1500 aaccugccca acgagaaggu gcugcccaag cacagccugc uguacgagua cuucaccgug 1560 uacaacgagc ugaccaaagu gaaauacgug accgagggaa ugagaaagcc cgccuuccug 1620 agcggcgagc agaaaaaagc caucguggac cugcuguuca agaccaaccg gaaagugacc 1680 gugaagcagc ugaaagagga cuacuucaag aaaaucgagu gcuucgacuc cguggaaauc 1740 uccggcgugg aagaucgguu caacgccucc cugggcacau accacgaucu gcugaaaauu 1800 aucaaggaca aggacuuccu ggacaaugag gaaaacgagg acauucugga agauaucgug 1860 cugacccuga cacuguuuga ggacagagag augaucgagg aacggcugaa aaccuaugcc 1920
Description Sequence SEQ
ID
O
caccuguucg acgacaaagu gaugaagcag cugaagcggc ggagauacac cggcuggggc 1980 aggcugagcc ggaagcugau caacggcauc cgggacaagc aguccggcaa gacaauccug 2040 gauuuccuga aguccgacgg cuucgccaac agaaacuuca ugcagcugau ccacgacgac 2100 agccugaccu uuaaagagga cauccagaaa gcccaggugu ccggccaggg cgauagccug 2160 cacgagcaca uugccaaucu ggccggcagc cccgccauua agaagggcau ccugcagaca 2220 gugaaggugg uggacgagcu cgugaaagug augggccggc acaagcccga gaacaucgug 2280 aucgaaaugg ccagagagaa ccagaccacc cagaagggac agaagaacag ccgcgagaga 2340 augaagcgga ucgaagaggg caucaaagag cugggcagcc agauccugaa agaacacccc 2400 guggaaaaca cccagcugca gaacgagaag cuguaccugu acuaccugca gaaugggcgg 2460 gauauguacg uggaccagga acuggacauc aaccggcugu ccgacuacga uguggaccau 2520 aucgugccuc agagcuuucu gaaggacgac uccaucgaua acaaagugcu gacucggagc 2580 gacaagaacc ggggcaagag cgacaacgug cccuccgaag aggucgugaa gaagaugaag 2640 aacuacuggc gccagcugcu gaaugccaag cugauuaccc agaggaaguu cgacaaucug 2700 accaaggccg agagaggcgg ccugagcgaa cuggauaagg ccggcuucau caagagacag 2760 cugguggaaa cccggcagau cacaaagcac guggcacaga uccuggacuc ccggaugaac 2820 acuaaguacg acgagaacga caaacugauc cgggaaguga aagugaucac ccugaagucc 2880 aagcuggugu ccgauuuccg gaaggauuuc caguuuuaca aagugcgcga gaucaacaac 2940 uaccaccacg cccacgacgc cuaccugaac gccgucgugg gaaccgcccu gaucaaaaag 3000 uacccuaagc uggaaagcga guucguguac ggcgacuaca agguguacga cgugcggaag 3060 augaucgcca agagcgagca ggaaaucggc aaggcuaccg ccaaguacuu cuucuacagc 3120 aacaucauga acuuuuucaa gaccgagauu acccuggcca acggcgagau ccggaagcgg 3180 ccucugaucg agacaaacgg cgaaacaggc gagaucgugu gggauaaggg ccgggacuuu 3240 gccaccgugc ggaaagugcu gucuaugccc caagugaaua ucgugaaaaa gaccgaggug 3300 cagacaggcg gcuucagcaa agagucuauc cugcccaaga ggaacagcga caagcugauc 3360 gccagaaaga aggacuggga cccuaagaag uacggcggcu ucgacagccc caccguggcc 3420 uauucugugc uggugguggc caaaguggaa aagggcaagu ccaagaaacu gaagagugug 3480 aaagagcugc uggggaucac caucauggaa agaagcagcu ucgagaagaa ucccaucgac 3540 uuucuggaag ccaagggcua caaagaagug aaaaaggacc ugaucaucaa gcugccuaag 3600 uacucccugu ucgagcugga aaacggccgg aagagaaugc uggccucugc cggcgaacug 3660 cagaagggaa acgaacuggc ccugcccucc aaauauguga acuuccugua ccuggccagc 3720 cacuaugaga agcugaaggg cucccccgag gauaaugagc agaaacagcu guuuguggaa 3780 cagcacaaac acuaccugga cgagaucauc gagcagauca gcgaguucuc caagagagug 3840 auccuggccg acgcuaaucu ggacaaggug cugagcgccu acaacaagca cagagacaag 3900 ccuaucagag agcaggccga gaauaucauc caccuguuua cccugaccaa ucugggagcc 3960 ccugccgccu ucaaguacuu ugacaccacc aucgaccgga agagguacac cagcaccaaa 4020 gaggugcugg acgccacccu gauccaccag agcaucaccg gccuguacga gacacggauc 4080
Description Sequence SEQ
ID
O
gaccugucuc agcugggagg cgacgccuau cccuaugacg ugcccgauua ugccagccug 4140 ggcagcggcu cccccaagaa aaaacgcaag guggaagauc cuaagaaaaa gcggaaagug 4200 gacggcauug guagugggag caacggcagc agcggauccg ugagcaaggg cgaggagcug 4260 uucaccgggg uggugcccau ccuggucgag cuggacggcg acguaaacgg ccacaaguuc 4320 agcgugcgcg gcgagggcga gggcgaugcc accaacggca agcugacccu gaaguucauc 4380 ugcaccaccg gcaagcugcc cgugcccugg cccacccucg ugaccacccu gaccuacggc 4440 gugcagugcu ucagccgcua ccccgaccac augaagcagc acgacuucuu caaguccgcc 4500 augcccgaag gcuacgucca ggagcgcacc aucuccuuca aggacgacgg caccuacaag 4560 acccgcgccg aggugaaguu cgagggcgac acccugguga accgcaucga gcugaagggc 4620 aucgacuuca aggaggacgg caacauccug gggcacaagc uggaguacaa cuucaacagc 4680 cacaacgucu auaucacggc cgacaagcag aagaacggca ucaaggcgaa cuucaagauc 4740 cgccacaacg ucgaggacgg cagcgugcag cucgccgacc acuaccagca gaacaccccc 4800 aucggcgacg gccccgugcu gcugcccgac aaccacuacc ugagcaccca guccaagcug 4860 agcaaagacc ccaacgagaa gcgcgaucac augguccugc uggaguucgu gaccgccgcc 4920 gggaucacuc ucggcaugga cgagcuguac aaguag 4956
CRISPR- ugaucgccaa gucggaacag gaaaucggaa aggcuacugc aaaguacuuc uucuacucaa 60 4 associated acaucaugaa cuucuucaaa acggagauca cgcucgcgaa cggcgaaauc cggaaaaggc 120
endonuclease cgcucauuga aaccaacgga gaaaccgggg agaucgugug ggacaaggga agggauuuug 180
CAS9/Csnl cgacugugag gaagguguug uccaugccgc aagucaauau ugugaaaaag acggaagugc 240
mRNA aaaccggagg auucagcaaa gaauccaucc ucccaaagcg caacucggac aaacucaucg 300
cgcgcaagaa ggauugggac cccaagaaau acgguggcuu ugacagcccu acuguggcuu 360 acuccguccu cgucguggcu aaaguggaaa aggguaaauc caaaaagcuc aaaucgguga 420 aggagcuccu gggaaucacg aucauggagc ggucgagcuu cgaaaagaau ccuauugauu 480 uccuggaggc gaagggcuac aaggaaguca agaaagaccu gaucaucaag cucccgaagu 540 acagccucuu cgagcucgaa aacggcagaa agaggaugcu ggcaucagcg ggagaauugc 600 agaagggaaa cgaacuggca cugccgucca aguacgugaa uuuucucuau cuggcuagcc 660 acuacgaaaa gcugaaggga ucgcccgagg acaacgagca aaaacaacug uucguggagc 720 agcacaagca cuaccuggau gagaucaucg agcagaucuc cgaauucucg aaacgcguga 780 uccuugccga ugccaaucug gauaaagugu ugucggcuua caacaagcau cgggauaaac 840 cgauccgcga acaggcagaa aacaucauuc aucuguucac uuugaccaau cugggagcgc 900 cugccgcguu uaaguacuuc gacaccacua uugauagaaa gcgcuacacc ucgaccaagg 960 aagugcugga cgcuacccug auccaccagu ccaucaccgg acucuacgaa acucgcauug 1020 accuguccca gcuuggagga gauucacggg ccgauccaaa gaaaaagcgc aaggucugau 1080 aauaggcugg agccucggug gccaugcuuc uugccccuug ggccuccccc cagccccucc 1140 uccccuuccu gcacccguac ccccgugguc uuugaauaaa gucugagugg gcggcucuag 1200
Description Sequence
1201
CRISPR- ucaagcuuuu ggacccucgu acagaagcua auacgacuca cuauagggaa auaagagaga 60 associated aaagaagagu aagaagaaau auaagagcca ccauggacaa gaaauacagc aucggccugg 120 endonuclease auauuggaac uaacagcguu ggaugggcag ugaucaccga cgaguacaag gugccgagca 180
CAS9/Csnl agaaguucaa ggugcugggg aacacugacc gccauucaau uaagaaaaac cucauuggag 240 mRNA cacugcuuuu ugacucgggu gagacugccg aagcuaccag gcucaaacgc accgcacgca 300 gacgguacac ccgccgcaag aaucgcaucu gcuaucugca agagaucuuu uccaacgaga 360 uggcgaaggu ugacgacagc uuuuuccacc ggcuggaaga gagcuuccuc guggaagagg 420 acaaaaagca cgaaaggcau ccaaucuucg guaacaucgu ggacgaagug gcguaucacg 480 aaaaguaccc uaccaucuac caucugcgga agaagcuggu cgauuccacg gauaaggcag 540 accugagacu gaucuaccug gcuuuggccc auaugaucaa auuccgcggc cauuuccuga 600 ucgaggggga ccuuaacccg gauaacucgg augucgacaa gcuguucauc cagcuggucc 660 aaacguauaa ccaacuguuu gaggaaaauc ccaucaacgc uucgggggug gacgccaaag 720 caauccucuc cgcgcgccug agcaagucac ggcggcucga aaaccugauc gcgcagcugc 780 cgggagaaaa gaaaaaugga cuguuuggga aucugaucgc gcugucgcuc ggccugacuc 840 caaacuuuaa gucaaauuuc gauuuggccg aagaugccaa gcugcagcug ucaaaggaca 900 cuuacgacga cgaccuggac aaucugcugg cccagauugg ggaccaauac gcagaccugu 960 ucuuggccgc gaagaaccug agcgacgcca uucuucuguc cgauauucug agagucaaua 1020 ccgaaaucac uaaggcuccg cuguccgcuu caaugaucaa gcgcuacgau gaacaccacc 1080 aggaucucac ucugcucaaa gcccucguga gacaacaauu gccugaaaag uacaaggaga 1140 ucuucuucga ccagagcaaa aacggcuacg caggcuacau cgauggagga gcgucacaag 1200 aagaguucua caaguucauc aagccaaucu uggagaagau ggacgguacu gaagaacucc 1260 uugugaagcu gaauagggag gauuugcuca gaaagcagcg gacuuuugac aacggcucga 1320 ucccucauca gauucaccuc ggugagcugc augccauccu ucggcgccaa gaggauuuuu 1380 accccuuccu gaaggauaau cgcgagaaaa ucgaaaagau ccugacguuc agaauucccu 1440 acuacguggg accgcuggcg cgcgguaacu cgcgguuugc auggaugacu cgcaagucag 1500 aggaaacuau cacuccuugg aauuuugagg aggucgucga uaagggagcc uccgcccagu 1560 cauucaucga acgcaugacc aacuucgaca agaaucuucc gaacgagaag guccuuccaa 1620 agcacucccu guuguacgaa uacuucaccg uguacaauga gcugaccaaa guuaaguaug 1680 ucaccgaggg caugagaaag ccggccuucc ucagcggcga acaaaagaag gccaucgucg 1740 accuccucuu caagaccaac cggaagguga ccgucaagca acucaaggag gacuacuuca 1800 agaagaucga augcuuugac ucggucgaaa ucagcggagu ggaggaccgg uuuaacgcgu 1860 cacuggguac cuaccaugau cuccugaaaa ucaucaaaga caaggacuuc cuggacaacg 1920 aagaaaacga ggacauccug gaagauauug uguugacccu gacgcuguuc gaggaccggg 1980 aaaugaucga ggaaaggcuu aagaccuacg cacaccucuu cgaugacaaa gugaugaagc 2040
Description Sequence SEQ
ID
O
aacugaagcg gcggagauau acuggcuggg ggaggcucuc ccggaagcuc auuaauggaa 2100 ucagagacaa acagucgggu aaaacuaucc ucgacuuccu caagucggau ggguucgcca 2160 accggaacuu caugcagcug auccacgaug auuccuugac cuucaaggaa gauauccaga 2220 aggcgcaagu gagcggacag ggagauucgu ugcacgaaca uaucgcuaau cucgccggau 2280 ccccagccau caagaaagga auccugcaga ccgugaaggu gguggaugaa cuggugaaag 2340 ugauggggcg ccacaaacca gagaacaucg ucauugagau ggcccgcgag aaucagacca 2400 cucagaaggg acaaaagaac uccagagagc ggaugaaacg caucgaggaa ggcaucaaag 2460 agcuugguag ccaaauccug aaggaacacc cggucgagaa cacccagcuc cagaacgaaa 2520 agcuuuaccu guacuaccuc caaaauggac gggacaugua cgucgaccag gaauuggaca 2580 ucaacagacu cagcgacuac gauguggacc auauugugcc acaguccuuu cuuaaggacg 2640 acagcaucga uaacaaagug cucacuagau cagacaaaaa ucgcgggaaa ucagacaaug 2700 ugccaucgga agagguuguc aagaagauga aaaacuacug gagacagcug cucaaugcca 2760 aacuuaucac ccagcggaag uucgacaacc uuaccaaggc cgagcgcgga ggauuguccg 2820 aacucgacaa ggccggcuuc aucaaaaggc agcuggugga aacccggcag aucacuaaac 2880 acguggccca gauccucgau ucgcgcauga acacuaaaua cgaugagaau gacaagcuga 2940 uuagggaagu caaggucauc acucugaagu cgaaacuggu gucggacuuu agaaaggauu 3000 uccaguucua caaaguccgc gagauuaaca acuaccacca cgcucaugac gccuaccuga 3060 augcaguugu gggcaccgcg cugaucaaga aguauccgaa gcuggaaucc gaguucgugu 3120 acggagauua caaaguguac gacgugcgca aga 3153
CRISPR- ucaagcuuuu ggacccucgu acagaagcua auacgacuca cuauagggaa auaagagaga 60 6 associated aaagaagagu aagaagaaau auaagagcca ccauggacua caaggaccac gacggagacu 120
endonuclease acaaagacca ugacaucgau uacaaggaug acgaugacaa aauggcaccg aagaagaaga 180
CAS9/Csnl gaaaggucgg aauucacggg gugccggccg cggacaagaa guacucaauc ggacuggaua 240
mRNA ucggcacgaa cagcgugggu ugggcaguga ucaccgacga auacaaggug ccgagcaaga 300
aguucaaagu gcugggaaau accgaucgcc auucgaucaa gaaaaaucug auuggcgcgc 360 uccuguucga cucgggagag acugccgagg ccacuagacu gaagaggacc gcuaggcgcc 420 gcuacacgag gcgcaaaaac cgcaucugcu aucuucaaga aaucuucuca aacgagaugg 480 ccaaggugga cgacuccuuu uuccaucggc uggaagaauc auuucuggug gaggaggaca 540 agaagcacga acgccauccc auuuucggca acauugucga cgaaguggcc uaucaugaga 600 aguauccgac uaucuaccac uugagaaaga agcuggugga cuccacugac aaggcagauc 660 ugcgguugau cuaccucgca cuggcccaua ugaucaaauu ccggggacac uuccucaucg 720 agggcgaccu uaaucccgac aauuccgaug uggauaagcu uuucauccag cugguccaga 780 ccuacaacca acuguuugaa gaaaauccaa ucaaugcgag cggugucgau gcaaaggcca 840 uccugagcgc ccgccucucg aaaagcagaa ggcucgaaaa ccugaucgca caguugccug 900 gagagaagaa gaacggccuc uucggcaauc ucaucgcauu gucccuggga cugacuccaa 960
Description Sequence SEQ
ID
O
acuucaaauc caacuucgac uuggccgagg acgccaaacu gcaacugagc aaagauaccu 1020 acgaugauga cuuggacaau cuucuggcuc agaucggcga ccaguacgcc gaccuguucc 1080 uugcggcuaa gaaccugucg gacgccaucc ugcuguccga cauccugcgc gucaauaccg 1140 aaauuacuaa agcaccacuc ucggcaucca ugaucaagag auacgaugaa caccaccagg 1200 aucucacccu ccugaaagca cuggugcggc agcagcuccc ugagaaauac aaggaaaucu 1260 ucuuugauca guccaagaac ggauacgccg gauacaucga cggcggcgcg agccaagagg 1320 aauucuacaa guucaucaag ccgauccugg aaaagaugga uggcacggaa gaacuccugg 1380 ucaaacugaa uagagaggau cugcuccgca aacaacggac cuucgauaac ggaucgaucc 1440 cgcaccagau ccaccucggc gaacugcaug ccauccugcg gcggcaggag gacuuuuacc 1500 cguuccucaa agacaacaga gaaaagaucg agaagaucuu gaccuuucgc aucccguacu 1560 acgugggccc gcucgcgaga gguaacuccc gcuuugcuug gaugacuaga aagucagagg 1620 aaacgaucac cccauggaac uucgaagagg ugguugacaa aggagcgagc gcccaaucgu 1680 ucaucgaacg gaugacuaac uucgauaaga aucugccgaa ugagaagguc cugccuaagc 1740 acucacuucu guaugaauac uuuacugugu auaacgaacu caccaaaguc aaauacguga 1800 cugagggaau gcgcaagccu gcguuuuugu ccggcgagca gaaaaaggcc aucguggacu 1860 ugcuguucaa aaccaaccgc aaggugacug uuaagcaacu caaagaggac uacuuuaaga 1920 agaucgaaug cuuugacucg gucgagauuu ccgggguuga agauagauuc aacgcgucgc 1980 ugggaaccua ccaugaucuc cucaagauua ucaaggacaa agacuuccug gauaacgagg 2040 agaaugagga cauccucgaa gauauugugc uuacccugac ccuuuucgaa gaucgcgaaa 2100 ugaucgaaga acgccugaaa accuacgcuc accuguucga cgauaaggug augaaacagu 2160 ugaaacgccg gcgguacacg gguugggggc ggcugucgcg caagcugauc aacggaauuc 2220 gggacaaaca gagcggaaag accauccucg auuuucugaa guccgauggu uuugccaacc 2280 gcaacuucau gcagcucauc caugacgauu cgcuuaccuu uaaggaggau auccagaagg 2340 cacaaguguc gggacaaggg gauucgcucc acgaacacau cgccaaucug gcggggucgc 2400 cggcaauuaa gaagggaauc cuccagacug uuaagguggu cgacgagcug gugaagguga 2460 uggggagaca uaagccugaa aacauuguga ucgagauggc gagagaaaau caaacuacuc 2520 agaagggaca gaagaauucc cgggagcgga ugaagcgcau cgaggaggga aucaaggaac 2580 ugggcuccca aauccugaaa gagcaucccg uggaaaauac ucagcugcag aacgagaagc 2640 uuuaccugua cuaucuucaa aauggcaggg acauguacgu cgaccaagaa cuggauauca 2700 aucggcucuc cgauuacgac gucgaucaca ucguccccca aucauuccug aaggaugaua 2760 gcaucgauaa caaggugcuc acuagaucag acaaaaaccg gggaaaguca gauaacgucc 2820 ccagcgaaga agucgugaag aagaugaaga auuacuggag gcaacuucug aacgccaaac 2880 ucaucacuca gcgcaaguuc gacaaccuga ccaaagcaga aaggggagga cucagcgagc 2940 uggacaaggc ugguuucauc aaacggcagc ugguggagac ucgccaaauc acgaagcaug 3000 uggcccagau ucucgacucg cgcaugaaua cuaaguacga cgaaaacgau aagcugaucc 3060 gggaggugaa ggugaucacc cucaagagca agcucguguc cgauuuccgg aaagacuucc 3120
Description Sequence SEQ
ID
O
aguucuacaa ggugcgggag auuaacaacu accaucacgc ucacgacgcu uaccucaaug 3180 cugugguggg gacggcguug auuaagaagu acccaaaacu ggaguccgaa uucgucuacg 3240 gagauuacaa ggucuacgac gugcgcaaga ugauugccaa gucggagcag gaaauuggga 3300 aagcgacugc uaaguacuuc uucuacucga auaucaugaa cuucuucaag accgaaauca 3360 cccuggcuaa cggcgagauc aggaaacggc cgcugaucga aacuaauggu gagacuggug 3420 aaaucgugug ggauaaggga cgggacuucg ccacgguccg caagguccuc agcaugccgc 3480 aagugaauau uguuaagaaa accgaagugc agaccggugg guucucgaag gaauccaucc 3540 ugccaaagcg caacucggau aagcuuauug cccgcaagaa ggauugggac ccgaaaaagu 3600 acgguggguu cgacuccccu accguggcgu acucgguguu ggugguggcc aaaguggaaa 3660 agggcaaauc aaagaagcuc aagagcguca aggagcugcu gggaaucacc aucauggaga 3720 gguccagcuu ugagaaaaac ccgaucgacu ucuuggaagc caagggauac aaagagguga 3780 agaaagaccu gaucaucaaa cuuccaaagu acucccuguu cgaacucgaa aacgggagga 3840 agcgcaugcu cgccucagcc ggggaacugc aaaagggcaa cgaacuggcc cucccgucaa 3900 aauacgucaa cuuccuguac uuggcgucac acuacgaaaa gcugaaagga uccccagagg 3960 acaacgaaca gaaacagcug uucgucgagc agcacaagca cuaccuggac gagaucaucg 4020 aacagaucuc ggaauucagc aagagaguga ucuuggcaga cgcuaaccuu gacaaagucc 4080 ucucggcaua caauaagcau cgcgacaagc cgaucagaga acaggcggag aacaucaucc 4140 accuguucac ucucaccaac cugggcgcgc cagcggcuuu uaaguacuuu gauaccacca 4200 uugaccgcaa gagauacacc ucaacuaaag aagugcugga cgcaacccug auccaucaaa 4260 gcaucaccgg acuuuaugaa acucggaucg aucucucaca gcucggagga gacaaaagac 4320 cggcugccac caagaaggcc ggacaggcaa agaagaagaa augauaauag gcuggagccu 4380 cgguggccau gcuucuugcc ccuugggccu ccccccagcc ccuccucccc uuccugcacc 4440 cguacccccg uggucuuuga auaaagucug agugggcggc ucuaga 4486 dCAS9 as MDKKYSIGLAIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGETAEATRLKRTARRRYTRRKNRICYLQEIF 61 described in SNEMAKVDDSFFHRLEESFLVEEDKKHERHPIFGNIVDEVAYHEKYPTIYHLRKKLVDSTDKADLRLIYLALAHMIKFRGHFLIEG Qi et al DLNPDNSDVDKLFIQLVQTYNQLFEENPINASGVDAKAILSARLSKSRRLENLIAQLPGEKKNGLFGNLIALSLGLTPNFKSNFDL
AEDAKLQLSKDTYDDDLDNLLAQIGDQYADLFLAAKNLSDAILLSDILRVNTEITKAPLSASMIKRYDEHHQDLTLLKALVRQQLP EKYKEIFFDQSKNGYAGYIDGGASQEEFYKFIKPILEKMDGTEELLVKLNREDLLRKQRTFDNGSIPHQIHLGELHAILRRQEDFY PFLKDNREKIEKILTFRIPYYVGPLARGNSRFAWMTRKSEETITPWNFEEWDKGASAQSFIERMTNFDKNLPNEKVLPKHSLLYE YFTVYNELTKVKYVTEGMRKPAFLSGEQKKAIVDLLFKTNRKVTVKQLKEDYFKKIECFDSVEISGVEDRFNASLGTYHDLLKIIK DKDFLDNEENEDILEDIVLTLTLFEDREMIEERLKTYAHLFDDKVMKQLKRRRYTGWGRLSRKLINGIRDKQSGKTILDFLKSDGF ANRNFMQLIHDDSLTFKEDIQKAQVSGQGDSLHEHIANLAGSPAIKKGILQTVKVVDELVKVMGRHKPENIVIEMARENQTTQKGQ KNSRERMKRIEEGIKELGSQILKEHPVENTQLQNEKLYLYYLQNGRDMYVDQELDINRLSDYDVDAIVPQSFLKDDSIDNKVLTRS DKNRGKSDNVPSEEVVKKMKNYWRQLLNAKLITQRKFDNLTKAERGGLSELDKAGFIKRQLVETRQITKHVAQILDSRMNTKYDEN DKLIREVKVITLKSKLVSDFRKDFQFYKVREINNYHHAHDAYLNAVVGTALIKKYPKLESEFVYGDYKVYDVRKMIAKSEQEIGKA
Figure imgf000193_0001
Figure imgf000194_0001
Figure imgf000195_0001
Figure imgf000196_0001
Figure imgf000197_0001
Figure imgf000198_0001
Figure imgf000199_0001
Figure imgf000200_0001
Figure imgf000201_0001
Table 6: 5'UTR
Figure imgf000202_0001
Figure imgf000203_0001
Figure imgf000204_0001
Figure imgf000205_0001
Figure imgf000206_0001
Figure imgf000207_0001
Table 8 : DNA constructs encoding synthetic polynucleotides (mRNA) coding for CRISPR related proteins
Description Sequence SEQ
ID
NO:
DNA sequence TCAAGCTTTTGGACCCTCGTACAGAAGCTAATACGACTCACTATAGGGAAATAAGAGAGAAAAGAAGAGTAAGAAGAAATATAAGA 41 coding for GCCACCATGGACAAGAAATACAGCATCGGCCTGGATATTGGAACTAACAGCGTTGGATGGGCAGTGATCACCGACGAGTACAAGGT mRNA GCCGAGCAAGAAGTTCAAGGTGCTGGGGAACACTGACCGCCATTCAATTAAGAAAAACCTCATTGGAGCACTGCTTTTTGACTCGG transcript of
GTGAGACTGCCGAAGCTACCAGGCTCAAACGCACCGCACGCAGACGGTACACCCGCCGCAAGAATCGCATCTGCTATCTGCAAGAG
Cas9 (Mali)
ATCTTTTCCAACGAGATGGCGAAGGTTGACGACAGCTTTTTCCACCGGCTGGAAGAGAGCTTCCTCGTGGAAGAGGACAAAAAGCA CGAAAGGCATCCAATCTTCGGTAACATCGTGGACGAAGTGGCGTATCACGAAAAGTACCCTACCATCTACCATCTGCGGAAGAAGC TGGTCGATTCCACGGATAAGGCAGACCTGAGACTGATCTACCTGGCTTTGGCCCATATGATCAAATTCCGCGGCCATTTCCTGATC GAGGGGGACCTTAACCCGGATAACTCGGATGTCGACAAGCTGTTCATCCAGCTGGTCCAAACGTATAACCAACTGTTTGAGGAAAA TCCCATCAACGCTTCGGGGGTGGACGCCAAAGCAATCCTCTCCGCGCGCCTGAGCAAGTCACGGCGGCTCGAAAACCTGATCGCGC AGCTGCCGGGAGAAAAGAAAAATGGACTGTTTGGGAATCTGATCGCGCTGTCGCTCGGCCTGACTCCAAACTTTAAGTCAAATTTC GATTTGGCCGAAGATGCCAAGCTGCAGCTGTCAAAGGACACTTACGACGACGACCTGGACAATCTGCTGGCCCAGATTGGGGACCA ATACGCAGACCTGTTCTTGGCCGCGAAGAACCTGAGCGACGCCATTCTTCTGTCCGATATTCTGAGAGTCAATACCGAAATCACTA
o AGGCTCCGCTGTCCGCTTCAATGATCAAGCGCTACGATGAACACCACCAGGATCTCACTCTGCTCAAAGCCCTCGTGAGACAACAA
TTGCCTGAAAAGTACAAGGAGATCTTCTTCGACCAGAGCAAAAACGGCTACGCAGGCTACATCGATGGAGGAGCGTCACAAGAAGA GTTCTACAAGTTCATCAAGCCAATCTTGGAGAAGATGGACGGTACTGAAGAACTCCTTGTGAAGCTGAATAGGGAGGATTTGCTCA GAAAGCAGCGGACTTTTGACAACGGCTCGATCCCTCATCAGATTCACCTCGGTGAGCTGCATGCCATCCTTCGGCGCCAAGAGGAT TTTTACCCCTTCCTGAAGGATAATCGCGAGAAAATCGAAAAGATCCTGACGTTCAGAATTCCCTACTACGTGGGACCGCTGGCGCG CGGTAACTCGCGGTTTGCATGGATGACTCGCAAGTCAGAGGAAACTATCACTCCTTGGAATTTTGAGGAGGTCGTCGATAAGGGAG CCTCCGCCCAGTCATTCATCGAACGCATGACCAACTTCGACAAGAATCTTCCGAACGAGAAGGTCCTTCCAAAGCACTCCCTGTTG TACGAATACTTCACCGTGTACAATGAGCTGACCAAAGTTAAGTATGTCACCGAGGGCATGAGAAAGCCGGCCTTCCTCAGCGGCGA ACAAAAGAAGGCCATCGTCGACCTCCTCTTCAAGACCAACCGGAAGGTGACCGTCAAGCAACTCAAGGAGGACTACTTCAAGAAGA TCGAATGCTTTGACTCGGTCGAAATCAGCGGAGTGGAGGACCGGTTTAACGCGTCACTGGGTACCTACCATGATCTCCTGAAAATC ATCAAAGACAAGGACTTCCTGGACAACGAAGAAAACGAGGACATCCTGGAAGATATTGTGTTGACCCTGACGCTGTTCGAGGACCG GGAAATGATCGAGGAAAGGCTTAAGACCTACGCACACCTCTTCGATGACAAAGTGATGAAGCAACTGAAGCGGCGGAGATATACTG GCTGGGGGAGGCTCTCCCGGAAGCTCATTAATGGAATCAGAGACAAACAGTCGGGTAAAACTATCCTCGACTTCCTCAAGTCGGAT GGGTTCGCCAACCGGAACTTCATGCAGCTGATCCACGATGATTCCTTGACCTTCAAGGAAGATATCCAGAAGGCGCAAGTGAGCGG ACAGGGAGATTCGTTGCACGAACATATCGCTAATCTCGCCGGATCCCCAGCCATCAAGAAAGGAATCCTGCAGACCGTGAAGGTGG TGGATGAACTGGTGAAAGTGATGGGGCGCCACAAACCAGAGAACATCGTCATTGAGATGGCCCGCGAGAATCAGACCACTCAGAAG GGACAAAAGAACTCCAGAGAGCGGATGAAACGCATCGAGGAAGGCATCAAAGAGCTTGGTAGCCAAATCCTGAAGGAACACCCGGT
Figure imgf000209_0001
Figure imgf000210_0001
Figure imgf000211_0001
Figure imgf000212_0001
Figure imgf000213_0001
Figure imgf000214_0001
Figure imgf000215_0001
Figure imgf000216_0001
Figure imgf000217_0001
Table 9 : sgRNA constructs
Figure imgf000218_0001
Table 10: Synthetic polynucleotides encoding a CRISPR related protein and synthetic sgRNA
Figure imgf000219_0001
Figure imgf000220_0001
Figure imgf000221_0001
GCUACACGCGCCGCAAGAACCGGAUCUGCUACCUCCAAGAAAUCUUCUCGAACGAAAUGGCUAAGGUGGACGACUCGUUCUUUCAC CGGCUCGAGGAGUCAUUCCUUGUGGAGGAAGAUAAGAAGCACGAAAGACACCCGAUCUUCGGCAACAUCGUGGACGAAGUCGCGUA CCACGAAAAGUACCCGACUAUCUACCAUCUCCGGAAGAAGCUCGUGGAUAGCACCGAUAAGGCCGAUCUGCGACUGAUCUACCUCG CGCUGGCCCAUAUGAUUAAGUUCCGCGGGCACUUCCUCAUCGAAGGGGACCUGAAUCCAGACAACUCGGACGUGGAUAAGCUGUUU AUCCAGCUGGUGCAGACUUACAAUCAAUUGUUUGAAGAAAACCCUAUCAACGCGUCUGGGGUGGACGCAAAGGCCAUCCUGAGCGC GCGGCUGUCAAAAUCCAGACGGCUGGAAAAUCUGAUAGCCCAACUGCCGGGCGAGAAGAAAAACGGCCUGUUUGGAAAUCUUAUCG CCCUGUCCCUGGGACUGACCCCCAACUUCAAGUCGAACUUCGACUUGGCCGAGGAUGCGAAGCUCCAGCUCAGCAAAGACACCUAC GACGAUGACCUCGAUAACCUGUUGGCCCAGAUCGGUGACCAGUAUGCUGAUCUCUUCUUGGCGGCCAAGAACCUGUCAGACGCAAU UCUGCUCUCCGACAUCCUGCGGGUGAAUACUGAGAUCACUAAAGCCCCAUUGAGCGCGUCGAUGAUCAAAAGAUACGACGAGCACC ACCAGGAUCUGACUCUCCUCAAGGCACUGGUCCGCCAACAGCUCCCGGAAAAGUACAAAGAGAUCUUCUUUGACCAAUCCAAAAAC GGAUACGCUGGUUACAUAGACGGCGGAGCGUCACAAGAAGAGUUCUACAAGUUCAUCAAGCCUAUCCUGGAAAAGAUGGACGGGAC CGAGGAACUCCUGGUUAAGCUCAAUAGGGAGGAUCUGCUGCGCAAGCAACGCACGUUCGACAAUGGAAGCAUCCCCCAUCAGAUCC ACCUGGGGGAGCUCCACGCGAUCCUGAGGCGCCAGGAAGAUUUCUACCCAUUUCUGAAGGACAAUAGAGAGAAAAUCGAAAAGAUC CUGACUUUCCGAAUCCCGUACUACGUGGGCCCGCUCGCACGGGGAAACUCACGGUUUGCCUGGAUGACUCGCAAAUCCGAAGAAAC CAUUACCCCCUGGAAUUUCGAGGAGGUGGUCGAUAAAGGCGCCUCAGCCCAGUCGUUCAUCGAAAGAAUGACCAACUUUGACAAGA ACCUCCCAAAUGAGAAGGUGCUGCCAAAACAUAGCCUGCUGUACGAGUACUUUACUGUGUAUAACGAACUCACCAAGGUGAAAUAC GUGACCGAGGGAAUGCGCAAGCCGGCAUUUCUGUCGGGCGAACAGAAGAAGGCAAUUGUGGACUUGCUGUUCAAAACCAACCGGAA GGUGACCGUGAAACAGCUCAAGGAAGAUUACUUUAAGAAGAUCGAGUGUUUCGAUAGCGUCGAAAUUUCGGGGGUGGAAGAUCGCU UCAAUGCAAGCCUUGGGACGUACCACGAUCUGCUUAAGAUCAUUAAGGACAAGGAUUUCCUUGACAACGAAGAGAACGAGGAUAUU CUCGAGGAUAUCGUCCUGACCCUGACUCUGUUUGAGGAUAGAGAAAUGAUCGAGGAGAGAUUGAAAACUUACGCACACCUCUUCGA CGAUAAGGUGAUGAAACAGCUGAAAAGGCGUAGAUACACUGGUUGGGGAAGGCUGUCGAGAAAGCUGAUCAACGGAAUUAGGGACA AGCAGUCCGGAAAAACCAUCCUGGAUUUCCUCAAGUCCGACGGUUUCGCCAACCGCAACUUCAUGCAGCUGAUCCACGAUGAUUCC CUGACGUUCAAAGAGGAUAUCCAGAAGGCACAAGUGUCCGGACAAGGAGACUCACUCCACGAGCAUAUCGCUAAUCUCGCCGGAUC GCCAGCUAUCAAGAAGGGAAUCUUGCAGACUGUCAAGGUGGUGGACGAACUGGUGAAAGUGAUGGGAAGGCAUAAGCCGGAGAAUA UCGUGAUCGAGAUGGCGAGGGAAAACCAGACGACCCAGAAAGGACAGAAAAACAGCCGGGAACGCAUGAAGCGCAUCGAAGAGGGA AUCAAAGAGCUUGGGAGCCAAAUCCUCAAAGAACACCCUGUGGAAAAUACCCAACUGCAGAAUGAGAAGCUUUACCUGUAUUACCU CCAAAACGGGCGCGACAUGUACGUUGACCAGGAAUUGGACAUUAACCGGCUUUCCGACUACGAUGUGGACGCUAUCGUCCCGCAGU CCUUCCUGAAAGACGAUUCGAUCGACAAUAAGGUCCUGACUAGAUCAGACAAGAAUCGGGGAAAGUCAGACAACGUGCCUAGCGAA GAGGUCGUUAAGAAGAUGAAGAAUUACUGGCGCCAGCUGCUGAACGCGAAGCUUAUCACUCAGCGCAAGUUCGACAACCUCACCAA GGCAGAAAGAGGCGGAUUGUCGGAGCUCGACAAAGCUGGCUUCAUCAAGCGCCAGCUCGUCGAAACUCGCCAGAUUACUAAGCAUG UGGCGCAGAUCCUGGACAGCCGCAUGAAUACUAAGUAUGAUGAGAAUGACAAGCUCAUCCGGGAGGUGAAGGUCAUCACCCUGAAG UCCAAGCUGGUGUCCGACUUCCGGAAGGACUUCCAAUUCUACAAAGUCAGAGAAAUCAACAAUUACCAUCACGCGCAUGACGCCUA CUUGAAUGCAGUGGUGGGUACUGCCCUCAUCAAGAAAUACCCAAAGCUUGAAAGCGAGUUUGUCUACGGAGACUACAAGGUGUACG ACGUCCGGAAGAUGAUCGCCAAAUCGGAACAGGAAAUUGGGAAGGCGACCGCUAAGUACUUCUUCUACUCGAAUAUCAUGAAUUUC UUCAAGACCGAGAUCACGCUUGCAAAUGGCGAAAUCCGGAAGCGGCCCCUCAUCGAAACCAACGGAGAAACCGGAGAAAUCGUGUG GGACAAGGGUCGCGAUUUUGCGACCGUCCGAAAGGUUCUUAGCAUGCCUCAAGUGAACAUCGUCAAGAAAACGGAAGUGCAGACUG GAGGCUUCAGCAAGGAGUCCAUUCUCCCGAAACGCAACUCCGACAAACUGAUCGCACGCAAGAAAGACUGGGACCCGAAGAAAUAC GGAGGCUUCGAUUCGCCGACUGUGGCUUACUCGGUCCUGGUUGUGGCCAAGGUGGAAAAGGGAAAGUCCAAGAAGCUGAAGUCCGU CAAGGAGCUCCUCGGAAUCACCAUCAUGGAACGGUCAAGCUUCGAGAAAAACCCAAUUGACUUCCUGGAGGCAAAGGGGUACAAGG
Figure imgf000223_0001
Figure imgf000224_0001
UCUUCUGUCCGAUAUUCUGAGAGUCAAUACCGAAAUCACUAAGGCUCCGCUGUCCGCUUCAAUGAUCAAGCGCUACGAUGAACACC ACCAGGAUCUCACUCUGCUCAAAGCCCUCGUGAGACAACAAUUGCCUGAAAAGUACAAGGAGAUCUUCUUCGACCAGAGCAAAAAC GGCUACGCAGGCUACAUCGAUGGAGGAGCGUCACAAGAAGAGUUCUACAAGUUCAUCAAGCCAAUCUUGGAGAAGAUGGACGGUAC UGAAGAACUCCUUGUGAAGCUGAAUAGGGAGGAUUUGCUCAGAAAGCAGCGGACUUUUGACAACGGCUCGAUCCCUCAUCAGAUUC ACCUCGGUGAGCUGCAUGCCAUCCUUCGGCGCCAAGAGGAUUUUUACCCCUUCCUGAAGGAUAAUCGCGAGAAAAUCGAAAAGAUC CUGACGUUCAGAAUUCCCUACUACGUGGGACCGCUGGCGCGCGGUAACUCGCGGUUUGCAUGGAUGACUCGCAAGUCAGAGGAAAC UAUCACUCCUUGGAAUUUUGAGGAGGUCGUCGAUAAGGGAGCCUCCGCCCAGUCAUUCAUCGAACGCAUGACCAACUUCGACAAGA AUCUUCCGAACGAGAAGGUCCUUCCAAAGCACUCCCUGUUGUACGAAUACUUCACCGUGUACAAUGAGCUGACCAAAGUUAAGUAU GUCACCGAGGGCAUGAGAAAGCCGGCCUUCCUCAGCGGCGAACAAAAGAAGGCCAUCGUCGACCUCCUCUUCAAGACCAACCGGAA GGUGACCGUCAAGCAACUCAAGGAGGACUACUUCAAGAAGAUCGAAUGCUUUGACUCGGUCGAAAUCAGCGGAGUGGAGGACCGGU UUAACGCGUCACUGGGUACCUACCAUGAUCUCCUGAAAAUCAUCAAAGACAAGGACUUCCUGGACAACGAAGAAAACGAGGACAUC CUGGAAGAUAUUGUGUUGACCCUGACGCUGUUCGAGGACCGGGAAAUGAUCGAGGAAAGGCUUAAGACCUACGCACACCUCUUCGA UGACAAAGUGAUGAAGCAACUGAAGCGGCGGAGAUAUACUGGCUGGGGGAGGCUCUCCCGGAAGCUCAUUAAUGGAAUCAGAGACA AACAGUCGGGUAAAACUAUCCUCGACUUCCUCAAGUCGGAUGGGUUCGCCAACCGGAACUUCAUGCAGCUGAUCCACGAUGAUUCC UUGACCUUCAAGGAAGAUAUCCAGAAGGCGCAAGUGAGCGGACAGGGAGAUUCGUUGCACGAACAUAUCGCUAAUCUCGCCGGAUC CCCAGCCAUCAAGAAAGGAAUCCUGCAGACCGUGAAGGUGGUGGAUGAACUGGUGAAAGUGAUGGGGCGCCACAAACCAGAGAACA UCGUCAUUGAGAUGGCCCGCGAGAAUCAGACCACUCAGAAGGGACAAAAGAACUCCAGAGAGCGGAUGAAACGCAUCGAGGAAGGC AUCAAAGAGCUUGGUAGCCAAAUCCUGAAGGAACACCCGGUCGAGAACACCCAGCUCCAGAACGAAAAGCUUUACCUGUACUACCU CCAAAAUGGACGGGACAUGUACGUCGACCAGGAAUUGGACAUCAACAGACUCAGCGACUACGAUGUGGACCAUAUUGUGCCACAGU CCUUUCUUAAGGACGACAGCAUCGAUAACAAAGUGCUCACUAGAUCAGACAAAAAUCGCGGGAAAUCAGACAAUGUGCCAUCGGAA GAGGUUGUCAAGAAGAUGAAAAACUACUGGAGACAGCUGCUCAAUGCCAAACUUAUCACCCAGCGGAAGUUCGACAACCUUACCAA GGCCGAGCGCGGAGGAUUGUCCGAACUCGACAAGGCCGGCUUCAUCAAAAGGCAGCUGGUGGAAACCCGGCAGAUCACUAAACACG UGGCCCAGAUCCUCGAUUCGCGCAUGAACACUAAAUACGAUGAGAAUGACAAGCUGAUUAGGGAAGUCAAGGUCAUCACUCUGAAG UCGAAACUGGUGUCGGACUUUAGAAAGGAUUUCCAGUUCUACAAAGUCCGCGAGAUUAACAACUACCACCACGCUCAUGACGCCUA CCUGAAUGCAGUUGUGGGCACCGCGCUGAUCAAGAAGUAUCCGAAGCUGGAAUCCGAGUUCGUGUACGGAGAUUACAAAGUGUACG ACGUGCGCAAGAUGAUCGCCAAGUCGGAACAGGAAAUCGGAAAGGCUACUGCAAAGUACUUCUUCUACUCAAACAUCAUGAACUUC UUCAAAACGGAGAUCACGCUCGCGAACGGCGAAAUCCGGAAAAGGCCGCUCAUUGAAACCAACGGAGAAACCGGGGAGAUCGUGUG GGACAAGGGAAGGGAUUUUGCGACUGUGAGGAAGGUGUUGUCCAUGCCGCAAGUCAAUAUUGUGAAAAAGACGGAAGUGCAAACCG GAGGAUUCAGCAAAGAAUCCAUCCUCCCAAAGCGCAACUCGGACAAACUCAUCGCGCGCAAGAAGGAUUGGGACCCCAAGAAAUAC GGUGGCUUUGACAGCCCUACUGUGGCUUACUCCGUCCUCGUCGUGGCUAAAGUGGAAAAGGGUAAAUCCAAAAAGCUCAAAUCGGU GAAGGAGCUCCUGGGAAUCACGAUCAUGGAGCGGUCGAGCUUCGAAAAGAAUCCUAUUGAUUUCCUGGAGGCGAAGGGCUACAAGG AAGUCAAGAAAGACCUGAUCAUCAAGCUCCCGAAGUACAGCCUCUUCGAGCUCGAAAACGGCAGAAAGAGGAUGCUGGCAUCAGCG GGAGAAUUGCAGAAGGGAAACGAACUGGCACUGCCGUCCAAGUACGUGAAUUUUCUCUAUCUGGCUAGCCACUACGAAAAGCUGAA GGGAUCGCCCGAGGACAACGAGCAAAAACAACUGUUCGUGGAGCAGCACAAGCACUACCUGGAUGAGAUCAUCGAGCAGAUCUCCG AAUUCUCGAAACGCGUGAUCCUUGCCGAUGCCAAUCUGGAUAAAGUGUUGUCGGCUUACAACAAGCAUCGGGAUAAACCGAUCCGC GAACAGGCAGAAAACAUCAUUCAUCUGUUCACUUUGACCAAUCUGGGAGCGCCUGCCGCGUUUAAGUACUUCGACACCACUAUUGA UAGAAAGCGCUACACCUCGACCAAGGAAGUGCUGGACGCUACCCUGAUCCACCAGUCCAUCACCGGACUCUACGAAACUCGCAUUG ACCUGUCCCAGCUUGGAGGAGAUUCACGGGCCGAUCCAAAGAAAAAGCGCAAGGUCUGAUAAUAGGCUGGAGCCUCGGUGGCCAUG CUUCUUGCCCCUUGGGCCUCCCCCCAGCCCCUCCUCCCCUUCCUGCACCCGUACCCCCGUGGUCUUUGAAUAAAGUCUGAGUGGGC
Figure imgf000226_0001
GUACUUCUUCUACUCGAAUAUCAUGAACUUCUUCAAGACCGAAAUCACCCUGGCUAACGGCGAGAUCAGGAAACGGCCGCUGAUCG AAACUAAUGGUGAGACUGGUGAAAUCGUGUGGGAUAAGGGACGGGACUUCGCCACGGUCCGCAAGGUCCUCAGCAUGCCGCAAGUG AAUAUUGUUAAGAAAACCGAAGUGCAGACCGGUGGGUUCUCGAAGGAAUCCAUCCUGCCAAAGCGCAACUCGGAUAAGCUUAUUGC CCGCAAGAAGGAUUGGGACCCGAAAAAGUACGGUGGGUUCGACUCCCCUACCGUGGCGUACUCGGUGUUGGUGGUGGCCAAAGUGG AAAAGGGCAAAUCAAAGAAGCUCAAGAGCGUCAAGGAGCUGCUGGGAAUCACCAUCAUGGAGAGGUCCAGCUUUGAGAAAAACCCG AUCGACUUCUUGGAAGCCAAGGGAUACAAAGAGGUGAAGAAAGACCUGAUCAUCAAACUUCCAAAGUACUCCCUGUUCGAACUCGA AAACGGGAGGAAGCGCAUGCUCGCCUCAGCCGGGGAACUGCAAAAGGGCAACGAACUGGCCCUCCCGUCAAAAUACGUCAACUUCC UGUACUUGGCGUCACACUACGAAAAGCUGAAAGGAUCCCCAGAGGACAACGAACAGAAACAGCUGUUCGUCGAGCAGCACAAGCAC UACCUGGACGAGAUCAUCGAACAGAUCUCGGAAUUCAGCAAGAGAGUGAUCUUGGCAGACGCUAACCUUGACAAAGUCCUCUCGGC AUACAAUAAGCAUCGCGACAAGCCGAUCAGAGAACAGGCGGAGAACAUCAUCCACCUGUUCACUCUCACCAACCUGGGCGCGCCAG CGGCUUUUAAGUACUUUGAUACCACCAUUGACCGCAAGAGAUACACCUCAACUAAAGAAGUGCUGGACGCAACCCUGAUCCAUCAA AGCAUCACCGGACUUUAUGAAACUCGGAUCGAUCUCUCACAGCUCGGAGGAGACAAAAGACCGGCUGCCACCAAGAAGGCCGGACA GGCAAAGAAGAAGAAAUGAUAAUAGGCUGGAGCCUCGGUGGCCAUGCUUCUUGCCCCUUGGGCCUCCCCCCAGCCCCUCCUCCCCU UCCUGCACCCGUACCCCCGUGGUCUUUGAAUAAAGUCUGAGUGGGCGGC
Table 11: Synthetic sgRNA
Figure imgf000228_0001
Table 12: Additional Sequences as deposited in Addgene database (plasmid repository, Cambridge,
MA)
Figure imgf000229_0001
Figure imgf000230_0001
Figure imgf000231_0001
Figure imgf000232_0001
Figure imgf000233_0001
Figure imgf000234_0001
Figure imgf000235_0001
Figure imgf000236_0001
Figure imgf000237_0001
Figure imgf000238_0001
Figure imgf000239_0001
Figure imgf000240_0001
Figure imgf000241_0001
Figure imgf000242_0001

Claims

1. A synthetic polynucleotide comprising:
(a) a first region of linked nucleosides, said first region encoding a CRISPR related protein selected from the group consisting of the CRISPR related proteins found in Table 6;
(b) a first flanking region located at the 5' terminus of said first region comprising a sequence of linked nucleosides selected from the group consisting of the 5' untranslated region (UTR) found in Table 7;
(c) a second flanking region located at the 3 ' terminus of said first region comprising a sequence of linked nucleosides selected from the group consisting of the 3' untranslated region (UTR) found in Table 8.
2. The synthetic polynucleotide of claim I, wherein the synthetic polynucleotide is a modified RNA polynucleotide.
3. The synthetic polynucleotide of claim I, consisting of a sequence selected from SEQ
ID OS:51-56.
4. The synthetic polynucleotide of claim I, the first region comprising a sequence encoding human codon optimized dCAS9.
5. The synthetic polynucleotide of claim I, the first region encoding SEQ ID NO:61.
6. The synthetic polynucleotide of claim 1 , the first region further encoding an effector domain.
7. The synthetic polynucleotide of claim 1 , the first region further encoding an effector domain selected from the group consisting of KRAB, VP64, p65AD and Mxi.
8. The synthetic polynucleotide of claim I, the first region further encoding KRAB or VP64 as disclosed in Table 6.
9. The synthetic polynucleotide of claim I, the first region further encoding an effector domain and comprising a nucleotide sequence selected from the group consisting of the effector domains disclosed in Table 6.
10. The synthetic polynucleotide of claim 1, the first flanking region comprising SEQ ID NO:71.
1 1. The synthetic polynucleotide of claim 1, the second flanking region comprising SEQ ID NO:81.
12. The synthetic polynucleotide of claim 1, wherein the second flanking region comprises at least one miR binding site or one miR binding site seed.
13. The synthetic polynucleotide of claim 1, wherein the second flanking region comprises an miR-122 or miR- 142 or miR- 146 binding site.
14. The synthetic polynucleotide of claim 1, wherein the second flanking region comprises miR-122 binding site consisting of the mIR-122 binding site in SEQ ID NO:82.
15. The synthetic polynucleotide of claim 1, the second flanking region comprising SEQ ID NO:82.
16. The synthetic polynucleotide of claim 1, the second flanking region comprising a 3' tailing sequence of linked nucleosides.
17. The synthetic polynucleotide of claim 1, the second flanking region comprising a poly-A tail.
18. The synthetic polynucleotide of claim 1, the second flanking region comprising a poly-A tail 80 to 140 nucleotides in length.
19. The synthetic polynucleotide of claim 1, the second flanking region comprising a 100 nucleotide poly-A tail.
20. A second synthetic polynucleotide encoding the synthetic polynucleotide of claim 1.
21. The second synthetic polynucleotide of claim 20, wherein the second synthetic polynucleotide is a DNA polynucleotide.
22. The second synthetic polynucleotide of claim 20, further comprising a vector.
23. The synthetic polynucleotide of claim 1, wherein the polynucleotide further comprises at least one 5' cap structure.
24. The synthetic polynucleotide of claim 1, the first region of linked nucleosides comprising at least a first modified nucleoside.
25. The synthetic polynucleotide of claim 1, the first region of linked nucleosides comprising at least a one 1 -methyl-pseudouridine.
26. The synthetic polynucleotide of claim 1, wherein the synthetic polynucleotide comprises at least two modifications.
27. The synthetic polynucleotide of claim 1, wherein the synthetic polynucleotide comprises at least one 1 -methyl-pseudouridine and at least one 5 '-methyl cytidine.
28. The synthetic polynucleotide of claim 26, wherein a. the at least two modifications are located on one or more of a nucleoside and/or a backbone linkage between nucleosides; or b. the at least two modifications are located on both a nucleoside and a backbone linkage; or c. at least one modification is located on a backbone linkage; or d. one or more backbone linkages are modified by replacement of one or more oxygen atoms; or e. at least one modification comprises replacing at least one backbone linkage with a phosphorothioate linkage; or f. at least one modification is located on one or more nucleosides; or g. one or more modifications are on a sugar of one or more nucleosides; or h. at least one modification is located on one or more nucleobases selected from the group consisting of cytosine, guanine, adenine, thymine and uracil.
29. The synthetic polynucleotide of claim 1, produced using an in vitro transcription method or using a chemical synthesis method.
30. The synthetic polynucleotide of claim 1, wherein the synthetic polynucleotide is substantially purified.
31. A composition comprising the synthetic polynucleotide of any of the above claims.
32. The composition of claim 31, further comprising a pharmaceutically acceptable excipient.
33. The composition of claim 31, further comprising a pharmaceutically acceptable excipient selected from the group consisting of a solvent, aqueous solvent, non-aqueous solvent, dispersion media, diluent, dispersion, suspension aid, surface active agent, isotonic agent, thickening or emulsifying agent, preservative, lipid, lipidoids liposome, lipid nanoparticle, core-shell nanoparticles, polymer, lipoplex, peptide, protein, cell,
hyaluronidase, and mixtures thereof.
34. The composition of claim 31, further comprising a lipid selected from DLin-DMA, DLin-K-DMA, DLin-KC2-DMA, 98N12-5, C12-200, DLin-MC3 -DMA, reLNP, PLGA, PEG, PEG-DMA and PEGylated lipids and mixtures thereof.
35. The composition of claim 31, further comprising a lipid nanoparticle.
36. A method to produce a CRISPR related protein comprising contacting a cell or tissue with the synthetic polynucleotide of claim 1 or the composition of claim 31.
37. A method to produce a CRISPR related protein comprising administering to an organism the synthetic polynucleotide of claim 1 or the composition of claim 31.
38. The method of claim 37, wherein the synthetic polynucleotide is administered at a total daily dose of between 1 pg and 1 mg.
39. The method of claim 37, wherein the synthetic polynucleotide is administered in a single dose.
40. The method of claim 37, wherein the synthetic polynucleotide is administered in more than a single dose.
41. The method of claim 37, wherein administering is selected from the group consisting of prenatal administration, neonatal administration and postnatal administration.
42. The method of claim 37, wherein administering is selected from the group consisting of oral, by injection, by ophthalmic administration and by intranasal administration.
43. The method of claim 37, wherein administering is by injection and said injection is selected from the group consisting of intravenous, intraarterial, intraperotoneal, intradermal, subcutaneous and intramuscular.
44. A synthetic sgRNA for targeting a gene of interest, the sgRNA comprising:
(a) a first region of 20-25 linked nucleosides complementary to either strand of a 5' UTR of the gene of interest;
(b) a second flanking region located at the 3 ' terminus of said first region comprising a guide RNA scaffold sequence as found in SEQ ID NO: 90.
45. The sgRNA of claim 44, consisting of a sequence selected from SEQ ID NO: 91, 92, 93 or 94.
46. The sgRNA of claim 44, the target gene comprising VEGF.
47. The sgRNA of claim 44, the first region comprising a target sequence as disclosed in SEQ ID NO:91, 92, 93 or 94.
48. The sgRNA of claim 44 comprising SEQ ID NO: 90.
49. A second synthetic polynucleotide encoding the sgRNA of claim 44.
50. The second synthetic polynucleotide of claim 49, wherein the second synthetic polynucleotide is a DNA polynucleotide.
51. The second synthetic polynucleotide of claim 49, further comprising a vector.
52. The second synthetic polynucleotide of claim 49, further comprising a 5' UTR.
53. The sgRNA of claim 44, wherein the polynucleotide further comprises at least one 5' cap structure.
54. The sgRNA of claim 44, the first region of linked nucleosides comprising at least a first modified nucleoside.
55. The sgRNA of claim 44, wherein the sgRNA comprises at least two modifications.
56. The sgRNA of claim 55, wherein a. the at least two modifications are located on one or more of a nucleoside and/or a backbone linkage between nucleosides; or b. the at least two modifications are located on both a nucleoside and a backbone linkage; or c. at least one modification is located on a backbone linkage; or d. one or more backbone linkages are modified by replacement of one or more oxygen atoms; or e. at least one modification comprises replacing at least one backbone linkage with a phosphorothioate linkage; or f. at least one modification is located on one or more nucleosides; or one or more modifications are on a sugar of one or more nucleosides; or h. at least one modification is located on one or more nucleobases selected from the group consisting of cytosine, guanine, adenine, thymine and uracil.
57. The sgRNA of claim 44, comprising at least one non-translating modification that increases stabilization in serum.
58. The sgRNA of claim 44, produced using an in vitro transcription method or using a chemical synthesis method
59. The sgRNA of claim 44, wherein the sgRNA is substantially purified.
60. A composition comprising the sgRNA of any of the above claims.
61. The composition of claim 60, further comprising a pharmaceutically acceptable excipient.
62. The composition of claim 60, further comprising a pharmaceutically acceptable excipient selected from the group consisting of a solvent, aqueous solvent, non-aqueous solvent, dispersion media, diluent, dispersion, suspension aid, surface active agent, isotonic agent, thickening or emulsifying agent, preservative, lipid, lipidoids liposome, lipid nanoparticle, core-shell nanoparticles, polymer, lipoplex, peptide, protein, cell,
hyaluronidase, and mixtures thereof.
63. The composition of claim 60, further comprising a lipid selected from DLin-DMA, DLin-K-DMA, DLin-KC2-DMA, 98N12-5, C12-200, DLin-MC3 -DMA, reLNP, PLGA, PEG, PEG-DMA and PEGylated lipids and mixtures thereof.
64. The composition of claim 60, further comprising a lipid nanoparticle (LNP).
65. The composition of claim 60, not comprising a LNP.
66. A method for modulating transcription of a gene of interest in a cell comprising contacting the cell with the synthetic polynucleotide encoding a CRISPR related polypeptide of claim 1 and the synthetic sgRNA of claim 44 under conditions sufficient to modulate transcription of the gene of interest, the synthetic polynucleotide first region further comprising a polynucleotide sequence encoding an effector domain and the sgRNA first region sequence complementary to the gene of interest.
67. The method of claim 66, wherein the synthetic polynucleotide and the synthetic sgRNA are not a single polynucleotide.
68. The method of claim 66, wherein the synthetic polynucleotide is any of the synthetic polynucleotides described in the above claims..
69. The method of claim 66, wherein the sgRNA is any of the sgRNA of the above claims.
70. The method of claim 66, the gene of interest selected from the group consisting of VEGF, TPO, and LDHC.
71. The method of claim 66, the synthetic polynucleotide of claim 1 comprising an miR sequence specific for the cell.
72. The method of claim 66, wherein the gene of interest is VEGF and the cell is a U- 97MG cell, an HEK293 cell, a primary human hepatocyte, or a HepG2 cell, the method comprising contacting the cell one of the synthetic polynucleotides of claim 2 and one of the sgRNAs of claim 45 under conditions sufficient to modulate transcription of the VEGF gene.
73. A method for modulating transcription of a gene of interest in a subject comprising administering to the subject a first dosage of the synthetic polynucleotide of claim 1 and a second dosage of the synthetic sgRNA of claim 44 under conditions sufficient to modulate transcription of the gene of interest, the synthetic polynucleotide first region further comprising a polynucleotide sequence encoding an effector domain and the sgRNA first region sequence complementary to the gene of interest.
74. The method of claim 73, wherein the synthetic polynucleotide is any of the synthetic polynucleotides of the above claims.
75. The method of claim 73, wherein the sgRNA is any of the sgRNA of the above claims.
76. The method of claim 73, wherein the subject is a human.
77. The method of claim 73, wherein the synthetic polynucleotide and/or the synthetic sgRNA are formulated in a lipid nanoparticle formulation.
78. The method of claim 73, wherein the synthetic polynucleotide is formulated in a lipid nanoparticle formulation and the sgRNA is not formulated in a lipid nanoparticle formulation.
79. The method of claim 73, the gene of interest selected from the group consisting of VEGF, TPO, and LDHC.
80. The method of claim 73, the synthetic polynucleotide of claim 1 comprising an miR sequence specific for the cell.
81. The method of claim 73 , wherein a. the first dosage is 0.0005/mg/kg to 0.5 mg/kg synthetic polynucleotide; and/or b. the second dosage is between 0.0005/mg/kg-0.5 mg/kg sgRNA; and/or c. the synthetic polynucleotide and sgRNA are administered together or administered separately; and/or d. the synthetic polynucleotide and/or sgRNA are administered in a single dose or in multiple doses; and/or e. the synthetic polynucleotide and/or sgRNA are administered once a day or more than once a day; and/or f. the synthetic polynucleotide and/or sgRNA are administered prenatally, neonatally, postnatally, orally, ophthalmically, by intranasally, and/or by intravenous, intraarterial, intraperotoneal, intradermal, subcutaneous or intramuscular injection.
82. The method of claim 73, wherein the gene of interest is TPO and the subject is a mouse, the method comprising administering to the mouse 0.0005/mg/kg-0.5 mg/kg synthetic polynucleotide comprising SEQ ID NO:51 and 0.0005/mg/kg-0.5 mg/kg sgRNA comprising a first region comprising a sequence complementary to one strand of the 5' UTR of the TPO gene.
83. A method treating a disease in a subject comprising administering to the subject a first dosage of the synthetic polynucleotide of claim 1 and a second dosage of the synthetic sgRNA of claim 44 under conditions sufficient to modulate transcription of a gene of interest, the synthetic polynucleotide first region further comprising a polynucleotide sequence encoding an effector domain and the sgRNA first region sequence complementary to one strand of the gene of interest 5 'UTR, wherein expression of the gene is linked to the disease.
84. The method of claim 83, wherein the disease is cancer and the gene is an apoptosis or senescence gene.
85. The method of claim 83, wherein the synthetic polynucleotide is any of the synthetic polynucleotides of the above claims.
86. The method of claim 83, wherein the sgRNA is any of the sgRNA of claims the above claims.
87. The method of claim 83, wherein the subject is a human.
88. The method of claim 83, wherein the synthetic polynucleotide and/or the synthetic sgRNA are formulated in a lipid nanoparticle formulation.
89. The method of claim 83, wherein the synthetic polynucleotide is formulated in a lipid nanoparticle formulation and the sgRNA is not formulated in a lipid nanoparticle
formulation.
90. The method of claim 83, the gene of interest selected from the group consisting of VEGF, TPO, and LDHC.
91. The method of claim 83, the synthetic polynucleotide of claim 1 comprising an miR sequence.
92. The method of claim 83, wherein a. the first dosage is 0.0005/mg/kg to 0.5 mg/kg synthetic polynucleotide; and/or b. the second dosage is between 0.0005/mg/kg-0.5 mg/kg sgRNA; and/or c. the synthetic polynucleotide and sgRNA are administered together or administered separately; and/or d. the synthetic polynucleotide and/or sgRNA are administered in a single dose or in multiple doses; and/or e. the synthetic polynucleotide and/or sgRNA are administered once a day or more than once a day; and/or f. the synthetic polynucleotide and/or sgRNA are administered prenatally, neonatally, postnatally, orally, ophthalmically, by intranasally, and/or by intravenous, intraarterial, intraperotoneal, intradermal, subcutaneous or intramuscular injection.
PCT/US2014/046434 2013-07-11 2014-07-11 Compositions comprising synthetic polynucleotides encoding crispr related proteins and synthetic sgrnas and methods of use. Ceased WO2015006747A2 (en)

Priority Applications (17)

Application Number Priority Date Filing Date Title
EP14823392.7A EP3019619B1 (en) 2013-07-11 2014-07-11 Compositions comprising synthetic polynucleotides encoding crispr related proteins and synthetic sgrnas and methods of use
JP2016525829A JP7019233B2 (en) 2013-07-11 2014-07-11 Compositions and Methods of Use Containing Synthetic polynucleotides and Synthetic sgRNAs Encoding CRISPR-Related Proteins
SI201431887T SI3019619T1 (en) 2013-07-11 2014-07-11 Compositions comprising synthetic polynucleotides encoding crispr related proteins and synthetic sgrnas and methods of use
HRP20211563TT HRP20211563T1 (en) 2013-07-11 2014-07-11 Compositions comprising synthetic polynucleotides encoding crispr related proteins and synthetic sgrnas and methods of use
AU2014287009A AU2014287009B2 (en) 2013-07-11 2014-07-11 Compositions comprising synthetic polynucleotides encoding CRISPR related proteins and synthetic sgRNAs and methods of use
LTEPPCT/US2014/046434T LT3019619T (en) 2013-07-11 2014-07-11 COMPOSITIONS INCLUDING SYNTHETIC POLYNUCLEOTIDES CODING CRISPR-RELATED PROTEINS AND SYNTHETIC SCHEMES AND THEIR USES
PL14823392T PL3019619T3 (en) 2013-07-11 2014-07-11 Compositions comprising synthetic polynucleotides encoding crispr related proteins and synthetic sgrnas and methods of use
SM20210691T SMT202100691T1 (en) 2013-07-11 2014-07-11 Compositions comprising synthetic polynucleotides encoding crispr related proteins and synthetic sgrnas and methods of use
EP21192530.0A EP3971287A1 (en) 2013-07-11 2014-07-11 Compositions comprising synthetic polynucleotides encoding crispr related proteins and synthetic sgrnas and methods of use
ES14823392T ES2896755T3 (en) 2013-07-11 2014-07-11 Compositions Comprising Synthetic Polynucleotides Encoding CRISPR-Related Proteins and Synthetic sgRNAs and Methods of Use
US14/903,869 US11027025B2 (en) 2013-07-11 2014-07-11 Compositions comprising synthetic polynucleotides encoding CRISPR related proteins and synthetic sgRNAs and methods of use
DK14823392.7T DK3019619T3 (en) 2013-07-11 2014-07-11 COMPOSITIONS INCLUDING SYNTHETIC POLYNUCLEOTIDES CODING CRISPR-RELATED PROTEINS, SYNTHETIC SGRNAs, AND USES OF USE
CA2917348A CA2917348A1 (en) 2013-07-11 2014-07-11 Compositions comprising synthetic polynucleotides encoding crispr related proteins and synthetic sgrnas and methods of use
RS20211363A RS62529B1 (en) 2013-07-11 2014-07-11 Compositions comprising synthetic polynucleotides encoding crispr related proteins and synthetic sgrnas and methods of use
AU2021200486A AU2021200486B2 (en) 2013-07-11 2021-01-27 Compositions comprising synthetic polynucleotides encoding CRISPR related proteins and synthetic sgRNAs and methods of use
US17/329,368 US20220111079A1 (en) 2013-07-11 2021-05-25 COMPOSITIONS COMPRISING SYNTHETIC POLYNUCLEOTIDES ENCODING CRISPR RELATED PROTEINS AND SYNTHETIC SGRNAs AND METHODS OF USE
CY20211100957T CY1124740T1 (en) 2013-07-11 2021-11-05 COMPOSITIONS COMPRISING SYNTHETIC POLYNUCLEOTIDES ENCODING CRISPR-RELATED PROTEINS AND SYNTHETIC SGRNAS AND METHODS OF USE

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201361844890P 2013-07-11 2013-07-11
US61/844,890 2013-07-11
US201361886545P 2013-10-03 2013-10-03
US61/886,545 2013-10-03

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US14/903,869 A-371-Of-International US11027025B2 (en) 2013-07-11 2014-07-11 Compositions comprising synthetic polynucleotides encoding CRISPR related proteins and synthetic sgRNAs and methods of use
US17/329,368 Continuation US20220111079A1 (en) 2013-07-11 2021-05-25 COMPOSITIONS COMPRISING SYNTHETIC POLYNUCLEOTIDES ENCODING CRISPR RELATED PROTEINS AND SYNTHETIC SGRNAs AND METHODS OF USE

Publications (2)

Publication Number Publication Date
WO2015006747A2 true WO2015006747A2 (en) 2015-01-15
WO2015006747A3 WO2015006747A3 (en) 2015-04-23

Family

ID=52280736

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2014/046434 Ceased WO2015006747A2 (en) 2013-07-11 2014-07-11 Compositions comprising synthetic polynucleotides encoding crispr related proteins and synthetic sgrnas and methods of use.

Country Status (17)

Country Link
US (2) US11027025B2 (en)
EP (2) EP3971287A1 (en)
JP (4) JP7019233B2 (en)
AU (2) AU2014287009B2 (en)
CA (1) CA2917348A1 (en)
CY (1) CY1124740T1 (en)
DK (1) DK3019619T3 (en)
ES (1) ES2896755T3 (en)
HR (1) HRP20211563T1 (en)
HU (1) HUE056760T2 (en)
LT (1) LT3019619T (en)
PL (1) PL3019619T3 (en)
PT (1) PT3019619T (en)
RS (1) RS62529B1 (en)
SI (1) SI3019619T1 (en)
SM (1) SMT202100691T1 (en)
WO (1) WO2015006747A2 (en)

Cited By (173)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9068179B1 (en) 2013-12-12 2015-06-30 President And Fellows Of Harvard College Methods for correcting presenilin point mutations
US9095552B2 (en) 2012-04-02 2015-08-04 Moderna Therapeutics, Inc. Modified polynucleotides encoding copper metabolism (MURR1) domain containing 1
US9107886B2 (en) 2012-04-02 2015-08-18 Moderna Therapeutics, Inc. Modified polynucleotides encoding basic helix-loop-helix family member E41
CN105002198A (en) * 2015-08-07 2015-10-28 北京蛋白质组研究中心 Complete set of products for culturing transgenic pig expressing human serum albumin and application thereof
US9181321B2 (en) 2013-03-14 2015-11-10 Shire Human Genetic Therapies, Inc. CFTR mRNA compositions and related methods and uses
US9181319B2 (en) 2010-08-06 2015-11-10 Moderna Therapeutics, Inc. Engineered nucleic acids and methods of use thereof
US9186372B2 (en) 2011-12-16 2015-11-17 Moderna Therapeutics, Inc. Split dose administration
US9228207B2 (en) 2013-09-06 2016-01-05 President And Fellows Of Harvard College Switchable gRNAs comprising aptamers
US9283287B2 (en) 2012-04-02 2016-03-15 Moderna Therapeutics, Inc. Modified polynucleotides for the production of nuclear proteins
US9308281B2 (en) 2011-06-08 2016-04-12 Shire Human Genetic Therapies, Inc. MRNA therapy for Fabry disease
US9322037B2 (en) 2013-09-06 2016-04-26 President And Fellows Of Harvard College Cas9-FokI fusion proteins and uses thereof
US9322006B2 (en) 2011-07-22 2016-04-26 President And Fellows Of Harvard College Evaluation and improvement of nuclease cleavage specificity
US9359599B2 (en) 2013-08-22 2016-06-07 President And Fellows Of Harvard College Engineered transcription activator-like effector (TALE) domains and uses thereof
EP3064587A1 (en) 2015-03-06 2016-09-07 Leibniz-Institut für Pflanzenbiochemie (IPB) Library of synthetic promoters for coordinated gene expression in eukaryotic cells or organisms
WO2016154596A1 (en) * 2015-03-25 2016-09-29 Editas Medicine, Inc. Crispr/cas-related methods, compositions and components
WO2016135559A3 (en) * 2015-02-23 2016-10-20 Crispr Therapeutics Ag Materials and methods for treatment of human genetic diseases including hemoglobinopathies
US9512456B2 (en) 2012-08-14 2016-12-06 Modernatx, Inc. Enzymes and polymerases for the synthesis of RNA
WO2016197133A1 (en) 2015-06-04 2016-12-08 Protiva Biotherapeutics, Inc. Delivering crispr therapeutics with lipid nanoparticles
WO2016197132A1 (en) 2015-06-04 2016-12-08 Protiva Biotherapeutics Inc. Treating hepatitis b virus infection using crispr
US9522176B2 (en) 2013-10-22 2016-12-20 Shire Human Genetic Therapies, Inc. MRNA therapy for phenylketonuria
US9526784B2 (en) 2013-09-06 2016-12-27 President And Fellows Of Harvard College Delivery system for functional nucleases
US9533047B2 (en) 2011-03-31 2017-01-03 Modernatx, Inc. Delivery and formulation of engineered nucleic acids
WO2017004261A1 (en) 2015-06-29 2017-01-05 Ionis Pharmaceuticals, Inc. Modified crispr rna and modified single crispr rna and uses thereof
US9546128B2 (en) 2012-03-29 2017-01-17 Shire Human Genetic Therapies, Inc. Ionizable cationic lipids
WO2017024047A1 (en) * 2015-08-03 2017-02-09 Emendobio Inc. Compositions and methods for increasing nuclease induced recombination rate in cells
US9572897B2 (en) 2012-04-02 2017-02-21 Modernatx, Inc. Modified polynucleotides for the production of cytoplasmic and cytoskeletal proteins
US9597380B2 (en) 2012-11-26 2017-03-21 Modernatx, Inc. Terminally modified RNA
WO2017053312A1 (en) * 2015-09-21 2017-03-30 The Regents Of The University Of California Compositions and methods for target nucleic acid modification
WO2017058795A1 (en) * 2015-09-29 2017-04-06 Agenovir Corporation Compositions and methods for latent viral transcription regulation
US9629804B2 (en) 2013-10-22 2017-04-25 Shire Human Genetic Therapies, Inc. Lipid formulations for delivery of messenger RNA
US9668980B2 (en) 2014-07-02 2017-06-06 Rana Therapeutics, Inc. Encapsulation of messenger RNA
WO2017066497A3 (en) * 2015-10-13 2017-06-29 Duke University Genome engineering with type i crispr systems in eukaryotic cells
US9701965B2 (en) 2010-10-01 2017-07-11 Modernatx, Inc. Engineered nucleic acids and methods of use thereof
US9717690B2 (en) 2011-06-08 2017-08-01 Rana Therapeutics, Inc. Cleavable lipids
WO2017131237A1 (en) * 2016-01-30 2017-08-03 株式会社ボナック Artificial single guide rna and use thereof
EP3219799A1 (en) 2016-03-17 2017-09-20 IMBA-Institut für Molekulare Biotechnologie GmbH Conditional crispr sgrna expression
US9834791B2 (en) 2013-11-07 2017-12-05 Editas Medicine, Inc. CRISPR-related methods and compositions with governing gRNAS
US9850269B2 (en) 2014-04-25 2017-12-26 Translate Bio, Inc. Methods for purification of messenger RNA
WO2017222370A1 (en) 2016-06-20 2017-12-28 Keygene N.V. Method for targeted dna alteration in plant cells
WO2018003339A1 (en) * 2016-06-27 2018-01-04 国立大学法人京都大学 Method for cell-specifically controlling nuclease
WO2018009838A1 (en) 2016-07-07 2018-01-11 Rubius Therapeutics, Inc. Compositions and methods related to therapeutic cell systems expressing exogenous rna
US9877919B2 (en) 2012-03-29 2018-01-30 Translate Bio, Inc. Lipid-derived neutral nanoparticles
CN107787367A (en) * 2015-04-06 2018-03-09 里兰斯坦福初级大学理事会 Chemically modified guide RNAs for CRISPR/Cas-mediated gene regulation
US9943595B2 (en) 2014-12-05 2018-04-17 Translate Bio, Inc. Messenger RNA therapy for treatment of articular disease
US9957499B2 (en) 2013-03-14 2018-05-01 Translate Bio, Inc. Methods for purification of messenger RNA
US9956271B2 (en) 2010-11-30 2018-05-01 Translate Bio, Inc. mRNA for use in treatment of human genetic diseases
US9982279B1 (en) 2017-06-23 2018-05-29 Inscripta, Inc. Nucleic acid-guided nucleases
US9982278B2 (en) 2014-02-11 2018-05-29 The Regents Of The University Of Colorado, A Body Corporate CRISPR enabled multiplexed genome engineering
WO2018115389A1 (en) 2016-12-22 2018-06-28 Keygene N.V. Methods of targeted genetic alteration in plant cells
US10011849B1 (en) 2017-06-23 2018-07-03 Inscripta, Inc. Nucleic acid-guided nucleases
US10017760B2 (en) 2016-06-24 2018-07-10 Inscripta, Inc. Methods for generating barcoded combinatorial libraries
US10023626B2 (en) 2013-09-30 2018-07-17 Modernatx, Inc. Polynucleotides encoding immune modulating polypeptides
US10022455B2 (en) 2014-05-30 2018-07-17 Translate Bio, Inc. Biodegradable lipids for delivery of nucleic acids
JP2018519801A (en) * 2015-05-11 2018-07-26 エディタス・メディシン、インコーポレイテッド Optimized CRISPR / CAS9 system and method for gene editing in stem cells
WO2018149915A1 (en) 2017-02-15 2018-08-23 Keygene N.V. Methods of targeted genetic alteration in plant cells
US10077439B2 (en) 2013-03-15 2018-09-18 Modernatx, Inc. Removal of DNA fragments in mRNA production process
US10077453B2 (en) 2014-07-30 2018-09-18 President And Fellows Of Harvard College CAS9 proteins including ligand-dependent inteins
WO2018172556A1 (en) * 2017-03-24 2018-09-27 Curevac Ag Nucleic acids encoding crispr-associated proteins and uses thereof
US10087247B2 (en) 2013-03-14 2018-10-02 Translate Bio, Inc. Methods and compositions for delivering mRNA coded antibodies
WO2018183808A1 (en) 2017-03-31 2018-10-04 Agenovir Corporation Antiviral therapeutic
US10113163B2 (en) 2016-08-03 2018-10-30 President And Fellows Of Harvard College Adenosine nucleobase editors and uses thereof
US10117911B2 (en) 2015-05-29 2018-11-06 Agenovir Corporation Compositions and methods to treat herpes simplex virus infections
US10130649B2 (en) 2013-03-15 2018-11-20 Translate Bio, Inc. Synergistic enhancement of the delivery of nucleic acids via blended formulations
US10138213B2 (en) 2014-06-24 2018-11-27 Translate Bio, Inc. Stereochemically enriched compositions for delivery of nucleic acids
US10138507B2 (en) 2013-03-15 2018-11-27 Modernatx, Inc. Manufacturing methods for production of RNA transcripts
US10144942B2 (en) 2015-10-14 2018-12-04 Translate Bio, Inc. Modification of RNA-related enzymes for enhanced production
US10167457B2 (en) 2015-10-23 2019-01-01 President And Fellows Of Harvard College Nucleobase editors and uses thereof
US10172924B2 (en) 2015-03-19 2019-01-08 Translate Bio, Inc. MRNA therapy for pompe disease
WO2019048618A1 (en) 2017-09-08 2019-03-14 Keygene N.V. Balanced indels
US10245229B2 (en) 2012-06-08 2019-04-02 Translate Bio, Inc. Pulmonary delivery of mRNA to non-lung target cells
WO2019067992A1 (en) * 2017-09-29 2019-04-04 Intellia Therapeutics, Inc. Formulations
US10258698B2 (en) 2013-03-14 2019-04-16 Modernatx, Inc. Formulation and delivery of modified nucleoside, nucleotide, and nucleic acid compositions
US10266843B2 (en) 2016-04-08 2019-04-23 Translate Bio, Inc. Multimeric coding nucleic acid and uses thereof
EP3473720A1 (en) * 2013-08-22 2019-04-24 Pioneer Hi-Bred International, Inc. Genome modification using guide polynucleotide/cas endonuclease systems and methods of use
WO2019087113A1 (en) 2017-11-01 2019-05-09 Novartis Ag Synthetic rnas and methods of use
US10286086B2 (en) 2014-06-19 2019-05-14 Modernatx, Inc. Alternative nucleic acid molecules and uses thereof
WO2018057946A3 (en) * 2016-09-23 2019-05-31 Board Of Trustees Of Southern Illinois University Tuning crispr/cas9 activity with chemically modified nucleotide substitutions
WO2019116346A1 (en) 2017-12-15 2019-06-20 Novartis Ag Polya tail length analysis of rna by mass spectrometry
US10385088B2 (en) 2013-10-02 2019-08-20 Modernatx, Inc. Polynucleotide molecules and uses thereof
US10407683B2 (en) 2014-07-16 2019-09-10 Modernatx, Inc. Circular polynucleotides
US10494621B2 (en) 2015-06-18 2019-12-03 The Broad Institute, Inc. Crispr enzyme mutations reducing off-target effects
US10508298B2 (en) 2013-08-09 2019-12-17 President And Fellows Of Harvard College Methods for identifying a target site of a CAS9 nuclease
US10544405B2 (en) 2013-01-16 2020-01-28 Emory University Cas9-nucleic acid complexes and uses related thereto
US10550372B2 (en) 2013-12-12 2020-02-04 The Broad Institute, Inc. Systems, methods and compositions for sequence manipulation with optimized functional CRISPR-Cas systems
US10576166B2 (en) 2009-12-01 2020-03-03 Translate Bio, Inc. Liver specific delivery of messenger RNA
US10577630B2 (en) 2013-06-17 2020-03-03 The Broad Institute, Inc. Delivery and use of the CRISPR-Cas systems, vectors and compositions for hepatic targeting and therapy
US10590161B2 (en) 2013-03-15 2020-03-17 Modernatx, Inc. Ion exchange purification of mRNA
WO2020089448A1 (en) 2018-11-01 2020-05-07 Keygene N.V. Dual guide rna for crispr/cas genome editing in plants cells
KR20200071081A (en) * 2017-10-19 2020-06-18 큐어백 아게 New artificial nucleic acid molecule
US10696986B2 (en) 2014-12-12 2020-06-30 The Board Institute, Inc. Protected guide RNAS (PGRNAS)
US10711285B2 (en) 2013-06-17 2020-07-14 The Broad Institute, Inc. Optimized CRISPR-Cas double nickase systems, methods and compositions for sequence manipulation
US10738305B2 (en) 2015-02-23 2020-08-11 Vertex Pharmaceuticals Incorporated Materials and methods for treatment of hemoglobinopathies
WO2020163379A1 (en) 2019-02-05 2020-08-13 Emendobio Inc. Crispr compositions and methods for promoting gene editing of ribosomal protein s19 (rps19) gene
US10745677B2 (en) 2016-12-23 2020-08-18 President And Fellows Of Harvard College Editing of CCR5 receptor gene to protect against HIV infection
US10780052B2 (en) 2013-10-22 2020-09-22 Translate Bio, Inc. CNS delivery of MRNA and uses thereof
US10781444B2 (en) 2013-06-17 2020-09-22 The Broad Institute, Inc. Functional genomics using CRISPR-Cas systems, compositions, methods, screens and applications thereof
US10835583B2 (en) 2016-06-13 2020-11-17 Translate Bio, Inc. Messenger RNA therapy for the treatment of ornithine transcarbamylase deficiency
US10849920B2 (en) 2015-10-05 2020-12-01 Modernatx, Inc. Methods for therapeutic administration of messenger ribonucleic acid drugs
US10851357B2 (en) 2013-12-12 2020-12-01 The Broad Institute, Inc. Compositions and methods of use of CRISPR-Cas systems in nucleotide repeat disorders
US20210040460A1 (en) 2012-04-27 2021-02-11 Duke University Genetic correction of mutated genes
US10930367B2 (en) 2012-12-12 2021-02-23 The Broad Institute, Inc. Methods, models, systems, and apparatus for identifying target sequences for Cas enzymes or CRISPR-Cas systems for target sequences and conveying results thereof
US10934536B2 (en) 2018-12-14 2021-03-02 Pioneer Hi-Bred International, Inc. CRISPR-CAS systems for genome editing
US10946108B2 (en) 2013-06-17 2021-03-16 The Broad Institute, Inc. Delivery, use and therapeutic applications of the CRISPR-Cas systems and compositions for targeting disorders and diseases using viral components
JP2021058209A (en) * 2015-12-18 2021-04-15 ダニスコ・ユーエス・インク Methods and compositions for polymerase ii (pol-ii) based guide rna expression
US11008588B2 (en) 2013-06-17 2021-05-18 The Broad Institute, Inc. Delivery, engineering and optimization of tandem guide systems, methods and compositions for sequence manipulation
US11027025B2 (en) 2013-07-11 2021-06-08 Modernatx, Inc. Compositions comprising synthetic polynucleotides encoding CRISPR related proteins and synthetic sgRNAs and methods of use
US11041173B2 (en) 2012-12-12 2021-06-22 The Broad Institute, Inc. Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications
US11155795B2 (en) 2013-12-12 2021-10-26 The Broad Institute, Inc. CRISPR-Cas systems, crystal structure and uses thereof
US11167043B2 (en) 2017-12-20 2021-11-09 Translate Bio, Inc. Composition and methods for treatment of ornithine transcarbamylase deficiency
US11173190B2 (en) 2017-05-16 2021-11-16 Translate Bio, Inc. Treatment of cystic fibrosis by delivery of codon-optimized mRNA encoding CFTR
US11174500B2 (en) 2018-08-24 2021-11-16 Translate Bio, Inc. Methods for purification of messenger RNA
EP3134131B1 (en) 2014-04-23 2021-12-22 ModernaTX, Inc. Nucleic acid vaccines
US11224642B2 (en) 2013-10-22 2022-01-18 Translate Bio, Inc. MRNA therapy for argininosuccinate synthetase deficiency
US11254936B2 (en) 2012-06-08 2022-02-22 Translate Bio, Inc. Nuclease resistant polynucleotides and uses thereof
US11253605B2 (en) 2017-02-27 2022-02-22 Translate Bio, Inc. Codon-optimized CFTR MRNA
US11268082B2 (en) 2017-03-23 2022-03-08 President And Fellows Of Harvard College Nucleobase editors comprising nucleic acid programmable DNA binding proteins
US11268077B2 (en) 2018-02-05 2022-03-08 Vertex Pharmaceuticals Incorporated Materials and methods for treatment of hemoglobinopathies
US11306324B2 (en) 2016-10-14 2022-04-19 President And Fellows Of Harvard College AAV delivery of nucleobase editors
EP3718565B1 (en) 2015-10-22 2022-04-27 ModernaTX, Inc. Respiratory virus vaccines
US11319532B2 (en) 2017-08-30 2022-05-03 President And Fellows Of Harvard College High efficiency base editors comprising Gam
RU2775176C2 (en) * 2017-03-24 2022-06-28 Куревак Аг Nucleic acids encoding crispr-associated proteins, and their use
US11377470B2 (en) 2013-03-15 2022-07-05 Modernatx, Inc. Ribonucleic acid purification
US11407985B2 (en) 2013-12-12 2022-08-09 The Broad Institute, Inc. Delivery, use and therapeutic applications of the CRISPR-Cas systems and compositions for genome editing
WO2022171783A1 (en) 2021-02-11 2022-08-18 Koninklijke Nederlandse Akademie Van Wetenschappen Curing disease by transcription regulatory gene editing
US11434486B2 (en) 2015-09-17 2022-09-06 Modernatx, Inc. Polynucleotides containing a morpholino linker
US11447770B1 (en) 2019-03-19 2022-09-20 The Broad Institute, Inc. Methods and compositions for prime editing nucleotide sequences
US11466271B2 (en) 2017-02-06 2022-10-11 Novartis Ag Compositions and methods for the treatment of hemoglobinopathies
US11542509B2 (en) 2016-08-24 2023-01-03 President And Fellows Of Harvard College Incorporation of unnatural amino acids into proteins using base editing
US11542496B2 (en) 2017-03-10 2023-01-03 President And Fellows Of Harvard College Cytosine to guanine base editor
US11560566B2 (en) 2017-05-12 2023-01-24 President And Fellows Of Harvard College Aptazyme-embedded guide RNAs for use with CRISPR-Cas9 in genome editing and transcriptional activation
US11566237B2 (en) * 2016-09-23 2023-01-31 University Of Massachusetts Silencing of DUX4 by recombinant gene editing complexes
US11578312B2 (en) 2015-06-18 2023-02-14 The Broad Institute Inc. Engineering and optimization of systems, methods, enzymes and guide scaffolds of CAS9 orthologs and variants for sequence manipulation
US11603399B2 (en) 2013-03-13 2023-03-14 Modernatx, Inc. Long-lived polynucleotide molecules
US11661590B2 (en) 2016-08-09 2023-05-30 President And Fellows Of Harvard College Programmable CAS9-recombinase fusion proteins and uses thereof
US11697806B2 (en) 2017-09-29 2023-07-11 Intellia Therapeutics, Inc. Polynucleotides, compositions, and methods for genome editing
US11732274B2 (en) 2017-07-28 2023-08-22 President And Fellows Of Harvard College Methods and compositions for evolving base editors using phage-assisted continuous evolution (PACE)
WO2023185697A2 (en) 2022-03-29 2023-10-05 Accuredit Therapeutics (Suzhou) Co., Ltd. Compositions and methods for treatment of transthyretin amyloidosis
US11795443B2 (en) 2017-10-16 2023-10-24 The Broad Institute, Inc. Uses of adenosine base editors
WO2024023067A1 (en) 2022-07-25 2024-02-01 Koninklijke Nederlandse Akademie Van Wetenschappen Curing disease by transcription regulatory gene editing
US11898179B2 (en) 2017-03-09 2024-02-13 President And Fellows Of Harvard College Suppression of pain by gene editing
US11912985B2 (en) 2020-05-08 2024-02-27 The Broad Institute, Inc. Methods and compositions for simultaneous editing of both strands of a target double-stranded nucleotide sequence
US11920128B2 (en) 2013-09-18 2024-03-05 Kymab Limited Methods, cells and organisms
US11939579B2 (en) 2016-04-02 2024-03-26 Research Institute At Nationwide Children's Hospital Modified U6 promoter system for tissue specific expression
WO2024061296A2 (en) 2022-09-22 2024-03-28 Accuredit Therapeutics (Suzhou) Co., Ltd. Compositions and methods for treatment of hypercholesterolemia and/or cardiovascular disease
US12043843B2 (en) 2015-11-04 2024-07-23 Vertex Pharmaceuticals Incorporated Materials and methods for treatment of hemoglobinopathies
US12059475B2 (en) * 2015-04-29 2024-08-13 Solmic Biotech GmbH Targeted nanocarriers for targeted drug delivery of gene therapeutics
US12084676B2 (en) 2018-02-23 2024-09-10 Pioneer Hi-Bred International, Inc. Cas9 orthologs
US12098399B2 (en) 2022-06-24 2024-09-24 Tune Therapeutics, Inc. Compositions, systems, and methods for epigenetic regulation of proprotein convertase subtilisin/kexin type 9 (PCSK9) gene expression
US12109274B2 (en) 2015-09-17 2024-10-08 Modernatx, Inc. Polynucleotides containing a stabilizing tail region
US12157760B2 (en) 2018-05-23 2024-12-03 The Broad Institute, Inc. Base editors and uses thereof
US12195505B2 (en) 2018-11-21 2025-01-14 Translate Bio, Inc. Treatment of cystic fibrosis by delivery of nebulized mRNA encoding CFTR
US12214056B2 (en) 2016-07-19 2025-02-04 Duke University Therapeutic applications of CPF1-based genome editing
US12215366B2 (en) 2015-02-09 2025-02-04 Duke University Compositions and methods for epigenome editing
US12214054B2 (en) 2015-11-30 2025-02-04 Duke University Therapeutic targets for the correction of the human dystrophin gene by gene editing and methods of use
US12215345B2 (en) 2013-03-19 2025-02-04 Duke University Compositions and methods for the induction and tuning of gene expression
US12251450B2 (en) 2013-12-12 2025-03-18 The Broad Institute, Inc. Delivery, use and therapeutic applications of the CRISPR-Cas systems and compositions for HBV and viral diseases and disorders
US12281338B2 (en) 2018-10-29 2025-04-22 The Broad Institute, Inc. Nucleobase editors comprising GeoCas9 and uses thereof
US12318443B2 (en) 2016-11-11 2025-06-03 Modernatx, Inc. Influenza vaccine
US12351837B2 (en) 2019-01-23 2025-07-08 The Broad Institute, Inc. Supernegatively charged proteins and uses thereof
US12385034B2 (en) 2016-06-24 2025-08-12 Modernatx, Inc. Methods and apparatus for filtration
US12390514B2 (en) 2017-03-09 2025-08-19 President And Fellows Of Harvard College Cancer vaccine
US12390538B2 (en) 2023-05-15 2025-08-19 Nchroma Bio, Inc. Compositions and methods for epigenetic regulation of HBV gene expression
US12406749B2 (en) 2017-12-15 2025-09-02 The Broad Institute, Inc. Systems and methods for predicting repair outcomes in genetic engineering
WO2025194138A1 (en) 2024-03-14 2025-09-18 Tessera Therapeutics, Inc. St1cas9 compositions and methods for modulating a genome
US12421506B2 (en) 2013-12-12 2025-09-23 The Broad Institute, Inc. Engineering of systems, methods and optimized guide compositions with new architectures for sequence manipulation
US12428631B2 (en) 2016-04-13 2025-09-30 Duke University CRISPR/Cas9-based repressors for silencing gene targets in vivo and methods of use
US12435320B2 (en) 2014-12-24 2025-10-07 The Broad Institute, Inc. CRISPR having or associated with destabilization domains
US12435330B2 (en) 2019-10-10 2025-10-07 The Broad Institute, Inc. Methods and compositions for prime editing RNA
US12454687B2 (en) 2012-12-12 2025-10-28 The Broad Institute, Inc. Functional genomics using CRISPR-Cas systems, compositions, methods, knock out libraries and applications thereof
US12473543B2 (en) 2019-04-17 2025-11-18 The Broad Institute, Inc. Adenine base editors with reduced off-target effects
US12509492B2 (en) 2018-01-19 2025-12-30 Duke University Genome engineering with CRISPR-Cas systems in eukaryotes
US12522807B2 (en) 2018-07-09 2026-01-13 The Broad Institute, Inc. RNA programmable epigenetic RNA modifiers and uses thereof
US12611442B2 (en) 2019-09-20 2026-04-28 Translate Bio, Inc. mRNA encoding engineered CFTR

Families Citing this family (46)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2016094880A1 (en) * 2014-12-12 2016-06-16 The Broad Institute Inc. Delivery, use and therapeutic applications of crispr systems and compositions for genome editing as to hematopoietic stem cells (hscs)
MA42543A (en) 2015-07-30 2018-06-06 Modernatx Inc CONCATEMERIC PEPTIDIC EPITOPE RNA
WO2017068077A1 (en) 2015-10-20 2017-04-27 Institut National De La Sante Et De La Recherche Medicale (Inserm) Methods and products for genetic engineering
WO2017201342A1 (en) 2016-05-18 2017-11-23 Modernatx, Inc. Polynucleotides encoding jagged1 for the treatment of alagille syndrome
US10927383B2 (en) * 2016-06-30 2021-02-23 Ethris Gmbh Cas9 mRNAs
SG11201901306XA (en) * 2016-08-19 2019-03-28 Toolgen Inc Artificially engineered angiogenesis regulatory system
CA3036831A1 (en) 2016-09-14 2018-03-22 Modernatx, Inc. High purity rna compositions and methods for preparation thereof
WO2018170256A1 (en) 2017-03-15 2018-09-20 Modernatx, Inc. Herpes simplex virus vaccine
KR101852718B1 (en) * 2017-04-04 2018-05-18 주식회사 제네웰 Kit for pain reduction of incision site after surgical operation
US11905525B2 (en) 2017-04-05 2024-02-20 Modernatx, Inc. Reduction of elimination of immune responses to non-intravenous, e.g., subcutaneously administered therapeutic proteins
MA49421A (en) 2017-06-15 2020-04-22 Modernatx Inc RNA FORMULATIONS
EP3668979A4 (en) 2017-08-18 2021-06-02 Modernatx, Inc. PROCESSES FOR HPLC ANALYSIS
MA49914A (en) 2017-08-18 2021-04-21 Modernatx Inc HPLC ANALYTICAL PROCESSES
WO2019036682A1 (en) 2017-08-18 2019-02-21 Modernatx, Inc. Rna polymerase variants
EP3675817A1 (en) 2017-08-31 2020-07-08 Modernatx, Inc. Methods of making lipid nanoparticles
KR102061251B1 (en) 2017-10-31 2019-12-31 주식회사 에이치유비바이오텍 Recombinant cell and method for production of endogenous polypeptide
EP3746090A4 (en) 2018-01-29 2021-11-17 ModernaTX, Inc. RSV RNA VACCINES
WO2019204750A1 (en) * 2018-04-20 2019-10-24 Cellino Biotech, Inc. Directed cell fate specification and targeted maturation
AU2019265019B2 (en) 2018-05-11 2025-11-06 Beam Therapeutics Inc. Methods of substituting pathogenic amino acids using programmable base editor systems
AU2019271132B2 (en) * 2018-05-15 2026-02-05 Translate Bio, Inc. Subcutaneous delivery of messenger RNA
CN108642055B (en) * 2018-05-17 2021-12-03 吉林大学 sgRNA capable of effectively editing pig miR-17-92 gene cluster
WO2020014577A1 (en) * 2018-07-13 2020-01-16 Allele Biotechnology And Pharmaceuticals, Inc. Methods of achieving high specificity of genome editing
US12496311B2 (en) 2018-07-17 2025-12-16 Aronora, Inc. Methods for safely reducing thrombopoietin
CA3113025A1 (en) 2018-09-19 2020-03-26 Modernatx, Inc. Peg lipids and uses thereof
WO2020061295A1 (en) 2018-09-19 2020-03-26 Modernatx, Inc. High-purity peg lipids and uses thereof
WO2020061457A1 (en) 2018-09-20 2020-03-26 Modernatx, Inc. Preparation of lipid nanoparticles and methods of administration thereof
EP3877748A4 (en) 2018-11-06 2022-11-09 Cellino Biotech, Inc. SYSTEMS FOR CELL CONTROL
AU2020224103A1 (en) 2019-02-20 2021-09-16 Modernatx, Inc. Rna polymerase variants for co-transcriptional capping
CN113874502A (en) 2019-03-11 2021-12-31 摩登纳特斯有限公司 Fed-batch in vitro transcription method
US12070495B2 (en) 2019-03-15 2024-08-27 Modernatx, Inc. HIV RNA vaccines
US11827926B2 (en) 2020-03-23 2023-11-28 President And Fellows Of Harvard College Methods and compositions for the diagnosis and treatment of COVID 19
CA3176545A1 (en) 2020-04-22 2021-10-28 President And Fellows Of Harvard College Isothermal methods, compositions, kits, and systems for detecting nucleic acids
US12188060B2 (en) 2020-05-15 2025-01-07 Crispr Therapeutics Ag Messenger RNA encoding Cas9 for use in genome-editing systems
JPWO2022004765A1 (en) * 2020-06-30 2022-01-06
EP4225946A4 (en) 2020-10-06 2024-10-30 President And Fellows Of Harvard College METHODS, COMPOSITIONS, KITS AND SYSTEMS FOR SIGNAL-ON DETECTION OF NEUTRALISATION TARGETS
US20240016855A1 (en) * 2020-10-13 2024-01-18 Centre National De La Recherche Scientifique (Cnrs) Targeted-antibacterial-plasmids combining conjugation and crispr/cas systems and uses thereof
EP4274607A1 (en) 2021-01-11 2023-11-15 ModernaTX, Inc. Seasonal rna influenza virus vaccines
CN112877368B (en) * 2021-01-25 2023-05-16 华中农业大学 Gene editing system and method for mature plants
US20220363937A1 (en) 2021-05-14 2022-11-17 Armstrong World Industries, Inc. Stabilization of antimicrobial coatings
EP4355882A2 (en) 2021-06-15 2024-04-24 Modernatx, Inc. Engineered polynucleotides for cell-type or microenvironment-specific expression
US12529047B1 (en) 2021-12-21 2026-01-20 Modernatx, Inc. mRNA quantification methods
EP4202043A1 (en) * 2021-12-22 2023-06-28 Technische Universität München A method for genetic modification for high cg content microorganisms
WO2024026254A1 (en) 2022-07-26 2024-02-01 Modernatx, Inc. Engineered polynucleotides for temporal control of expression
EP4660306A1 (en) 2023-01-31 2025-12-10 Synplogen Co., Ltd. Artificially synthesized nucleic acid for increasing protein expression
WO2025108148A1 (en) * 2023-11-24 2025-05-30 山东舜丰生物科技有限公司 Cas protein having improved activity and use thereof
CN120290555B (en) * 2024-12-04 2026-02-27 中国农业科学院北京畜牧兽医研究所 A method for detecting biallelic gene editing cells based on CRISPR/Cas12a technology

Citations (170)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4587044A (en) 1983-09-01 1986-05-06 The Johns Hopkins University Linkage of proteins to nucleic acids
US4605735A (en) 1983-02-14 1986-08-12 Wakunaga Seiyaku Kabushiki Kaisha Oligonucleotide derivatives
US4667025A (en) 1982-08-09 1987-05-19 Wakunaga Seiyaku Kabushiki Kaisha Oligonucleotide derivatives
US4762779A (en) 1985-06-13 1988-08-09 Amgen Inc. Compositions and methods for functionalizing nucleic acids
US4824941A (en) 1983-03-10 1989-04-25 Julian Gordon Specific antibody to the native form of 2'5'-oligonucleotides, the method of preparation and the use as reagents in immunoassays or for binding 2'5'-oligonucleotides in biological systems
US4828979A (en) 1984-11-08 1989-05-09 Life Technologies, Inc. Nucleotide analogs for nucleic acid labeling and detection
US4835263A (en) 1983-01-27 1989-05-30 Centre National De La Recherche Scientifique Novel compounds containing an oligonucleotide sequence bonded to an intercalating agent, a process for their synthesis and their use
US4876335A (en) 1986-06-30 1989-10-24 Wakunaga Seiyaku Kabushiki Kaisha Poly-labelled oligonucleotide derivative
US4904582A (en) 1987-06-11 1990-02-27 Synthetic Genetics Novel amphiphilic nucleic acid conjugates
US4948882A (en) 1983-02-22 1990-08-14 Syngene, Inc. Single-stranded labelled oligonucleotides, reactive monomers and methods of synthesis
US4958013A (en) 1989-06-06 1990-09-18 Northwestern University Cholesteryl modified oligonucleotides
US4981957A (en) 1984-07-19 1991-01-01 Centre National De La Recherche Scientifique Oligonucleotides with modified phosphate and modified carbohydrate moieties at the respective chain termini
US5082830A (en) 1988-02-26 1992-01-21 Enzo Biochem, Inc. End labeled nucleotide probe
US5109124A (en) 1988-06-01 1992-04-28 Biogen, Inc. Nucleic acid probe linked to a label having a terminal cysteine
US5112963A (en) 1987-11-12 1992-05-12 Max-Planck-Gesellschaft Zur Foerderung Der Wissenschaften E.V. Modified oligonucleotides
US5118800A (en) 1983-12-20 1992-06-02 California Institute Of Technology Oligonucleotides possessing a primary amino group in the terminal nucleotide
US5118802A (en) 1983-12-20 1992-06-02 California Institute Of Technology DNA-reporter conjugates linked via the 2' or 5'-primary amino group of the 5'-terminal nucleoside
US5138045A (en) 1990-07-27 1992-08-11 Isis Pharmaceuticals Polyamine conjugated oligonucleotides
US5208020A (en) 1989-10-25 1993-05-04 Immunogen Inc. Cytotoxic agents comprising maytansinoids and their therapeutic use
US5214136A (en) 1990-02-20 1993-05-25 Gilead Sciences, Inc. Anthraquinone-derivatives oligonucleotides
US5218105A (en) 1990-07-27 1993-06-08 Isis Pharmaceuticals Polyamine conjugated oligonucleotides
US5245022A (en) 1990-08-03 1993-09-14 Sterling Drug, Inc. Exonuclease resistant terminally substituted oligonucleotides
US5254469A (en) 1989-09-12 1993-10-19 Eastman Kodak Company Oligonucleotide-enzyme conjugate that can be used as a probe in hybridization assays and polymerase chain reaction procedures
US5258506A (en) 1984-10-16 1993-11-02 Chiron Corporation Photolabile reagents for incorporation into oligonucleotide chains
US5262536A (en) 1988-09-15 1993-11-16 E. I. Du Pont De Nemours And Company Reagents for the preparation of 5'-tagged oligonucleotides
US5272250A (en) 1992-07-10 1993-12-21 Spielvogel Bernard F Boronated phosphoramidate compounds
US5292873A (en) 1989-11-29 1994-03-08 The Research Foundation Of State University Of New York Nucleic acids labeled with naphthoquinone probe
US5317098A (en) 1986-03-17 1994-05-31 Hiroaki Shizuya Non-radioisotope tagging of fragments
US5319080A (en) 1991-10-17 1994-06-07 Ciba-Geigy Corporation Bicyclic nucleosides, oligonucleotides, process for their preparation and intermediates
US5359044A (en) 1991-12-13 1994-10-25 Isis Pharmaceuticals Cyclobutyl oligonucleotide surrogates
US5371241A (en) 1991-07-19 1994-12-06 Pharmacia P-L Biochemicals Inc. Fluorescein labelled phosphoramidites
US5391723A (en) 1989-05-31 1995-02-21 Neorx Corporation Oligonucleotide conjugates
US5414077A (en) 1990-02-20 1995-05-09 Gilead Sciences Non-nucleoside linkers for convenient attachment of labels to oligonucleotides using standard synthetic methods
US5446137A (en) 1993-12-09 1995-08-29 Syntex (U.S.A.) Inc. Oligonucleotides containing 4'-substituted nucleotides
US5451413A (en) 1992-09-17 1995-09-19 Gist-Brocades, B.V. Yeast derivative and method to improve bread quality
US5466786A (en) 1989-10-24 1995-11-14 Gilead Sciences 2'modified nucleoside and nucleotide compounds
US5475092A (en) 1992-03-25 1995-12-12 Immunogen Inc. Cell binding agent conjugates of analogues and derivatives of CC-1065
US5486603A (en) 1990-01-08 1996-01-23 Gilead Sciences, Inc. Oligonucleotide having enhanced binding affinity
US5510475A (en) 1990-11-08 1996-04-23 Hybridon, Inc. Oligonucleotide multiple reporter precursors
US5512439A (en) 1988-11-21 1996-04-30 Dynal As Oligonucleotide-linked magnetic particles and uses thereof
US5512667A (en) 1990-08-28 1996-04-30 Reed; Michael W. Trifunctional intermediates for preparing 3'-tailed oligonucleotides
US5514785A (en) 1990-05-11 1996-05-07 Becton Dickinson And Company Solid supports for nucleic acid hybridization assays
US5519134A (en) 1994-01-11 1996-05-21 Isis Pharmaceuticals, Inc. Pyrrolidine-containing monomers and oligomers
US5525465A (en) 1987-10-28 1996-06-11 Howard Florey Institute Of Experimental Physiology And Medicine Oligonucleotide-polyamide conjugates and methods of production and applications of the same
US5539082A (en) 1993-04-26 1996-07-23 Nielsen; Peter E. Peptide nucleic acids
US5545730A (en) 1984-10-16 1996-08-13 Chiron Corporation Multifunctional nucleic acid monomer
US5565552A (en) 1992-01-21 1996-10-15 Pharmacyclics, Inc. Method of expanded porphyrin-oligonucleotide conjugate synthesis
US5567811A (en) 1990-05-03 1996-10-22 Amersham International Plc Phosphoramidite derivatives, their preparation and the use thereof in the incorporation of reporter groups on synthetic oligonucleotides
US5574142A (en) 1992-12-15 1996-11-12 Microprobe Corporation Peptide linkers for improved oligonucleotide delivery
US5576427A (en) 1993-03-30 1996-11-19 Sterling Winthrop, Inc. Acyclic nucleoside analogs and oligonucleotide sequences containing them
US5578718A (en) 1990-01-11 1996-11-26 Isis Pharmaceuticals, Inc. Thiol-derivatized nucleosides
US5580731A (en) 1994-08-25 1996-12-03 Chiron Corporation N-4 modified pyrimidine deoxynucleotides and oligonucleotide probes synthesized therewith
US5585481A (en) 1987-09-21 1996-12-17 Gen-Probe Incorporated Linking reagents for nucleotide probes
US5587371A (en) 1992-01-21 1996-12-24 Pharmacyclics, Inc. Texaphyrin-oligonucleotide conjugates
US5591722A (en) 1989-09-15 1997-01-07 Southern Research Institute 2'-deoxy-4'-thioribonucleosides and their antiviral activity
US5595726A (en) 1992-01-21 1997-01-21 Pharmacyclics, Inc. Chromophore probe for detection of nucleic acid
US5597909A (en) 1994-08-25 1997-01-28 Chiron Corporation Polynucleotide reagents containing modified deoxyribose moieties, and associated methods of synthesis and use
US5597696A (en) 1994-07-18 1997-01-28 Becton Dickinson And Company Covalent cyanine dye oligonucleotide conjugates
US5599923A (en) 1989-03-06 1997-02-04 Board Of Regents, University Of Tx Texaphyrin metal complexes having improved functionalization
US5608046A (en) 1990-07-27 1997-03-04 Isis Pharmaceuticals, Inc. Conjugated 4'-desmethyl nucleoside analog compounds
US5610300A (en) 1992-07-01 1997-03-11 Ciba-Geigy Corporation Carbocyclic nucleosides containing bicyclic rings, oligonucleotides therefrom, process for their preparation, their use and intermediates
US5627053A (en) 1994-03-29 1997-05-06 Ribozyme Pharmaceuticals, Inc. 2'deoxy-2'-alkylnucleotide containing nucleic acid
US5639873A (en) 1992-02-05 1997-06-17 Centre National De La Recherche Scientifique (Cnrs) Oligothionucleotides
US5646265A (en) 1990-01-11 1997-07-08 Isis Pharmceuticals, Inc. Process for the preparation of 2'-O-alkyl purine phosphoramidites
US5658873A (en) 1993-04-10 1997-08-19 Degussa Aktiengesellschaft Coated sodium percarbonate particles, a process for their production and detergent, cleaning and bleaching compositions containing them
US5670633A (en) 1990-01-11 1997-09-23 Isis Pharmaceuticals, Inc. Sugar modified oligonucleotides that detect and modulate gene expression
US5688941A (en) 1990-07-27 1997-11-18 Isis Pharmaceuticals, Inc. Methods of making conjugated 4' desmethyl nucleoside analog compounds
US5714331A (en) 1991-05-24 1998-02-03 Buchardt, Deceased; Ole Peptide nucleic acids having enhanced binding affinity, sequence specificity and solubility
US5719262A (en) 1993-11-22 1998-02-17 Buchardt, Deceased; Ole Peptide nucleic acids having amino acid side chains
US6177274B1 (en) 1998-05-20 2001-01-23 Expression Genetics, Inc. Hepatocyte targeting polyethylene glyco-grafted poly-L-lysine polymeric gene carrier
US6190315B1 (en) 1998-01-08 2001-02-20 Sontra Medical, Inc. Sonophoretic enhanced transdermal transport
US6217912B1 (en) 1998-07-13 2001-04-17 Expression Genetics, Inc. Polyester analogue of poly-L-lysine as a soluble, biodegradable gene delivery carrier
US6234990B1 (en) 1996-06-28 2001-05-22 Sontra Medical, Inc. Ultrasound enhancement of transdermal transport
US6267987B1 (en) 1997-12-12 2001-07-31 Samyang Corporation Positively charged poly[alpha-(omega-aminoalkyl) glycolic acid] for the delivery of a bioactive agent via tissue and cellular uptake
US6268490B1 (en) 1997-03-07 2001-07-31 Takeshi Imanishi Bicyclonucleoside and oligonucleotide analogues
US6294664B1 (en) 1993-07-29 2001-09-25 Isis Pharmaceuticals, Inc. Synthesis of oligonucleotides
US6320017B1 (en) 1997-12-23 2001-11-20 Inex Pharmaceuticals Corp. Polyamide oligomers
US6517869B1 (en) 1997-12-12 2003-02-11 Expression Genetics, Inc. Positively charged poly(alpha-(omega-aminoalkyl)lycolic acid) for the delivery of a bioactive agent via tissue and cellular uptake
US6576752B1 (en) 1997-02-14 2003-06-10 Isis Pharmaceuticals, Inc. Aminooxy functionalized oligomers
US6586524B2 (en) 2001-07-19 2003-07-01 Expression Genetics, Inc. Cellular targeting poly(ethylene glycol)-grafted polymeric gene carrier
US6652886B2 (en) 2001-02-16 2003-11-25 Expression Genetics Biodegradable cationic copolymers of poly (alkylenimine) and poly (ethylene glycol) for the delivery of bioactive agents
US6670461B1 (en) 1997-09-12 2003-12-30 Exiqon A/S Oligonucleotide analogues
US6696038B1 (en) 2000-09-14 2004-02-24 Expression Genetics, Inc. Cationic lipopolymer as biocompatible gene delivery agent
US6783931B1 (en) 1990-01-11 2004-08-31 Isis Pharmaceuticals, Inc. Amine-derivatized nucleosides and oligonucleosides
US20040171980A1 (en) 1998-12-18 2004-09-02 Sontra Medical, Inc. Method and apparatus for enhancement of transdermal transport
US20040236268A1 (en) 1998-01-08 2004-11-25 Sontra Medical, Inc. Method and apparatus for enhancement of transdermal transport
US20050059005A1 (en) 2001-09-28 2005-03-17 Thomas Tuschl Microrna molecules
US20050222064A1 (en) 2002-02-20 2005-10-06 Sirna Therapeutics, Inc. Polycationic compositions for cellular delivery of polynucleotides
US20050261218A1 (en) 2003-07-31 2005-11-24 Christine Esau Oligomeric compounds and compositions for use in modulation small non-coding RNAs
US6998484B2 (en) 2000-10-04 2006-02-14 Santaris Pharma A/S Synthesis of purine locked nucleic acid analogues
US7037646B1 (en) 1990-01-11 2006-05-02 Isis Pharmaceuticals, Inc. Amine-derivatized nucleosides and oligonucleosides
US7053207B2 (en) 1999-05-04 2006-05-30 Exiqon A/S L-ribo-LNA analogues
US7084125B2 (en) 1999-03-18 2006-08-01 Exiqon A/S Xylo-LNA analogues
US20070117112A1 (en) 2005-06-30 2007-05-24 Diener John L Materials and methods for the generation of fully 2'-modified nucleic acid transcripts
US7361903B2 (en) 2004-09-01 2008-04-22 Koninklijke Philips Electronics N.V. Image system with non-circular patient aperture
US7374930B2 (en) 2002-05-21 2008-05-20 Expression Genetics, Inc. GLP-1 gene delivery for the treatment of type 2 diabetes
US7385034B2 (en) 1998-12-22 2008-06-10 Serono Genetics Institute S.A. Complementary DNAs encoding proteins with signal peptides
WO2008078180A2 (en) 2006-12-22 2008-07-03 Archemix Corp. Materials and methods for the generation of transcripts comprising modified nucleotides
US20080166414A1 (en) 2004-01-28 2008-07-10 Johns Hopkins University Drugs And Gene Carrier Particles That Rapidly Move Through Mucous Barriers
US7399845B2 (en) 2006-01-27 2008-07-15 Isis Pharmaceuticals, Inc. 6-modified bicyclic nucleic acid analogs
US7404969B2 (en) 2005-02-14 2008-07-29 Sirna Therapeutics, Inc. Lipid nanoparticle based compositions and methods for the delivery of biologically active molecules
US7413875B2 (en) 1999-08-05 2008-08-19 Serono Genetics Institute S.A. ESTs and encoded human proteins
WO2008103276A2 (en) 2007-02-16 2008-08-28 Merck & Co., Inc. Compositions and methods for potentiated activity of biologicaly active molecules
WO2008121949A1 (en) 2007-03-30 2008-10-09 Bind Biosciences, Inc. Cancer cell targeting using nanoparticles
US20080275468A1 (en) 2007-04-27 2008-11-06 Echo Therapeutics, Inc. Skin permeation device for analyte sensing or transdermal drug delivery
US20090042825A1 (en) 2007-08-06 2009-02-12 Majed Matar Composition, method of preparation & application of concentrated formulations of condensed nucleic acids with a cationic lipopolymer
US20100004315A1 (en) 2008-03-14 2010-01-07 Gregory Slobodkin Biodegradable Cross-Linked Branched Poly(Alkylene Imines)
US20100003337A1 (en) 2004-12-10 2010-01-07 Justin Hanes Functionalized poly(ether-anhydride) block copolymers
US20100004313A1 (en) 2008-02-29 2010-01-07 Tbd Modified Poloxamers for Gene Expression and Associated Methods
WO2010005725A2 (en) 2008-06-16 2010-01-14 Bind Biosciences, Inc. Therapeutic polymeric nanoparticles comprising vinca alkaloids and methods of making and using same
WO2010005740A2 (en) 2008-06-16 2010-01-14 Bind Biosciences, Inc. Methods for the preparation of targeting agent functionalized diblock copolymers for use in fabrication of therapeutic targeted nanoparticles
WO2010005723A2 (en) 2008-06-16 2010-01-14 Bind Biosciences, Inc. Drug loaded polymeric nanoparticles and methods of making and using same
WO2010005726A2 (en) 2008-06-16 2010-01-14 Bind Biosciences Inc. Therapeutic polymeric nanoparticles with mtor inhibitors and methods of making and using same
US20100009424A1 (en) 2008-07-14 2010-01-14 Natasha Forde Sonoporation systems and methods
US20100036115A1 (en) 1997-07-23 2010-02-11 Sirna Therapeutics, Inc. Novel Compositions for the Delivery of Negatively Charged Molecules
WO2010021865A1 (en) 2008-08-18 2010-02-25 Merck Sharp & Dohme Corp. Novel lipid nanoparticles and novel components for delivery of nucleic acids
WO2010030763A2 (en) 2008-09-10 2010-03-18 Bind Biosciences, Inc. High throughput fabrication of nanoparticles
US20100075072A1 (en) 2008-09-25 2010-03-25 Tsung-Wei Chen Decorative structure of tree-shaped bells
US20100120024A1 (en) 2005-06-30 2010-05-13 Sharon Cload Materials and methods for the generation of transcripts comprising modified nucleotides
US20100129877A1 (en) 2005-09-28 2010-05-27 Ugur Sahin Modification of RNA, Producing an Increased Transcript Stability and Translation Efficiency
WO2010080724A1 (en) 2009-01-12 2010-07-15 Merck Sharp & Dohme Corp. Novel lipid nanoparticles and novel components for delivery of nucleic acids
US20100196983A1 (en) 2009-02-05 2010-08-05 Ut-Battelle, Llc Transformation of gram positive bacteria by sonoporation
US20100215580A1 (en) 2006-09-08 2010-08-26 The Johns Hopkins University Compositions and methods for enhancing transport through mucus
US20100216804A1 (en) 2008-12-15 2010-08-26 Zale Stephen E Long Circulating Nanoparticles for Sustained Release of Therapeutic Agents
US20100260817A1 (en) 2009-03-20 2010-10-14 Egen, Inc. Polyamine Derivatives
WO2010123569A2 (en) 2009-04-21 2010-10-28 Selecta Biosciences, Inc. Immunonanotherapeutics providing a th1-biased response
WO2010129709A1 (en) 2009-05-05 2010-11-11 Alnylam Pharmaceuticals, Inc. Lipid compositions
US7833992B2 (en) 2001-05-18 2010-11-16 Merck Sharpe & Dohme Conjugates and compositions for cellular delivery
WO2010138193A2 (en) 2009-05-27 2010-12-02 Selecta Biosciences, Inc. Targeted synthetic nanocarriers with ph sensitive release of immunomodulatory agents
US20100324120A1 (en) 2009-06-10 2010-12-23 Jianxin Chen Lipid formulation
US7893302B2 (en) 2005-02-14 2011-02-22 Sirna Therapeutics, Inc. Lipid nanoparticle based compositions and methods for the delivery of biologically active molecules
WO2011022460A1 (en) 2009-08-20 2011-02-24 Merck Sharp & Dohme Corp. Novel cationic lipids with various head groups for oligonucleotide delivery
WO2011043913A2 (en) 2009-10-08 2011-04-14 Merck Sharp & Dohme Corp. Novel cationic lipids with short lipid chains for oligonucleotide delivery
WO2011072218A2 (en) 2009-12-11 2011-06-16 Bind Biosciences Stable formulations for lyophilizing therapeutic particles
US7964571B2 (en) 2004-12-09 2011-06-21 Egen, Inc. Combination of immuno gene therapy and chemotherapy for treatment of cancer and hyperproliferative diseases
US7964578B2 (en) 2001-05-18 2011-06-21 Sirna Therapeutics, Inc. Conjugates and compositions for cellular delivery
WO2011084521A2 (en) 2009-12-15 2011-07-14 Bind Biosciences, Inc. Therapeutic polymeric nanoparticles comprising epothilone and methods of making and using same
WO2011084513A2 (en) 2009-12-15 2011-07-14 Bind Biosciences, Inc. Therapeutic polymeric nanoparticle compositions with high glass transition temperature or high molecular weight copolymers
US20110171248A1 (en) 2010-01-08 2011-07-14 Selecta Biosciences, Inc. Synthetic virus-like particles conjugated to human papillomavirus capsid peptides for use as vaccines
WO2011084518A2 (en) 2009-12-15 2011-07-14 Bind Biosciences, Inc. Therapeutic polymeric nanoparticles comprising corticosteroids and methods of making and using same
WO2011090965A1 (en) 2010-01-22 2011-07-28 Merck Sharp & Dohme Corp. Novel cationic lipids for oligonucleotide delivery
US7994304B2 (en) 2005-11-22 2011-08-09 Helicos Biosciences Corporation Methods and compositions for sequencing a nucleic acid
WO2011115862A1 (en) 2010-03-18 2011-09-22 Merck Sharp & Dohme Corp. Endosomolytic poly(amidoamine) disulfide polymers for the delivery of oligonucleotides
WO2011127255A1 (en) 2010-04-08 2011-10-13 Merck Sharp & Dohme Corp. Preparation of lipid nanoparticles
US20110262491A1 (en) 2010-04-12 2011-10-27 Selecta Biosciences, Inc. Emulsions and methods of making nanocarriers
US8057821B2 (en) 2004-11-03 2011-11-15 Egen, Inc. Biodegradable cross-linked cationic multi-block copolymers for gene delivery and methods of making thereof
WO2011149733A2 (en) 2010-05-24 2011-12-01 Merck Sharp & Dohme Corp. Novel amino alcohol cationic lipids for oligonucleotide delivery
WO2011153120A1 (en) 2010-06-04 2011-12-08 Merck Sharp & Dohme Corp. Novel low molecular weight cationic lipids for oligonucleotide delivery
WO2012006376A2 (en) 2010-07-06 2012-01-12 Novartis Ag Virion-like delivery particles for self-replicating rna molecules
US8124379B2 (en) 2004-06-14 2012-02-28 Novozymes A/S Signal peptide for producing a polypeptide
WO2012040184A2 (en) 2010-09-20 2012-03-29 Merck Sharp & Dohme Corp. Novel low molecular weight cationic lipids for oligonucleotide delivery
WO2012044638A1 (en) 2010-09-30 2012-04-05 Merck Sharp & Dohme Corp. Low molecular weight cationic lipids for oligonucleotide delivery
WO2012054923A2 (en) 2010-10-22 2012-04-26 Bind Biosciences, Inc. Therapeutic nanoparticles with high molecular weight copolymers
WO2012054365A2 (en) 2010-10-21 2012-04-26 Merck Sharp & Dohme Corp. Novel low molecular weight cationic lipids for oligonucleotide delivery
WO2012061259A2 (en) 2010-11-05 2012-05-10 Merck Sharp & Dohme Corp. Novel low molecular weight cyclic amine containing cationic lipids for oligonucleotide delivery
US20120121718A1 (en) 2010-11-05 2012-05-17 The Johns Hopkins University Compositions and methods relating to reduced mucoadhesion
WO2012068187A1 (en) 2010-11-19 2012-05-24 Merck Sharp & Dohme Corp. Poly(amide) polymers for the delivery of oligonucleotides
WO2012082574A1 (en) 2010-12-17 2012-06-21 Merck Sharp & Dohme Corp. Membrane lytic poly(amido amine) polymers for the delivery of oligonucleotides
US20120171229A1 (en) 2010-12-30 2012-07-05 Selecta Biosciences, Inc. Synthetic nanocarriers with reactive groups that release biologically active agents
WO2012094304A1 (en) 2011-01-04 2012-07-12 Brown University Nanotubes as carriers of nucleic acids into cells
US20120178702A1 (en) 1995-01-23 2012-07-12 University Of Pittsburgh Stable lipid-comprising drug delivery complexes and methods for their production
WO2012099805A2 (en) 2011-01-19 2012-07-26 Ocean Nanotech, Llc Nanoparticle based immunological stimulation
WO2012099755A1 (en) 2011-01-11 2012-07-26 Alnylam Pharmaceuticals, Inc. Pegylated lipids and their use for drug delivery
US20130115272A1 (en) 2011-10-03 2013-05-09 modeRNA Therapeutics Modified nucleosides, nucleotides, and nucleic acids, and uses thereof
WO2013086502A1 (en) 2011-12-09 2013-06-13 President And Fellows Of Harvard College Organ chips and uses thereof
WO2013086505A1 (en) 2011-12-09 2013-06-13 Vanderbilt University Integrated organ-on-chip system and applications of the same
WO2013086486A1 (en) 2011-12-09 2013-06-13 President And Fellows Of Harvard College Integrated human organ-on-chip microphysiological systems
WO2013090648A1 (en) 2011-12-16 2013-06-20 modeRNA Therapeutics Modified nucleoside, nucleotide, and nucleic acid compositions
WO2013102203A1 (en) 2011-12-30 2013-07-04 Cellscript, Inc. MAKING AND USING IN VITRO-SYNTHESIZED ssRNA FOR INTRODUCING INTO MAMMALIAN CELLS TO INDUCE A BIOLOGICAL OR BIOCHEMICAL EFFECT
US20130259924A1 (en) 2012-04-02 2013-10-03 modeRNA Therapeutics Modified polynucleotides for the production of biologics and proteins associated with human disease

Family Cites Families (229)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5034506A (en) 1985-03-15 1991-07-23 Anti-Gene Development Group Uncharged morpholino-based polymers having achiral intersubunit linkages
US5759802A (en) 1988-10-26 1998-06-02 Tonen Corporation Production of human serum alubumin A
US5451463A (en) 1989-08-28 1995-09-19 Clontech Laboratories, Inc. Non-nucleoside 1,3-diol reagents for labeling synthetic oligonucleotides
AU638762B2 (en) 1989-10-05 1993-07-08 Optein Inc Cell-free synthesis and isolation of novel genes and polypeptides
CA2028849A1 (en) 1990-03-08 1991-09-09 Michinao Mizugaki Monoclonal antibodies, assay method, reagent kit, sarching method and drug missiles using them
US5637459A (en) 1990-06-11 1997-06-10 Nexstar Pharmaceuticals, Inc. Systematic evolution of ligands by exponential enrichment: chimeric selex
US5489677A (en) 1990-07-27 1996-02-06 Isis Pharmaceuticals, Inc. Oligonucleoside linkages containing adjacent oxygen and nitrogen atoms
US5602240A (en) 1990-07-27 1997-02-11 Ciba Geigy Ag. Backbone modified oligonucleotide analogs
US5426180A (en) 1991-03-27 1995-06-20 Research Corporation Technologies, Inc. Methods of making single-stranded circular oligonucleotides
US5437976A (en) 1991-08-08 1995-08-01 Arizona Board Of Regents, The University Of Arizona Multi-domain DNA ligands bound to a solid matrix for protein and nucleic acid affinity chromatography and processing of solid-phase DNA
JP3131222B2 (en) 1991-12-24 2001-01-31 アイシス・ファーマシューティカルス・インコーポレーテッド 2 'modified oligonucleotide having a gap
FR2733762B1 (en) 1995-05-02 1997-08-01 Genset Sa METHOD FOR THE SPECIFIC COUPLING OF THE HAIR OF THE 5 'END OF A RNAM FRAGMENT AND PREPARATION OF RNAM AND COMPLETE DNA
US5808039A (en) 1995-10-18 1998-09-15 Beckman Instruments, Inc. 2'-OMe CAC phosphoramidite and methods for preparation and use thereof
US5871697A (en) 1995-10-24 1999-02-16 Curagen Corporation Method and apparatus for identifying, classifying, or quantifying DNA sequences in a sample without sequencing
US6022737A (en) 1995-11-02 2000-02-08 Amgen Inc. Formulations for non-viral in vivo transfection in the lungs
US5789578A (en) 1996-01-11 1998-08-04 Massey University Methods for the preparation of resins with ligands attached thereto through a linking group comprising sulfide, sulfoxide or sulfone functionality
US7291463B2 (en) 1996-01-23 2007-11-06 Affymetrix, Inc. Nucleic acid labeling compounds
US6475388B1 (en) 1996-11-13 2002-11-05 Transgenomic, Inc. Method and system for RNA analysis by matched ion polynucleotide chromatography
GB2324370B (en) 1997-04-14 1999-03-03 Stuart Harbron Detection of hybrid double-stranded DNA with antibody after enzyme degradation of excess single-standed DNA
US5989911A (en) 1997-05-09 1999-11-23 University Of Massachusetts Site-specific synthesis of pseudouridine in RNA
US6303378B1 (en) 1997-10-24 2001-10-16 Valentis, Inc. Methods for preparing polynucleotide transfection complexes
US5955310A (en) 1998-02-26 1999-09-21 Novo Nordisk Biotech, Inc. Methods for producing a polypeptide in a bacillus cell
US6248268B1 (en) 1998-11-16 2001-06-19 Xc Corporation Process of making microparticles of a thermally-gelled polysaccharide
CA2361201A1 (en) 1999-01-28 2000-08-03 Medical College Of Georgia Research Institute, Inc. Composition and method for in vivo and in vitro attenuation of gene expression using double stranded rna
US8410248B2 (en) 1999-03-12 2013-04-02 Human Genome Sciences Inc. HWBAO62 polypeptides
US6270970B1 (en) 1999-05-14 2001-08-07 Promega Corporation Mixed-bed solid phase and its use in the isolation of nucleic acids
ES2238799T3 (en) 1999-09-09 2005-09-01 Curevac Gmbh RNA-M TRANSFER.
CN1317291C (en) 1999-09-10 2007-05-23 杰龙公司 Oligonucleotide N3'-P5' thiophosphoramidates, their synthesis and use
US6511832B1 (en) 1999-10-06 2003-01-28 Texas A&M University System In vitro synthesis of capped and polyadenylated mRNAs using baculovirus RNA polymerase
US6818739B2 (en) 1999-12-03 2004-11-16 Ndsu Research Foundation Somatostatins
WO2001055306A2 (en) 2000-01-31 2001-08-02 Human Genome Sciences, Inc. Nucleic acids, proteins, and antibodies
WO2001055301A2 (en) 2000-01-31 2001-08-02 Human Genome Sciences, Inc. Nucleic acids, proteins, and antibodies
WO2001075166A2 (en) 2000-03-31 2001-10-11 Genentech, Inc. Compositions and methods for detecting and quantifying gene expression
WO2002000677A1 (en) 2000-06-07 2002-01-03 Human Genome Sciences, Inc. Nucleic acids, proteins, and antibodies
AU2001292561A1 (en) 2000-09-01 2002-03-13 Hyseq, Inc. Nucleic acids and polypeptides
US20040142474A1 (en) 2000-09-14 2004-07-22 Expression Genetics, Inc. Novel cationic lipopolymer as a biocompatible gene delivery agent
US6521411B2 (en) 2000-09-28 2003-02-18 Transgenomic, Inc. Method and system for the preparation of cDNA
WO2002044399A2 (en) 2000-11-28 2002-06-06 Rosetta Inpharmatics, Inc. In vitro transcription method for rna amplification
US20020130430A1 (en) 2000-12-29 2002-09-19 Castor Trevor Percival Methods for making polymer microspheres/nanospheres and encapsulating therapeutic proteins and other products
US20040142433A1 (en) 2001-02-02 2004-07-22 Padgett Hal S. Polynucleotide sequence variants
US7211654B2 (en) 2001-03-14 2007-05-01 Regents Of The University Of Michigan Linkers and co-coupling agents for optimization of oligonucleotide synthesis and purification on solid supports
US20050235369A1 (en) 2001-03-28 2005-10-20 Yen Choo Gene regulation II
ES2295351T3 (en) 2001-04-21 2008-04-16 Curevac Gmbh DEVICE FOR INJECTION OF RNAM.
EP1383887A4 (en) 2001-05-03 2004-07-07 Rensselaer Polytech Inst NEW DIRECTED EVOLUTION METHODS
US20030170891A1 (en) 2001-06-06 2003-09-11 Mcswiggen James A. RNA interference mediated inhibition of epidermal growth factor receptor gene expression using short interfering nucleic acid (siNA)
ES2340499T3 (en) 2001-06-05 2010-06-04 Curevac Gmbh TUMOR ANTIGEN ARNM STABILIZED WITH AN INCREASED G / C CONTENT.
US7235358B2 (en) * 2001-06-08 2007-06-26 Expression Diagnostics, Inc. Methods and compositions for diagnosing and monitoring transplant rejection
US20040142325A1 (en) 2001-09-14 2004-07-22 Liat Mintz Methods and systems for annotating biomolecular sequences
AU2002338926B2 (en) 2001-11-05 2007-05-24 Janssen Pharmaceutica N.V. Method for the in vitro synthesis of short double stranded RNAs
WO2003039523A2 (en) 2001-11-05 2003-05-15 Exiqon A/S OLIGONUCLEOTIDES MODIFIED WITH NOVEL α-L-RNA ANALOGUES
US20040076978A1 (en) 2001-11-14 2004-04-22 Catherine Verfaillie Method to identify genes associated with chronic myelogenous leukemia
WO2003051881A1 (en) 2001-12-17 2003-06-26 Ribapharm Inc. Substituted purine nucleoside libraries and compounds by solid-phase combinatorial strategies
DE10162480A1 (en) 2001-12-19 2003-08-07 Ingmar Hoerr The application of mRNA for use as a therapeutic agent against tumor diseases
AU2002366713A1 (en) 2001-12-20 2003-07-09 Incyte Genomics, Inc. Nucleotide polymorphisms associated with osteoarthritis
US7285394B2 (en) 2002-03-15 2007-10-23 Epigenomics Ag Discovery and diagnostic methods using 5-methylcytosine DNA glycosylase
ATE432347T1 (en) 2002-06-24 2009-06-15 Exiqon As METHODS AND SYSTEMS FOR DETECTION AND ISOLATION OF NUCLEIC ACID SEQUENCES
AU2003264041A1 (en) 2002-08-09 2004-02-25 California Institute Of Technology Method and compositions relating to 5'-chimeric ribonucleic acids
WO2004015062A2 (en) 2002-08-12 2004-02-19 New England Biolabs, Inc. Methods and compositions relating to gene silencing
KR100521309B1 (en) 2002-08-31 2005-10-14 씨제이 주식회사 Glycosylated Human Granulocyte Colony Stimulating Factor(G-CSF)
AU2003264844A1 (en) 2002-09-24 2004-04-19 Yissum Research Development Company Of The Hebrew University Of Jerusalem Methods of determining the effect of an agent on diploid cells and/or on the pattern of expression of polypeptides expressed therewith
WO2004042054A1 (en) 2002-10-23 2004-05-21 Hubit Genomix, Inc. Genetic morphisms relating to periodontal diseases
US20050042623A1 (en) 2002-10-30 2005-02-24 Dana Ault-Riche Systems for capture and analysis of biological particles and methods using the systems
CA2512484A1 (en) 2003-01-16 2004-05-08 Hybridon, Inc. Modulation of immunostimulatory properties of oligonucleotide-based compounds by utilizing modified immunostimulatory dinucleotides
WO2004082703A1 (en) 2003-03-20 2004-09-30 Keiichi Fukuda Combined use of g-csf with angiogenetic factor
US8158354B2 (en) 2003-05-13 2012-04-17 Ibis Biosciences, Inc. Methods for rapid purification of nucleic acids for subsequent analysis by mass spectrometry by solution capture
US20060182736A1 (en) 2003-06-10 2006-08-17 Kim Jin-Soo Transducible dna-binding proteins
JP4567683B2 (en) 2003-09-12 2010-10-20 セダーズ−シナイ メディカル センター Antisense inhibition of laminin-8 expression to inhibit human glioma
AU2004275876B2 (en) 2003-09-25 2011-03-31 Coley Pharmaceutical Gmbh Nucleic acid-lipophilic conjugates
CA3059497A1 (en) 2003-12-03 2005-06-16 Ocunexus Therapeutics, Inc. Antisense compounds targeted to connexins and methods of use thereof
KR20070052694A (en) 2004-01-09 2007-05-22 더 리젠트스 오브 더 유니이버시티 오브 캘리포니아 Cell-type-specific pattern for gene expression
DE102004035227A1 (en) 2004-07-21 2006-02-16 Curevac Gmbh mRNA mixture for vaccination against tumor diseases
EP1791567B1 (en) 2004-08-10 2015-07-29 Alnylam Pharmaceuticals Inc. Chemically modified oligonucleotides
EP1789094B1 (en) 2004-08-13 2014-12-10 MARSHALL, Barry J. Bacterial delivery system
EP1789447B1 (en) 2004-08-16 2012-04-25 Immune Disease Institute, Inc. Method of delivering rna interference and uses thereof
EP2338994B1 (en) 2004-09-02 2014-03-19 Yale University Regulation of oncogenes by microRNAs
WO2006053131A1 (en) 2004-11-11 2006-05-18 Modular Genetics, Inc. Ladder assembly and system for generating diversity
FR2880345A1 (en) 2004-12-30 2006-07-07 Adisseo Ireland Ltd SYNTHESIS AND APPLICATIONS OF 2-OXO-4-METHYLTHIOBUTYRIC ACID, ITS SUCH AND ITS DERIVATIVES
WO2007024798A2 (en) 2005-08-22 2007-03-01 Applera Corporation Apparatus, system, and method using immiscible-fluid-discrete-volumes
US9012219B2 (en) 2005-08-23 2015-04-21 The Trustees Of The University Of Pennsylvania RNA preparations comprising purified modified RNA for reprogramming cells
PL2578685T3 (en) 2005-08-23 2020-01-31 The Trustees Of The University Of Pennsylvania Rna containing modified nucleosides and methods of use thereof
US9157066B2 (en) 2005-12-13 2015-10-13 The Trustees Of The University Of Pennsylvania Transcriptome transfer produces cellular phenotype conversion
US20070161031A1 (en) 2005-12-16 2007-07-12 The Board Of Trustees Of The Leland Stanford Junior University Functional arrays for high throughput characterization of gene expression regulatory elements
WO2007089607A2 (en) 2006-01-26 2007-08-09 University Of Massachusetts Rna silencing agents for use in therapy and nanotransporters for efficient delivery of same
EP2010659B1 (en) 2006-04-14 2014-06-18 CellScript, Inc. Kits and methods for generating 5' capped RNA
EP2295045A1 (en) 2006-07-07 2011-03-16 Aarhus Universitet Nanoparticles for nucleic acid delivery
US8304529B2 (en) 2006-07-28 2012-11-06 Life Technologies Corporation Dinucleotide MRNA cap analogs
ES2911034T3 (en) 2006-08-08 2022-05-17 Univ Bonn Rheinische Friedrich Wilhelms Structure and use of 5' phosphate oligonucleotides
GB2445441B (en) 2006-09-26 2010-06-30 Ge Healthcare Bio Sciences Nucleic acid purification method
US9163229B2 (en) 2006-10-10 2015-10-20 Trovagene, Inc. Compositions, methods and kits for isolating nucleic acids from body fluids using anion exchange media
DE102006051516A1 (en) 2006-10-31 2008-05-08 Curevac Gmbh (Base) modified RNA to increase the expression of a protein
DE102006061015A1 (en) 2006-12-22 2008-06-26 Curevac Gmbh Process for the purification of RNA on a preparative scale by HPLC
DE102007001370A1 (en) 2007-01-09 2008-07-10 Curevac Gmbh RNA-encoded antibodies
EP2135080A4 (en) 2007-03-08 2010-12-01 Switchgear Genomics FUNCTIONAL ARRAYS FOR CHARACTERIZATION WITH HIGH PASSAGE OF REGULATORY ELEMENTS IN NONTRANSLATED SURFACES OF GENES
GB0706243D0 (en) 2007-03-30 2007-05-09 Univ Southampton Modified nucleic acids
US7682789B2 (en) 2007-05-04 2010-03-23 Ventana Medical Systems, Inc. Method for quantifying biomolecules conjugated to a nanoparticle
US20080311140A1 (en) 2007-05-29 2008-12-18 Baylor College Of Medicine Antigen specific immunosuppression by dendritic cell therapy
WO2009030254A1 (en) 2007-09-04 2009-03-12 Curevac Gmbh Complexes of rna and cationic peptides for transfection and for immunostimulation
CA2715078C (en) * 2007-09-26 2019-07-23 Intrexon Corporation Synthetic 5'utrs, expression vectors, and methods for increasing transgene expression
WO2009058911A2 (en) 2007-10-31 2009-05-07 Applied Biosystems Inc. Preparation and isolation of 5' capped mrna
CA2707042A1 (en) 2007-12-10 2009-06-18 Alnylam Pharmaceuticals, Inc. Compositions and methods for inhibiting expression of factor vii gene
WO2009074968A2 (en) 2007-12-12 2009-06-18 Ecole Polytechnique Federale De Lausanne (Epfl) Method for predicting the efficacy of cancer therapy
WO2009117167A1 (en) 2008-01-02 2009-09-24 Blood Cell Storage, Inc. Devices and processes for nucleic acid extraction
DK2176408T5 (en) 2008-01-31 2015-12-14 Curevac Gmbh Nucleic acids comprising FORMULA (NuGiXmGnNv) a AND DERIVATIVES AS IMMUNE STIMULATING AGENTS / ADJUVANTS.
US20110130440A1 (en) 2008-03-26 2011-06-02 Alnylam Pharmaceuticals, Inc. Non-natural ribonucleotides, and methods of use thereof
CA2721333C (en) 2008-04-15 2020-12-01 Protiva Biotherapeutics, Inc. Novel lipid formulations for nucleic acid delivery
WO2009127230A1 (en) 2008-04-16 2009-10-22 Curevac Gmbh MODIFIED (m)RNA FOR SUPPRESSING OR AVOIDING AN IMMUNOSTIMULATORY RESPONSE AND IMMUNOSUPPRESSIVE COMPOSITION
WO2009147519A1 (en) 2008-06-06 2009-12-10 Centre National De La Recherche Scientifique - Cnrs- Use of endo-lysosomal system and secreted vesicles (exosome-like) in treatments and diagnostics based on small rna and experimental study of small rna
PL215513B1 (en) 2008-06-06 2013-12-31 Univ Warszawski New borane phosphate analogs of dinucleotides, their application, RNA particle, method of obtaining RNA and method of obtaining peptides or protein
JP4642922B2 (en) 2008-07-24 2011-03-02 明治製菓株式会社 Pyripyropene A biosynthetic gene
TW201004658A (en) 2008-07-31 2010-02-01 Enzon Pharmaceuticals Inc Nanoparticle compositions for nucleic acids delivery system
CN105030809A (en) 2008-08-01 2015-11-11 协和发酵麒麟株式会社 Composition for inhibiting expression of target gene
US20110201103A1 (en) 2008-08-07 2011-08-18 University Of Southern California System For Synergetic Expression Of Multiple Small Functional RNA Elements
WO2010037408A1 (en) 2008-09-30 2010-04-08 Curevac Gmbh Composition comprising a complexed (m)rna and a naked mrna for providing or enhancing an immunostimulatory response in a mammal and uses thereof
EP3269395A1 (en) 2008-11-07 2018-01-17 Massachusetts Institute Of Technology Aminoalcohol lipidoids and uses thereof
US8367330B2 (en) 2008-12-22 2013-02-05 Quest Diagnostics Investments Incorporated Methods for detecting TCR-gamma gene rearrangement
AU2010227247B2 (en) 2009-03-24 2015-10-22 Council Of Scientific & Industrial Research Process for the preparation of agarose polymer from seaweed extractive
JP2012523236A (en) 2009-04-09 2012-10-04 カリフォルニア インスティチュート オブ テクノロジー Multiple sites for polymer synthesis
WO2010123501A1 (en) * 2009-04-22 2010-10-28 Massachusetts Institute Of Technology Innate immune suppression enables repeated delivery of long rna molecules
EP3028707A1 (en) 2009-05-01 2016-06-08 Ophthotech Corporation Methods for treating or preventing ophthalmological diseases
US8765370B2 (en) 2009-06-11 2014-07-01 Scinopharm Taiwan, Ltd Inhibition-based high-throughput screen strategy for cell clones
EP3058953A1 (en) 2009-07-07 2016-08-24 The Research Foundation Of State University Of New York Lipidic compositions for induction of immune tolerance
US9512164B2 (en) 2009-07-07 2016-12-06 Alnylam Pharmaceuticals, Inc. Oligonucleotide end caps
AU2010273220B2 (en) 2009-07-13 2015-10-15 President And Fellows Of Harvard College Bifunctional stapled polypeptides and uses thereof
CA2769670C (en) 2009-07-31 2018-10-02 Ethris Gmbh Rna with a combination of unmodified and modified nucleotides for protein expression
US8598327B2 (en) 2009-08-18 2013-12-03 Baxter International Inc. Aptamers to tissue factor pathway inhibitor and their use as bleeding disorder therapeutics
GB2473814B (en) 2009-09-16 2014-06-11 Spheritech Ltd Hollow particulate support
CN107028886A (en) 2009-11-04 2017-08-11 不列颠哥伦比亚大学 Lipid particle and related methods containing nucleic acid
EP3318248B1 (en) 2009-12-01 2019-04-10 Translate Bio, Inc. Delivery of mrna for the augmentation of proteins and enzymes in human genetic diseases
US8808982B2 (en) 2009-12-07 2014-08-19 Cellscript, Llc Compositions and methods for reprogramming eukaryotic cells
EP2518144B1 (en) 2009-12-21 2015-08-05 Hiroshima University Aging marker, method for evaluating aging inhibitor, and cancer inhibitor
JP2011130725A (en) 2009-12-25 2011-07-07 Contig I:Kk Lna oligonucleotide and cosmetic containing the same
WO2011104032A1 (en) 2010-02-26 2011-09-01 Qiagen Gmbh Method for isolating rna from a rna and dna containing sample
US20110218170A1 (en) 2010-03-02 2011-09-08 Southern Research Institute Use of 2'-deoxy-4'-thiocytidine and its analogues as dna hypomethylating anticancer agents
EP3540059A1 (en) 2010-04-16 2019-09-18 Nuevolution A/S Bi-functional complexes and methods for making and using such complexes
EP2377938A1 (en) 2010-04-16 2011-10-19 Eukarys Capping-prone RNA polymerase enzymes and their applications
US8802438B2 (en) 2010-04-16 2014-08-12 Children's Medical Center Corporation Compositions, kits, and methods for making induced pluripotent stem cells using synthetic modified RNAs
WO2011133868A2 (en) 2010-04-22 2011-10-27 Alnylam Pharmaceuticals, Inc. Conformationally restricted dinucleotide monomers and oligonucleotides
CA2800728C (en) 2010-05-28 2020-10-27 Genentech, Inc. Decreasing lactate level and increasing polypeptide production by downregulating the expression of lactate dehydrogenase and pyruvate dehydrogenase kinase
WO2012019168A2 (en) 2010-08-06 2012-02-09 Moderna Therapeutics, Inc. Engineered nucleic acids and methods of use thereof
LT4226941T (en) 2010-08-31 2025-01-10 Glaxosmithkline Biologicals Sa Pegylated liposomes for delivery of immunogen-encoding rna
EP2625189B1 (en) 2010-10-01 2018-06-27 ModernaTX, Inc. Engineered nucleic acids and methods of use thereof
US8898864B1 (en) 2010-10-08 2014-12-02 David Porter Integrated rockably released leverage snap fastening system
DE102011082231A1 (en) 2011-01-12 2012-07-12 Robert Bosch Gmbh Ignition coil, especially for small engines
AU2012236099A1 (en) 2011-03-31 2013-10-03 Moderna Therapeutics, Inc. Delivery and formulation of engineered nucleic acids
EP2694524B1 (en) 2011-04-04 2016-05-18 The U.S.A. As Represented By The Secretary, Department Of Health And Human Services 2'-o-aminooxymethyl nucleoside derivatives for use in the synthesis and modification of nucleosides, nucleotides and oligonucleotides
US8691750B2 (en) 2011-05-17 2014-04-08 Axolabs Gmbh Lipids and compositions for intracellular delivery of biologically active compounds
CA2835428A1 (en) 2011-05-17 2012-11-22 Moderna Therapeutics, Inc. Engineered nucleic acids and methods of use thereof for non-human vertebrates
WO2012164565A1 (en) * 2011-06-01 2012-12-06 Yeda Research And Development Co. Ltd. Compositions and methods for downregulating prokaryotic genes
US20130046083A1 (en) 2011-08-16 2013-02-21 Tom Brown Oligonucleotide ligation
US8846883B2 (en) 2011-08-16 2014-09-30 University Of Southhampton Oligonucleotide ligation
WO2013036301A1 (en) 2011-09-06 2013-03-14 Selecta Biosciences, Inc. Induced tolerogenic dendritic cells for inducing regulatory b cells
WO2013036748A1 (en) 2011-09-09 2013-03-14 Berry, Lana, L. Bicyclo[6.1.0]non-4-yne reagents for chemical modification of oligonucleotides
WO2013039861A2 (en) 2011-09-12 2013-03-21 modeRNA Therapeutics Engineered nucleic acids and methods of use thereof
EP2755986A4 (en) 2011-09-12 2015-05-20 Moderna Therapeutics Inc MODIFIED NUCLEIC ACIDS AND METHODS OF USE
US9464124B2 (en) 2011-09-12 2016-10-11 Moderna Therapeutics, Inc. Engineered nucleic acids and methods of use thereof
US9579338B2 (en) * 2011-11-04 2017-02-28 Nitto Denko Corporation Method of producing lipid nanoparticles for drug delivery
EP3485875A1 (en) * 2011-11-04 2019-05-22 Nitto Denko Corporation Single use system for sterelily producing lipid-nucleic acid particles
WO2013071047A1 (en) 2011-11-11 2013-05-16 Children's Medical Center Corporation Compositions and methods for in vitro transcription of rna
US8450107B1 (en) 2011-11-30 2013-05-28 The Broad Institute Inc. Nucleotide-specific recognition sequences for designer TAL effectors
WO2013086354A1 (en) 2011-12-07 2013-06-13 Alnylam Pharmaceuticals, Inc. Biodegradable lipids for the delivery of active agents
JP6407028B2 (en) 2011-12-12 2018-10-17 ザ トラスティーズ オブ ザ ユニバーシティ オブ ペンシルバニア Protein containing MRSA PBP2a and fragments thereof, nucleic acid encoding the same, composition for preventing and treating MRSA infection and use thereof
WO2013090186A1 (en) 2011-12-14 2013-06-20 modeRNA Therapeutics Modified nucleic acids, and acute care uses thereof
WO2013130161A1 (en) 2011-12-14 2013-09-06 modeRNA Therapeutics Methods of responding to a biothreat
WO2013090897A1 (en) 2011-12-15 2013-06-20 The Trustees Of The University Of Pennsylvania Using adaptive immunity to detect drug resistance
CN104968354A (en) 2011-12-21 2015-10-07 现代治疗公司 Methods of increasing the viability or longevity of an organ or organ explant
WO2013101690A1 (en) 2011-12-29 2013-07-04 modeRNA Therapeutics Modified mrnas encoding cell-penetrating polypeptides
WO2013103659A1 (en) 2012-01-04 2013-07-11 Board Of Supervisors Of Louisiana State University And Agricultural And Mechanical College Stabilizing rna by incorporating chain-terminating nucleosides at the 3'-terminus
US20150030576A1 (en) 2012-01-10 2015-01-29 Moderna Therapeutics, Inc. Methods and compositions for targeting agents into and across the blood-brain barrier
WO2013113326A1 (en) 2012-01-31 2013-08-08 Curevac Gmbh Pharmaceutical composition comprising a polymeric carrier cargo complex and at least one protein or peptide antigen
WO2013113325A1 (en) 2012-01-31 2013-08-08 Curevac Gmbh Negatively charged nucleic acid comprising complexes for immunostimulation
CN103325662B (en) 2012-03-21 2016-03-30 清华大学 The preparation method of semi-conductive single-walled carbon nanotubes
US20150050354A1 (en) 2012-04-02 2015-02-19 Moderna Therapeutics, Inc. Modified polynucleotides for the treatment of otic diseases and conditions
CN104411338A (en) 2012-04-02 2015-03-11 现代治疗公司 Modified polynucleotides for the production of biologics and proteins associated with human disease
US9254311B2 (en) 2012-04-02 2016-02-09 Moderna Therapeutics, Inc. Modified polynucleotides for the production of proteins
EP2647426A1 (en) 2012-04-03 2013-10-09 Max-Planck-Gesellschaft zur Förderung der Wissenschaften e.V. Replication of distributed nucleic acid molecules with preservation of their relative distribution through hybridization-based binding
WO2013184976A2 (en) 2012-06-06 2013-12-12 Northwestern University Compositions and methods for antigen-specific tolerance
EP2858679B2 (en) 2012-06-08 2024-06-05 Translate Bio, Inc. Pulmonary delivery of mrna to non-lung target cells
WO2014028429A2 (en) 2012-08-14 2014-02-20 Moderna Therapeutics, Inc. Enzymes and polymerases for the synthesis of rna
WO2014093924A1 (en) 2012-12-13 2014-06-19 Moderna Therapeutics, Inc. Modified nucleic acid molecules and uses thereof
PL2922554T3 (en) 2012-11-26 2022-06-20 Modernatx, Inc. Terminally modified rna
IL239344B2 (en) * 2012-12-12 2024-06-01 Broad Inst Inc Engineering of systems, methods and optimized guide compositions for sequence manipulation
EP3031921B1 (en) * 2012-12-12 2025-03-12 The Broad Institute, Inc. Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications
WO2014093574A1 (en) 2012-12-13 2014-06-19 Moderna Therapeutics, Inc. Modified polynucleotides for altering cell phenotype
AU2013374345A1 (en) 2013-01-17 2015-08-06 Moderna Therapeutics, Inc. Signal-sensor polynucleotides for the alteration of cellular phenotypes
US20160022840A1 (en) 2013-03-09 2016-01-28 Moderna Therapeutics, Inc. Heterologous untranslated regions for mrna
WO2014160284A1 (en) 2013-03-14 2014-10-02 The Trustees Of The University Of Pennsylvania Compositions and methods for treatment of stroke
EP3750903A1 (en) 2013-03-14 2020-12-16 Translate Bio, Inc. Ribonucleic acids with 4'-thio-modified nucleotides and related methods
WO2014152211A1 (en) 2013-03-14 2014-09-25 Moderna Therapeutics, Inc. Formulation and delivery of modified nucleoside, nucleotide, and nucleic acid compositions
US20160032316A1 (en) 2013-03-14 2016-02-04 The Trustees Of The University Of Pennsylvania Purification and Purity Assessment of RNA Molecules Synthesized with Modified Nucleosides
US10590161B2 (en) 2013-03-15 2020-03-17 Modernatx, Inc. Ion exchange purification of mRNA
WO2014152027A1 (en) 2013-03-15 2014-09-25 Moderna Therapeutics, Inc. Manufacturing methods for production of rna transcripts
US8980864B2 (en) 2013-03-15 2015-03-17 Moderna Therapeutics, Inc. Compositions and methods of altering cholesterol levels
WO2014152031A1 (en) 2013-03-15 2014-09-25 Moderna Therapeutics, Inc. Ribonucleic acid purification
US20160017313A1 (en) 2013-03-15 2016-01-21 Moderna Therapeutics, Inc. Analysis of mrna heterogeneity and stability
WO2014144039A1 (en) 2013-03-15 2014-09-18 Moderna Therapeutics, Inc. Characterization of mrna molecules
US20140273230A1 (en) * 2013-03-15 2014-09-18 Sigma-Aldrich Co., Llc Crispr-based genome modification and regulation
EP2971165A4 (en) 2013-03-15 2016-11-23 Moderna Therapeutics Inc ELIMINATING DNA FRAGMENTS IN METHODS OF PRODUCING MRNA
EP4286517A3 (en) 2013-04-04 2024-03-13 President and Fellows of Harvard College Therapeutic uses of genome editing with crispr/cas systems
EP3019595A4 (en) 2013-07-09 2016-11-30 THERAPEUTIC USES OF GENOME EDITING WITH CRISPR / CAS SYSTEMS
CA2917348A1 (en) 2013-07-11 2015-01-15 Moderna Therapeutics, Inc. Compositions comprising synthetic polynucleotides encoding crispr related proteins and synthetic sgrnas and methods of use
CA2921556A1 (en) 2013-08-16 2015-02-19 Rana Therapeutics, Inc. Compositions and methods for modulating rna
EP3041934A1 (en) 2013-09-03 2016-07-13 Moderna Therapeutics, Inc. Chimeric polynucleotides
WO2015034925A1 (en) 2013-09-03 2015-03-12 Moderna Therapeutics, Inc. Circular polynucleotides
WO2015038892A1 (en) 2013-09-13 2015-03-19 Moderna Therapeutics, Inc. Polynucleotide compositions containing amino acids
GB201317301D0 (en) 2013-09-30 2013-11-13 Linnarsson Sten Method for capturing and encoding nucleic acid from a plurality of single cells
WO2015048744A2 (en) 2013-09-30 2015-04-02 Moderna Therapeutics, Inc. Polynucleotides encoding immune modulating polypeptides
EP3052479A4 (en) 2013-10-02 2017-10-25 Moderna Therapeutics, Inc. Polynucleotide molecules and uses thereof
EP3052511A4 (en) 2013-10-02 2017-05-31 Moderna Therapeutics, Inc. Polynucleotide molecules and uses thereof
EP3052521A1 (en) 2013-10-03 2016-08-10 Moderna Therapeutics, Inc. Polynucleotides encoding low density lipoprotein receptor
AU2014337156A1 (en) 2013-10-18 2016-05-12 Modernatx, Inc. Compositions and methods for tolerizing cellular systems
WO2015070413A1 (en) 2013-11-14 2015-05-21 深圳智慧能源技术有限公司 Ceramic thermal shielding piece and heat-resistant structure
EP3076994A4 (en) 2013-12-06 2017-06-07 Modernatx, Inc. Targeted adaptive vaccines
EP3053585A1 (en) 2013-12-13 2016-08-10 Moderna Therapeutics, Inc. Alternative nucleic acid molecules and uses thereof
CN111304231A (en) 2013-12-30 2020-06-19 库瑞瓦格股份公司 artificial nucleic acid molecules
EP3092250A4 (en) 2014-01-08 2017-05-24 Moderna Therapeutics, Inc. Polynucleotides for the in vivo production of antibodies
PL4023249T3 (en) 2014-04-23 2025-03-10 Modernatx, Inc. Nucleic acid vaccines
US20170175129A1 (en) 2014-06-19 2017-06-22 Moderna Therapeutics, Inc. Alternative nucleic acid molecules and uses thereof
WO2015196128A2 (en) 2014-06-19 2015-12-23 Moderna Therapeutics, Inc. Alternative nucleic acid molecules and uses thereof
WO2015196118A1 (en) 2014-06-19 2015-12-23 Moderna Therapeutics, Inc. Alternative nucleic acid molecules and uses thereof
CN106794141B (en) 2014-07-16 2021-05-28 诺华股份有限公司 Methods of Encapsulating Nucleic Acids in Lipid Nanoparticle Hosts
US20170204152A1 (en) 2014-07-16 2017-07-20 Moderna Therapeutics, Inc. Chimeric polynucleotides
US10407683B2 (en) 2014-07-16 2019-09-10 Modernatx, Inc. Circular polynucleotides
US20170348415A1 (en) 2014-09-03 2017-12-07 Moderna Therapeutics, Inc. Tolerogenic compositions and methods
WO2016077125A1 (en) 2014-11-10 2016-05-19 Moderna Therapeutics, Inc. Alternative nucleic acid molecules containing reduced uracil content and uses thereof
EP3247363A4 (en) 2015-01-21 2018-10-03 Moderna Therapeutics, Inc. Lipid nanoparticle compositions
EP3247398A4 (en) 2015-01-23 2018-09-26 Moderna Therapeutics, Inc. Lipid nanoparticle compositions
WO2016180430A1 (en) 2015-05-08 2016-11-17 Curevac Ag Method for producing rna
AU2016342045A1 (en) 2015-10-22 2018-06-07 Modernatx, Inc. Human cytomegalovirus vaccine
EP4011451A1 (en) 2015-10-22 2022-06-15 ModernaTX, Inc. Metapneumovirus mrna vaccines

Patent Citations (216)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4667025A (en) 1982-08-09 1987-05-19 Wakunaga Seiyaku Kabushiki Kaisha Oligonucleotide derivatives
US4789737A (en) 1982-08-09 1988-12-06 Wakunaga Seiyaku Kabushiki Kaisha Oligonucleotide derivatives and production thereof
US4835263A (en) 1983-01-27 1989-05-30 Centre National De La Recherche Scientifique Novel compounds containing an oligonucleotide sequence bonded to an intercalating agent, a process for their synthesis and their use
US4605735A (en) 1983-02-14 1986-08-12 Wakunaga Seiyaku Kabushiki Kaisha Oligonucleotide derivatives
US5541313A (en) 1983-02-22 1996-07-30 Molecular Biosystems, Inc. Single-stranded labelled oligonucleotides of preselected sequence
US4948882A (en) 1983-02-22 1990-08-14 Syngene, Inc. Single-stranded labelled oligonucleotides, reactive monomers and methods of synthesis
US4824941A (en) 1983-03-10 1989-04-25 Julian Gordon Specific antibody to the native form of 2'5'-oligonucleotides, the method of preparation and the use as reagents in immunoassays or for binding 2'5'-oligonucleotides in biological systems
US4587044A (en) 1983-09-01 1986-05-06 The Johns Hopkins University Linkage of proteins to nucleic acids
US5118802A (en) 1983-12-20 1992-06-02 California Institute Of Technology DNA-reporter conjugates linked via the 2' or 5'-primary amino group of the 5'-terminal nucleoside
US5118800A (en) 1983-12-20 1992-06-02 California Institute Of Technology Oligonucleotides possessing a primary amino group in the terminal nucleotide
US4981957A (en) 1984-07-19 1991-01-01 Centre National De La Recherche Scientifique Oligonucleotides with modified phosphate and modified carbohydrate moieties at the respective chain termini
US5545730A (en) 1984-10-16 1996-08-13 Chiron Corporation Multifunctional nucleic acid monomer
US5552538A (en) 1984-10-16 1996-09-03 Chiron Corporation Oligonucleotides with cleavable sites
US5258506A (en) 1984-10-16 1993-11-02 Chiron Corporation Photolabile reagents for incorporation into oligonucleotide chains
US5578717A (en) 1984-10-16 1996-11-26 Chiron Corporation Nucleotides for introducing selectably cleavable and/or abasic sites into oligonucleotides
US4828979A (en) 1984-11-08 1989-05-09 Life Technologies, Inc. Nucleotide analogs for nucleic acid labeling and detection
US4762779A (en) 1985-06-13 1988-08-09 Amgen Inc. Compositions and methods for functionalizing nucleic acids
US5317098A (en) 1986-03-17 1994-05-31 Hiroaki Shizuya Non-radioisotope tagging of fragments
US4876335A (en) 1986-06-30 1989-10-24 Wakunaga Seiyaku Kabushiki Kaisha Poly-labelled oligonucleotide derivative
US4904582A (en) 1987-06-11 1990-02-27 Synthetic Genetics Novel amphiphilic nucleic acid conjugates
US5585481A (en) 1987-09-21 1996-12-17 Gen-Probe Incorporated Linking reagents for nucleotide probes
US5525465A (en) 1987-10-28 1996-06-11 Howard Florey Institute Of Experimental Physiology And Medicine Oligonucleotide-polyamide conjugates and methods of production and applications of the same
US5112963A (en) 1987-11-12 1992-05-12 Max-Planck-Gesellschaft Zur Foerderung Der Wissenschaften E.V. Modified oligonucleotides
US5082830A (en) 1988-02-26 1992-01-21 Enzo Biochem, Inc. End labeled nucleotide probe
US5109124A (en) 1988-06-01 1992-04-28 Biogen, Inc. Nucleic acid probe linked to a label having a terminal cysteine
US5262536A (en) 1988-09-15 1993-11-16 E. I. Du Pont De Nemours And Company Reagents for the preparation of 5'-tagged oligonucleotides
US5512439A (en) 1988-11-21 1996-04-30 Dynal As Oligonucleotide-linked magnetic particles and uses thereof
US5599923A (en) 1989-03-06 1997-02-04 Board Of Regents, University Of Tx Texaphyrin metal complexes having improved functionalization
US5391723A (en) 1989-05-31 1995-02-21 Neorx Corporation Oligonucleotide conjugates
US5416203A (en) 1989-06-06 1995-05-16 Northwestern University Steroid modified oligonucleotides
US4958013A (en) 1989-06-06 1990-09-18 Northwestern University Cholesteryl modified oligonucleotides
US5254469A (en) 1989-09-12 1993-10-19 Eastman Kodak Company Oligonucleotide-enzyme conjugate that can be used as a probe in hybridization assays and polymerase chain reaction procedures
US5591722A (en) 1989-09-15 1997-01-07 Southern Research Institute 2'-deoxy-4'-thioribonucleosides and their antiviral activity
US5466786A (en) 1989-10-24 1995-11-14 Gilead Sciences 2'modified nucleoside and nucleotide compounds
US5466786B1 (en) 1989-10-24 1998-04-07 Gilead Sciences 2' Modified nucleoside and nucleotide compounds
US5208020A (en) 1989-10-25 1993-05-04 Immunogen Inc. Cytotoxic agents comprising maytansinoids and their therapeutic use
US5292873A (en) 1989-11-29 1994-03-08 The Research Foundation Of State University Of New York Nucleic acids labeled with naphthoquinone probe
US5486603A (en) 1990-01-08 1996-01-23 Gilead Sciences, Inc. Oligonucleotide having enhanced binding affinity
US6783931B1 (en) 1990-01-11 2004-08-31 Isis Pharmaceuticals, Inc. Amine-derivatized nucleosides and oligonucleosides
US5578718A (en) 1990-01-11 1996-11-26 Isis Pharmaceuticals, Inc. Thiol-derivatized nucleosides
US7037646B1 (en) 1990-01-11 2006-05-02 Isis Pharmaceuticals, Inc. Amine-derivatized nucleosides and oligonucleosides
US5670633A (en) 1990-01-11 1997-09-23 Isis Pharmaceuticals, Inc. Sugar modified oligonucleotides that detect and modulate gene expression
US5646265A (en) 1990-01-11 1997-07-08 Isis Pharmceuticals, Inc. Process for the preparation of 2'-O-alkyl purine phosphoramidites
US6900297B1 (en) 1990-01-11 2005-05-31 Isis Pharmaceuticals, Inc. Amine-derivatized nucleosides and oligonucleosides
US5414077A (en) 1990-02-20 1995-05-09 Gilead Sciences Non-nucleoside linkers for convenient attachment of labels to oligonucleotides using standard synthetic methods
US5214136A (en) 1990-02-20 1993-05-25 Gilead Sciences, Inc. Anthraquinone-derivatives oligonucleotides
US5567811A (en) 1990-05-03 1996-10-22 Amersham International Plc Phosphoramidite derivatives, their preparation and the use thereof in the incorporation of reporter groups on synthetic oligonucleotides
US5514785A (en) 1990-05-11 1996-05-07 Becton Dickinson And Company Solid supports for nucleic acid hybridization assays
US5218105A (en) 1990-07-27 1993-06-08 Isis Pharmaceuticals Polyamine conjugated oligonucleotides
US5688941A (en) 1990-07-27 1997-11-18 Isis Pharmaceuticals, Inc. Methods of making conjugated 4' desmethyl nucleoside analog compounds
US5138045A (en) 1990-07-27 1992-08-11 Isis Pharmaceuticals Polyamine conjugated oligonucleotides
US5608046A (en) 1990-07-27 1997-03-04 Isis Pharmaceuticals, Inc. Conjugated 4'-desmethyl nucleoside analog compounds
US5567810A (en) 1990-08-03 1996-10-22 Sterling Drug, Inc. Nuclease resistant compounds
US5245022A (en) 1990-08-03 1993-09-14 Sterling Drug, Inc. Exonuclease resistant terminally substituted oligonucleotides
US5512667A (en) 1990-08-28 1996-04-30 Reed; Michael W. Trifunctional intermediates for preparing 3'-tailed oligonucleotides
US5510475A (en) 1990-11-08 1996-04-23 Hybridon, Inc. Oligonucleotide multiple reporter precursors
US5714331A (en) 1991-05-24 1998-02-03 Buchardt, Deceased; Ole Peptide nucleic acids having enhanced binding affinity, sequence specificity and solubility
US5371241A (en) 1991-07-19 1994-12-06 Pharmacia P-L Biochemicals Inc. Fluorescein labelled phosphoramidites
US5319080A (en) 1991-10-17 1994-06-07 Ciba-Geigy Corporation Bicyclic nucleosides, oligonucleotides, process for their preparation and intermediates
US5393878A (en) 1991-10-17 1995-02-28 Ciba-Geigy Corporation Bicyclic nucleosides, oligonucleotides, process for their preparation and intermediates
US5359044A (en) 1991-12-13 1994-10-25 Isis Pharmaceuticals Cyclobutyl oligonucleotide surrogates
US5587371A (en) 1992-01-21 1996-12-24 Pharmacyclics, Inc. Texaphyrin-oligonucleotide conjugates
US5565552A (en) 1992-01-21 1996-10-15 Pharmacyclics, Inc. Method of expanded porphyrin-oligonucleotide conjugate synthesis
US5595726A (en) 1992-01-21 1997-01-21 Pharmacyclics, Inc. Chromophore probe for detection of nucleic acid
US5639873A (en) 1992-02-05 1997-06-17 Centre National De La Recherche Scientifique (Cnrs) Oligothionucleotides
US5475092A (en) 1992-03-25 1995-12-12 Immunogen Inc. Cell binding agent conjugates of analogues and derivatives of CC-1065
US5846545A (en) 1992-03-25 1998-12-08 Immunogen, Inc. Targeted delivery of cyclopropylbenzindole-containing cytotoxic drugs
US5585499A (en) 1992-03-25 1996-12-17 Immunogen Inc. Cyclopropylbenzindole-containing cytotoxic drugs
US5700920A (en) 1992-07-01 1997-12-23 Novartis Corporation Carbocyclic nucleosides containing bicyclic rings, oligonucleotides therefrom, process for their preparation, their use and intermediates
US5610300A (en) 1992-07-01 1997-03-11 Ciba-Geigy Corporation Carbocyclic nucleosides containing bicyclic rings, oligonucleotides therefrom, process for their preparation, their use and intermediates
US5272250A (en) 1992-07-10 1993-12-21 Spielvogel Bernard F Boronated phosphoramidate compounds
US5451413A (en) 1992-09-17 1995-09-19 Gist-Brocades, B.V. Yeast derivative and method to improve bread quality
US5574142A (en) 1992-12-15 1996-11-12 Microprobe Corporation Peptide linkers for improved oligonucleotide delivery
US5576427A (en) 1993-03-30 1996-11-19 Sterling Winthrop, Inc. Acyclic nucleoside analogs and oligonucleotide sequences containing them
US5658873A (en) 1993-04-10 1997-08-19 Degussa Aktiengesellschaft Coated sodium percarbonate particles, a process for their production and detergent, cleaning and bleaching compositions containing them
US5539082A (en) 1993-04-26 1996-07-23 Nielsen; Peter E. Peptide nucleic acids
US6294664B1 (en) 1993-07-29 2001-09-25 Isis Pharmaceuticals, Inc. Synthesis of oligonucleotides
US5719262A (en) 1993-11-22 1998-02-17 Buchardt, Deceased; Ole Peptide nucleic acids having amino acid side chains
US5446137A (en) 1993-12-09 1995-08-29 Syntex (U.S.A.) Inc. Oligonucleotides containing 4'-substituted nucleotides
US5446137B1 (en) 1993-12-09 1998-10-06 Behringwerke Ag Oligonucleotides containing 4'-substituted nucleotides
US5519134A (en) 1994-01-11 1996-05-21 Isis Pharmaceuticals, Inc. Pyrrolidine-containing monomers and oligomers
US5599928A (en) 1994-02-15 1997-02-04 Pharmacyclics, Inc. Texaphyrin compounds having improved functionalization
US5627053A (en) 1994-03-29 1997-05-06 Ribozyme Pharmaceuticals, Inc. 2'deoxy-2'-alkylnucleotide containing nucleic acid
US5597696A (en) 1994-07-18 1997-01-28 Becton Dickinson And Company Covalent cyanine dye oligonucleotide conjugates
US5580731A (en) 1994-08-25 1996-12-03 Chiron Corporation N-4 modified pyrimidine deoxynucleotides and oligonucleotide probes synthesized therewith
US5597909A (en) 1994-08-25 1997-01-28 Chiron Corporation Polynucleotide reagents containing modified deoxyribose moieties, and associated methods of synthesis and use
US5591584A (en) 1994-08-25 1997-01-07 Chiron Corporation N-4 modified pyrimidine deoxynucleotides and oligonucleotide probes synthesized therewith
US20120178702A1 (en) 1995-01-23 2012-07-12 University Of Pittsburgh Stable lipid-comprising drug delivery complexes and methods for their production
US6234990B1 (en) 1996-06-28 2001-05-22 Sontra Medical, Inc. Ultrasound enhancement of transdermal transport
US6491657B2 (en) 1996-06-28 2002-12-10 Sontra Medical, Inc. Ultrasound enhancement of transdermal transport
US6576752B1 (en) 1997-02-14 2003-06-10 Isis Pharmaceuticals, Inc. Aminooxy functionalized oligomers
US6268490B1 (en) 1997-03-07 2001-07-31 Takeshi Imanishi Bicyclonucleoside and oligonucleotide analogues
US20100036115A1 (en) 1997-07-23 2010-02-11 Sirna Therapeutics, Inc. Novel Compositions for the Delivery of Negatively Charged Molecules
US6670461B1 (en) 1997-09-12 2003-12-30 Exiqon A/S Oligonucleotide analogues
US6794499B2 (en) 1997-09-12 2004-09-21 Exiqon A/S Oligonucleotide analogues
US6517869B1 (en) 1997-12-12 2003-02-11 Expression Genetics, Inc. Positively charged poly(alpha-(omega-aminoalkyl)lycolic acid) for the delivery of a bioactive agent via tissue and cellular uptake
US6267987B1 (en) 1997-12-12 2001-07-31 Samyang Corporation Positively charged poly[alpha-(omega-aminoalkyl) glycolic acid] for the delivery of a bioactive agent via tissue and cellular uptake
US6320017B1 (en) 1997-12-23 2001-11-20 Inex Pharmaceuticals Corp. Polyamide oligomers
US6190315B1 (en) 1998-01-08 2001-02-20 Sontra Medical, Inc. Sonophoretic enhanced transdermal transport
US20040236268A1 (en) 1998-01-08 2004-11-25 Sontra Medical, Inc. Method and apparatus for enhancement of transdermal transport
US6177274B1 (en) 1998-05-20 2001-01-23 Expression Genetics, Inc. Hepatocyte targeting polyethylene glyco-grafted poly-L-lysine polymeric gene carrier
US6217912B1 (en) 1998-07-13 2001-04-17 Expression Genetics, Inc. Polyester analogue of poly-L-lysine as a soluble, biodegradable gene delivery carrier
US20040171980A1 (en) 1998-12-18 2004-09-02 Sontra Medical, Inc. Method and apparatus for enhancement of transdermal transport
US7385034B2 (en) 1998-12-22 2008-06-10 Serono Genetics Institute S.A. Complementary DNAs encoding proteins with signal peptides
US7084125B2 (en) 1999-03-18 2006-08-01 Exiqon A/S Xylo-LNA analogues
US7053207B2 (en) 1999-05-04 2006-05-30 Exiqon A/S L-ribo-LNA analogues
US7413875B2 (en) 1999-08-05 2008-08-19 Serono Genetics Institute S.A. ESTs and encoded human proteins
US6696038B1 (en) 2000-09-14 2004-02-24 Expression Genetics, Inc. Cationic lipopolymer as biocompatible gene delivery agent
US6998484B2 (en) 2000-10-04 2006-02-14 Santaris Pharma A/S Synthesis of purine locked nucleic acid analogues
US6652886B2 (en) 2001-02-16 2003-11-25 Expression Genetics Biodegradable cationic copolymers of poly (alkylenimine) and poly (ethylene glycol) for the delivery of bioactive agents
US7833992B2 (en) 2001-05-18 2010-11-16 Merck Sharpe & Dohme Conjugates and compositions for cellular delivery
US7964578B2 (en) 2001-05-18 2011-06-21 Sirna Therapeutics, Inc. Conjugates and compositions for cellular delivery
US6586524B2 (en) 2001-07-19 2003-07-01 Expression Genetics, Inc. Cellular targeting poly(ethylene glycol)-grafted polymeric gene carrier
US20050059005A1 (en) 2001-09-28 2005-03-17 Thomas Tuschl Microrna molecules
US20050222064A1 (en) 2002-02-20 2005-10-06 Sirna Therapeutics, Inc. Polycationic compositions for cellular delivery of polynucleotides
US7374930B2 (en) 2002-05-21 2008-05-20 Expression Genetics, Inc. GLP-1 gene delivery for the treatment of type 2 diabetes
US20090227660A1 (en) 2002-05-21 2009-09-10 Seungjoon Oh GLP-1 gene delivery for the treatment of type 2 diabetes
US20050261218A1 (en) 2003-07-31 2005-11-24 Christine Esau Oligomeric compounds and compositions for use in modulation small non-coding RNAs
US20080166414A1 (en) 2004-01-28 2008-07-10 Johns Hopkins University Drugs And Gene Carrier Particles That Rapidly Move Through Mucous Barriers
US8124379B2 (en) 2004-06-14 2012-02-28 Novozymes A/S Signal peptide for producing a polypeptide
US7361903B2 (en) 2004-09-01 2008-04-22 Koninklijke Philips Electronics N.V. Image system with non-circular patient aperture
US20120009145A1 (en) 2004-11-03 2012-01-12 Gregory Slobodkin Biodegradable Cross-Linked Cationic Multi-block Copolymers for Gene Delivery and Methods of Making Thereof
US8057821B2 (en) 2004-11-03 2011-11-15 Egen, Inc. Biodegradable cross-linked cationic multi-block copolymers for gene delivery and methods of making thereof
US7964571B2 (en) 2004-12-09 2011-06-21 Egen, Inc. Combination of immuno gene therapy and chemotherapy for treatment of cancer and hyperproliferative diseases
US20110218231A1 (en) 2004-12-09 2011-09-08 Egen, Inc. Combination of Immuno Gene Therapy and Chemotherapy for Treatment of Cancer and Hyperproliferative Diseases
US20100003337A1 (en) 2004-12-10 2010-01-07 Justin Hanes Functionalized poly(ether-anhydride) block copolymers
US7893302B2 (en) 2005-02-14 2011-02-22 Sirna Therapeutics, Inc. Lipid nanoparticle based compositions and methods for the delivery of biologically active molecules
US7404969B2 (en) 2005-02-14 2008-07-29 Sirna Therapeutics, Inc. Lipid nanoparticle based compositions and methods for the delivery of biologically active molecules
US20100120024A1 (en) 2005-06-30 2010-05-13 Sharon Cload Materials and methods for the generation of transcripts comprising modified nucleotides
US20070117112A1 (en) 2005-06-30 2007-05-24 Diener John L Materials and methods for the generation of fully 2'-modified nucleic acid transcripts
US8101385B2 (en) 2005-06-30 2012-01-24 Archemix Corp. Materials and methods for the generation of transcripts comprising modified nucleotides
US20100129877A1 (en) 2005-09-28 2010-05-27 Ugur Sahin Modification of RNA, Producing an Increased Transcript Stability and Translation Efficiency
US7994304B2 (en) 2005-11-22 2011-08-09 Helicos Biosciences Corporation Methods and compositions for sequencing a nucleic acid
US7399845B2 (en) 2006-01-27 2008-07-15 Isis Pharmaceuticals, Inc. 6-modified bicyclic nucleic acid analogs
US20100215580A1 (en) 2006-09-08 2010-08-26 The Johns Hopkins University Compositions and methods for enhancing transport through mucus
WO2008078180A2 (en) 2006-12-22 2008-07-03 Archemix Corp. Materials and methods for the generation of transcripts comprising modified nucleotides
WO2008103276A2 (en) 2007-02-16 2008-08-28 Merck & Co., Inc. Compositions and methods for potentiated activity of biologicaly active molecules
WO2008121949A1 (en) 2007-03-30 2008-10-09 Bind Biosciences, Inc. Cancer cell targeting using nanoparticles
US8246968B2 (en) 2007-03-30 2012-08-21 Bind Biosciences, Inc. Cancer cell targeting using nanoparticles
US20080275468A1 (en) 2007-04-27 2008-11-06 Echo Therapeutics, Inc. Skin permeation device for analyte sensing or transdermal drug delivery
US20090042825A1 (en) 2007-08-06 2009-02-12 Majed Matar Composition, method of preparation & application of concentrated formulations of condensed nucleic acids with a cationic lipopolymer
US20090042829A1 (en) 2007-08-06 2009-02-12 Majed Matar Nucleic Acid-Lipopolymer Compositions
US20120004293A1 (en) 2007-09-28 2012-01-05 Zale Stephen E Cancer Cell Targeting Using Nanoparticles
US8236330B2 (en) 2007-09-28 2012-08-07 Bind Biosciences, Inc. Cancer cell targeting using nanoparticles
US20100004313A1 (en) 2008-02-29 2010-01-07 Tbd Modified Poloxamers for Gene Expression and Associated Methods
US20100004315A1 (en) 2008-03-14 2010-01-07 Gregory Slobodkin Biodegradable Cross-Linked Branched Poly(Alkylene Imines)
WO2010005726A2 (en) 2008-06-16 2010-01-14 Bind Biosciences Inc. Therapeutic polymeric nanoparticles with mtor inhibitors and methods of making and using same
US8206747B2 (en) 2008-06-16 2012-06-26 Bind Biosciences, Inc. Drug loaded polymeric nanoparticles and methods of making and using same
WO2010005725A2 (en) 2008-06-16 2010-01-14 Bind Biosciences, Inc. Therapeutic polymeric nanoparticles comprising vinca alkaloids and methods of making and using same
US20110274759A1 (en) 2008-06-16 2011-11-10 Greg Troiano Drug Loaded Polymeric Nanoparticles and Methods of Making and Using Same
US20100068286A1 (en) 2008-06-16 2010-03-18 Greg Troiano Drug Loaded Polymeric Nanoparticles and Methods of Making and Using Same
US20100069426A1 (en) 2008-06-16 2010-03-18 Zale Stephen E Therapeutic polymeric nanoparticles with mTor inhibitors and methods of making and using same
US20100068285A1 (en) 2008-06-16 2010-03-18 Zale Stephen E Drug Loaded Polymeric Nanoparticles and Methods of Making and Using Same
US20100104645A1 (en) 2008-06-16 2010-04-29 Bind Biosciences, Inc. Methods for the preparation of targeting agent functionalized diblock copolymers for use in fabrication of therapeutic targeted nanoparticles
WO2010005740A2 (en) 2008-06-16 2010-01-14 Bind Biosciences, Inc. Methods for the preparation of targeting agent functionalized diblock copolymers for use in fabrication of therapeutic targeted nanoparticles
US20100104655A1 (en) 2008-06-16 2010-04-29 Zale Stephen E Therapeutic Polymeric Nanoparticles Comprising Vinca Alkaloids and Methods of Making and Using Same
WO2010005723A2 (en) 2008-06-16 2010-01-14 Bind Biosciences, Inc. Drug loaded polymeric nanoparticles and methods of making and using same
WO2010005721A2 (en) 2008-06-16 2010-01-14 Bind Biosciences, Inc. Drug loaded polymeric nanoparticles and methods of making and using same
US20100009424A1 (en) 2008-07-14 2010-01-14 Natasha Forde Sonoporation systems and methods
WO2010021865A1 (en) 2008-08-18 2010-02-25 Merck Sharp & Dohme Corp. Novel lipid nanoparticles and novel components for delivery of nucleic acids
WO2010030763A2 (en) 2008-09-10 2010-03-18 Bind Biosciences, Inc. High throughput fabrication of nanoparticles
US20100087337A1 (en) 2008-09-10 2010-04-08 Bind Biosciences, Inc. High Throughput Fabrication of Nanoparticles
US20100075072A1 (en) 2008-09-25 2010-03-25 Tsung-Wei Chen Decorative structure of tree-shaped bells
US20110217377A1 (en) 2008-12-15 2011-09-08 Zale Stephen E Long Circulating Nanoparticles for Sustained Release of Therapeutic Agents
US20100216804A1 (en) 2008-12-15 2010-08-26 Zale Stephen E Long Circulating Nanoparticles for Sustained Release of Therapeutic Agents
WO2010080724A1 (en) 2009-01-12 2010-07-15 Merck Sharp & Dohme Corp. Novel lipid nanoparticles and novel components for delivery of nucleic acids
US20100196983A1 (en) 2009-02-05 2010-08-05 Ut-Battelle, Llc Transformation of gram positive bacteria by sonoporation
US20100260817A1 (en) 2009-03-20 2010-10-14 Egen, Inc. Polyamine Derivatives
US20110223201A1 (en) 2009-04-21 2011-09-15 Selecta Biosciences, Inc. Immunonanotherapeutics Providing a Th1-Biased Response
WO2010123569A2 (en) 2009-04-21 2010-10-28 Selecta Biosciences, Inc. Immunonanotherapeutics providing a th1-biased response
WO2010129709A1 (en) 2009-05-05 2010-11-11 Alnylam Pharmaceuticals, Inc. Lipid compositions
US20110027217A1 (en) 2009-05-27 2011-02-03 Selecta Biosciences, Inc. Immunomodulatory agent-polymeric compounds
US20110020388A1 (en) 2009-05-27 2011-01-27 Selecta Biosciences, Inc. Targeted synthetic nanocarriers with ph sensitive release of immunomodulatory agents
WO2010138192A2 (en) 2009-05-27 2010-12-02 Selecta Biosciences, Inc. Nanocarriers possessing components with different rates of release
US20100303850A1 (en) 2009-05-27 2010-12-02 Selecta Biosciences, Inc. Nanocarriers possessing components with different rates of release
WO2010138194A2 (en) 2009-05-27 2010-12-02 Selecta Biosciences, Inc. Immunomodulatory agent-polymeric compounds
WO2010138193A2 (en) 2009-05-27 2010-12-02 Selecta Biosciences, Inc. Targeted synthetic nanocarriers with ph sensitive release of immunomodulatory agents
US20100324120A1 (en) 2009-06-10 2010-12-23 Jianxin Chen Lipid formulation
WO2011022460A1 (en) 2009-08-20 2011-02-24 Merck Sharp & Dohme Corp. Novel cationic lipids with various head groups for oligonucleotide delivery
WO2011043913A2 (en) 2009-10-08 2011-04-14 Merck Sharp & Dohme Corp. Novel cationic lipids with short lipid chains for oligonucleotide delivery
WO2011072218A2 (en) 2009-12-11 2011-06-16 Bind Biosciences Stable formulations for lyophilizing therapeutic particles
US8211473B2 (en) 2009-12-11 2012-07-03 Bind Biosciences, Inc. Stable formulations for lyophilizing therapeutic particles
WO2011084518A2 (en) 2009-12-15 2011-07-14 Bind Biosciences, Inc. Therapeutic polymeric nanoparticles comprising corticosteroids and methods of making and using same
US20110294717A1 (en) 2009-12-15 2011-12-01 Ali Mir M Therapeutic Polymeric Nanoparticle Compositions with High Glass Transition Temperature or High Molecular Weight Copolymers
WO2011084521A2 (en) 2009-12-15 2011-07-14 Bind Biosciences, Inc. Therapeutic polymeric nanoparticles comprising epothilone and methods of making and using same
WO2011084513A2 (en) 2009-12-15 2011-07-14 Bind Biosciences, Inc. Therapeutic polymeric nanoparticle compositions with high glass transition temperature or high molecular weight copolymers
US20120140790A1 (en) 2009-12-15 2012-06-07 Ali Mir M Therapeutic Polymeric Nanoparticle Compositions with High Glass Transition Termperature or High Molecular Weight Copolymers
WO2011085231A2 (en) 2010-01-08 2011-07-14 Selecta Biosciences, Inc. Synthetic virus-like particles conjugated to human papillomavirus capsid peptides for use as vaccines
US20110171248A1 (en) 2010-01-08 2011-07-14 Selecta Biosciences, Inc. Synthetic virus-like particles conjugated to human papillomavirus capsid peptides for use as vaccines
WO2011090965A1 (en) 2010-01-22 2011-07-28 Merck Sharp & Dohme Corp. Novel cationic lipids for oligonucleotide delivery
WO2011115862A1 (en) 2010-03-18 2011-09-22 Merck Sharp & Dohme Corp. Endosomolytic poly(amidoamine) disulfide polymers for the delivery of oligonucleotides
WO2011127255A1 (en) 2010-04-08 2011-10-13 Merck Sharp & Dohme Corp. Preparation of lipid nanoparticles
US20110262491A1 (en) 2010-04-12 2011-10-27 Selecta Biosciences, Inc. Emulsions and methods of making nanocarriers
WO2011149733A2 (en) 2010-05-24 2011-12-01 Merck Sharp & Dohme Corp. Novel amino alcohol cationic lipids for oligonucleotide delivery
WO2011153120A1 (en) 2010-06-04 2011-12-08 Merck Sharp & Dohme Corp. Novel low molecular weight cationic lipids for oligonucleotide delivery
WO2012006376A2 (en) 2010-07-06 2012-01-12 Novartis Ag Virion-like delivery particles for self-replicating rna molecules
WO2012040184A2 (en) 2010-09-20 2012-03-29 Merck Sharp & Dohme Corp. Novel low molecular weight cationic lipids for oligonucleotide delivery
WO2012044638A1 (en) 2010-09-30 2012-04-05 Merck Sharp & Dohme Corp. Low molecular weight cationic lipids for oligonucleotide delivery
WO2012054365A2 (en) 2010-10-21 2012-04-26 Merck Sharp & Dohme Corp. Novel low molecular weight cationic lipids for oligonucleotide delivery
WO2012054923A2 (en) 2010-10-22 2012-04-26 Bind Biosciences, Inc. Therapeutic nanoparticles with high molecular weight copolymers
US20120121718A1 (en) 2010-11-05 2012-05-17 The Johns Hopkins University Compositions and methods relating to reduced mucoadhesion
WO2012061259A2 (en) 2010-11-05 2012-05-10 Merck Sharp & Dohme Corp. Novel low molecular weight cyclic amine containing cationic lipids for oligonucleotide delivery
WO2012068187A1 (en) 2010-11-19 2012-05-24 Merck Sharp & Dohme Corp. Poly(amide) polymers for the delivery of oligonucleotides
WO2012082574A1 (en) 2010-12-17 2012-06-21 Merck Sharp & Dohme Corp. Membrane lytic poly(amido amine) polymers for the delivery of oligonucleotides
US20120171229A1 (en) 2010-12-30 2012-07-05 Selecta Biosciences, Inc. Synthetic nanocarriers with reactive groups that release biologically active agents
WO2012094304A1 (en) 2011-01-04 2012-07-12 Brown University Nanotubes as carriers of nucleic acids into cells
WO2012099755A1 (en) 2011-01-11 2012-07-26 Alnylam Pharmaceuticals, Inc. Pegylated lipids and their use for drug delivery
US20120189700A1 (en) 2011-01-19 2012-07-26 Zoraida Aguilar Nanoparticle Based Immunological Stimulation
WO2012099805A2 (en) 2011-01-19 2012-07-26 Ocean Nanotech, Llc Nanoparticle based immunological stimulation
US20130115272A1 (en) 2011-10-03 2013-05-09 modeRNA Therapeutics Modified nucleosides, nucleotides, and nucleic acids, and uses thereof
WO2013086502A1 (en) 2011-12-09 2013-06-13 President And Fellows Of Harvard College Organ chips and uses thereof
WO2013086505A1 (en) 2011-12-09 2013-06-13 Vanderbilt University Integrated organ-on-chip system and applications of the same
WO2013086486A1 (en) 2011-12-09 2013-06-13 President And Fellows Of Harvard College Integrated human organ-on-chip microphysiological systems
WO2013090648A1 (en) 2011-12-16 2013-06-20 modeRNA Therapeutics Modified nucleoside, nucleotide, and nucleic acid compositions
WO2013102203A1 (en) 2011-12-30 2013-07-04 Cellscript, Inc. MAKING AND USING IN VITRO-SYNTHESIZED ssRNA FOR INTRODUCING INTO MAMMALIAN CELLS TO INDUCE A BIOLOGICAL OR BIOCHEMICAL EFFECT
US20130259924A1 (en) 2012-04-02 2013-10-03 modeRNA Therapeutics Modified polynucleotides for the production of biologics and proteins associated with human disease

Non-Patent Citations (153)

* Cited by examiner, † Cited by third party
Title
"Biocomputing: Informatics and Genome Projects", 1993, ACADEMIC PRESS
"Computational Molecular Biology", 1988, OXFORD UNIVERSITY PRESS
"Computer Analysis of Sequence Data", 1994, HUMANA PRESS
"Drug Design", 1987, AMERICAN PHARMACEUTICAL ASSOCIATION AND PERGAMON PRESS
"Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", NUCLEIC ACIDS RES., vol. 25, 1997, pages 3389 - 3402
"Methods in Molecular Biology", vol. 288, 2005, HUMANA PRESS, article "Oligonucleotide synthesis: methods and applications"
"Oligonucleotide synthesis: a practical approach, Oxford [Oxfordshire", 1984, IRL PRESS
"Pharmaceutical Salts: Properties, Selection, and Use", 2008, WILEY-VCH
"Remington: The Science and Practice of Pharmacy", 2005, LIPPINCOTT WILLIAMS & WILKINS
"Remington's Phannaceutical Sciences", 1985, MACK PUBLISHING COMPANY, pages: 1418
"Sequence Analysis Primer", 1991, M STOCKTON PRESS
8TH INTERNATIONAL JUDAH FOLKMAN CONFERENCE, 8 October 2010 (2010-10-08)
A. R. GENNARO: "Remington: The Science and Practice of Pharmacy", 2006, LIPPINCOTT, WILLIAMS & WILKINS
A. R. GENNARO: "Remington's The Science and Practice qf Pharmacy", 2006, LIPPINCOTT, WILLIAMS & WILKINS
AKINC ET AL., MOL THER., vol. 17, 2009, pages 872 - 879
AKINC ET AL., MOL THER., vol. 18, 2010, pages 1357 - 1364
AKINC ET AL., NAT BIOTECHNOL., vol. 26, 2008, pages 561 - 569
ALEKU ET AL., CANCER RES., vol. 68, 2008, pages 9788 - 9798
ALTSCHUL, S. F. ET AL., J. MOLEC. BIOI., vol. 215, 1990, pages 403
ANDERSON BR ET AL., NAR, 2010
ANDRE, CUFF GENE THER., vol. 10, 2010, pages 267 - 280
ANNONI A ET AL., BLOOD, vol. 114, 2009, pages 5152 - 5161
BASHA ET AL., MOL THER., vol. 19, 2011, pages 2186 - 2200
BASHA ET AL., MOL. THER., vol. 19, 2011, pages 2186 - 2200
BEN-ARIE ET AL., METHODS MOL BIOL., vol. 757, 2012, pages 497 - 507
BENOIT ET AL., BIOMACROMOLECULES, vol. 12, 2011, pages 2708 - 2714
BERGE ET AL., JOURNAL OF PHARMACEUTICAL SCIENCE, vol. 66, 1977, pages 1 - 19
BRIEBA ET AL., BIOCHEMISTRY, vol. 41, 2002, pages 5144 - 5
CARILLO, H.; LIPMAN, D.; SIAM J, APPLIED MATH., vol. 48, 1988, pages 1073
CARON ET AL., MOL. THER., vol. 3, no. 3, 2001, pages 310 - 8
CHATURVEDI ET AL., EXPERT OPIN DRUG DELIV., vol. 8, 2011, pages 1455 - 1468
CHIARELLA ET AL., CURR GENE THER., vol. 10, 2010, pages 281 - 286
CHO ET AL., ADV. FUNCT. MATER., vol. 19, 2009, pages 3112 - 3118
CHU ET AL., ACC CHEM RES., 13 January 2012 (2012-01-13)
CONG; MALI, SCIENCE, vol. 339, 2013, pages 819 - 23
CONVERTINE ET AL., BIOMACROMOLECULES., 1 October 2010 (2010-10-01)
CRONICAN ET AL., ACS CHEM. BIOL, vol. 5, 2010, pages 747 - 752
CUSI, HUM VACCIN., vol. 2, 2006, pages 1 - 7
DAVIS, MOL PHARM., vol. 6, 2009, pages 659 - 668
DAVIS, NATURE, vol. 464, 2010, pages 1067 - 1070
DE JONGE ET AL., GENE THER., vol. 13, 2006, pages 400 - 411
DEFOUGEROLLES, HUM GENE THER., vol. 19, 2008, pages 125 - 132
DEKOKER ET AL., ADV DRUG DELIV REV., vol. 63, 2011, pages 748 - 761
DESHAYES ET AL., CELL. MOL. LIFE SCI., vol. 62, no. 16, 2005, pages 1839 - 49
DEVEREUX, J., NUCLEIC ACIDS RESEARCH, vol. 12, no. 1, 1984, pages 387
EL-ANDALOUSSI ET AL., CURR. PHARM. DES., vol. 11, no. 28, 2003, pages 3597 - 611
ENDRES ET AL., BIOMATERIALS, vol. 32, 2011, pages 7721 - 7731
ESVCLT ET AL., NATURE, vol. 472, no. 7344, 2011, pages 499 - 503
ESVELT ET AL., NATURE, vol. 472, no. 7344, 2011, pages 499 - 503
FANG ET AL., EXPERT OPIN BIOL THER., vol. 12, 2012, pages 385 - 389
FENSKE; CULLIS, EXPERT OPIN DRUG DELIV., vol. 5, 2008, pages 25 - 44
FOTIN-MLECZEK ET AL., J. IMMUNOTHER., vol. 34, 2011, pages 1 - 15
FRANK-KAMENETSKY ET AL., PROC NATL ACAD SCI USA, vol. 105, 2008, pages 11915 - 11920
FROST, EXPERT OPIN. DRUG DELIV., vol. 4, 2007, pages 427 - 440
FUKUHARA ET AL., BIOCHEMISTRY, vol. 1, no. 4, 1962, pages 563 - 568
FULLER ET AL., BIOMATERIALS, vol. 29, 2008, pages 1526 - 1532
G. S. BANKER: "Modern Pharmaceutics, Drugs and the Pharmaceutical Sciences", vol. 72, 1996, MARCEL DEKKER
GEALL ET AL.: "Nonviral delivery of self-amplifying RNA vaccines", PNAS, 2012
GILBERT ET AL., CELL, vol. 154, 2013, pages 1 - 10
GODFRIN ET AL., EXPERT OPIN BIOL THER., vol. 12, 2012, pages 127 - 133
GRIMSON A; FARH KK; JOHNSTON WK; GARRETT-ENGELE P; LIM LP; BARTEL DP, MOL CELL, vol. 27, no. 1, 6 July 2007 (2007-07-06), pages 91 - 105
GUTBIER ET AL., PULM PHARMACOL. THER., vol. 23, 2010, pages 334 - 344
HEIDEL, PROC NATL ACAD SCI USA, vol. 104, 2007, pages 5715 - 21
HEYES ET AL., J CONTR REL., vol. 107, 2005, pages 276 - 287
HEYES ET AL., MOL THER., vol. 15, 2007, pages 713 - 720
HOJMAN, CURR GENE THER., vol. 10, 2010, pages 128 - 138
HU ET AL., PROΕ NATL ACAD SCI USA, vol. 108, 2011, pages 10980 - 10985
HUCKRIEDE ET AL., J LIPOSOME RES., vol. 17, 2007, pages 39 - 47
HU-LIESKOVAN, CANCER RES., vol. 65, 2005, pages 8984 - 8982
JEFFS ET AL., PHARM RES., vol. 22, 2005, pages 362 - 372
JINEK ET AL., SCIENCE, vol. 337, 2012, pages 816 - 821
JUDGE ET AL., J CLIN INVEST., vol. 119, 2009, pages 661 - 673
KARIKO K ET AL., IMMUNITY, vol. 23, 2005, pages 165 - 75
KARIKO K ET AL., MOL THER, vol. 16, 2008, pages 1833 - 40
KATZ ET AL., ANESTH ANALG, vol. 98, 2004, pages 371 - 76
KAUFMANN ET AL., MICROVASC RES, vol. 80, 2010, pages 286 - 293
KAZIKAWA ET AL., J CONTR REL., vol. 111, 2006, pages 368 - 370
KAZIKAWA, J CONTR REL., vol. 97, 2004, pages 345 - 356
KIM ET AL., METHODS MOL BIOL., vol. 721, 2011, pages 339 - 353
KOLHATKAR ET AL., CURR DRUG DISCOV TECHNOL., vol. 8, 2011, pages 197 - 206
LAI ET AL., ADV DRUG DELIV REV., vol. 61, no. 2, 2009, pages 158 - 171
LAI ET AL., PNAS, vol. 104, no. 5, 2007, pages 1482 - 487
LANDEN ET AL., CANCER BIOLOGY & THERAPY, vol. 5, no. 12, 2006, pages 1708 - 1713
LANGEL: "Cell-Penetrating Peptides: Processes and Applications", 2002, CRC PRESS
LEE ET AL., NATURE NANOTECHNOLOGY, vol. 7, 2012, pages 389 - 393
LEUSCHNER ET AL., NAT BIOTECHNOL, vol. 29, 2011, pages 1005 - 1010
LEUSCHNER ET AL., NAT BIOTECHNOL., vol. 29, 2011, pages 1005 - 1010
LI ET AL., J CONTR REL., vol. 142, 2010, pages 416 - 421
LI ET AL., J CONTR REL., vol. 158, 2012, pages 108 - 114
LIU; HUANG, MOLECULAR THERAPY, 2010, pages 669 - 670
LOVE ET AL., PROC NATL ACAD SCI U S A, vol. 107, 2010, pages 1864 - 1869
LOVE ET AL., PROC NATL ACAD SCI USA, vol. 107, 2010, pages 1864 - 1869
LUND ET AL., PHARM RES., vol. 27, 2010, pages 400 - 420
MAHON ET AL., BIOCONJUG CHEM., vol. 21, 2010, pages 1448 - 1454
MALI ET AL., SCIENCE, vol. 339, 2013, pages 823 - 826
MANGANIELLO ET AL., BIOMATERIALS, vol. 33, 2012, pages 2301 - 2309
MCNAUGHTON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 106, 2009, pages 6111 - 6116
MEYERS; MILLER, CABIOS, vol. 4, 1989, pages 11 - 17
MORRISSEY ET AL., NAT BIOTECHNOL., vol. 2, 2005, pages 1002 - 1007
MURUGAIAH ET AL., ANALYTICAL BIOCHEMISTRY, vol. 401, 2010, pages 61
MUSACCHIO; TORCHILIN, FRONT BIOSCI., vol. 16, 2011, pages 1388 - 1412
NEWMAN; BETTINGER, GENE THER., vol. 14, 2007, pages 465 - 475
NIELSEN ET AL., SCIENCE, vol. 254, 1991, pages 1497 - 1500
OGATA ET AL., J. ORG. CHEM., vol. 74, 2009, pages 2585 - 2588
PASCOLO EXPERT OPIN. BIOL. THER., vol. 4, pages 1285 - 1294
PATIL ET AL., CRIT REV THER DRUG CARRIER SYST., vol. 25, 2008, pages 1 - 61
PEER ET AL., PROC NATL ACAD SCI U S A, vol. 104, 2007, pages 4095 - 4100
PEER ET AL., PROC NATL ACAD SCI USA., vol. 6, no. 1O4, 2007, pages 4095 - 41O0
PEER ET AL., SCIENCE, vol. 319, 2008, pages 627 - 630
PEER, J CONTROL RELEASE., vol. 20, 2010, pages 63 - 68
PEER; LIEBERMAN, GENE THER., vol. 18, 2011, pages 1127 - 1133
PITELLA ET AL., BIOMATERIALS, vol. 32, 2011, pages 3106 - 31 14
POSTEMA; GILJA, CURR PHARM BIOTECHNOL., vol. 8, 2007, pages 355 - 361
PURMAL ET AL., NUCL, ACIDS RES., vol. 22, no. 1, 1994, pages 72 - 78
QI ET AL., CELL, vol. 152, 2013, pages 1173 - 1183
ROZEMA ET AL., PROC NATL ACAD SCI USA, vol. 104, 2007, pages 12982 - 12887
ROZEMA ET AL., PROC NATL ACAD SCI USA., vol. 104, 2007, pages 12982 - 12887
SANTEL ET AL., GENE THER, vol. 13, 2006, pages 1222 - 1234
SANTEL ET AL., GENE THER, vol. 13, 2006, pages 1360 - 1370
SANTEL, GENE THER, vol. 13, 2006, pages 1360 - 1370
SAPRANAUSKAS ET AL., NUCLEIC ACIDS RESEARCH, vol. 39, 2011, pages 9275 - 9282
SAWYER, CHEM BIOL DRUG DES., vol. 73, 2009, pages 3 - 6
SCHAFFERT; WAGNER, GENE THER., vol. 16, 2008, pages 1131 - 1138
SCHROEDER ET AL., J INTERN MED., vol. 267, 2010, pages 9 - 21
SCIENCE, vol. 339, 2013, pages 823 - 6
SEMPLE ET AL., NATURE BIOTECH., vol. 28, 2010, pages 172 - 176
SHI ET AL., ANGEW CHEM INT ED., vol. 50, 2011, pages 7027 - 7031
SIEGWART ET AL., PROC NATL ACAD SCI USA, vol. 108, 2011, pages 12996 - 13001
SIEGWART ET AL., PROC NATL ACAD SCI USA, vol. 108, 2011, pages 12996 - 3001
SINGHA ET AL., NUCLEIC ACID THER., vol. 2, 2011, pages 133 - 147
SONG ET AL., NAT BIOTECHNOL., vol. 23, 2005, pages 709 - 717
SONG ET AL., NATURE BIOTECHNOL., vol. 23, 2005, pages 709 - 717
SRINIVASAN ET AL., METHODS MOL BIOL., vol. 820, 2012, pages 105 - 116
STRUMBERG ET AL., INT J CLIN PHARMACOL THER, vol. 50, 2012, pages 76 - 78
SU ET AL., MOL PHARM., vol. 8, no. 3, 6 June 2011 (2011-06-06), pages 774 - 87
SUBRAMANYA ET AL., MOL THER., vol. 18, 2010, pages 2028 - 2037
SULLIVAN ET AL., EXPERT OPIN DRUG DELIV., vol. 7, 2010, pages 1433 - 1446
VERDINE; HILINSKI, METHODS ENZYMOI., vol. 503, 2012, pages 3 - 33
VON HEINJE, G.: "Sequence Analysis in Molecular Biology", 1987, ACADEMIC PRESS
WANG ET AL., NAT MATER., vol. 5, 2006, pages 791 - 796
WEIDE ET AL., J IMMUNOTHER., vol. 31, 2008, pages 180 - 188
WEIDE ET AL., J IMMUNOTHER., vol. 32, 2009, pages 498 - 507
WHEELER ET AL., GENE THERAPY, vol. 6, 1999, pages 271 - 281
WHITEHEAD ET AL., MOL. THER., vol. 19, 2011, pages 1688 - 1694
XU, TETRAHEDRON, vol. 48, no. 9, 1992, pages 1729 - 1740
YANG ET AL., ANGEW. CHEM. INT. ED., vol. 50, 2011, pages 2597 - 2600
YANG ET AL., MOL THER., vol. 20, 2012, pages 609 - 615
YOON; PARK, EXPERT OPIN DRUG DELIV., vol. 7, 2010, pages 321 - 330
YU ET AL., MOL MEMBR BIOL., vol. 27, 2010, pages 286 - 298
ZHANG ET AL., ACS NANO, vol. 2, no. 8, 2008, pages 1696 - 1702
ZHANG ET AL., GENE THERAPY, vol. 6, 1999, pages 1438 - 1447
ZHAO ET AL., EXPERT OPIN DRUG DELIV., vol. 5, 2008, pages 309 - 319
ZIMMERMANN ET AL., NATURE, vol. 441, 2006, pages 111 - 114

Cited By (426)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10576166B2 (en) 2009-12-01 2020-03-03 Translate Bio, Inc. Liver specific delivery of messenger RNA
US9181319B2 (en) 2010-08-06 2015-11-10 Moderna Therapeutics, Inc. Engineered nucleic acids and methods of use thereof
US9447164B2 (en) 2010-08-06 2016-09-20 Moderna Therapeutics, Inc. Engineered nucleic acids and methods of use thereof
US9937233B2 (en) 2010-08-06 2018-04-10 Modernatx, Inc. Engineered nucleic acids and methods of use thereof
US9701965B2 (en) 2010-10-01 2017-07-11 Modernatx, Inc. Engineered nucleic acids and methods of use thereof
US9956271B2 (en) 2010-11-30 2018-05-01 Translate Bio, Inc. mRNA for use in treatment of human genetic diseases
US11135274B2 (en) 2010-11-30 2021-10-05 Translate Bio, Inc. MRNA for use in treatment of human genetic diseases
US12409226B2 (en) 2011-03-31 2025-09-09 Modernatx, Inc. Delivery and formulation of engineered nucleic acids
US12419957B2 (en) 2011-03-31 2025-09-23 Modernatx, Inc. Delivery and formulation of engineered nucleic acids
US9950068B2 (en) 2011-03-31 2018-04-24 Modernatx, Inc. Delivery and formulation of engineered nucleic acids
US10898574B2 (en) 2011-03-31 2021-01-26 Modernatx, Inc. Delivery and formulation of engineered nucleic acids
US11911474B2 (en) 2011-03-31 2024-02-27 Modernatx, Inc. Delivery and formulation of engineered nucleic acids
US12364763B2 (en) 2011-03-31 2025-07-22 Modernatx, Inc. Delivery and formulation of engineered nucleic acids
US9533047B2 (en) 2011-03-31 2017-01-03 Modernatx, Inc. Delivery and formulation of engineered nucleic acids
US12502431B2 (en) 2011-03-31 2025-12-23 Modernatx, Inc. Delivery and formulation of engineered nucleic acids
US10507183B2 (en) 2011-06-08 2019-12-17 Translate Bio, Inc. Cleavable lipids
US11951179B2 (en) 2011-06-08 2024-04-09 Translate Bio, Inc. Lipid nanoparticle compositions and methods for MRNA delivery
US11338044B2 (en) 2011-06-08 2022-05-24 Translate Bio, Inc. Lipid nanoparticle compositions and methods for mRNA delivery
US11730825B2 (en) 2011-06-08 2023-08-22 Translate Bio, Inc. Lipid nanoparticle compositions and methods for mRNA delivery
US9717690B2 (en) 2011-06-08 2017-08-01 Rana Therapeutics, Inc. Cleavable lipids
US11291734B2 (en) 2011-06-08 2022-04-05 Translate Bio, Inc. Lipid nanoparticle compositions and methods for mRNA delivery
US11052159B2 (en) 2011-06-08 2021-07-06 Translate Bio, Inc. Lipid nanoparticle compositions and methods for mRNA delivery
US9308281B2 (en) 2011-06-08 2016-04-12 Shire Human Genetic Therapies, Inc. MRNA therapy for Fabry disease
US10507249B2 (en) 2011-06-08 2019-12-17 Translate Bio, Inc. Lipid nanoparticle compositions and methods for mRNA delivery
US12102720B2 (en) 2011-06-08 2024-10-01 Translate Bio, Inc. Cleavable lipids
US10413618B2 (en) 2011-06-08 2019-09-17 Translate Bio, Inc. Lipid nanoparticle compositions and methods for mRNA delivery
US11951181B2 (en) 2011-06-08 2024-04-09 Translate Bio, Inc. Lipid nanoparticle compositions and methods for mRNA delivery
US9597413B2 (en) 2011-06-08 2017-03-21 Shire Human Genetic Therapies, Inc. Pulmonary delivery of mRNA
US11951180B2 (en) 2011-06-08 2024-04-09 Translate Bio, Inc. Lipid nanoparticle compositions and methods for MRNA delivery
US10888626B2 (en) 2011-06-08 2021-01-12 Translate Bio, Inc. Lipid nanoparticle compositions and methods for mRNA delivery
US11547764B2 (en) 2011-06-08 2023-01-10 Translate Bio, Inc. Lipid nanoparticle compositions and methods for MRNA delivery
US12121592B2 (en) 2011-06-08 2024-10-22 Translate Bio, Inc. Lipid nanoparticle compositions and methods for mRNA delivery
US11185595B2 (en) 2011-06-08 2021-11-30 Translate Bio, Inc. Lipid nanoparticle compositions and methods for mRNA delivery
US10350303B1 (en) 2011-06-08 2019-07-16 Translate Bio, Inc. Lipid nanoparticle compositions and methods for mRNA delivery
US11234936B2 (en) 2011-06-08 2022-02-01 Translate Bio, Inc. Cleavable lipids
US10702478B2 (en) 2011-06-08 2020-07-07 Translate Bio, Inc. Cleavable lipids
US10238754B2 (en) 2011-06-08 2019-03-26 Translate Bio, Inc. Lipid nanoparticle compositions and methods for MRNA delivery
US9322006B2 (en) 2011-07-22 2016-04-26 President And Fellows Of Harvard College Evaluation and improvement of nuclease cleavage specificity
US10323236B2 (en) 2011-07-22 2019-06-18 President And Fellows Of Harvard College Evaluation and improvement of nuclease cleavage specificity
US12006520B2 (en) 2011-07-22 2024-06-11 President And Fellows Of Harvard College Evaluation and improvement of nuclease cleavage specificity
US9295689B2 (en) 2011-12-16 2016-03-29 Moderna Therapeutics, Inc. Formulation and delivery of PLGA microspheres
US9186372B2 (en) 2011-12-16 2015-11-17 Moderna Therapeutics, Inc. Split dose administration
US12459885B2 (en) 2012-03-29 2025-11-04 Translate Bio, Inc. Ionizable cationic lipids
US10065919B2 (en) 2012-03-29 2018-09-04 Translate Bio, Inc. Ionizable cationic lipids
US10137087B2 (en) 2012-03-29 2018-11-27 Translate Bio, Inc. Lipid-derived neutral nanoparticles
US12331005B2 (en) 2012-03-29 2025-06-17 Translate Bio, Inc. Ionizable cationic lipids
US9877919B2 (en) 2012-03-29 2018-01-30 Translate Bio, Inc. Lipid-derived neutral nanoparticles
US10786455B2 (en) 2012-03-29 2020-09-29 Translate Bio, Inc. Lipid-derived neutral nanoparticles
US9546128B2 (en) 2012-03-29 2017-01-17 Shire Human Genetic Therapies, Inc. Ionizable cationic lipids
US11999675B2 (en) 2012-03-29 2024-06-04 Translate Bio, Inc. Ionizable cationic lipids
US10766852B2 (en) 2012-03-29 2020-09-08 Translate Bio, Inc. Ionizable cationic lipids
US10137086B2 (en) 2012-03-29 2018-11-27 Translate Bio, Inc. Lipid-derived neutral nanoparticles
US11497716B2 (en) 2012-03-29 2022-11-15 Translate Bio, Inc. Lipid-derived neutral nanoparticles
US9301993B2 (en) 2012-04-02 2016-04-05 Moderna Therapeutics, Inc. Modified polynucleotides encoding apoptosis inducing factor 1
US9675668B2 (en) 2012-04-02 2017-06-13 Moderna Therapeutics, Inc. Modified polynucleotides encoding hepatitis A virus cellular receptor 2
US10772975B2 (en) 2012-04-02 2020-09-15 Modernatx, Inc. Modified Polynucleotides for the production of biologics and proteins associated with human disease
US9587003B2 (en) 2012-04-02 2017-03-07 Modernatx, Inc. Modified polynucleotides for the production of oncology-related proteins and peptides
US9572897B2 (en) 2012-04-02 2017-02-21 Modernatx, Inc. Modified polynucleotides for the production of cytoplasmic and cytoskeletal proteins
US10703789B2 (en) 2012-04-02 2020-07-07 Modernatx, Inc. Modified polynucleotides for the production of secreted proteins
US9782462B2 (en) 2012-04-02 2017-10-10 Modernatx, Inc. Modified polynucleotides for the production of proteins associated with human disease
US9814760B2 (en) 2012-04-02 2017-11-14 Modernatx, Inc. Modified polynucleotides for the production of biologics and proteins associated with human disease
US9827332B2 (en) 2012-04-02 2017-11-28 Modernatx, Inc. Modified polynucleotides for the production of proteins
US9828416B2 (en) 2012-04-02 2017-11-28 Modernatx, Inc. Modified polynucleotides for the production of secreted proteins
US10577403B2 (en) 2012-04-02 2020-03-03 Modernatx, Inc. Modified polynucleotides for the production of secreted proteins
US9303079B2 (en) 2012-04-02 2016-04-05 Moderna Therapeutics, Inc. Modified polynucleotides for the production of cytoplasmic and cytoskeletal proteins
US9283287B2 (en) 2012-04-02 2016-03-15 Moderna Therapeutics, Inc. Modified polynucleotides for the production of nuclear proteins
US9255129B2 (en) 2012-04-02 2016-02-09 Moderna Therapeutics, Inc. Modified polynucleotides encoding SIAH E3 ubiquitin protein ligase 1
US9254311B2 (en) 2012-04-02 2016-02-09 Moderna Therapeutics, Inc. Modified polynucleotides for the production of proteins
US9233141B2 (en) 2012-04-02 2016-01-12 Moderna Therapeutics, Inc. Modified polynucleotides for the production of proteins associated with blood and lymphatic disorders
US9221891B2 (en) 2012-04-02 2015-12-29 Moderna Therapeutics, Inc. In vivo production of proteins
US9878056B2 (en) 2012-04-02 2018-01-30 Modernatx, Inc. Modified polynucleotides for the production of cosmetic proteins and peptides
US9220755B2 (en) 2012-04-02 2015-12-29 Moderna Therapeutics, Inc. Modified polynucleotides for the production of proteins associated with blood and lymphatic disorders
US9220792B2 (en) 2012-04-02 2015-12-29 Moderna Therapeutics, Inc. Modified polynucleotides encoding aquaporin-5
US9216205B2 (en) 2012-04-02 2015-12-22 Moderna Therapeutics, Inc. Modified polynucleotides encoding granulysin
US9192651B2 (en) 2012-04-02 2015-11-24 Moderna Therapeutics, Inc. Modified polynucleotides for the production of secreted proteins
US10385106B2 (en) 2012-04-02 2019-08-20 Modernatx, Inc. Modified polynucleotides for the production of secreted proteins
US9149506B2 (en) 2012-04-02 2015-10-06 Moderna Therapeutics, Inc. Modified polynucleotides encoding septin-4
US9114113B2 (en) 2012-04-02 2015-08-25 Moderna Therapeutics, Inc. Modified polynucleotides encoding citeD4
US9107886B2 (en) 2012-04-02 2015-08-18 Moderna Therapeutics, Inc. Modified polynucleotides encoding basic helix-loop-helix family member E41
US9095552B2 (en) 2012-04-02 2015-08-04 Moderna Therapeutics, Inc. Modified polynucleotides encoding copper metabolism (MURR1) domain containing 1
US20210040460A1 (en) 2012-04-27 2021-02-11 Duke University Genetic correction of mutated genes
US11976307B2 (en) 2012-04-27 2024-05-07 Duke University Genetic correction of mutated genes
US11254936B2 (en) 2012-06-08 2022-02-22 Translate Bio, Inc. Nuclease resistant polynucleotides and uses thereof
US10245229B2 (en) 2012-06-08 2019-04-02 Translate Bio, Inc. Pulmonary delivery of mRNA to non-lung target cells
US11090264B2 (en) 2012-06-08 2021-08-17 Translate Bio, Inc. Pulmonary delivery of mRNA to non-lung target cells
US9512456B2 (en) 2012-08-14 2016-12-06 Modernatx, Inc. Enzymes and polymerases for the synthesis of RNA
US9597380B2 (en) 2012-11-26 2017-03-21 Modernatx, Inc. Terminally modified RNA
US12454687B2 (en) 2012-12-12 2025-10-28 The Broad Institute, Inc. Functional genomics using CRISPR-Cas systems, compositions, methods, knock out libraries and applications thereof
US10930367B2 (en) 2012-12-12 2021-02-23 The Broad Institute, Inc. Methods, models, systems, and apparatus for identifying target sequences for Cas enzymes or CRISPR-Cas systems for target sequences and conveying results thereof
US12252707B2 (en) 2012-12-12 2025-03-18 The Broad Institute, Inc. Delivery, Engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications
US11041173B2 (en) 2012-12-12 2021-06-22 The Broad Institute, Inc. Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications
US11312945B2 (en) 2013-01-16 2022-04-26 Emory University CAS9-nucleic acid complexes and uses related thereto
US10544405B2 (en) 2013-01-16 2020-01-28 Emory University Cas9-nucleic acid complexes and uses related thereto
US11603399B2 (en) 2013-03-13 2023-03-14 Modernatx, Inc. Long-lived polynucleotide molecules
US11692189B2 (en) 2013-03-14 2023-07-04 Translate Bio, Inc. Methods for purification of messenger RNA
US10087247B2 (en) 2013-03-14 2018-10-02 Translate Bio, Inc. Methods and compositions for delivering mRNA coded antibodies
US9181321B2 (en) 2013-03-14 2015-11-10 Shire Human Genetic Therapies, Inc. CFTR mRNA compositions and related methods and uses
US11820977B2 (en) 2013-03-14 2023-11-21 Translate Bio, Inc. Methods for purification of messenger RNA
US10258698B2 (en) 2013-03-14 2019-04-16 Modernatx, Inc. Formulation and delivery of modified nucleoside, nucleotide, and nucleic acid compositions
US11510937B2 (en) 2013-03-14 2022-11-29 Translate Bio, Inc. CFTR MRNA compositions and related methods and uses
US10876104B2 (en) 2013-03-14 2020-12-29 Translate Bio, Inc. Methods for purification of messenger RNA
US9713626B2 (en) 2013-03-14 2017-07-25 Rana Therapeutics, Inc. CFTR mRNA compositions and related methods and uses
US9957499B2 (en) 2013-03-14 2018-05-01 Translate Bio, Inc. Methods for purification of messenger RNA
US10420791B2 (en) 2013-03-14 2019-09-24 Translate Bio, Inc. CFTR MRNA compositions and related methods and uses
US12594295B2 (en) 2013-03-14 2026-04-07 Translate Bio, Inc. CFTR mRNA compositions and related methods and uses
US12577554B2 (en) 2013-03-14 2026-03-17 Translate Bio, Inc. Methods for purification of messenger RNA
US12234446B2 (en) 2013-03-14 2025-02-25 Translate Bio, Inc. Methods for purification of messenger RNA
US10138507B2 (en) 2013-03-15 2018-11-27 Modernatx, Inc. Manufacturing methods for production of RNA transcripts
US10590161B2 (en) 2013-03-15 2020-03-17 Modernatx, Inc. Ion exchange purification of mRNA
US11377470B2 (en) 2013-03-15 2022-07-05 Modernatx, Inc. Ribonucleic acid purification
US10077439B2 (en) 2013-03-15 2018-09-18 Modernatx, Inc. Removal of DNA fragments in mRNA production process
US12453739B2 (en) 2013-03-15 2025-10-28 Translate Bio, Inc. Synergistic enhancement of the delivery of nucleic acids via blended formulations
US10858647B2 (en) 2013-03-15 2020-12-08 Modernatx, Inc. Removal of DNA fragments in mRNA production process
US10130649B2 (en) 2013-03-15 2018-11-20 Translate Bio, Inc. Synergistic enhancement of the delivery of nucleic acids via blended formulations
US10646504B2 (en) 2013-03-15 2020-05-12 Translate Bio, Inc. Synergistic enhancement of the delivery of nucleic acids via blended formulations
US11845772B2 (en) 2013-03-15 2023-12-19 Modernatx, Inc. Ribonucleic acid purification
US12215345B2 (en) 2013-03-19 2025-02-04 Duke University Compositions and methods for the induction and tuning of gene expression
US10577630B2 (en) 2013-06-17 2020-03-03 The Broad Institute, Inc. Delivery and use of the CRISPR-Cas systems, vectors and compositions for hepatic targeting and therapy
US10781444B2 (en) 2013-06-17 2020-09-22 The Broad Institute, Inc. Functional genomics using CRISPR-Cas systems, compositions, methods, screens and applications thereof
US12441995B2 (en) 2013-06-17 2025-10-14 The Broad Institute, Inc. Functional genomics using CRISPR-Cas systems, compositions, methods, screens and applications thereof
US10946108B2 (en) 2013-06-17 2021-03-16 The Broad Institute, Inc. Delivery, use and therapeutic applications of the CRISPR-Cas systems and compositions for targeting disorders and diseases using viral components
US11008588B2 (en) 2013-06-17 2021-05-18 The Broad Institute, Inc. Delivery, engineering and optimization of tandem guide systems, methods and compositions for sequence manipulation
EP3011031B1 (en) * 2013-06-17 2020-09-30 The Broad Institute Inc. Delivery and use of the crispr-cas systems, vectors and compositions for hepatic targeting and therapy
US12553065B2 (en) 2013-06-17 2026-02-17 The Broad Institute, Inc. Optimized CRISPR-CAS double nickase systems, methods and compositions for sequence manipulation
US12018275B2 (en) 2013-06-17 2024-06-25 The Broad Institute, Inc. Delivery and use of the CRISPR-CAS systems, vectors and compositions for hepatic targeting and therapy
EP3825406A1 (en) * 2013-06-17 2021-05-26 The Broad Institute Inc. Delivery and use of the crispr-cas systems, vectors and compositions for hepatic targeting and therapy
US11597949B2 (en) 2013-06-17 2023-03-07 The Broad Institute, Inc. Optimized CRISPR-Cas double nickase systems, methods and compositions for sequence manipulation
US10711285B2 (en) 2013-06-17 2020-07-14 The Broad Institute, Inc. Optimized CRISPR-Cas double nickase systems, methods and compositions for sequence manipulation
US11027025B2 (en) 2013-07-11 2021-06-08 Modernatx, Inc. Compositions comprising synthetic polynucleotides encoding CRISPR related proteins and synthetic sgRNAs and methods of use
US10508298B2 (en) 2013-08-09 2019-12-17 President And Fellows Of Harvard College Methods for identifying a target site of a CAS9 nuclease
US11920181B2 (en) 2013-08-09 2024-03-05 President And Fellows Of Harvard College Nuclease profiling system
US10954548B2 (en) 2013-08-09 2021-03-23 President And Fellows Of Harvard College Nuclease profiling system
US12378566B2 (en) 2013-08-22 2025-08-05 Pioneer Hi-Bred International, Inc. Plant genome modification using guide RNA/Cas endonuclease systems and methods of use
US12428645B2 (en) 2013-08-22 2025-09-30 Pioneer Hi-Bred International, Inc. Methods for producing genetic modifications in a plant genome without incorporating a selectable transgene marker, and compositions thereof
EP3473720A1 (en) * 2013-08-22 2019-04-24 Pioneer Hi-Bred International, Inc. Genome modification using guide polynucleotide/cas endonuclease systems and methods of use
EP3036327B1 (en) 2013-08-22 2019-05-08 Pioneer Hi-Bred International, Inc. Genome modification using guide polynucleotide/cas endonuclease systems and methods of use
US10227581B2 (en) 2013-08-22 2019-03-12 President And Fellows Of Harvard College Engineered transcription activator-like effector (TALE) domains and uses thereof
US9359599B2 (en) 2013-08-22 2016-06-07 President And Fellows Of Harvard College Engineered transcription activator-like effector (TALE) domains and uses thereof
US11046948B2 (en) 2013-08-22 2021-06-29 President And Fellows Of Harvard College Engineered transcription activator-like effector (TALE) domains and uses thereof
US9737604B2 (en) 2013-09-06 2017-08-22 President And Fellows Of Harvard College Use of cationic lipids to deliver CAS9
US10597679B2 (en) 2013-09-06 2020-03-24 President And Fellows Of Harvard College Switchable Cas9 nucleases and uses thereof
US9228207B2 (en) 2013-09-06 2016-01-05 President And Fellows Of Harvard College Switchable gRNAs comprising aptamers
US10912833B2 (en) 2013-09-06 2021-02-09 President And Fellows Of Harvard College Delivery of negatively charged proteins using cationic lipids
US10858639B2 (en) 2013-09-06 2020-12-08 President And Fellows Of Harvard College CAS9 variants and uses thereof
US9340799B2 (en) 2013-09-06 2016-05-17 President And Fellows Of Harvard College MRNA-sensing switchable gRNAs
US9526784B2 (en) 2013-09-06 2016-12-27 President And Fellows Of Harvard College Delivery system for functional nucleases
US9999671B2 (en) 2013-09-06 2018-06-19 President And Fellows Of Harvard College Delivery of negatively charged proteins using cationic lipids
US9322037B2 (en) 2013-09-06 2016-04-26 President And Fellows Of Harvard College Cas9-FokI fusion proteins and uses thereof
US11299755B2 (en) 2013-09-06 2022-04-12 President And Fellows Of Harvard College Switchable CAS9 nucleases and uses thereof
US12473573B2 (en) 2013-09-06 2025-11-18 President And Fellows Of Harvard College Switchable Cas9 nucleases and uses thereof
US12559737B2 (en) 2013-09-06 2026-02-24 President And Fellows Of Harvard College Cas9 variants and uses thereof
US9388430B2 (en) 2013-09-06 2016-07-12 President And Fellows Of Harvard College Cas9-recombinase fusion proteins and uses thereof
US12584118B2 (en) 2013-09-06 2026-03-24 President And Fellows Of Harvard College Cas9 variants and uses thereof
US9340800B2 (en) 2013-09-06 2016-05-17 President And Fellows Of Harvard College Extended DNA-sensing GRNAS
US10682410B2 (en) 2013-09-06 2020-06-16 President And Fellows Of Harvard College Delivery system for functional nucleases
US11920128B2 (en) 2013-09-18 2024-03-05 Kymab Limited Methods, cells and organisms
US10023626B2 (en) 2013-09-30 2018-07-17 Modernatx, Inc. Polynucleotides encoding immune modulating polypeptides
US10815291B2 (en) 2013-09-30 2020-10-27 Modernatx, Inc. Polynucleotides encoding immune modulating polypeptides
US10385088B2 (en) 2013-10-02 2019-08-20 Modernatx, Inc. Polynucleotide molecules and uses thereof
US10780052B2 (en) 2013-10-22 2020-09-22 Translate Bio, Inc. CNS delivery of MRNA and uses thereof
US11224642B2 (en) 2013-10-22 2022-01-18 Translate Bio, Inc. MRNA therapy for argininosuccinate synthetase deficiency
US9629804B2 (en) 2013-10-22 2017-04-25 Shire Human Genetic Therapies, Inc. Lipid formulations for delivery of messenger RNA
US11890377B2 (en) 2013-10-22 2024-02-06 Translate Bio, Inc. Lipid formulations for delivery of messenger RNA
US10052284B2 (en) 2013-10-22 2018-08-21 Translate Bio, Inc. Lipid formulations for delivery of messenger RNA
US11377642B2 (en) 2013-10-22 2022-07-05 Translate Bio, Inc. mRNA therapy for phenylketonuria
US12533402B2 (en) 2013-10-22 2026-01-27 Translate Bio, Inc. MRNA therapy for argininosuccinate synthetase deficiency
US9522176B2 (en) 2013-10-22 2016-12-20 Shire Human Genetic Therapies, Inc. MRNA therapy for phenylketonuria
US12016954B2 (en) 2013-10-22 2024-06-25 Translate Bio, Inc. CNS delivery of mRNA and uses thereof
US10208295B2 (en) 2013-10-22 2019-02-19 Translate Bio, Inc. MRNA therapy for phenylketonuria
US10959953B2 (en) 2013-10-22 2021-03-30 Translate Bio, Inc. Lipid formulations for delivery of messenger RNA
US10493031B2 (en) 2013-10-22 2019-12-03 Translate Bio, Inc. Lipid formulations for delivery of messenger RNA
US12509666B2 (en) 2013-10-22 2025-12-30 Translate Bio, Inc. MRNA therapy for phenylketonuria
US10190137B2 (en) 2013-11-07 2019-01-29 Editas Medicine, Inc. CRISPR-related methods and compositions with governing gRNAS
US9834791B2 (en) 2013-11-07 2017-12-05 Editas Medicine, Inc. CRISPR-related methods and compositions with governing gRNAS
US11390887B2 (en) 2013-11-07 2022-07-19 Editas Medicine, Inc. CRISPR-related methods and compositions with governing gRNAS
US10640788B2 (en) 2013-11-07 2020-05-05 Editas Medicine, Inc. CRISPR-related methods and compositions with governing gRNAs
US11597919B2 (en) 2013-12-12 2023-03-07 The Broad Institute Inc. Systems, methods and compositions for sequence manipulation with optimized functional CRISPR-Cas systems
US11053481B2 (en) 2013-12-12 2021-07-06 President And Fellows Of Harvard College Fusions of Cas9 domains and nucleic acid-editing domains
US11591581B2 (en) 2013-12-12 2023-02-28 The Broad Institute, Inc. Compositions and methods of use of CRISPR-Cas systems in nucleotide repeat disorders
US12258595B2 (en) 2013-12-12 2025-03-25 The Broad Institute, Inc. Systems, methods and compositions for sequence manipulation with optimized functional CRISPR-Cas systems
US11124782B2 (en) 2013-12-12 2021-09-21 President And Fellows Of Harvard College Cas variants for gene editing
US11155795B2 (en) 2013-12-12 2021-10-26 The Broad Institute, Inc. CRISPR-Cas systems, crystal structure and uses thereof
US12421506B2 (en) 2013-12-12 2025-09-23 The Broad Institute, Inc. Engineering of systems, methods and optimized guide compositions with new architectures for sequence manipulation
US9068179B1 (en) 2013-12-12 2015-06-30 President And Fellows Of Harvard College Methods for correcting presenilin point mutations
US12251450B2 (en) 2013-12-12 2025-03-18 The Broad Institute, Inc. Delivery, use and therapeutic applications of the CRISPR-Cas systems and compositions for HBV and viral diseases and disorders
US12410435B2 (en) 2013-12-12 2025-09-09 The Broad Institute, Inc. Compositions and methods of use of CRISPR-Cas systems in nucleotide repeat disorders
US11407985B2 (en) 2013-12-12 2022-08-09 The Broad Institute, Inc. Delivery, use and therapeutic applications of the CRISPR-Cas systems and compositions for genome editing
US10550372B2 (en) 2013-12-12 2020-02-04 The Broad Institute, Inc. Systems, methods and compositions for sequence manipulation with optimized functional CRISPR-Cas systems
US12215365B2 (en) 2013-12-12 2025-02-04 President And Fellows Of Harvard College Cas variants for gene editing
US10851357B2 (en) 2013-12-12 2020-12-01 The Broad Institute, Inc. Compositions and methods of use of CRISPR-Cas systems in nucleotide repeat disorders
US10465176B2 (en) 2013-12-12 2019-11-05 President And Fellows Of Harvard College Cas variants for gene editing
US9840699B2 (en) 2013-12-12 2017-12-12 President And Fellows Of Harvard College Methods for nucleic acid editing
US10435715B2 (en) 2014-02-11 2019-10-08 The Regents Of The University Of Colorado, A Body Corporate CRISPR enabled multiplexed genome engineering
US10669559B2 (en) 2014-02-11 2020-06-02 The Regents Of The University Of Colorado, A Body Corporate CRISPR enabled multiplexed genome engineering
US10731180B2 (en) 2014-02-11 2020-08-04 The Regents Of The University Of Colorado CRISPR enabled multiplexed genome engineering
US10351877B2 (en) 2014-02-11 2019-07-16 The Regents Of The University Of Colorado, A Body Corporate CRISPR enabled multiplexed genome engineering
US10711284B2 (en) 2014-02-11 2020-07-14 The Regents Of The University Of Colorado CRISPR enabled multiplexed genome engineering
US11795479B2 (en) 2014-02-11 2023-10-24 The Regents Of The University Of Colorado CRISPR enabled multiplexed genome engineering
US10465207B2 (en) 2014-02-11 2019-11-05 The Regents Of The University Of Colorado, A Body Corporate CRISPR enabled multiplexed genome engineering
US11345933B2 (en) 2014-02-11 2022-05-31 The Regents Of The University Of Colorado CRISPR enabled multiplexed genome engineering
US10364442B2 (en) 2014-02-11 2019-07-30 The Regents Of The University Of Colorado, A Body Corporate CRISPR enabled multiplexed genome engineering
US10240167B2 (en) 2014-02-11 2019-03-26 Inscripta, Inc. CRISPR enabled multiplexed genome engineering
US10266849B2 (en) 2014-02-11 2019-04-23 The Regents Of The University Of Colorado, A Body Corporate CRISPR enabled multiplexed genome engineering
US11702677B2 (en) 2014-02-11 2023-07-18 The Regents Of The University Of Colorado CRISPR enabled multiplexed genome engineering
US9982278B2 (en) 2014-02-11 2018-05-29 The Regents Of The University Of Colorado, A Body Corporate CRISPR enabled multiplexed genome engineering
US11078498B2 (en) 2014-02-11 2021-08-03 The Regents Of The University Of Colorado, A Body Corporate CRISPR enabled multiplexed genome engineering
US11639511B2 (en) 2014-02-11 2023-05-02 The Regents Of The University Of Colorado, A Body Corporate CRISPR enabled multiplexed genome engineering
EP3134131B1 (en) 2014-04-23 2021-12-22 ModernaTX, Inc. Nucleic acid vaccines
EP4023249B1 (en) 2014-04-23 2024-10-09 ModernaTX, Inc. Nucleic acid vaccines
US12274743B2 (en) 2014-04-23 2025-04-15 Modernatx, Inc. Nucleic acid vaccines
EP3981437B1 (en) 2014-04-23 2024-10-09 ModernaTX, Inc. Nucleic acid vaccines
US12329812B2 (en) 2014-04-23 2025-06-17 Modernatx, Inc. Nucleic acid vaccines
US10155785B2 (en) 2014-04-25 2018-12-18 Translate Bio, Inc. Methods for purification of messenger RNA
US12060381B2 (en) 2014-04-25 2024-08-13 Translate Bio, Inc. Methods for purification of messenger RNA
US9850269B2 (en) 2014-04-25 2017-12-26 Translate Bio, Inc. Methods for purification of messenger RNA
US11884692B2 (en) 2014-04-25 2024-01-30 Translate Bio, Inc. Methods for purification of messenger RNA
US11059841B2 (en) 2014-04-25 2021-07-13 Translate Bio, Inc. Methods for purification of messenger RNA
US10293057B2 (en) 2014-05-30 2019-05-21 Translate Bio, Inc. Biodegradable lipids for delivery of nucleic acids
US10493166B2 (en) 2014-05-30 2019-12-03 Translate Bio, Inc. Biodegradable lipids for delivery of nucleic acids
US10912844B2 (en) 2014-05-30 2021-02-09 Translate Bio, Inc. Biodegradable lipids for delivery of nucleic acids
US10286083B2 (en) 2014-05-30 2019-05-14 Translate Bio, Inc. Biodegradable lipids for delivery of nucleic acids
US10286082B2 (en) 2014-05-30 2019-05-14 Translate Bio, Inc. Biodegradable lipids for delivery of nucleic acids
US11433144B2 (en) 2014-05-30 2022-09-06 Translate Bio, Inc. Biodegradable lipids for delivery of nucleic acids
US10022455B2 (en) 2014-05-30 2018-07-17 Translate Bio, Inc. Biodegradable lipids for delivery of nucleic acids
US10286086B2 (en) 2014-06-19 2019-05-14 Modernatx, Inc. Alternative nucleic acid molecules and uses thereof
US10138213B2 (en) 2014-06-24 2018-11-27 Translate Bio, Inc. Stereochemically enriched compositions for delivery of nucleic acids
US11104652B2 (en) 2014-06-24 2021-08-31 Translate Bio, Inc. Stereochemically enriched compositions for delivery of nucleic acids
US9668980B2 (en) 2014-07-02 2017-06-06 Rana Therapeutics, Inc. Encapsulation of messenger RNA
US10407683B2 (en) 2014-07-16 2019-09-10 Modernatx, Inc. Circular polynucleotides
US10077453B2 (en) 2014-07-30 2018-09-18 President And Fellows Of Harvard College CAS9 proteins including ligand-dependent inteins
US12398406B2 (en) 2014-07-30 2025-08-26 President And Fellows Of Harvard College CAS9 proteins including ligand-dependent inteins
US11578343B2 (en) 2014-07-30 2023-02-14 President And Fellows Of Harvard College CAS9 proteins including ligand-dependent inteins
US10704062B2 (en) 2014-07-30 2020-07-07 President And Fellows Of Harvard College CAS9 proteins including ligand-dependent inteins
US9943595B2 (en) 2014-12-05 2018-04-17 Translate Bio, Inc. Messenger RNA therapy for treatment of articular disease
US10864267B2 (en) 2014-12-05 2020-12-15 Translate Bio, Inc. Messenger RNA therapy for treatment of articular disease
US11998601B2 (en) 2014-12-05 2024-06-04 Translate Bio, Inc. Messenger RNA therapy for treatment of articular disease
US11624078B2 (en) 2014-12-12 2023-04-11 The Broad Institute, Inc. Protected guide RNAS (pgRNAS)
US10696986B2 (en) 2014-12-12 2020-06-30 The Board Institute, Inc. Protected guide RNAS (PGRNAS)
US12571005B2 (en) 2014-12-12 2026-03-10 The Broad Institute, Inc. Protected guide RNAs (pgRNAs)
US12435320B2 (en) 2014-12-24 2025-10-07 The Broad Institute, Inc. CRISPR having or associated with destabilization domains
US12215366B2 (en) 2015-02-09 2025-02-04 Duke University Compositions and methods for epigenome editing
US12129471B2 (en) 2015-02-23 2024-10-29 Vertex Pharmaceuticals Incorporated Materials and methods for treatment of human genetic diseases including hemoglobinopathies
US10738305B2 (en) 2015-02-23 2020-08-11 Vertex Pharmaceuticals Incorporated Materials and methods for treatment of hemoglobinopathies
WO2016135559A3 (en) * 2015-02-23 2016-10-20 Crispr Therapeutics Ag Materials and methods for treatment of human genetic diseases including hemoglobinopathies
US12134767B2 (en) 2015-02-23 2024-11-05 Vertex Pharmaceuticals Incorporated Materials and methods for treatment of hemoglobinopathies
EP3064587A1 (en) 2015-03-06 2016-09-07 Leibniz-Institut für Pflanzenbiochemie (IPB) Library of synthetic promoters for coordinated gene expression in eukaryotic cells or organisms
US11712463B2 (en) 2015-03-19 2023-08-01 Translate Bio, Inc. MRNA therapy for pompe disease
US10172924B2 (en) 2015-03-19 2019-01-08 Translate Bio, Inc. MRNA therapy for pompe disease
US11090368B2 (en) 2015-03-19 2021-08-17 Translate Bio, Inc. MRNA therapy for Pompe disease
EP4019635A1 (en) * 2015-03-25 2022-06-29 Editas Medicine, Inc. Crispr/cas-related methods, compositions and components
WO2016154596A1 (en) * 2015-03-25 2016-09-29 Editas Medicine, Inc. Crispr/cas-related methods, compositions and components
US11851652B2 (en) 2015-04-06 2023-12-26 The Board Of Trustees Of The Leland Stanford Junior Compositions comprising chemically modified guide RNAs for CRISPR/Cas-mediated editing of HBB
CN107787367B (en) * 2015-04-06 2021-10-26 里兰斯坦福初级大学理事会 Chemically modified guide RNAs for CRISPR/CAS mediated gene regulation
US11306309B2 (en) 2015-04-06 2022-04-19 The Board Of Trustees Of The Leland Stanford Junior University Chemically modified guide RNAs for CRISPR/CAS-mediated gene regulation
CN107787367A (en) * 2015-04-06 2018-03-09 里兰斯坦福初级大学理事会 Chemically modified guide RNAs for CRISPR/Cas-mediated gene regulation
US11535846B2 (en) 2015-04-06 2022-12-27 The Board Of Trustees Of The Leland Stanford Junior University Chemically modified guide RNAS for CRISPR/Cas-mediated gene regulation
US12059475B2 (en) * 2015-04-29 2024-08-13 Solmic Biotech GmbH Targeted nanocarriers for targeted drug delivery of gene therapeutics
US11390884B2 (en) 2015-05-11 2022-07-19 Editas Medicine, Inc. Optimized CRISPR/cas9 systems and methods for gene editing in stem cells
JP2018519801A (en) * 2015-05-11 2018-07-26 エディタス・メディシン、インコーポレイテッド Optimized CRISPR / CAS9 system and method for gene editing in stem cells
JP2022084601A (en) * 2015-05-11 2022-06-07 エディタス・メディシン、インコーポレイテッド Optimized CRISPR / CAS9 system and method for gene editing in stem cells
JP7030522B2 (en) 2015-05-11 2022-03-07 エディタス・メディシン、インコーポレイテッド Optimized CRISPR / CAS9 system and method for gene editing in stem cells
US10117911B2 (en) 2015-05-29 2018-11-06 Agenovir Corporation Compositions and methods to treat herpes simplex virus infections
WO2016197132A1 (en) 2015-06-04 2016-12-08 Protiva Biotherapeutics Inc. Treating hepatitis b virus infection using crispr
US10626393B2 (en) 2015-06-04 2020-04-21 Arbutus Biopharma Corporation Delivering CRISPR therapeutics with lipid nanoparticles
WO2016197133A1 (en) 2015-06-04 2016-12-08 Protiva Biotherapeutics, Inc. Delivering crispr therapeutics with lipid nanoparticles
US11578312B2 (en) 2015-06-18 2023-02-14 The Broad Institute Inc. Engineering and optimization of systems, methods, enzymes and guide scaffolds of CAS9 orthologs and variants for sequence manipulation
US12168789B2 (en) 2015-06-18 2024-12-17 The Broad Institute, Inc. Engineering and optimization of systems, methods, enzymes and guide scaffolds of CAS9 orthologs and variants for sequence manipulation
US12123032B2 (en) 2015-06-18 2024-10-22 The Broad Institute, Inc. CRISPR enzyme mutations reducing off-target effects
US10494621B2 (en) 2015-06-18 2019-12-03 The Broad Institute, Inc. Crispr enzyme mutations reducing off-target effects
US10876100B2 (en) 2015-06-18 2020-12-29 The Broad Institute, Inc. Crispr enzyme mutations reducing off-target effects
US11414657B2 (en) 2015-06-29 2022-08-16 Ionis Pharmaceuticals, Inc. Modified CRISPR RNA and modified single CRISPR RNA and uses thereof
EP4545544A2 (en) 2015-06-29 2025-04-30 Ionis Pharmaceuticals, Inc. MODIFIED CRISPR RNA AND MODIFIED SINGLE CRISPR RNA AND USES THEREOF
WO2017004261A1 (en) 2015-06-29 2017-01-05 Ionis Pharmaceuticals, Inc. Modified crispr rna and modified single crispr rna and uses thereof
JP2018519811A (en) * 2015-06-29 2018-07-26 アイオーニス ファーマシューティカルズ, インコーポレーテッドIonis Pharmaceuticals,Inc. Modified CRISPR RNA and modified single CRISPR RNA and uses thereof
WO2017024047A1 (en) * 2015-08-03 2017-02-09 Emendobio Inc. Compositions and methods for increasing nuclease induced recombination rate in cells
CN105002198A (en) * 2015-08-07 2015-10-28 北京蛋白质组研究中心 Complete set of products for culturing transgenic pig expressing human serum albumin and application thereof
CN105002198B (en) * 2015-08-07 2018-07-06 北京蛋白质组研究中心 For cultivating the complete sets of products of the transgene pig of expression human serum albumins and its application
US12109274B2 (en) 2015-09-17 2024-10-08 Modernatx, Inc. Polynucleotides containing a stabilizing tail region
US11434486B2 (en) 2015-09-17 2022-09-06 Modernatx, Inc. Polynucleotides containing a morpholino linker
US12071620B2 (en) 2015-09-17 2024-08-27 Modernatx, Inc. Polynucleotides containing a morpholino linker
WO2017053312A1 (en) * 2015-09-21 2017-03-30 The Regents Of The University Of California Compositions and methods for target nucleic acid modification
WO2017058795A1 (en) * 2015-09-29 2017-04-06 Agenovir Corporation Compositions and methods for latent viral transcription regulation
US11590157B2 (en) 2015-10-05 2023-02-28 Modernatx, Inc. Methods for therapeutic administration of messenger ribonucleic acid drugs
US12246030B2 (en) 2015-10-05 2025-03-11 Modernatx, Inc. Methods for therapeutic administration of messenger ribonucleic acid drugs
US10849920B2 (en) 2015-10-05 2020-12-01 Modernatx, Inc. Methods for therapeutic administration of messenger ribonucleic acid drugs
WO2017066497A3 (en) * 2015-10-13 2017-06-29 Duke University Genome engineering with type i crispr systems in eukaryotic cells
US11970710B2 (en) 2015-10-13 2024-04-30 Duke University Genome engineering with Type I CRISPR systems in eukaryotic cells
US11421251B2 (en) 2015-10-13 2022-08-23 Duke University Genome engineering with type I CRISPR systems in eukaryotic cells
US10144942B2 (en) 2015-10-14 2018-12-04 Translate Bio, Inc. Modification of RNA-related enzymes for enhanced production
US12577600B2 (en) 2015-10-14 2026-03-17 Translate Bio, Inc. Modification of RNA-related enzymes for enhanced production
US10995354B2 (en) 2015-10-14 2021-05-04 Translate Bio, Inc. Modification of RNA-related enzymes for enhanced production
EP3718565B1 (en) 2015-10-22 2022-04-27 ModernaTX, Inc. Respiratory virus vaccines
US11214780B2 (en) 2015-10-23 2022-01-04 President And Fellows Of Harvard College Nucleobase editors and uses thereof
US10167457B2 (en) 2015-10-23 2019-01-01 President And Fellows Of Harvard College Nucleobase editors and uses thereof
US12043852B2 (en) 2015-10-23 2024-07-23 President And Fellows Of Harvard College Evolved Cas9 proteins for gene editing
US12344869B2 (en) 2015-10-23 2025-07-01 President And Fellows Of Harvard College Nucleobase editors and uses thereof
US12043843B2 (en) 2015-11-04 2024-07-23 Vertex Pharmaceuticals Incorporated Materials and methods for treatment of hemoglobinopathies
US12214054B2 (en) 2015-11-30 2025-02-04 Duke University Therapeutic targets for the correction of the human dystrophin gene by gene editing and methods of use
JP7160891B2 (en) 2015-12-18 2022-10-25 ダニスコ・ユーエス・インク Methods and compositions for polymerase II (Pol-II)-based guide RNA expression
JP2021058209A (en) * 2015-12-18 2021-04-15 ダニスコ・ユーエス・インク Methods and compositions for polymerase ii (pol-ii) based guide rna expression
JPWO2017131237A1 (en) * 2016-01-30 2018-11-01 株式会社ボナック Artificial single guide RNA and its use
WO2017131237A1 (en) * 2016-01-30 2017-08-03 株式会社ボナック Artificial single guide rna and use thereof
JP2020198880A (en) * 2016-01-30 2020-12-17 株式会社ボナック Artificial single guide rna and use thereof
JP7096604B2 (en) 2016-01-30 2022-07-06 株式会社ボナック Artificial single guide RNA and its uses
US11518994B2 (en) 2016-01-30 2022-12-06 Bonac Corporation Artificial single guide RNA and use thereof
WO2017158153A1 (en) 2016-03-17 2017-09-21 Imba - Institut Für Molekulare Biotechnologie Gmbh Conditional crispr sgrna expression
EP3219799A1 (en) 2016-03-17 2017-09-20 IMBA-Institut für Molekulare Biotechnologie GmbH Conditional crispr sgrna expression
US11939579B2 (en) 2016-04-02 2024-03-26 Research Institute At Nationwide Children's Hospital Modified U6 promoter system for tissue specific expression
US10266843B2 (en) 2016-04-08 2019-04-23 Translate Bio, Inc. Multimeric coding nucleic acid and uses thereof
US10428349B2 (en) 2016-04-08 2019-10-01 Translate Bio, Inc. Multimeric coding nucleic acid and uses thereof
US11124804B2 (en) 2016-04-08 2021-09-21 Translate Bio, Inc. Multimeric coding nucleic acid and uses thereof
US12428631B2 (en) 2016-04-13 2025-09-30 Duke University CRISPR/Cas9-based repressors for silencing gene targets in vivo and methods of use
US10835583B2 (en) 2016-06-13 2020-11-17 Translate Bio, Inc. Messenger RNA therapy for the treatment of ornithine transcarbamylase deficiency
US12201677B2 (en) 2016-06-13 2025-01-21 Translate Bio, Inc. Messenger RNA therapy for the treatment of ornithine transcarbamylase deficiency
WO2017222370A1 (en) 2016-06-20 2017-12-28 Keygene N.V. Method for targeted dna alteration in plant cells
US11584928B2 (en) 2016-06-24 2023-02-21 The Regents Of The University Of Colorado, A Body Corporate Methods for generating barcoded combinatorial libraries
US10017760B2 (en) 2016-06-24 2018-07-10 Inscripta, Inc. Methods for generating barcoded combinatorial libraries
US10294473B2 (en) 2016-06-24 2019-05-21 The Regents Of The University Of Colorado, A Body Corporate Methods for generating barcoded combinatorial libraries
US12385034B2 (en) 2016-06-24 2025-08-12 Modernatx, Inc. Methods and apparatus for filtration
US10287575B2 (en) 2016-06-24 2019-05-14 The Regents Of The University Of Colorado, A Body Corporate Methods for generating barcoded combinatorial libraries
JP7362097B2 (en) 2016-06-27 2023-10-17 国立大学法人京都大学 How to control nucleases in a cell-specific manner
JPWO2018003339A1 (en) * 2016-06-27 2019-11-07 国立大学法人京都大学 Method for controlling cell-specific nuclease
WO2018003339A1 (en) * 2016-06-27 2018-01-04 国立大学法人京都大学 Method for cell-specifically controlling nuclease
WO2018009838A1 (en) 2016-07-07 2018-01-11 Rubius Therapeutics, Inc. Compositions and methods related to therapeutic cell systems expressing exogenous rna
US12214056B2 (en) 2016-07-19 2025-02-04 Duke University Therapeutic applications of CPF1-based genome editing
US11702651B2 (en) 2016-08-03 2023-07-18 President And Fellows Of Harvard College Adenosine nucleobase editors and uses thereof
US10947530B2 (en) 2016-08-03 2021-03-16 President And Fellows Of Harvard College Adenosine nucleobase editors and uses thereof
US11999947B2 (en) 2016-08-03 2024-06-04 President And Fellows Of Harvard College Adenosine nucleobase editors and uses thereof
US10113163B2 (en) 2016-08-03 2018-10-30 President And Fellows Of Harvard College Adenosine nucleobase editors and uses thereof
US11661590B2 (en) 2016-08-09 2023-05-30 President And Fellows Of Harvard College Programmable CAS9-recombinase fusion proteins and uses thereof
US11542509B2 (en) 2016-08-24 2023-01-03 President And Fellows Of Harvard College Incorporation of unnatural amino acids into proteins using base editing
US12084663B2 (en) 2016-08-24 2024-09-10 President And Fellows Of Harvard College Incorporation of unnatural amino acids into proteins using base editing
US12467045B2 (en) 2016-09-23 2025-11-11 Board Of Trustees Of Southern Illinois University Tuning CRISPR/Cas9 activity with chemically modified nucleotide substitutions
US11306305B2 (en) 2016-09-23 2022-04-19 Board Of Trustees Of Southern Illinois University Tuning CRISPR/Cas9 activity with chemically modified nucleotide substitutions
WO2018057946A3 (en) * 2016-09-23 2019-05-31 Board Of Trustees Of Southern Illinois University Tuning crispr/cas9 activity with chemically modified nucleotide substitutions
US11566237B2 (en) * 2016-09-23 2023-01-31 University Of Massachusetts Silencing of DUX4 by recombinant gene editing complexes
US11306324B2 (en) 2016-10-14 2022-04-19 President And Fellows Of Harvard College AAV delivery of nucleobase editors
US12318443B2 (en) 2016-11-11 2025-06-03 Modernatx, Inc. Influenza vaccine
US12409218B2 (en) 2016-11-11 2025-09-09 Modernatx, Inc. Influenza vaccine
WO2018115389A1 (en) 2016-12-22 2018-06-28 Keygene N.V. Methods of targeted genetic alteration in plant cells
US10745677B2 (en) 2016-12-23 2020-08-18 President And Fellows Of Harvard College Editing of CCR5 receptor gene to protect against HIV infection
US11820969B2 (en) 2016-12-23 2023-11-21 President And Fellows Of Harvard College Editing of CCR2 receptor gene to protect against HIV infection
US12559748B2 (en) 2017-02-06 2026-02-24 Novartis Ag Compositions and methods for the treatment of hemoglobinopathies
US11466271B2 (en) 2017-02-06 2022-10-11 Novartis Ag Compositions and methods for the treatment of hemoglobinopathies
WO2018149915A1 (en) 2017-02-15 2018-08-23 Keygene N.V. Methods of targeted genetic alteration in plant cells
US11253605B2 (en) 2017-02-27 2022-02-22 Translate Bio, Inc. Codon-optimized CFTR MRNA
US12390514B2 (en) 2017-03-09 2025-08-19 President And Fellows Of Harvard College Cancer vaccine
US11898179B2 (en) 2017-03-09 2024-02-13 President And Fellows Of Harvard College Suppression of pain by gene editing
US12516308B2 (en) 2017-03-09 2026-01-06 President And Fellows Of Harvard College Suppression of pain by gene editing
US12435331B2 (en) 2017-03-10 2025-10-07 President And Fellows Of Harvard College Cytosine to guanine base editor
US11542496B2 (en) 2017-03-10 2023-01-03 President And Fellows Of Harvard College Cytosine to guanine base editor
US11268082B2 (en) 2017-03-23 2022-03-08 President And Fellows Of Harvard College Nucleobase editors comprising nucleic acid programmable DNA binding proteins
WO2018172556A1 (en) * 2017-03-24 2018-09-27 Curevac Ag Nucleic acids encoding crispr-associated proteins and uses thereof
AU2018240515B2 (en) * 2017-03-24 2024-07-25 CureVac SE Nucleic acids encoding CRISPR-associated proteins and uses thereof
US12371699B2 (en) 2017-03-24 2025-07-29 CureVac SE Nucleic acids encoding CRISPR-associated proteins and uses thereof
KR102842382B1 (en) * 2017-03-24 2025-08-04 큐어백 에스이 Nucleic acid encoding a CRISPR-associated protein and uses thereof
US11739335B2 (en) 2017-03-24 2023-08-29 CureVac SE Nucleic acids encoding CRISPR-associated proteins and uses thereof
KR20190133699A (en) * 2017-03-24 2019-12-03 큐어백 아게 Nucleic acid encoding CRISPR-associated protein and uses thereof
CN110914433A (en) * 2017-03-24 2020-03-24 库尔维科公司 Nucleic acids encoding CRISPR-associated proteins and uses thereof
RU2775176C2 (en) * 2017-03-24 2022-06-28 Куревак Аг Nucleic acids encoding crispr-associated proteins, and their use
WO2018183808A1 (en) 2017-03-31 2018-10-04 Agenovir Corporation Antiviral therapeutic
US11560566B2 (en) 2017-05-12 2023-01-24 President And Fellows Of Harvard College Aptazyme-embedded guide RNAs for use with CRISPR-Cas9 in genome editing and transcriptional activation
US11173190B2 (en) 2017-05-16 2021-11-16 Translate Bio, Inc. Treatment of cystic fibrosis by delivery of codon-optimized mRNA encoding CFTR
US9982279B1 (en) 2017-06-23 2018-05-29 Inscripta, Inc. Nucleic acid-guided nucleases
US10011849B1 (en) 2017-06-23 2018-07-03 Inscripta, Inc. Nucleic acid-guided nucleases
US10626416B2 (en) 2017-06-23 2020-04-21 Inscripta, Inc. Nucleic acid-guided nucleases
US11697826B2 (en) 2017-06-23 2023-07-11 Inscripta, Inc. Nucleic acid-guided nucleases
US12195749B2 (en) 2017-06-23 2025-01-14 Inscripta, Inc. Nucleic acid-guided nucleases
US12180502B2 (en) 2017-06-23 2024-12-31 Inscripta, Inc. Nucleic acid-guided nucleases
US10435714B2 (en) 2017-06-23 2019-10-08 Inscripta, Inc. Nucleic acid-guided nucleases
US10337028B2 (en) 2017-06-23 2019-07-02 Inscripta, Inc. Nucleic acid-guided nucleases
US12359218B2 (en) 2017-07-28 2025-07-15 President And Fellows Of Harvard College Methods and compositions for evolving base editors using phage-assisted continuous evolution (PACE)
US11732274B2 (en) 2017-07-28 2023-08-22 President And Fellows Of Harvard College Methods and compositions for evolving base editors using phage-assisted continuous evolution (PACE)
US11319532B2 (en) 2017-08-30 2022-05-03 President And Fellows Of Harvard College High efficiency base editors comprising Gam
US11932884B2 (en) 2017-08-30 2024-03-19 President And Fellows Of Harvard College High efficiency base editors comprising Gam
WO2019048618A1 (en) 2017-09-08 2019-03-14 Keygene N.V. Balanced indels
IL273541B1 (en) * 2017-09-29 2025-06-01 Intellia Therapeutics Inc Formulations
CN111406108A (en) * 2017-09-29 2020-07-10 英特利亚治疗股份有限公司 Preparation
IL273541B2 (en) * 2017-09-29 2025-10-01 Intellia Therapeutics Inc Formulations
WO2019067992A1 (en) * 2017-09-29 2019-04-04 Intellia Therapeutics, Inc. Formulations
EP4385514A3 (en) * 2017-09-29 2024-10-23 Intellia Therapeutics, Inc. Formulations
US11697806B2 (en) 2017-09-29 2023-07-11 Intellia Therapeutics, Inc. Polynucleotides, compositions, and methods for genome editing
AU2018338915B2 (en) * 2017-09-29 2024-10-24 Intellia Therapeutics, Inc. Formulations
AU2018338915C1 (en) * 2017-09-29 2025-05-08 Intellia Therapeutics, Inc. Formulations
US11795443B2 (en) 2017-10-16 2023-10-24 The Broad Institute, Inc. Uses of adenosine base editors
KR20200071081A (en) * 2017-10-19 2020-06-18 큐어백 아게 New artificial nucleic acid molecule
KR102858623B1 (en) 2017-10-19 2025-09-10 큐어백 에스이 Novel artificial nucleic acid molecules
WO2019087113A1 (en) 2017-11-01 2019-05-09 Novartis Ag Synthetic rnas and methods of use
WO2019116346A1 (en) 2017-12-15 2019-06-20 Novartis Ag Polya tail length analysis of rna by mass spectrometry
US12406749B2 (en) 2017-12-15 2025-09-02 The Broad Institute, Inc. Systems and methods for predicting repair outcomes in genetic engineering
US11167043B2 (en) 2017-12-20 2021-11-09 Translate Bio, Inc. Composition and methods for treatment of ornithine transcarbamylase deficiency
US12268754B2 (en) 2017-12-20 2025-04-08 Translate Bio, Inc. Composition and methods for treatment of ornithine transcarbamylase deficiency
US12509492B2 (en) 2018-01-19 2025-12-30 Duke University Genome engineering with CRISPR-Cas systems in eukaryotes
US12492388B2 (en) 2018-02-05 2025-12-09 Vertex Pharmaceuticals Incorporated Materials and methods for treatment of hemoglobinopathies
US11268077B2 (en) 2018-02-05 2022-03-08 Vertex Pharmaceuticals Incorporated Materials and methods for treatment of hemoglobinopathies
US12084676B2 (en) 2018-02-23 2024-09-10 Pioneer Hi-Bred International, Inc. Cas9 orthologs
US12157760B2 (en) 2018-05-23 2024-12-03 The Broad Institute, Inc. Base editors and uses thereof
US12522807B2 (en) 2018-07-09 2026-01-13 The Broad Institute, Inc. RNA programmable epigenetic RNA modifiers and uses thereof
US11174500B2 (en) 2018-08-24 2021-11-16 Translate Bio, Inc. Methods for purification of messenger RNA
US12084702B2 (en) 2018-08-24 2024-09-10 Translate Bio, Inc. Methods for purification of messenger RNA
US12281338B2 (en) 2018-10-29 2025-04-22 The Broad Institute, Inc. Nucleobase editors comprising GeoCas9 and uses thereof
WO2020089448A1 (en) 2018-11-01 2020-05-07 Keygene N.V. Dual guide rna for crispr/cas genome editing in plants cells
US12195505B2 (en) 2018-11-21 2025-01-14 Translate Bio, Inc. Treatment of cystic fibrosis by delivery of nebulized mRNA encoding CFTR
US12215364B2 (en) 2018-12-14 2025-02-04 Pioneer Hi-Bred International, Inc. CRISPR-cas systems for genome editing
US11807878B2 (en) 2018-12-14 2023-11-07 Pioneer Hi-Bred International, Inc. CRISPR-Cas systems for genome editing
US10934536B2 (en) 2018-12-14 2021-03-02 Pioneer Hi-Bred International, Inc. CRISPR-CAS systems for genome editing
US12351837B2 (en) 2019-01-23 2025-07-08 The Broad Institute, Inc. Supernegatively charged proteins and uses thereof
WO2020163379A1 (en) 2019-02-05 2020-08-13 Emendobio Inc. Crispr compositions and methods for promoting gene editing of ribosomal protein s19 (rps19) gene
US12509680B2 (en) 2019-03-19 2025-12-30 The Broad Institute, Inc. Methods and compositions for prime editing nucleotide sequences
US11795452B2 (en) 2019-03-19 2023-10-24 The Broad Institute, Inc. Methods and compositions for prime editing nucleotide sequences
US12570972B2 (en) 2019-03-19 2026-03-10 The Broad Institute, Inc. Methods and compositions for prime editing nucleotide sequences
US11643652B2 (en) 2019-03-19 2023-05-09 The Broad Institute, Inc. Methods and compositions for prime editing nucleotide sequences
US12281303B2 (en) 2019-03-19 2025-04-22 The Broad Institute, Inc. Methods and compositions for prime editing nucleotide sequences
US11447770B1 (en) 2019-03-19 2022-09-20 The Broad Institute, Inc. Methods and compositions for prime editing nucleotide sequences
US12473543B2 (en) 2019-04-17 2025-11-18 The Broad Institute, Inc. Adenine base editors with reduced off-target effects
US12611442B2 (en) 2019-09-20 2026-04-28 Translate Bio, Inc. mRNA encoding engineered CFTR
US12435330B2 (en) 2019-10-10 2025-10-07 The Broad Institute, Inc. Methods and compositions for prime editing RNA
US12031126B2 (en) 2020-05-08 2024-07-09 The Broad Institute, Inc. Methods and compositions for simultaneous editing of both strands of a target double-stranded nucleotide sequence
US11912985B2 (en) 2020-05-08 2024-02-27 The Broad Institute, Inc. Methods and compositions for simultaneous editing of both strands of a target double-stranded nucleotide sequence
WO2022171783A1 (en) 2021-02-11 2022-08-18 Koninklijke Nederlandse Akademie Van Wetenschappen Curing disease by transcription regulatory gene editing
WO2023185697A2 (en) 2022-03-29 2023-10-05 Accuredit Therapeutics (Suzhou) Co., Ltd. Compositions and methods for treatment of transthyretin amyloidosis
US12098399B2 (en) 2022-06-24 2024-09-24 Tune Therapeutics, Inc. Compositions, systems, and methods for epigenetic regulation of proprotein convertase subtilisin/kexin type 9 (PCSK9) gene expression
WO2024023067A1 (en) 2022-07-25 2024-02-01 Koninklijke Nederlandse Akademie Van Wetenschappen Curing disease by transcription regulatory gene editing
WO2024061296A2 (en) 2022-09-22 2024-03-28 Accuredit Therapeutics (Suzhou) Co., Ltd. Compositions and methods for treatment of hypercholesterolemia and/or cardiovascular disease
US12390538B2 (en) 2023-05-15 2025-08-19 Nchroma Bio, Inc. Compositions and methods for epigenetic regulation of HBV gene expression
WO2025194138A1 (en) 2024-03-14 2025-09-18 Tessera Therapeutics, Inc. St1cas9 compositions and methods for modulating a genome

Also Published As

Publication number Publication date
EP3971287A1 (en) 2022-03-23
JP2022164843A (en) 2022-10-27
JP7225456B2 (en) 2023-02-20
ES2896755T3 (en) 2022-02-25
EP3019619A4 (en) 2017-01-11
JP2022115896A (en) 2022-08-09
RS62529B1 (en) 2021-11-30
US11027025B2 (en) 2021-06-08
JP7136826B2 (en) 2022-09-13
PT3019619T (en) 2021-11-11
JP2020108379A (en) 2020-07-16
CY1124740T1 (en) 2022-07-22
AU2014287009B2 (en) 2020-10-29
EP3019619B1 (en) 2021-08-25
SMT202100691T1 (en) 2022-01-10
AU2014287009A1 (en) 2016-02-11
JP7019233B2 (en) 2022-02-15
US20160367702A1 (en) 2016-12-22
US20220111079A1 (en) 2022-04-14
CA2917348A1 (en) 2015-01-15
EP3019619A2 (en) 2016-05-18
JP2016523564A (en) 2016-08-12
AU2021200486A1 (en) 2021-02-25
AU2021200486B2 (en) 2023-08-31
HRP20211563T1 (en) 2022-01-07
SI3019619T1 (en) 2021-12-31
DK3019619T3 (en) 2021-10-11
HUE056760T2 (en) 2022-03-28
LT3019619T (en) 2021-12-10
PL3019619T3 (en) 2022-01-10
WO2015006747A3 (en) 2015-04-23

Similar Documents

Publication Publication Date Title
JP7225456B2 (en) Compositions Comprising Synthetic Polynucleotides Encoding CRISPR-Related Proteins and Synthetic sgRNAs and Methods of Use
EP2970987B1 (en) Compositions and methods of altering cholesterol levels
US9790531B2 (en) Enzymes and polymerases for the synthesis of RNA
US20180291335A1 (en) Modified polynucleotides for altering cell phenotype
US20160024181A1 (en) Long-lived polynucleotide molecules
AU2017202228A1 (en) Terminally modified RNA
EP3052521A1 (en) Polynucleotides encoding low density lipoprotein receptor
EP3171895A1 (en) Modified polynucleotides for the production of intrabodies
HK40070836A (en) Compositions comprising synthetic polynucleotides encoding crispr related proteins and synthetic sgrnas and methods of use
HK1224700B (en) Compositions comprising synthetic polynucleotides encoding crispr related proteins and synthetic sgrnas and methods of use
HK1220489B (en) Compositions and methods of altering cholesterol levels

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 14823392

Country of ref document: EP

Kind code of ref document: A2

ENP Entry into the national phase

Ref document number: 2917348

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2016525829

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 14903869

Country of ref document: US

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 2014823392

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2014287009

Country of ref document: AU

Date of ref document: 20140711

Kind code of ref document: A

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 14823392

Country of ref document: EP

Kind code of ref document: A2

WWW Wipo information: withdrawn in national office

Ref document number: 2014823392

Country of ref document: EP