WO2014210358A1 - Methods and compositions for dengue virus vaccines - Google Patents
Methods and compositions for dengue virus vaccines Download PDFInfo
- Publication number
- WO2014210358A1 WO2014210358A1 PCT/US2014/044410 US2014044410W WO2014210358A1 WO 2014210358 A1 WO2014210358 A1 WO 2014210358A1 US 2014044410 W US2014044410 W US 2014044410W WO 2014210358 A1 WO2014210358 A1 WO 2014210358A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- glycoprotein
- dengue virus
- subject
- dengue
- chimeric
- Prior art date
Links
- 239000000203 mixture Substances 0.000 title claims abstract description 79
- 238000000034 method Methods 0.000 title claims abstract description 40
- 229940023605 dengue virus vaccine Drugs 0.000 title description 4
- 241000725619 Dengue virus Species 0.000 claims abstract description 100
- 108090000288 Glycoproteins Proteins 0.000 claims abstract description 72
- 102000003886 Glycoproteins Human genes 0.000 claims abstract description 71
- 238000006467 substitution reaction Methods 0.000 claims abstract description 11
- 125000003275 alpha amino acid group Chemical group 0.000 claims abstract 3
- 241000710831 Flavivirus Species 0.000 claims description 49
- 108020004707 nucleic acids Proteins 0.000 claims description 47
- 102000039446 nucleic acids Human genes 0.000 claims description 47
- 150000007523 nucleic acids Chemical class 0.000 claims description 47
- 206010012310 Dengue fever Diseases 0.000 claims description 43
- 241000700605 Viruses Species 0.000 claims description 42
- 208000025729 dengue disease Diseases 0.000 claims description 41
- 239000002245 particle Substances 0.000 claims description 33
- 208000001490 Dengue Diseases 0.000 claims description 26
- 230000028993 immune response Effects 0.000 claims description 23
- 208000015181 infectious disease Diseases 0.000 claims description 18
- 239000003937 drug carrier Substances 0.000 claims description 12
- 230000000694 effects Effects 0.000 claims description 9
- 239000002253 acid Substances 0.000 claims 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 claims 1
- 108090000765 processed proteins & peptides Proteins 0.000 description 40
- 150000001413 amino acids Chemical group 0.000 description 34
- 102000004196 processed proteins & peptides Human genes 0.000 description 34
- 239000002671 adjuvant Substances 0.000 description 28
- 229920001184 polypeptide Polymers 0.000 description 25
- 238000009472 formulation Methods 0.000 description 20
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 17
- 239000008194 pharmaceutical composition Substances 0.000 description 17
- 210000004027 cell Anatomy 0.000 description 16
- 210000004201 immune sera Anatomy 0.000 description 15
- 229940042743 immune sera Drugs 0.000 description 15
- 230000003472 neutralizing effect Effects 0.000 description 15
- 108090000695 Cytokines Proteins 0.000 description 14
- 102000004127 Cytokines Human genes 0.000 description 14
- 230000002163 immunogen Effects 0.000 description 13
- 230000001681 protective effect Effects 0.000 description 13
- 108090000623 proteins and genes Proteins 0.000 description 13
- 239000007788 liquid Substances 0.000 description 12
- 125000003729 nucleotide group Chemical group 0.000 description 12
- 102000004169 proteins and genes Human genes 0.000 description 12
- 201000010099 disease Diseases 0.000 description 11
- 239000002773 nucleotide Substances 0.000 description 11
- 239000013598 vector Substances 0.000 description 11
- 239000007787 solid Substances 0.000 description 10
- 239000000427 antigen Substances 0.000 description 9
- 108091007433 antigens Proteins 0.000 description 9
- 102000036639 antigens Human genes 0.000 description 9
- 239000012634 fragment Substances 0.000 description 9
- 230000036039 immunity Effects 0.000 description 9
- 239000000243 solution Substances 0.000 description 9
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 9
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 8
- -1 antibodies Substances 0.000 description 8
- 238000004519 manufacturing process Methods 0.000 description 8
- 230000002265 prevention Effects 0.000 description 8
- 229960005486 vaccine Drugs 0.000 description 8
- 239000000443 aerosol Substances 0.000 description 7
- 238000003556 assay Methods 0.000 description 7
- 150000001875 compounds Chemical class 0.000 description 7
- 235000002639 sodium chloride Nutrition 0.000 description 7
- 108020004414 DNA Proteins 0.000 description 6
- 241001465754 Metazoa Species 0.000 description 6
- 208000035475 disorder Diseases 0.000 description 6
- 239000000839 emulsion Substances 0.000 description 6
- 230000006870 function Effects 0.000 description 6
- 230000002458 infectious effect Effects 0.000 description 6
- 238000006386 neutralization reaction Methods 0.000 description 6
- 108091033319 polynucleotide Chemical group 0.000 description 6
- 239000002157 polynucleotide Chemical group 0.000 description 6
- 102000040430 polynucleotide Human genes 0.000 description 6
- 239000000725 suspension Substances 0.000 description 6
- 208000024891 symptom Diseases 0.000 description 6
- 230000003612 virological effect Effects 0.000 description 6
- 101710204837 Envelope small membrane protein Proteins 0.000 description 5
- 101710145006 Lysis protein Proteins 0.000 description 5
- 241000282560 Macaca mulatta Species 0.000 description 5
- 206010058874 Viraemia Diseases 0.000 description 5
- 230000001154 acute effect Effects 0.000 description 5
- 230000008901 benefit Effects 0.000 description 5
- 239000000969 carrier Substances 0.000 description 5
- 239000003795 chemical substances by application Substances 0.000 description 5
- 230000003053 immunization Effects 0.000 description 5
- 239000004615 ingredient Substances 0.000 description 5
- 238000002347 injection Methods 0.000 description 5
- 239000007924 injection Substances 0.000 description 5
- 239000000843 powder Substances 0.000 description 5
- 230000004044 response Effects 0.000 description 5
- 239000003826 tablet Substances 0.000 description 5
- 241000282326 Felis catus Species 0.000 description 4
- 241001123946 Gaga Species 0.000 description 4
- 230000000890 antigenic effect Effects 0.000 description 4
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 4
- 239000003085 diluting agent Substances 0.000 description 4
- 108020001507 fusion proteins Proteins 0.000 description 4
- 102000037865 fusion proteins Human genes 0.000 description 4
- 229940035032 monophosphoryl lipid a Drugs 0.000 description 4
- 210000002966 serum Anatomy 0.000 description 4
- 239000011780 sodium chloride Substances 0.000 description 4
- 239000000126 substance Substances 0.000 description 4
- 239000004094 surface-active agent Substances 0.000 description 4
- 230000001225 therapeutic effect Effects 0.000 description 4
- 210000001519 tissue Anatomy 0.000 description 4
- 238000002255 vaccination Methods 0.000 description 4
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 3
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 3
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 3
- 208000009714 Severe Dengue Diseases 0.000 description 3
- 241000710772 Yellow fever virus Species 0.000 description 3
- 230000005875 antibody response Effects 0.000 description 3
- 239000007864 aqueous solution Substances 0.000 description 3
- 239000000872 buffer Substances 0.000 description 3
- 239000008121 dextrose Substances 0.000 description 3
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 3
- 239000002552 dosage form Substances 0.000 description 3
- 150000002148 esters Chemical class 0.000 description 3
- 239000008187 granular material Substances 0.000 description 3
- 230000002519 immonomodulatory effect Effects 0.000 description 3
- 238000002649 immunization Methods 0.000 description 3
- 238000001990 intravenous administration Methods 0.000 description 3
- 230000000670 limiting effect Effects 0.000 description 3
- 238000013507 mapping Methods 0.000 description 3
- 238000012986 modification Methods 0.000 description 3
- 230000004048 modification Effects 0.000 description 3
- 239000003921 oil Substances 0.000 description 3
- 239000002953 phosphate buffered saline Substances 0.000 description 3
- 230000003389 potentiating effect Effects 0.000 description 3
- 238000002360 preparation method Methods 0.000 description 3
- 230000002829 reductive effect Effects 0.000 description 3
- 238000011160 research Methods 0.000 description 3
- 150000003839 salts Chemical class 0.000 description 3
- 210000003491 skin Anatomy 0.000 description 3
- 230000000638 stimulation Effects 0.000 description 3
- 230000000699 topical effect Effects 0.000 description 3
- 229940051021 yellow-fever virus Drugs 0.000 description 3
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 2
- 108010029697 CD40 Ligand Proteins 0.000 description 2
- 102100032937 CD40 ligand Human genes 0.000 description 2
- 241000282693 Cercopithecidae Species 0.000 description 2
- 238000002965 ELISA Methods 0.000 description 2
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 2
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 2
- 108010002350 Interleukin-2 Proteins 0.000 description 2
- 102000000588 Interleukin-2 Human genes 0.000 description 2
- XEEYBQQBJWHFJM-UHFFFAOYSA-N Iron Chemical compound [Fe] XEEYBQQBJWHFJM-UHFFFAOYSA-N 0.000 description 2
- 241000710842 Japanese encephalitis virus Species 0.000 description 2
- 240000007472 Leucaena leucocephala Species 0.000 description 2
- 235000010643 Leucaena leucocephala Nutrition 0.000 description 2
- 241000282553 Macaca Species 0.000 description 2
- WCUXLLCKKVVCTQ-UHFFFAOYSA-M Potassium chloride Chemical compound [Cl-].[K+] WCUXLLCKKVVCTQ-UHFFFAOYSA-M 0.000 description 2
- 241000288906 Primates Species 0.000 description 2
- 101710172711 Structural protein Proteins 0.000 description 2
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 2
- 229930006000 Sucrose Natural products 0.000 description 2
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 2
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 description 2
- AZDRQVAHHNSJOQ-UHFFFAOYSA-N alumane Chemical class [AlH3] AZDRQVAHHNSJOQ-UHFFFAOYSA-N 0.000 description 2
- 239000003963 antioxidant agent Substances 0.000 description 2
- 238000013459 approach Methods 0.000 description 2
- 239000008365 aqueous carrier Substances 0.000 description 2
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 2
- 239000011230 binding agent Substances 0.000 description 2
- 230000015572 biosynthetic process Effects 0.000 description 2
- 229940031416 bivalent vaccine Drugs 0.000 description 2
- 210000004369 blood Anatomy 0.000 description 2
- 239000008280 blood Substances 0.000 description 2
- 239000002775 capsule Substances 0.000 description 2
- 239000003153 chemical reaction reagent Substances 0.000 description 2
- 235000012000 cholesterol Nutrition 0.000 description 2
- 238000010276 construction Methods 0.000 description 2
- 238000007796 conventional method Methods 0.000 description 2
- 201000002950 dengue hemorrhagic fever Diseases 0.000 description 2
- 238000013461 design Methods 0.000 description 2
- 235000014113 dietary fatty acids Nutrition 0.000 description 2
- 238000010790 dilution Methods 0.000 description 2
- 239000012895 dilution Substances 0.000 description 2
- 239000003814 drug Substances 0.000 description 2
- 239000003995 emulsifying agent Substances 0.000 description 2
- 239000000194 fatty acid Substances 0.000 description 2
- 229930195729 fatty acid Natural products 0.000 description 2
- 150000004665 fatty acids Chemical class 0.000 description 2
- 230000003394 haemopoietic effect Effects 0.000 description 2
- 230000036541 health Effects 0.000 description 2
- 238000002169 hydrotherapy Methods 0.000 description 2
- 230000003308 immunostimulating effect Effects 0.000 description 2
- 230000001965 increasing effect Effects 0.000 description 2
- 230000001939 inductive effect Effects 0.000 description 2
- 238000007918 intramuscular administration Methods 0.000 description 2
- 238000007913 intrathecal administration Methods 0.000 description 2
- 239000007937 lozenge Substances 0.000 description 2
- 239000000463 material Substances 0.000 description 2
- 230000008774 maternal effect Effects 0.000 description 2
- 230000003278 mimic effect Effects 0.000 description 2
- 238000000465 moulding Methods 0.000 description 2
- 229940031348 multivalent vaccine Drugs 0.000 description 2
- 230000035772 mutation Effects 0.000 description 2
- 239000006199 nebulizer Substances 0.000 description 2
- 235000019198 oils Nutrition 0.000 description 2
- 238000007911 parenteral administration Methods 0.000 description 2
- 230000036961 partial effect Effects 0.000 description 2
- 239000008177 pharmaceutical agent Substances 0.000 description 2
- 229920001223 polyethylene glycol Polymers 0.000 description 2
- 235000010482 polyoxyethylene sorbitan monooleate Nutrition 0.000 description 2
- 229920000053 polysorbate 80 Polymers 0.000 description 2
- 230000008569 process Effects 0.000 description 2
- 230000035755 proliferation Effects 0.000 description 2
- 230000009467 reduction Effects 0.000 description 2
- 238000007493 shaping process Methods 0.000 description 2
- 210000002027 skeletal muscle Anatomy 0.000 description 2
- 238000007920 subcutaneous administration Methods 0.000 description 2
- 239000005720 sucrose Substances 0.000 description 2
- 238000012546 transfer Methods 0.000 description 2
- 239000003981 vehicle Substances 0.000 description 2
- 239000000080 wetting agent Substances 0.000 description 2
- KIUKXJAPPMFGSW-DNGZLQJQSA-N (2S,3S,4S,5R,6R)-6-[(2S,3R,4R,5S,6R)-3-Acetamido-2-[(2S,3S,4R,5R,6R)-6-[(2R,3R,4R,5S,6R)-3-acetamido-2,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl]oxy-2-carboxy-4,5-dihydroxyoxan-3-yl]oxy-5-hydroxy-6-(hydroxymethyl)oxan-4-yl]oxy-3,4,5-trihydroxyoxane-2-carboxylic acid Chemical compound CC(=O)N[C@H]1[C@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O[C@H]1[C@H](O)[C@@H](O)[C@H](O[C@H]2[C@@H]([C@@H](O[C@H]3[C@@H]([C@@H](O)[C@H](O)[C@H](O3)C(O)=O)O)[C@H](O)[C@@H](CO)O2)NC(C)=O)[C@@H](C(O)=O)O1 KIUKXJAPPMFGSW-DNGZLQJQSA-N 0.000 description 1
- IIZPXYDJLKNOIY-JXPKJXOSSA-N 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCC\C=C/C\C=C/C\C=C/C\C=C/CCCCC IIZPXYDJLKNOIY-JXPKJXOSSA-N 0.000 description 1
- CYDQOEWLBCCFJZ-UHFFFAOYSA-N 4-(4-fluorophenyl)oxane-4-carboxylic acid Chemical compound C=1C=C(F)C=CC=1C1(C(=O)O)CCOCC1 CYDQOEWLBCCFJZ-UHFFFAOYSA-N 0.000 description 1
- 241000023308 Acca Species 0.000 description 1
- 229920001817 Agar Polymers 0.000 description 1
- 101100351528 Arabidopsis thaliana THAS1 gene Proteins 0.000 description 1
- 241000894006 Bacteria Species 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 1
- UXVMQQNJUSDDNG-UHFFFAOYSA-L Calcium chloride Chemical compound [Cl-].[Cl-].[Ca+2] UXVMQQNJUSDDNG-UHFFFAOYSA-L 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- 108090000565 Capsid Proteins Proteins 0.000 description 1
- 241000700199 Cavia porcellus Species 0.000 description 1
- 108010039939 Cell Wall Skeleton Proteins 0.000 description 1
- 241000272165 Charadriidae Species 0.000 description 1
- 102000019034 Chemokines Human genes 0.000 description 1
- 108010012236 Chemokines Proteins 0.000 description 1
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 1
- 108020004705 Codon Proteins 0.000 description 1
- 102000036364 Cullin Ring E3 Ligases Human genes 0.000 description 1
- LVGKNOAMLMIIKO-UHFFFAOYSA-N Elaidinsaeure-aethylester Natural products CCCCCCCCC=CCCCCCCCC(=O)OCC LVGKNOAMLMIIKO-UHFFFAOYSA-N 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 241000283074 Equus asinus Species 0.000 description 1
- 241000283073 Equus caballus Species 0.000 description 1
- 241001200922 Gagata Species 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- 241000282575 Gorilla Species 0.000 description 1
- 241000238631 Hexapoda Species 0.000 description 1
- 229930010555 Inosine Natural products 0.000 description 1
- UGQMRVRMYYASKQ-KQYNXXCUSA-N Inosine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C2=NC=NC(O)=C2N=C1 UGQMRVRMYYASKQ-KQYNXXCUSA-N 0.000 description 1
- 241000134253 Lanka Species 0.000 description 1
- 241000699666 Mus <mouse, genus> Species 0.000 description 1
- 101100476480 Mus musculus S100a8 gene Proteins 0.000 description 1
- 241000282341 Mustela putorius furo Species 0.000 description 1
- 108700015872 N-acetyl-nor-muramyl-L-alanyl-D-isoglutamine Proteins 0.000 description 1
- 238000005481 NMR spectroscopy Methods 0.000 description 1
- 101710163270 Nuclease Proteins 0.000 description 1
- 108091028043 Nucleic acid sequence Proteins 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 241000282577 Pan troglodytes Species 0.000 description 1
- 241001504519 Papio ursinus Species 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 241000009328 Perro Species 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 1
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 1
- VMHLLURERBWHNL-UHFFFAOYSA-M Sodium acetate Chemical compound [Na+].CC([O-])=O VMHLLURERBWHNL-UHFFFAOYSA-M 0.000 description 1
- 108700027479 Syntex adjuvant formulation Proteins 0.000 description 1
- 230000024932 T cell mediated immunity Effects 0.000 description 1
- 108091008874 T cell receptors Proteins 0.000 description 1
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 1
- 210000001744 T-lymphocyte Anatomy 0.000 description 1
- 235000012308 Tagetes Nutrition 0.000 description 1
- 241000736851 Tagetes Species 0.000 description 1
- 108010074506 Transfer Factor Proteins 0.000 description 1
- 241000625014 Vir Species 0.000 description 1
- 241000710886 West Nile virus Species 0.000 description 1
- HCHKCACWOHOZIP-UHFFFAOYSA-N Zinc Chemical compound [Zn] HCHKCACWOHOZIP-UHFFFAOYSA-N 0.000 description 1
- FHICGHSMIPIAPL-HDYAAECPSA-N [2-[3-[6-[3-[(5R,6aS,6bR,12aR)-10-[6-[2-[2-[4,5-dihydroxy-3-(3,4,5-trihydroxyoxan-2-yl)oxyoxan-2-yl]ethoxy]ethyl]-3,4,5-trihydroxyoxan-2-yl]oxy-5-hydroxy-2,2,6a,6b,9,9,12a-heptamethyl-1,3,4,5,6,6a,7,8,8a,10,11,12,13,14b-tetradecahydropicene-4a-carbonyl]peroxypropyl]-5-[[5-[8-[3,5-dihydroxy-4-(3,4,5-trihydroxyoxan-2-yl)oxyoxan-2-yl]octoxy]-3,4-dihydroxy-6-methyloxan-2-yl]methoxy]-3,4-dihydroxyoxan-2-yl]propoxymethyl]-5-hydroxy-3-[(6S)-6-hydroxy-2,6-dimethylocta-2,7-dienoyl]oxy-6-methyloxan-4-yl] (2E,6S)-6-hydroxy-2-(hydroxymethyl)-6-methylocta-2,7-dienoate Chemical compound C=C[C@@](C)(O)CCC=C(C)C(=O)OC1C(OC(=O)C(\CO)=C\CC[C@](C)(O)C=C)C(O)C(C)OC1COCCCC1C(O)C(O)C(OCC2C(C(O)C(OCCCCCCCCC3C(C(OC4C(C(O)C(O)CO4)O)C(O)CO3)O)C(C)O2)O)C(CCCOOC(=O)C23C(CC(C)(C)CC2)C=2[C@@]([C@]4(C)CCC5C(C)(C)C(OC6C(C(O)C(O)C(CCOCCC7C(C(O)C(O)CO7)OC7C(C(O)C(O)CO7)O)O6)O)CC[C@]5(C)C4CC=2)(C)C[C@H]3O)O1 FHICGHSMIPIAPL-HDYAAECPSA-N 0.000 description 1
- CUJRVFIICFDLGR-UHFFFAOYSA-N acetylacetonate Chemical compound CC(=O)[CH-]C(C)=O CUJRVFIICFDLGR-UHFFFAOYSA-N 0.000 description 1
- 239000004480 active ingredient Substances 0.000 description 1
- 239000013543 active substance Substances 0.000 description 1
- 239000000654 additive Substances 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 239000008272 agar Substances 0.000 description 1
- 150000001298 alcohols Chemical class 0.000 description 1
- 125000001931 aliphatic group Chemical group 0.000 description 1
- 208000026935 allergic disease Diseases 0.000 description 1
- NWMHDZMRVUOQGL-CZEIJOLGSA-N almurtide Chemical compound OC(=O)CC[C@H](C(N)=O)NC(=O)[C@H](C)NC(=O)CO[C@@H]([C@H](O)[C@H](O)CO)[C@@H](NC(C)=O)C=O NWMHDZMRVUOQGL-CZEIJOLGSA-N 0.000 description 1
- 229940037003 alum Drugs 0.000 description 1
- WNROFYMDJYEPJX-UHFFFAOYSA-K aluminium hydroxide Chemical compound [OH-].[OH-].[OH-].[Al+3] WNROFYMDJYEPJX-UHFFFAOYSA-K 0.000 description 1
- ILRRQNADMUWWFW-UHFFFAOYSA-K aluminium phosphate Chemical compound O1[Al]2OP1(=O)O2 ILRRQNADMUWWFW-UHFFFAOYSA-K 0.000 description 1
- 229940024545 aluminum hydroxide Drugs 0.000 description 1
- 229940024546 aluminum hydroxide gel Drugs 0.000 description 1
- SMYKVLBUSSNXMV-UHFFFAOYSA-K aluminum;trihydroxide;hydrate Chemical compound O.[OH-].[OH-].[OH-].[Al+3] SMYKVLBUSSNXMV-UHFFFAOYSA-K 0.000 description 1
- 230000001668 ameliorated effect Effects 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- 239000004599 antimicrobial Substances 0.000 description 1
- 230000002238 attenuated effect Effects 0.000 description 1
- 210000003719 b-lymphocyte Anatomy 0.000 description 1
- 230000003385 bacteriostatic effect Effects 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 239000011575 calcium Substances 0.000 description 1
- 229910052791 calcium Inorganic materials 0.000 description 1
- 239000001110 calcium chloride Substances 0.000 description 1
- 229910001628 calcium chloride Inorganic materials 0.000 description 1
- 235000011148 calcium chloride Nutrition 0.000 description 1
- 125000004432 carbon atom Chemical group C* 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 210000004534 cecum Anatomy 0.000 description 1
- 210000004520 cell wall skeleton Anatomy 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- 230000008614 cellular interaction Effects 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- 239000002738 chelating agent Substances 0.000 description 1
- 229940110456 cocoa butter Drugs 0.000 description 1
- 235000019868 cocoa butter Nutrition 0.000 description 1
- 230000000536 complexating effect Effects 0.000 description 1
- 239000007891 compressed tablet Substances 0.000 description 1
- 238000004590 computer program Methods 0.000 description 1
- 239000006071 cream Substances 0.000 description 1
- GVJHHUAWPYXKBD-UHFFFAOYSA-N d-alpha-tocopherol Natural products OC1=C(C)C(C)=C2OC(CCCC(C)CCCC(C)CCCC(C)C)(C)CCC2=C1C GVJHHUAWPYXKBD-UHFFFAOYSA-N 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 230000003111 delayed effect Effects 0.000 description 1
- 230000002939 deleterious effect Effects 0.000 description 1
- 201000009892 dengue shock syndrome Diseases 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 230000004069 differentiation Effects 0.000 description 1
- 102000038379 digestive enzymes Human genes 0.000 description 1
- 108091007734 digestive enzymes Proteins 0.000 description 1
- 239000002270 dispersing agent Substances 0.000 description 1
- 239000003792 electrolyte Substances 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 239000003623 enhancer Substances 0.000 description 1
- 230000002708 enhancing effect Effects 0.000 description 1
- 238000003114 enzyme-linked immunosorbent spot assay Methods 0.000 description 1
- 210000002615 epidermis Anatomy 0.000 description 1
- LVGKNOAMLMIIKO-QXMHVHEDSA-N ethyl oleate Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OCC LVGKNOAMLMIIKO-QXMHVHEDSA-N 0.000 description 1
- 229940093471 ethyl oleate Drugs 0.000 description 1
- 239000012530 fluid Substances 0.000 description 1
- 210000001035 gastrointestinal tract Anatomy 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- 238000010353 genetic engineering Methods 0.000 description 1
- 150000004676 glycans Chemical class 0.000 description 1
- 125000005456 glyceride group Chemical group 0.000 description 1
- 235000011187 glycerol Nutrition 0.000 description 1
- 239000001963 growth medium Substances 0.000 description 1
- 238000000265 homogenisation Methods 0.000 description 1
- 230000028996 humoral immune response Effects 0.000 description 1
- 229920002674 hyaluronan Polymers 0.000 description 1
- 229960003160 hyaluronic acid Drugs 0.000 description 1
- 230000008105 immune reaction Effects 0.000 description 1
- 210000000987 immune system Anatomy 0.000 description 1
- 239000002955 immunomodulating agent Substances 0.000 description 1
- 230000001976 improved effect Effects 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 238000001727 in vivo Methods 0.000 description 1
- 239000003701 inert diluent Substances 0.000 description 1
- 239000011261 inert gas Substances 0.000 description 1
- 239000007972 injectable composition Substances 0.000 description 1
- 229960003786 inosine Drugs 0.000 description 1
- 238000001361 intraarterial administration Methods 0.000 description 1
- 150000002500 ions Chemical class 0.000 description 1
- 229910052742 iron Inorganic materials 0.000 description 1
- 230000007794 irritation Effects 0.000 description 1
- 230000000366 juvenile effect Effects 0.000 description 1
- 239000000787 lecithin Substances 0.000 description 1
- 235000010445 lecithin Nutrition 0.000 description 1
- 229940067606 lecithin Drugs 0.000 description 1
- 150000002632 lipids Chemical class 0.000 description 1
- 239000002502 liposome Substances 0.000 description 1
- 239000006193 liquid solution Substances 0.000 description 1
- 239000006194 liquid suspension Substances 0.000 description 1
- 239000006210 lotion Substances 0.000 description 1
- 239000000314 lubricant Substances 0.000 description 1
- 210000004698 lymphocyte Anatomy 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 230000001404 mediated effect Effects 0.000 description 1
- XMYQHJDBLRZMLW-UHFFFAOYSA-N methanolamine Chemical compound NCO XMYQHJDBLRZMLW-UHFFFAOYSA-N 0.000 description 1
- 229940087646 methanolamine Drugs 0.000 description 1
- 239000004530 micro-emulsion Substances 0.000 description 1
- JMUHBNWAORSSBD-WKYWBUFDSA-N mifamurtide Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@@H](OC(=O)CCCCCCCCCCCCCCC)COP(O)(=O)OCCNC(=O)[C@H](C)NC(=O)CC[C@H](C(N)=O)NC(=O)[C@H](C)NC(=O)[C@@H](C)O[C@H]1[C@H](O)[C@@H](CO)OC(O)[C@@H]1NC(C)=O JMUHBNWAORSSBD-WKYWBUFDSA-N 0.000 description 1
- 229960005225 mifamurtide Drugs 0.000 description 1
- 108700007621 mifamurtide Proteins 0.000 description 1
- 230000000116 mitigating effect Effects 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 239000007932 molded tablet Substances 0.000 description 1
- SQMWSBKSHWARHU-SDBHATRESA-N n6-cyclopentyladenosine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C2=NC=NC(NC3CCCC3)=C2N=C1 SQMWSBKSHWARHU-SDBHATRESA-N 0.000 description 1
- 231100000252 nontoxic Toxicity 0.000 description 1
- 230000003000 nontoxic effect Effects 0.000 description 1
- 239000000346 nonvolatile oil Substances 0.000 description 1
- 235000015097 nutrients Nutrition 0.000 description 1
- 239000007764 o/w emulsion Substances 0.000 description 1
- 239000002674 ointment Substances 0.000 description 1
- 235000021313 oleic acid Nutrition 0.000 description 1
- 150000002889 oleic acids Chemical class 0.000 description 1
- 239000004006 olive oil Substances 0.000 description 1
- 235000008390 olive oil Nutrition 0.000 description 1
- 230000003287 optical effect Effects 0.000 description 1
- 150000002895 organic esters Chemical class 0.000 description 1
- 230000008520 organization Effects 0.000 description 1
- IPCSVZSSVZVIGE-UHFFFAOYSA-N palmitic acid group Chemical group C(CCCCCCCCCCCCCCC)(=O)O IPCSVZSSVZVIGE-UHFFFAOYSA-N 0.000 description 1
- 239000006072 paste Substances 0.000 description 1
- 235000010603 pastilles Nutrition 0.000 description 1
- 230000007918 pathogenicity Effects 0.000 description 1
- 230000007170 pathology Effects 0.000 description 1
- 235000019271 petrolatum Nutrition 0.000 description 1
- 238000002823 phage display Methods 0.000 description 1
- 239000000546 pharmaceutical excipient Substances 0.000 description 1
- WTJKGGKOPKCXLL-RRHRGVEJSA-N phosphatidylcholine Chemical group CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCCCCCCC=CCCCCCCCC WTJKGGKOPKCXLL-RRHRGVEJSA-N 0.000 description 1
- 239000004033 plastic Substances 0.000 description 1
- 229920003023 plastic Polymers 0.000 description 1
- 239000008389 polyethoxylated castor oil Substances 0.000 description 1
- 229920000642 polymer Polymers 0.000 description 1
- 229920001282 polysaccharide Polymers 0.000 description 1
- 239000005017 polysaccharide Substances 0.000 description 1
- 229920000136 polysorbate Polymers 0.000 description 1
- 229950008882 polysorbate Drugs 0.000 description 1
- 239000001103 potassium chloride Substances 0.000 description 1
- 235000011164 potassium chloride Nutrition 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- 230000002035 prolonged effect Effects 0.000 description 1
- 230000000069 prophylactic effect Effects 0.000 description 1
- 230000009257 reactivity Effects 0.000 description 1
- 230000000601 reactogenic effect Effects 0.000 description 1
- 238000009877 rendering Methods 0.000 description 1
- 230000000630 rising effect Effects 0.000 description 1
- 230000028327 secretion Effects 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 239000001632 sodium acetate Substances 0.000 description 1
- 235000017281 sodium acetate Nutrition 0.000 description 1
- 239000001540 sodium lactate Substances 0.000 description 1
- 229940005581 sodium lactate Drugs 0.000 description 1
- 235000011088 sodium lactate Nutrition 0.000 description 1
- 239000002904 solvent Substances 0.000 description 1
- 238000000527 sonication Methods 0.000 description 1
- 239000007921 spray Substances 0.000 description 1
- 230000007480 spreading Effects 0.000 description 1
- 238000003892 spreading Methods 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 238000010561 standard procedure Methods 0.000 description 1
- 239000007858 starting material Substances 0.000 description 1
- 230000004936 stimulating effect Effects 0.000 description 1
- 235000000346 sugar Nutrition 0.000 description 1
- 150000005846 sugar alcohols Polymers 0.000 description 1
- 150000008163 sugars Chemical class 0.000 description 1
- 239000000829 suppository Substances 0.000 description 1
- 239000000375 suspending agent Substances 0.000 description 1
- 238000013268 sustained release Methods 0.000 description 1
- 239000012730 sustained-release form Substances 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 230000002194 synthesizing effect Effects 0.000 description 1
- 230000009885 systemic effect Effects 0.000 description 1
- 230000008685 targeting Effects 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- 239000002562 thickening agent Substances 0.000 description 1
- 230000002992 thymic effect Effects 0.000 description 1
- 229960001295 tocopherol Drugs 0.000 description 1
- 229930003799 tocopherol Natural products 0.000 description 1
- 235000010384 tocopherol Nutrition 0.000 description 1
- 239000011732 tocopherol Substances 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 208000037918 transfusion-transmitted disease Diseases 0.000 description 1
- 238000013519 translation Methods 0.000 description 1
- 125000001493 tyrosinyl group Chemical class [H]OC1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 1
- 235000015112 vegetable and seed oil Nutrition 0.000 description 1
- 239000008158 vegetable oil Substances 0.000 description 1
- 238000002424 x-ray crystallography Methods 0.000 description 1
- 239000011701 zinc Substances 0.000 description 1
- 229910052725 zinc Inorganic materials 0.000 description 1
- GVJHHUAWPYXKBD-IEOSBIPESA-N α-tocopherol Chemical compound OC1=C(C)C(C)=C2O[C@@](CCC[C@H](C)CCC[C@H](C)CCCC(C)C)(C)CCC2=C1C GVJHHUAWPYXKBD-IEOSBIPESA-N 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
- C07K14/08—RNA viruses
- C07K14/18—Togaviridae; Flaviviridae
- C07K14/1816—Flaviviridae, e.g. pestivirus, mucosal disease virus, bovine viral diarrhoea virus, classical swine fever virus (hog cholera virus), border disease virus
- C07K14/1825—Flaviviruses or Group B arboviruses, e.g. yellow fever virus, japanese encephalitis, tick-borne encephalitis, dengue
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/08—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses
- C07K16/10—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses from RNA viruses
- C07K16/1081—Togaviridae, e.g. flavivirus, rubella virus, hog cholera virus
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N7/00—Viruses; Bacteriophages; Compositions thereof; Preparation or purification thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2770/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
- C12N2770/00011—Details
- C12N2770/24011—Flaviviridae
- C12N2770/24111—Flavivirus, e.g. yellow fever virus, dengue, JEV
- C12N2770/24121—Viruses as such, e.g. new isolates, mutants or their genomic sequences
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2770/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
- C12N2770/00011—Details
- C12N2770/24011—Flaviviridae
- C12N2770/24111—Flavivirus, e.g. yellow fever virus, dengue, JEV
- C12N2770/24122—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2770/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
- C12N2770/00011—Details
- C12N2770/24011—Flaviviridae
- C12N2770/24111—Flavivirus, e.g. yellow fever virus, dengue, JEV
- C12N2770/24134—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Definitions
- the present invention is directed to dengue virus vaccines that induce neutralizing antibodies against more than, one dengue vims serotype from, a single source,
- Dengue is a mosquito-borne flavivirus that is spreading at an unprecedented rate and .has developed into a major health and economic burden in over 50 countries.
- Current DENY vaccines protecting against all four DENY serotypes must be delivered as a "tetravalent" fomiulation of four viruses or .four recombinant proteins, each intended to confer protection against that serotype.
- the correct mix of serotypes in the tetravalent cocktail to achieve a balanced antibody response is not known, underscored by the recent failure of the most advanced tetravalent live attenuated chimeric virus to provide clinically meaningful protection in a large phase 2B trial in Thailand (Sabehareon A, et al, 2012), Viral interference is.
- the DEN - 1/3 and DENY 3/1 chimeric viruses are single viruses that present epitopes recognized by neutralizing antibodies from both DENV-i and DENV-3 immune individuals. This indicates that single viruses should be able to elicit neutralizing . antibodies targeting two serotypes at once, replacing two viruses (DENV-I and 3) with one virus (DENV- ' I /3 or DENV-3/I). BRIEF DESCRIPTION OF THE DRAWINGS
- FIGS 1A-B For the DENV- 1/3 mutant, the EDI-II hinge from DENV3 was transplanted into a DENV-1 background, WestPac'74. creating a DENV-3/1. hinge mutant.
- the EDI-II hinge was defined using the DENV3 specific human mAb 5J7, A)
- the resultant virus, rDENV-1 3 was tested a ainst monoclonal antibody 5J7. This figure shows that DENV-1 is not neutralized by 5J7, whereas DENV-3 is.
- rDENV-1 3 whic only contains the DENV-3 EDI/II hinge, is neutralized by 5J7 at concentrations equivalent to DENV-3 neutralizing concentrations.
- FIG. 2A-B This figure shows primary DENV-1 and DENV-3 human immune sera tested against DENV-1, DENV-3 and the hinge chimeric virus WestPac-3001 hinge (rDENV-1/3) .
- the Y - axis shows fold dilution of immune .sera required to neutralize 50% of input virus in tissue culture. The higher values indicate more potent serum.
- rDENV-1/3 is sensitive to neutralization by DENV- 1 immune sera at concentrations similar to DENV-1, indicating that in contrast to the parental DENV-3 vims, the chimeric vims displays epitopes recognized by DENV-1 immune sera.
- DENV-3 primary immune sera does not neutralize DENV-1 but neutralizes DENV-3.
- rDENV-1/3 is neutralized by DENV-3 primary immune sera at concentrations similar to DENV-3, indicating that the chimeric virus rDENV-1/3 preserves the critical DENV-3 epitopes, targeted by DENV-3 antibodies, in DENV-3 human immune sera. * indicates not neutralized.
- FIG. 3 This figure shows that WestPac'74 3001 -hinge induces broadly cross- neutralizing antibodies at 28, 60, .90, 120 and 180 days post infection in rhesus macaques.
- the Y axis shows neutralizing antibody titer as above.
- the X axis- shows each virus serotype.
- Each plotted point is the neutralizing titer for a single rhesus macaque against a given serotype.
- the central line through each cluster of points- is the geometric mean neutralizing titer for each group of macaques against each serotype.
- the whiskers show standard error of the mean,
- Each time point (28, 30, 60, 90, 120, 180 days) shows broadly cross-neutralizing antibody responses against all four serotypes.
- Th s figure shows enzyme linked immunosorbent -assay (ELISA) data with relative binding of antibody by optical density (OD) on the Y-axis, and increasing antibody concentration on the X-axis,
- ELISA enzyme linked immunosorbent -assay
- FIG. 5A-B This figure shows primary DENV-i and DENV-3 human immune sera tested against DENV-1, DENV-3 and the hinge chimeric virus 3001-1 F4E.
- the Y - axis shows fold dilution of immune sera required to neutralize 50% of input vims in tissue culture. The higher values indicate more potent serum.
- DENV-3 primary immune sera does not neutralize DENV-1 but neutralizes DENV-3
- 3001 1F4E is neutralized b DENV-3 primary immune sera at concentrations similar to DENV-3, indicating that the chimeric virus 3001-1F4E preserves the critical DENV-3 epitopes targeted by DENV-3 antibodies in DENV-3 human immune sera.
- the present invention provides a chimeric dengue virus E glycoprotein comprising a dengue virus E glycoprotein backbone thai comprises amino acid substitutions feat introduce an- epitope mat is recognized by an antibody that is reactive with a dengue vims serotype that is different from the dengue virus serotype of the dengue virus E glycoprotein backbone.
- the dengue vims E glycoprotein backbone is from dengue virus serotype 1 and in one embodiment, the dengue vims E glycoprotein backbone is from dengue vims serotype 3.
- the antibody is reactive with dengue virus serotype 3 (e.g., monoclonal antibody 5J7) and in other embodiments, the antibody is reactive with dengue virus serotype 1 (e.g., monoclonal antibody 1F4).
- the present invention further provides a chimeric dengue virus E glycoprotein, comprising the amino acid sequence:
- chimeric dengue virus E glycoprotein comprising the amino acid sequence:
- VLP virus like particle
- An isolated nucleic acid molecule encoding the E glycoprotein of this invention is also provided herein, as well as an isolated nucleic acid molecule encoding the flavivirus particle or VLP of this invention.
- the present invention also provides a composition comprising the E glycoprotein of this invention in a pharmaceutically acceptable carrier and provides a composition comprising the nucleic acid molecule of this invention in a phamiaceutically acceptable carrier,
- the present invention provides a method of producing an immune response to a dengue virus in a subject (e.g., a subject in need thereof), comprising administering to the subject an effective amount of the E glycoprotein of this invention, the flavivirus particle of this invention, the nucleic acid molecule of this invention and or the composi ion of this invention and any combination thereof,
- the present invention also provides a method of treating a. dengue virus infection in a subject in need thereof, comprising administering to the subject an effective amount of the E glycoprotein of this invention, the flavivirus particle of this, invention, the nucleic acid molec ule of any of this invention and/or the composition of this invention and any combination thereof
- a method of preventing a dengue virus infection in a subject comprising -administering to the subject an effective amount of the E glycoprotein of this invention, the flavivirus particle of this invention, the nucleic acid molecule of any of this invention and/or the composition of ibis invention and any combination thereof.
- a method is also provided herein of protecting a subject (e.g. , a subject in need thereof), from the effects of dengue vims infection, comprising administering to the subject an effective amount of the E glycoprotein of this invention, the flavivirus particle of this in vention, the nucleic acid molecule of any of this invention and/'or the composition of this invention and any combination thereof.
- the present invention further provides the E glycoprotein of this invention, the flavivirus particle of this invention, the nucleic acid molecule of this invention and/or the composition of this invention for use in the manufacture of a medicament for producing an immune response to a dengue -virus in a subject, for treating a dengue virus infection in a subject in need thereof, for preventing a dengue vims infection in a subject and/or for protecting a subject from the effects of dengue virus infection,
- E glycoprotein of this invention the flavi virus particle of this invention, the nucleic acid molecule of this invention and/or the composition of this invention for use in producing an immune response to a dengue virus in a subject, in treating a dengue virus infection in a subject in need thereof, in preventing a dengue virus infection in a subject and/or in protecting a subject from the effects of dengue virus- infection.
- the present invention is based on the unexpected discovery that epitope regions that -define a DENY serotype can be transferred into a ' protein backbone of a different DENY serotype to create a chimeric molecule that contains antibody targets for both serotypes, thereby functioning as a bivalent vaccine that can induce neutralizing antibodies against two different DENY serotypes from a single source.
- the present invention provides a platform for construction of a chimeric dengue virus E glycoprotein backbone that comprises amino acid substitutions that introduce epitopes that are recognized by an antibody that is reactive with -a. dengue virus serotype that is different from th dengue virus serotype of the dengue virus E glycoprotein backbone.
- dengue vims E glycoprotein backbone is from dengue virus serotype 1
- the dengue virus E glycoprotein backbone can be from dengue virus serotype 2, dengue virus serotype 3 or dengue virus serotype 4,
- the antibody that is reactive with a dengue virus serotype that is different from the dengue virus serotype of the dengue virus E glycoprotein backbone is an antibody that Is reactive with dengue vims serotype 3.
- a nonlimiting example of such an antibody is monoclonal antibody 5J7.
- the antibody that is reactive with a dengue virus serotype that is different from the dengue virus serotype of the dengue virus E glycoprotein backbone is an antibody that is reactive with dengue virus serotype 1, dengue virus serotype 2 or dengue virus serotype 4,
- any combination of a first dengue virus serotype for the dengue virus E glycoprotein backbone and a second dengue virus serotype thai is the target of the antibody thai recognizes the epitope introduced into the E glycoprotein backbone can be used, provided that the first dengue virus serotype and the second dengue vims serotype are different (i.e., not the same serotype).
- the chimeric dengue virus E glycoprotein of this invention can comprise, consist essentially of or consist of the amino acid sequence:
- the chimeric dengue virus E glycoprotein of this invention can comprise, consist essentially of or consist of the amino acid sequence:
- the present invention also provides a fiavivirus particle or vims like particle (VLP) comprising the chimeric E glycoprotein of this invention.
- VLP fiavivirus particle or vims like particle
- Production of the chimeras of thi s invention can be carried out by introducing some (e.g., I, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, etc.) or all of the amino acid substitutions identified in Table 1 into a dengue vims E glycoprotein backbone or flavivirus E
- glycoprotein backbone not every amino acid identified -in Table 1 is required to be substituted to produce a chimeric protein of this invention. For example, in some embodiments further substitutions and/or omission of substitutions of about 1, 2, 3, 4 or 5 amino acids at either end of the contiguous amino acid sequences identified in Table 1 as the respective epitope regions can be included in prod-action of a chimera of this invention.
- the number of substitutions neces sary to produce the desired conformational epitope can be readily determined by one of ordinary skill in the art according to the teachings herein and according to protocols well known in the art.
- the amino acid position numbering in Table 1 is based on the amino acid sequence of WestPac74 (DENV-1), or the amino acid sequence of UNC 3001 (DENV-3), as provided herein. However it -would be readily understood by one of ordinary skill in the art that Che equivalent amino acid positions in other dengue vims E glycoprotein amino acid sequences or other flavivirus E glycoprotein amino acid sequences can ' be readily identified and employed in the production of the chimeric proteins of this invention.
- Table 2 shows one example of modifications that can be made to the nucleotide sequence encoding the DENV-1 E glycoprotein to introduce the epitope that is recognized by the monocionai antibody 5J7 S which is reactive with DENV-3,
- the amino acid sequence that results from translation of a nucleotide sequence comprising these substitutions is:
- Table 3 shows that WestPac'74 3001 -hinge is infectious in rhesus macaques infected subctttaneously with 500,000 infectious units of vims. The reported values for each day are log transformed monkey serum virus titers quantified by imraunofocus assay. Table 4, Attenuation of 30O1-1F4E in rhesus macaques. This table shows that 3001- 1F4E is infectious in rhesus niacaques infected subcutaneously with 500,000 infectious units of virus. However, this vims was below -quantitative level of detection (50 Infectious virus mL serum).
- a more sensitive assay is capable of detecting virus ⁇ 5.0 infectious units/mL, but is: not capable of quantifyin the low level of virus present. Consequently days for which virus was detected by our most sensitive assay are scored as positive with "+". Total number of days infected are shown in the left column. The low level ofviremia and low mean number of days infected (2,25 days) are consistent with vims attenuation in macaques.
- the present invention provides a chimeric flavivirus E glycoprotein in which amino acid substitutions are made to introduce a dengue virus epitope into a flavivirus E glycoprotein from a flavivirus that is not a dengue virus,
- the present invention provides a flavivirus E glycoprotein comprising a chimeric E glycoprotein comprising a flavivirus E glycoprotein backbone that is not a- dengue virus E glycoprotein backbone, wherein the flavivirus E glycoprotein backbone comprises amino acid substitutes that introduce an epitope that is recognized by an antibody that is reactive with a dengue virus.
- flaviviruses that can be used include yellow fever virus (YFV) (e.g., GeriBank ® ' Database Accession No. JX503529) Japanese encephalitis virus (JEV) (e.g.. GenBank ® Database Accession No. U14163), West Nile vims (WNV) (e.g., GenBank ' ⁇ Database Accession No. DQ21 1652) and any other flavivirus now known or later identified.
- YFV yellow fever virus
- JEV Japanese encephalitis virus
- WNV West Nile vims
- DQ21 1652 West Nile vims
- dengue virus vaccines result in the production of non-neutralizing antibodies, which may increase the likelihood of pathology upon subsequence exposure to natural .infection or vaccine.
- Another approach to provide an engineered epitope is to deliver all or a portion of the dengue virus -E protein incorporated into another flavivirus particle or VLP.
- the heterologous flavivirus is West Nile virus or Yellow Fever virus.
- Portions of the E protein can be grafted into the E protein of the heterologous flavivirus backbone, e.g., to reduce the generation of non-neutralizing dengue vires antibodies to non-neutralizing epitopes present in the dengue virus E protein and/or other dengue vims structural proteins.
- a chimeric flavivirus or chimeric flavivirus VLP can present the quaternary dengue virus epitope in proper conformation while reducing the generation ofnon- neutralizing an tibodies to other portions of the dengue virus E protein -and/of other structural proteins that, are not presented ia the chimeric flavivirus or flavivirus VLP.
- the indi vidual and conformational epitopes of the flavivirus E glycoprotein or dengue virus E glycoprotein can be presented on a synthetic backbone or support structure so that the epitopes within the synthetic backbone or support stractore mimic the conformation and arrangement of the epitopes within the structure of the E glycoprotein, virus particle or VLP,
- the present invention provides peptide miraitopes (see Meloen et ai. (2000) J. Mot R cogn , 13, 352-359) that mimic the individual and conformational epitopes of the E glycoproteins of the invention
- Mtmi opes may be identified using any technique known in the art, such as by surface stimulation, random peptide l braries or phage display libraries, using an antibody or antibodies to the individual, and conformational epitopes of the E glycoproteins of the invention.
- the invention further provides a nucleic acid (e.g., isolated nucleic acid) encoding a dengue virus epitope or a polypeptide of the invention,
- the invention further provides a nucleic acid ( g., an isolated nucleic acid) encoding a chimeric flavivirus VLP or a chimeric flavivirus particle (e.g., a viral coat of the flavivirus particle) of the invention.
- a nucleic acid g., an isolated nucleic acid
- a chimeric flavivirus VLP or a chimeric flavivirus particle (e.g., a viral coat of the flavivirus particle) of the invention.
- vectors encoding the nucleic acids of the invention are also provided.
- ceils comprising the vectors, nucleic acids, dengue virus epitopes, polypeptides, chimeric flavivirus VLPs or chimeric flavivirus particles of the invention.
- the invention also provides immunogenic compositions comprising the cells, vectors, nucleic acids, dengue virus epitopes, polypeptides, chimeric flavivirus VLPs or chimeric flavivirus particles of the invention, in embodiments, the immunogenic composition is monovalent. In embodiments, the immunogenic composition is multivalent (e.g. , tetravalent) for dengue virus serotypes DEN! , DEN2, DEN 3 and/or DEN4.
- the invention encompasses methods of producing an immune response to a dengue virus in a subject, die method comprising administering to the subject an effective amount of a dengue virus epitope, a polypeptide, a chimeric ⁇ flavivirus VLP or chimeric flavivirus particle, nucleic acid, vector, cell or immunogenic composition of the invention.
- the present invention can advantageously be practiced to induce an immune response against one, two, three or ail four of DENI, DEN2, DEN 3 and PEN4.
- effective and safe multivalent dengue vaccines have been, a challenge to design because of the problem of interference among serotypes.
- the immune response may be predominantly directed against only some of the target serotypes. Multiple vaccinations are then required to try to achieve a response against all serotypes; however, in the case of dengue virus, this approach can be dangerous because repeated administrations to a subject with pre-existing antibodies can lead to dengue hemorrhagic fever,
- a still further aspect of the inven tion is a method of treating a dengue virus infection, comprising administering to the subject an effective amount of a dengue virus epitope, a polypeptide, a chimeric flavivirus V ' LP or chimeric fiavivirus particle, nucleic acid, vector, ceil, or immunogenic composition of the invention,
- a still farther aspect of the invention is a method of preventing a dengue virus infection, comprising administering to the subject an effective amount of a dengue virus epitope, a polypeptide, a chimeric flavivirus VLP or chimeric flavivirus particle, nucleic acid, vector, cell, or immunogenic composition of the invention.
- a stilt further aspect of th invention is a method of protecting a subject from the effects of dengue virus infection, comprising administering to the subject, an effective amount of a dengue virus epitope, a polypeptide, a chimeric flavi virus VLP or chimeric flavivirus particle, nucleic acid, vector, ceil, or immunogenic composition of the invention.
- the dengue virus antigens and epitopes of the invention can be derived from any dengue virus, including all serotypes, strains and genotypes, now known or later identified.
- the dengue virus is UNCI 017 strain (DENI), West
- an "irnmunogenically active fragment" of a dengue vims polypeptide comprises, consists essentially of or consists of at least about 6, 8, 10, 12, 15, 20, 30, 50, 75, 100, 125, 150, 200, 250.
- the "iram nogenjcaliy active fragment" induces an immune response ⁇ e.g., lgG and/of IgA that react with the native antigen), optionally a protective immune response, against dengue virus in a host and induces the production of antibodies that specifically bind to the quaternary dengue virus epitope newly identified by the inventors.
- epitope means a specific amino acid sequence that, when present in the proper conformation, provides a reactive site for an antibody (e.g., B ceil epitope) or T cell receptor ⁇ e.g., T ceil epitope).
- an antibody e.g., B ceil epitope
- T cell receptor e.g., T ceil epitope
- Portions of a given polypeptide that include a B-cell epitope can he identified using any number of epitope mapping techniques thai are known in the art, (See, e.g. , Ep
- linear epitopes can be determined by, e.g., concurrently synthesizing large numbers of peptides on solid -supports, the peptides corresponding to portions of the protein molecule,, and reacting the peptides with antibodies while the peptides are still attached to the supports.
- conformational epitopes can he readily identified by determining spatial conformation of amino acids such as by, e.g.,- x-ray crystallography and 2-dimensional nuclear magnetic resonance.
- Antigenic regions of proteins can also be identified using standard antigenicity and hydropathy plots, such as those calculated using, e.g., the Orniga version 1 .0 software program available from the Oxford Molecular Group. This computer program employs the Hopp/ oods method (Hopp et al., Proc. Natl. Acad Sci USA ( ⁇ 981) 78:3824-3828) .for determining antigenicity profiles and the yte-Doolittle -technique ( yte et al, J. MoL Biol (1982) 157:105-132) for hydropathy plots.
- T-eell epitopes that are involved in stimulating the cellular arm of a subject's immune system are short peptides of about 8-25 amino acids.
- a common way to identify T-ceil . epitopes is to use overlapping synthetic peptides and analyze pools of these peptides, or the individual ones, that are recognized by T cells from animals that are immune to the antigen of interest, using, for example, an enzyme-linked immunospot assay
- ELISPOT overlapping peptides
- MH -tetrarners containing the peptide Such immunogenically active fragments can also be identified based on their ability to stimulate lymphocyte proliferation in response to stimulation by various fragments front the antigen of interest.
- the present invention can be practiced for prophylactic, therapeutic and/or diagnostic purposes.
- the invention can be practiced to produce antibodies for any purpose, such, as diagnostic or research purposes, or for passive immunization by transfer to another subject.
- kits comprising one or more compositions of this invention.
- the kit of this invention can comprise one or more containers and/or receptacles to hold the reagents (e.g., antibodies, antigens, nucleic acids) of the kit, along with appropriate buffers and/or diluents and/or other solutions and directions for using the kit, as would be well known in the art.
- reagents e.g., antibodies, antigens, nucleic acids
- kits can further comprise -adjuvants- and/or other immunostirauktory or
- immunomodulating agents as are well known in the art.
- compositions and kits of the present invention can also include other medicinal agents, pharmaceutical agents, -carriers, diluents, immunostimulatory cytokines, etc. Actual methods of preparing such dosage forms are known, or will be apparent to those skilled in this art.
- Administration to a subject can be by any route known in the art.
- the route of administration can be by inhalation (e.g., oral and/or nasal inhalation), oral, buccal ⁇ e.g., sublingual), rectal, vaginal, topical (including administration to the airways), intraocular, transdermal, by parenteral ⁇ e.g., intramuscular [e.g., administration to skeletal muscle], intravenous, mtra-arteriaL intraperitoneal- and the like), subcutaneous (including administration into the footpad), intradermal, intrapleural, intracerebral, and/or intrathecal routes,
- the epitopes, polypeptides, VLPs and viral, vectors of the invention can be delivered per se or by delivering a nucleic acid (e.g., DNA) that encodes the same.
- a nucleic acid e.g., DNA
- Immunomodulatory compounds such as immunomodulatory chemokines and cytokines (preferably, CTL inductive cytokines) can be administered concurrently to a subject,
- Cytokines may be administered by any method known in the art. Exogenous cytokines may be administered to the subject, or alternatively, a nucleic acid encoding cytokine may be delivered to the subject using a suitable vector, and the cytokine produced in vivo. In particular embodiments, a viral adjuvant expresses the cytokine. In embodiments of the invention, multiple dosages (e.g., two, three or mote) of a composition of the invention can be administered without detectable pathogenicity (e.g... Dengue Shock Syndrome/Dengue Hemorrhagic Fever).
- pathogenicity e.g.. Dengue Shock Syndrome/Dengue Hemorrhagic Fever
- the multivalent vaccines of the in vention do not result in immune interference, e.g. , a balanced immune response Is induced against all antigens presented.
- the balanced response results in protective immunity against DENV-1, DENV--2, DENY--3 and DENV-4.
- the multivalent vaccine can be administered to a subject that has anti -dengue maternal antibodies present.
- a can mean one or more than one.
- ceil can mean a single ceil or a multiplicity of cells.
- nucleic acid encompasses both RNA and DNA, including cD A, . genomic DNA, synthetic (e.g., chemically synthesized) DNA and chimeras of RNA and DNA.
- the nucleic acid may be double-stranded or single-stranded.
- the nucleic acid may be synthesized using nucleotide analogs or derivatives (e.g., inosine or phosphorotbioate nucleotides). Such nucleotides can be used, for example, to prepare nucleic acids that have altered base-pairing abilities or increased resistance to nucleases .
- polypeptide encompasses both peptides and proteins (including fusion proteins), unless indicated otherwise,
- a " ' fusion protein” is a polypeptide produced when two heterologous nucleotide sequences or fragments thereof coding for two (or more) different polypeptides not found fused together in nature are fused together in the correct iransiationai reading frame.
- a "recombinant" nucleic acid, polynucleotide or nucleotide sequence is one produced by genetic engineering techniques.
- a "recombinant" polypeptide is produced from a recombinant nucleic acid, polypeptide or nucleotide sequence.
- an “isolated” polynucleotide ⁇ e.g., an “isolated nucleic acid” or an “isolated nucleotide sequence” means a polynucleotide at least partially separated from at least some of the other components of the naturally occurring organism or vims, for example, the cell or viral structural components or other polypeptides or nucleic acids commonly found associated with the polynucleotide.
- the "isolated' 1 polynucleotide is present at a greater concentration ⁇ i.e., is enriched) as compared with the starting material (e.g., at least about a two-fold, three-fold, four-fold, ten-fold, twenty- fold, fifty-fold, one-hundred-fold,, five-hundred-fold, one thousand- old, ten thousand-fold or greater concentration), in representative embodiments, the isolated polynucleotide is at least about 1%, 5%, 10%, 20%, 30%, 40%, .50%, 60%, 70%, 80%, 90%, 95% or more pure.
- An ''isolated" polypeptide means a polypeptide that is at least partially separated from at least some of the other components of the naturally occurring organism or virus, for example, the cell or viral structural components or other polypeptides or nucleic acids commonly found associated with the polypeptide.
- the "isolated" polypeptide is present at a greater concentration ⁇ i.e., is enriched) as compared with the stalling material ⁇ e.g., at least about a two-fold, three-fold, four-fold, ten-fold, twenty-fold, fifty-fold, oae-hundred-fold, five-hundred-fold, one thousand-fold, ten thousandfold or greater concentration).
- the isolated polypeptide is at least about 1%, S% 5 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95% or more pure.
- an "isolated" cell is a cell that has been partially or completely separated from other components with which it is normally associated in nature.
- aft isolated- cell can be a cell in culture medium and/or a cell in a pharmaceutically acceptable earner.
- immufiogeti and “antigen” are used interchangeably herein and mean any compound (including polypept des) to which a cellular and/or humoral immune response can be directed.
- an immxsaogen or antigen can induce a protective immune response against the effects of dengue virus infection.
- Effective amount refers to -an amount of a vector, nucleic acid, epitope, polypeptide, cell, particle, VLP, composition or formulation of the invention that is sufficient to produce a desired effect, which can be a therapeutic and/or beneficial effect.
- the effective amount will vary with the age, general condition of the subject, the severity of the condition being treated, the particular agent administered, the duratio of the treatment, the nature of any concurrent treatment, the pharmaceutically acceptable carrier used, and like factors within the knowledge and expertise of those skilled in the art.
- an "effective amount” in an individual case can be determined by one of ordinary skill in the an by reference to the pertinent texts and literature and/or by using routine experimentation.
- immunogenic amount or "'effective immunizing dose,” as used herein, unless otherwise indicated, means an amount or dose sufficient to induce an immune response (which can optionally be a protective response) in the treated subject that is greater than the inherent immunity of non-immunized subjects.
- An immunogenic amount or effective immunizing dose in arty particular context can be routinel determined using methods known in the art.
- vaccine means vacuna
- vaccination means vaccination or immunization
- a process or -Composition that increases a subject's immune reaction to an immynogen ⁇ e.g. , by providing an active immune response), and therefore its ability to resist, overcome and/or recover from -infection (i.e., a protective immune response ⁇ ,
- treat By the terms “treat.” “treating” or “treatment of” (and grammatical variations thereof) it is meant thai the severity of the subject's condition is reduced,, at least partially improved or ameliorated and/or that some alleviation, mitigation or decrease- in at least one clinical symptom is achieved and/or there is a delay in the progression of the disease or disorder, in representative embodiments, the terms “treat,” “treating” or “treatment of (and grammatical variations thereof) refer to a reduction in the severity of viremia and/or a delay in the progression of viremia, with or without other signs of clinical disease.
- a “treatment effective” amount as used herein is an amount that is sufficient to treat (as defined herein) the subject. Those skilled in the art will appreciate tha , the therapeutic effects need ' not be complete or curative, as long as ' some benefit is provided to the subject.
- prevent refe to prevention and/or delay of the onset and/or progression of a disease, disorder and or a clinical syniptom(s) in a subject and or a reduction in the severity of the onset and/or progression of the disease, disorder and/or clinical symptom(s) relative to what would occur in the absence of the methods of the invention.
- the terms "prevent,” “preventing” or “prevention of (and grammatical variations thereof) refer to prevention and/or delay of the onset and/or progression of viremia in the subject, with or without other signs of clinical disease.
- the prevention can be complete, e.g., the total absence of the disease, disorder and/or clinical symptom(s).
- the prevention can also be partial, such that the occurrence of the disease, disorder and/or clinical symptom(s) in the subject and/or the severity of onset and/or the .progression is less than what would occur in the absence of the present invention.
- a ' ' prevention effective amount as used herein is an amount that is sufficient to prevent (as defined herein) the disease, disorder and/or clinical symptom in the subject. Those skilled in the art will appreciate that the level of prevention: need not be complete, as long as some benefit is provided to the subject.
- the efficacy of treating and/or preventing dengue virus infection by the methods of the present invention can he determined by detecting a clinical improvement as indicated by a change in the subject's symptoms and/or clinical parameters (e.g., viremia), as would be well known to one of skill in the art.
- a clinical improvement as indicated by a change in the subject's symptoms and/or clinical parameters (e.g., viremia), as would be well known to one of skill in the art.
- the terms “protect” “protecting,” “protection” and “protective” encompass both methods of preventing and treating dengue virus infection in a subject whether against one or multiple strains- genotypes or serotypes of dengue virus.
- protective immune response or “protective” immunity indicates that the immune response confers some benefit to the subject in that it prevents or reduces the incidence and/or severity and/or duration of disease or any other manifestation of infection.
- a protective immune response or protective immunity results in reduced viremia, whether or not accompanied by clinical disease.
- a protective immune response or protective immunity may be useful in. the therapeutic treatment of existing disease.
- an “active immune response” or “active immunity” is characterized by “participation of host tissues and cells after an encounter with the immunogen. It involves differentiation and proliferation of immunocompetent cells in lymphoreticular tissues, which lead to synthesis of antibody or the development of cell-mediated reactivity, or both.” Herbert B. Herscowitz, Immunophysio!ogy: Ceil Function and Cellular Interactions in Antibody
- an active immune response is mounted by the host after exposure to immimogens by infection or by vaccination.
- Active immunity can be contrasted with passive immunity, which is acquired through the "transfer of preformed substances (antibody, transfer factor, thymic graft, interleukin-2) from an actively immunized host to a non-immune host.” Id.
- a "subject" of the invention includes any animal susceptible to dengue virus infection.
- a subject is generally a mammalian subject (e.g. , a laboratory animal such as a rat, mouse, guinea pig, rabbit, primates, etc.), a farm or commercial animal (e.g., a cow, horse, goat, donkey, sheep, etc.), or a domestic animal (e.g., cat, dog, ferret, etc.).
- the subject is a primate subject, a non-human primate subject (e.g., a chimpanzee, baboon, monkey, gorilla, etc.) or a human.
- Subjects of the invention can be a subject kno or believed to be at risk of infection by dengue virus.
- a subject according to the invention can also include a subj ct not previously known or suspected to be infected by dengue virus or in need of treatment for dengue vims infection.
- Subjects may be treated for any purpose, such as for eliciting a protective immune response, or for eliciting the production of antibodies in that subject, which antibodies can be collected and used for other purposes such as research or diagnostic purposes or for administering to other subjects to produce passive immunity therein, etc.
- Subjects include males and/or females of any age, including neonates, juvenile, mature and geriatric subjects.
- the subject can be an infant (e.g., less than, about 12 months, 10 months, 9 months, 8 months, 7 months, 6 months, or younger), a toddler (e.g., at least about 12, 18 or 24 months and/or less than about 36, 30 or 24 months), or a child (e.g., at least about 1, 2, 3, 4 or 5 years of age and/or less than about 14, 12, 10, 8, 7, 6, 5, or 4 years of age), in embodiments of the invention, the subject is a human subject that is from about 0 to 3, 4, 5, 6, 9, 12, 15, 18.
- 24, 30, 36, 48 or 60 months of age from about 3 to 6, 9, 12, 15, 18, 24, 30, 36, 48 or 60 months of age, from about 6 to 9, 12, 15, 18, 24, 30 s 36 » 48 or 60 months of age, from about 9 to 12, 15, 18, 24, 30, 36, 48 Or 60 months of age, from about 12 to 18, 24, 36, 48 or 60 months of age, from about 18 to 24, 30, 36, 48 or 60 months of age, or from about 24 to 30, 36, 48 or 60 months of age.
- the subject has maternal antibodies to dengue virus.
- a ''subject in need" of the methods of the invention can be a subject known, to be. or suspected of being, infected with, or at risk of being infected with, dengue virus.
- compositions comprising the dengue virus epitopes, polypeptides, chimeric flavivirus VLPs or chimeric flavivirus particles, nucleic acids, vectors, cells or compositions of the invention and a pharmaceutically acceptable carrier are also provided, and can be formulated for administration in a pharmaceutical carrier in accordance with known techniques. See, e.g., Remington. The Science And Practice of Pharmacy (latest edition), in the manufacture of a pharmaceutical composition according to embodiments of the present invention, the composition of the invention is typically admixed with, inter alia, a pharmaceutically acceptable earner.
- pharmaceutically acceptable carrier is meant a carrier that is compatible with other ingredients in the pharmaceutical composition and that is not harmful or deleterious to the subject.
- the carrier may be a solid or a liquid, or both, and is preferably formulated with the composition of the invention as a unit-dose formulation, for example, a tablet, which may contain from about 0.01 or 0,5% to about 95% or 99% by weight of the composition.
- the pharmaceutical compositions are prepared by any of the well-known techniques of pharmacy including, but not limited to, admixing the components, optionally including one or more accessory ingredients, in certain embodiments, the pharmaceutically acceptable carrier is sterile and would be deemed suitable for administration into human subjects according to regulator)' guidelines for pharmaceutical compositions comprising the carrier.
- a "pharmaceutically acceptable" component such as a salt, carrier, excipient or.
- diluent of a composition according to the present invention is a component that (i) is compatible with the other ingredients of the composition in that it can be combined with the compositions of the present invention without rendering the composition unsuitable for its intended purpose, and (ii) is suitable for use with subjects as provided herein without undue adverse side effects (such as toxicity, irritation, and allergic response). Side effects are "undue” when their risk outweighs the benefit provided by the composition.
- Non-limiting examples of pharmaceutically acceptable components include any of the s tandard pharmaceutical carriers such as phosphate buffered saline solutions, water, -emulsions such as oil/water emulsion, microemulsions and various types of wetting agents.
- s tandard pharmaceutical carriers such as phosphate buffered saline solutions, water, -emulsions such as oil/water emulsion, microemulsions and various types of wetting agents.
- the compositions of the invention can further comprise one or more than one adjuvant.
- the adjuvants of the- present invention can be in the form of an amino acid sequence, and/or in the form or a nucleic acid encoding an adjuvant.
- the adjuvant can be a component of a nucleic acid encoding the poi peptide(s) or fragments) or epiiopc(s) and/or a separate component of the composition comprising the nucleic acid encoding the polypeptide(s) or fragment(s) or epitope(s) of the invention.
- the adjuvant can also be an amino acid sequence that is a peptide, a protein fragment or a whole protein that functions as an adjuvant, and/or the adjuvant can be a nucleic acid encoding a peptide, protein fragment or whole protein that functions as an adjuvant
- adjuvant describes a substance, which can he any immunomodulating substance capable of being combined with a composition of the invention to enhance, improve or otherwise modulate an immune response in a subject.
- the adjuvant can be, but is not limited to, an
- iiiimunostimulatory cytokine including, but not limited to, GM/CSF, interleukin-2, interleukm- 2, inteiferon-garnma, interleukin- , tumor necrosis factor-alpha, interleukin-l, hematopoietic factor flt3L, CD40L.
- SYNTEX adjuvant formulation 1 composed of 5 percent (wt/vol) sqttaiene (DASF, Parsippany, NJ.) > 2,5 percent Plutonic, LI 21 polymer (Aldrich Chemical, Milwaukee), and 0,2 percent polysorbate (Tween 80, Sigma) in phosphate-buffered saline.
- Suitable adjuvants also include an aluminum salt such as aluminum hydroxide gel (alum), aluminum phosphate, -or algannmulim but may also be a salt of calcium, iron or zinc, or may ⁇ be an insoluble suspension of acylated tyrosine, or acylated sugars, cationieaUy or arhoniealiy dertvatized polysaccharides, or poiyphosphazenes.
- aluminum salt such as aluminum hydroxide gel (alum), aluminum phosphate, -or algannmulim but may also be a salt of calcium, iron or zinc, or may ⁇ be an insoluble suspension of acylated tyrosine, or acylated sugars, cationieaUy or arhoniealiy dertvatized polysaccharides, or poiyphosphazenes.
- adjuvants are well known in the art and include without limitation MF 59, LT- 63 5 LT-R72 (Pal et al. s Vaccine 24(6);766-7S (2005)), QS-21, Fretaid's adjuvant (complete and incomplete), aluminum hydroxide.
- N-acetyl-mwamyl-L-threonyl-D-isoglutamine Ihr- MDP
- N-acetyl-normuraBiyS'-L-alariyl-D-isogiuiaiiiine CGP 11637, referred to as nor- MDP
- N-aceiyJmuramyi « L ⁇ danyl- ⁇ - gIycero-3-hydroxyphosphoryloxy)-ethylamine CGP 19835A, referred to as MTP-PE
- RIBI. ' which contains three components extracted from bacteria, monophosphoryl lipid A, trealose dimyeolate and cell wall skeleton (MPL+TD +CWS) in 2% sqiiafene/Tween 80 emulsion,
- Additional adjuvants can include, for example, a ' combination of monophosphoryl lipid A, preferably 3-de-0-acyIated monophosphoryl lipid A (3D- PL) together with an aluminum salt.
- An enhanced adjuvant. system involves the combination of a monophosphoryl lipid A and saponin derivative, particularly the combination of QS21 and 3D-MPL as disclosed in PCX publication number WO 94/00153, or a less reactogenic composition where the QS2I is quenched with cholesterol as disclosed in PCX publication number WO
- nucleic acid compositions of the invention can include an adjuvant by comprising a nucleotide sequence encoding the antigen and a nucleotide sequence that, provides an adjuvant function, such as CpG sequences.
- CpG sequences, or motifs are well known in the art.
- an adjuvant for use with the present invention such as, for example, an adjuvant for use with the present invention, such as, for example, an adjuvant for use with the present invention
- irnmunostimulatory cytokine can be administered before, concurrent with, and/or within a few hours, several hows, and/or 1, 2, 3, 4, 5, 6, 7, 8, 9, and/or 10 days before and/or after the administration of a composition of the invention to a subject.
- any combination of adjuvants such as immunostimuiatpry cytokines, can be co-administered to the subject before, after and/or concurrent with the administratio of an immunogenic composition of the invention.
- adjuvants such as immunostimuiatpry cytokines
- immiraostimulatory cytokines can consist of two or more immunostimulatory cytokines, such as GM/CSF, mterkukm-2 5 interieukin-12, interferon-gamnsa,. mtefieukifi-4, tumor necrosis factor-alpha, mterleukin-l, hematopoietic factor ACL, CD40L, B7.1 co-stimulatory molecules and B7.2 co-stimulatory molecules,
- the effectiveness of an adjuvant or combination of adjuvants can be determined by measuring the immune response produced in response to administratio of a composition of this invention to a subject with and without the adjuvant or combination of adjuvants, using standard procedures, as described herein and as known in the art.
- the adjuvant comprises an a!phavirus adjuvant as described, for example in U.S. 7,862,829.
- Boosting dosages can- further be administered over a time course of days, weeks, months or years, In chroni infection, initial high doses followed by boosting doses may be advantageous.
- the pharmaceutical formulations of the invention can optionally comprise other medicinalna! agents, pharmaceutical agents, stabilizing agents, buffers, carriers, diluents, salts, tonicity adjusting agents, wetting agents, and the like, for example, sodium acetate, sodium lactate, sodium chloride, potassium chloride, calcium chloride, sorbftan monoiaurate, Methanol amine oieate, etc.
- the carrier will typically be a liquid.
- the carrier may be either solid or liquid.
- the carrier will he respirable, and is typically in a solid or liquid particulate form,
- compositions of the invention can ' be formulated for administration in a pharmaceutical carrier in accordance with known techniques. See, e.g., Remington, The Science And Practice of Pharmacy (9 th Ed. 1 95).
- the VLPs are typically admixed. with, inter alia, an acceptable carrier.
- the carrier can be a solid or a liquid, or both;, and is optionally formulated with the compound as a unit-dose formulation, for example, a tablet
- aqueous earners can be used, e.g., water, buffered water, 0.9% saline, 0,3% glycine, hyaluronic acid, pyrogen-free water, p rogen-free phosphate-buffered saline solution, bacteriostatic water, or Cremophor ELfRl (BASF, Parsippany, NX), and the like.
- These compositions can be sterilised by conventional techniques.
- the formulations of the invention can be prepared by any of the well-known techniques of pharmacy,
- the pharmaceutical formulations can be packaged for use as is, or iyophi!ized, the lyopMlized preparation generally being combined with a sterile aqueous solution prior to administration.
- the compositions can further be packaged in unit/dose or multi-dose containers, for example, in sealed ampoules and vials.
- compositions can be formulated for administration by any method known in the art according to conventional techniques of pharmacy,
- the compositions can be formulated to be administered intranasally, by inhalation (e.g. , oral inhalation), orally, buccally (e.g. , sublingually), rectally, vaginally, topically, intrathecally, intraoeukriy, transdermaiiy, by parenteral administration (e.g. , intramuscular [e.g. , skeletal muscle], intravenous, subcutaneous, intradermal, .intrapleural, intracerebral arid intra-arterial, intrathecal), or topically (e.g. , to both skin and mucosal surfaces, including airway surfaces).
- parenteral administration e.g. , intramuscular [e.g. , skeletal muscle], intravenous, subcutaneous, intradermal, .intrapleural, intracerebral arid intra-arterial, intrathecal
- the pharmaceutical formulation can be formulated as an aerosol (this term including both liquid and dry powder aerosols).
- the pharmaceutical formulation can be pro vided in a finely di vided form along with a surfactant and propellan Typical percentages of the composition are 0,01 -20% by weight, preferably 1-10%.
- the surfactant is generally nontoxic and soluble in the propeliant
- Representative of such agents are the esters or partial esters of fatty acids containing from 6 to 22 carbon atoms, such as caproic, octanoic, Jauric, palmitic, stearic, linoleic, !inolenic, olesieric and oleic acids with an aliphatic polyhydric alcohol or its cyclic anhydride.
- Mixed esters such as mixed or natural glycerides may be employed.
- the surfactant may constitute 0,1-20% by weight of the composition, preferably 0.25-5%.
- the balance of the composition is ordinarily propeliant
- a carrier can also be included, if desired, as with lecithin for intranasal delivery.
- Aerosols of liquid particles can be produced by any suitable means, such as with a pressure-driven aerosol nebulizer or an ultrasonic nebulizer, as is known to those of skill in the art. See, e.g., U.S. Patent No. 4,501,729, Aerosols of solid particles can likewise be produced with any solid particulate medicament aerosol generator, by techniques known in the pharmaceutical art. Intranasal administration can also be by droplet administration to a nasal surface.
- injectable formulations can be prepared in conventional forms, either as liquid solutions or suspensions, solid forms suitable for solution or suspensio in liquid prior to injection, or as emulsions.
- Extemporaneous injection solutions and suspensions can be prepared from sterile powders, grannies and tablets of the kind previously described.
- an injectable, stable, sterile formulation of the invention in a unit dosage form in a sealed container can be provided.
- the formulation can be provided in the form of a lyophilizate, which ca be reconstituted with a suitable pharmaceutically acceptable carrier to form a liquid composition suitable for injection into a subject
- the unit dosage form can be from about 1 ug to about. 10 grams of the formulation.
- a sufficient amount of emulsifying agent which is pharmaceutically acceptable, can be included- in sufficient quantity to emulsify the formulation in an aqueous carrier.
- emulsifying agent is phosphatidyl choline.
- compositions suitable for oral administration can be presented in discrete units, such as capsules, cachets, lozenges, or tables, as a powder or granules; as a solution or a suspension in an aqueous or non-aqueous liquid; or as an osHn-waier or water- in-oil. emulsion.
- Oral deliver can be performed by complexing .
- a compound(s) of the present invention to a carrier capable of withstanding degradation by digestive enzymes in the gut of an animal. Examples of such carriers include plastic capsules or tablets, as known in the art.
- Such formulations are prepared by any suitable method of pharmacy, which includes the step of bringing into association the protein(s) and a suitable carrier (which may contain one or more accessory ingredients as noted above),
- the pharmaceutical formulations are prepared by umformiy and intimately admixing the compound(s) with a liquid or finely divided solid carrier, or both, and then, if necessary, shaping the resulting mixture.
- a tablet can be prepared by compressing or molding a powder or granules, optionally with one or more accessory ingredients. Compressed tablets are prepared by compressing, i a suitable machine, the formulation in.
- a free-flowing form such as a powder or granules optionally mixed with a binder, lubricant, inert diluent, and/or surface active/dispersing agent(s).
- Molded tablets are made by molding, in a suitable machine s the powdered protein moistened with an inert liquid binder.
- compositions suitable for buccal (sub-lingual) administration include lozenges comprising the compound(s) In a flavored base, usually sucrose and acacia or tragaeanfh; and pastilles in an inert base such as gelatin and glycerin or sucrose and acacia.
- compositions suitable for parenteral administration can comprise sterile aqueous and non-aqueous injection solutions, which preparations are preferably isotonic with the blood of the intended recipient, These preparations can contain antioxidants, buffers, bacteriostats and solutes, which render the composition isotonic with the blood of the intended recipient.
- Aqueous and non-aqueous sterile suspensions, solutions and emuls ons can include suspending agents and thickening agents. Exam les of nonaqueous solvents are propylene glycol, polyethylene glycol, vegetable oils such as olive oil, and injectable organic esters such as ethyl oleate.
- Aqueous carriers include water,
- aicohoiic/aqueous solutions including saline and buffered media.
- Parenteral vehicles include sodium chloride solution, Ringer's dextrose, dextrose and sodium chloride, laetated Ringer's, or fixed oils
- Intravenous vehicles include fluid and nutrient replenishes, electrolyte replenishes ⁇ (such as those based on Ringer's dextrose), and the like
- Preservatives and oilier additives may also be present such as, for example, antimicrobials, antioxidants, chelating agents, and inert gases and the like.
- compositions suitable for rectal administration are optionally presented as unit dose suppositories, These can be prepared by admixing the active agent with one or more conventional solid carriers, such as for example, cocoa butter and then shaping the resulting mixture.
- compositions suitable for topical application to the skin preferably take the form of an ointment, cream, lotion, paste, gel, spray, aerosol, or oil.
- Carriers thai can be used include, but are not limited to, petroleum jelly, lanolme, polyethylene glycols, alcohols, transdermal enhancers, and combinations of two or more thereof, in some embodiments, for example, topical delivery can be performed by mixing a pharmaceutical forrrmlation of the present invention with a lipophilic reagent ⁇ e.g., DMS0) that is capable of passing into the skin.
- a lipophilic reagent ⁇ e.g., DMS0
- compositions suitable for transdermal administration can be in the form of discrete patches adapted to remain in intimate contact with the epidermis of the subject for a prolonged period of time.
- Formulations suitable for transdermal administration can also be delivered by iontophoresis (see, for example, Pharmaceutical Research 3:318 (1986)) and typically take the form of a buffered aqueous solution of the compound ⁇ s).
- Suitable formulations can comprise citrate or ethanol/water and can contain from 0.1 to 0.2M active ingredient.
- the dosage of a virus particle of this invention can be in a range of about 1.0 4 to about 10'' plaque forming units (PFUs).
- the dosage of a VLP of this invention can be in a range of about 500 micrograms to about 5 milligrams, in embodiments of this invention, the dosage of a protein of this invention can he in a range of about 10° to about 10 ' micrograms ⁇ +/- adjuvant
- composition can be formulated as a liposomal fonnuktion.
- the lipid layer employed can be of any conventional composition and can either contain cholesterol or can be ebo!esiero!-free.
- the liposomes that ate produced can be reduced in size, for example, through the use of standard sonication and homogenization techniques.
- the liposomal formulations can be iyophilized to produce a lyophilizate which can be reconstituted with & pharmaceutically acceptable carrier, such as water, to regenerate a liposomal suspension.
- the immunogenic formulations of the invention can optionally be sterile, and can further be provided in a closed pathogen-impermeable container.
- the dengue virus (DENV) complex consists of four closely related viruses designated DENV serotypes 1-4, which are amigenically similar yet induce complex patterns of cross reactive neutralizing and enhancing antibody responses in human populations.
- DENV serotypes 1-4 which are amigenically similar yet induce complex patterns of cross reactive neutralizing and enhancing antibody responses in human populations.
- Recombinant viruses were viable, evaluated for growth on insect and mammalian hosts, and monoclonal and polyclonal neutralization tests demonstrate that natural fflicrovariation among DENS neutralization influences cross neutralization susceptibility patterns.
- Recombinant vimses were viable and gain and loss of function assays with monoclonal and polyclonal sera revealed antigenic patterns that reveal important considerations in vaccine design.
- the anti-dengue virus (DENV) human monoclonal antibody (mAb) 5J7 potently neutralizes DENV serotype 3 (DENV-3) by binding to an epitope on the DENV-3 envelope (E) glycoprotein. This epitope spans the E region known as the E domain Hi (EDI-ii) hinge.
- DENV-3 5 7 epitope was transplanted into a DENV serotype 1 (DENV-l) E glycoprotein. This transplant makes the recombinant DENV- 1/3 virus sensitive to neutralization by mAb 5J7.
- the transplant does not disrupt the native DENV-l antigenic structure, and the recombinant vims is sensitive to both DENV-l and DENV-3 human polyclonal sera.
- This sensitivity indicates that the DENV- 1/3 chimeric E glycoprotein may function as a bivalent vaccine capable of inducing neutralizing antibodies against two virus serotypes > DENV-l and DENV-3.
- ctttcgtgga 6120 actcatgagg aggggtgacc ttcoagt r g gttagcccat aaagtagcat caga gggat 618 Q caaatataca gatagaaaat ggtgctttga tggacaacgc aataa caaa ttttagagga 6240 gaacatggat gtggaaatct ggacaagga aggagaaaag aaaaaattga gacctagg g 6300 gcttgatgcc cgcacttatt cagatccctt agcacrca-ag gaatttaagg actttgcggc 6360 tggcagaaag tcaatcgccc t.gatct.tgt gacagaaata ggaagagtgc ctcacacct
- aagaaatctc 360 aa catgttg aacaf.aatga acaggaggaa aagatctgtg accatgctce tcatgctgc 42.Q gcccacagcc ctggcgttcc atcfcgaccae ccgaggggga gageegca.ca tgatagttag 480 eaagcaggaa agaggaaaat cacttttgtt caagacetet gcaggtgtca acatgtgcac 540 ccttattgca atggatttgg gaqaqttatg tgaggacaca atgacetaca.
- aatgcccccg 600 gatcaetgag acggaaccag atgaogttga ctgttggtge aatgccacgg agacatgggt 660 gaectatgga acatgttctc aaactggtga acaccgacga g.aeaacgtt.
- gaaaactt.aa aat ttcag gatagtcacc gt cacactg gagaccagca 1380 ecaag gga aatgagacca cagaacatgg aaoaattgca aecataaeae ctcaagctcc 1440 cacgtcggaa atacagctga cagactacgg agct.ctaaca ttggattgtt cacctagaac 1S00 agggcr.agac ttta.atgaga tggt.gt.t.gtt gacaatgaaaaaaaaar.ca ggct.cgtc.ca 1560 caaacaatgg tttotagaet taccactgcc ttggacctcg ggggcttcaa- eateocaaga 1620 gacttggaat agacaagact
- ggca fc tttg tcac caatga agtccacaee tggacagagc aatataaatt 2520 ccaggccgac tccctaaga gactatcagc ggccattggg aaggcatggg aggagggtgt 2580 gtgtggaatt cqatcagcca ctcgtetega gaacatcatg tggaageaaa tat.caaat.ga 2640 attaaaccac atcttacttg aaaatgacat gaaatttaca gtggtegtag gagacgttag 2700 tggaatcttg gcccaaggaa agaaaatgat taqgccacaa cccacggaac.
- acaaat.ac.tc 2760 gtggaaaagc tggggaaag ccaaaatqat aggagcagat gtacagaata ccaccttcat 2820 catcgacggc ccaaacaccc cagaatgccc tgataac.caa agagcatgga ac.atttggga 288.0 agttgaagac tatggafcttg gaattttcar.
- gctatgcata tcaataatga tcgaagaggt 3540 aa gaga cc agatggagca gaaaaatgct.
- gatgactgga acattggctg tgttcetcet 3600 tcttacaatg ggacaattga catggaatga tcga cagg ctatgtatca tggttggagc 3560 caacgcttca gacaagatgg ggatgggaac aacgtaccta gctttgatgg eeaetttcag: 3720 aatgagacca atgttegcag tegggctaet gttcgcaga ttaacatcta gagaagttct 3780 tcttcttaca gtggattga gtctggtggc at
- ttggatgcaa 4080 accactaaco atgtttcccs taacagaaaa caaaatctgg ggaaggaaa gctggoctct 4140 eaatgaagga atr.atggetg ttggaatagt tagcattc t et agttca.e t etcaagaa 4200 fcgatgtgcca ctagctggcc caetaatagc tggaggca g ctaatageat gttatgtcat 4260 atctggaagc toggccgatt tatcactgga gaaagcggci; gaggtctcet gggaagaaga 4320 agcaqaacac tctggtgcqt cacaeaaeat actaqtggag gtccaagatg at.ggaaceat 4380 gaagataa
- ggai:gaagca catttcaccg atccagccag 5400 catagcag.cc agagggtata tctcaacccg agtgggtatg ggtgaagcag c.tgcgatttt 54 ' 6C cat acagcc acteceeccg atcggtgga ggcctf.tcoa cagagcaa g cagttatcca 5-520 agatgaggaa agagacattc etgaaagatc atggaa tca ggctatgact ggatcactga 5580 ttcccaggt aaaaagtet ggtttgttcc aagcatcaggaaatg acattgccaa 5640 atgttta .ga aagaatggga acgggtggt ccaattg
- Atgcagtggc 6960 cacaacaatt atcaotccca- tgatgagaca cacaattgaa aacacaacgg cgaatatttc 7020 actgacagct a gcaaacc aggeagetat.
- ctacagcatc 10680 a tccaggca cagaacgeca ga a tggaa ggtgctg i: gaa tcaacag gt.tctaaacg 10740 aagagc 10746
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Virology (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Biochemistry (AREA)
- Molecular Biology (AREA)
- Biophysics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Immunology (AREA)
- Communicable Diseases (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Zoology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Engineering & Computer Science (AREA)
- Gastroenterology & Hepatology (AREA)
- Oncology (AREA)
- Wood Science & Technology (AREA)
- Microbiology (AREA)
- Biotechnology (AREA)
- Biomedical Technology (AREA)
- General Engineering & Computer Science (AREA)
- Tropical Medicine & Parasitology (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Peptides Or Proteins (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Mycology (AREA)
- Epidemiology (AREA)
Abstract
The present invention provides compositions and methods of use comprising a chimeric dengue virus E glycoprotein comprising a dengue virus E glycoprotein backbone, which comprises amino acid substitutions that introduce an epitope that is recognized by an antibody from a dengue virus serotype that is different from the dengue virus serotype of the dengue virus E glycoprotein backbone.
Description
METHODS AND COMPOSITIONS FOR DENGUE VIRUS VACCINES
STATEMENT O PRIORITY
This application claims the benefit, under 35 U.8.C, § 11 (e), of U.S Provisional Application Serial No, 61/839,687, filed June 26, 2013, the entire contents of which are incorporated by reference herein.
STATEMENT Of GOVERNMENT SUPPORT This invention was made with government support under Grant No. U54 AI0S7157 awarded by the National Institutes of Health. The United States government has certain rights in the invention.
FIELD OF THE INVENTION
The present invention is directed to dengue virus vaccines that induce neutralizing antibodies against more than, one dengue vims serotype from, a single source,
BACKGROUND OF THE INVENTION
Dengue is a mosquito-borne flavivirus that is spreading at an unprecedented rate and .has developed into a major health and economic burden in over 50 countries. Current DENY vaccines protecting against all four DENY serotypes must be delivered as a "tetravalent" fomiulation of four viruses or .four recombinant proteins, each intended to confer protection against that serotype. The correct mix of serotypes in the tetravalent cocktail to achieve a balanced antibody response is not known, underscored by the recent failure of the most advanced tetravalent live attenuated chimeric virus to provide clinically meaningful protection in a large phase 2B trial in Thailand (Sabehareon A, et al, 2012), Viral interference is. thought to contribute to failure as one or more virus serotypes out-compete the others. The DEN - 1/3 and DENY 3/1 chimeric viruses are single viruses that present epitopes recognized by neutralizing antibodies from both DENV-i and DENV-3 immune individuals. This indicates that single viruses should be able to elicit neutralizing . antibodies targeting two serotypes at once, replacing two viruses (DENV-I and 3) with one virus (DENV-'I /3 or DENV-3/I).
BRIEF DESCRIPTION OF THE DRAWINGS
Figures 1A-B. For the DENV- 1/3 mutant, the EDI-II hinge from DENV3 was transplanted into a DENV-1 background, WestPac'74. creating a DENV-3/1. hinge mutant. The EDI-II hinge was defined using the DENV3 specific human mAb 5J7, A) The resultant virus, rDENV-1 3, was tested a ainst monoclonal antibody 5J7. This figure shows that DENV-1 is not neutralized by 5J7, whereas DENV-3 is. rDENV-1 3, whic only contains the DENV-3 EDI/II hinge, is neutralized by 5J7 at concentrations equivalent to DENV-3 neutralizing concentrations. This demonstrates successful transplant of the SJ7 epitope into DENY . B) This panel shows that DENV-3 is not neutralized by mAb 1F4, DENV-1 is neutralized by 1 F4t and rDENV-1/3 is also neutralized, indicating that 1F4 can still, bind to and neutralize the chimeric virus.
Figures 2A-B. This figure shows primary DENV-1 and DENV-3 human immune sera tested against DENV-1, DENV-3 and the hinge chimeric virus WestPac-3001 hinge (rDENV-1/3) . The Y - axis shows fold dilution of immune .sera required to neutralize 50% of input virus in tissue culture. The higher values indicate more potent serum. A) DENV- 1 primary immune sera potently neutralizes DENV-1 but not DENV-3. rDENV-1/3 is sensitive to neutralization by DENV- 1 immune sera at concentrations similar to DENV-1, indicating that in contrast to the parental DENV-3 vims, the chimeric vims displays epitopes recognized by DENV-1 immune sera. B) DENV-3 primary immune sera does not neutralize DENV-1 but neutralizes DENV-3. rDENV-1/3 is neutralized by DENV-3 primary immune sera at concentrations similar to DENV-3, indicating that the chimeric virus rDENV-1/3 preserves the critical DENV-3 epitopes, targeted by DENV-3 antibodies, in DENV-3 human immune sera. * indicates not neutralized.
Figure 3. This figure shows that WestPac'74 3001 -hinge induces broadly cross- neutralizing antibodies at 28, 60, .90, 120 and 180 days post infection in rhesus macaques.
The Y axis shows neutralizing antibody titer as above. The X axis- shows each virus serotype. Each plotted point is the neutralizing titer for a single rhesus macaque against a given serotype. The central line through each cluster of points- is the geometric mean neutralizing titer for each group of macaques against each serotype. The whiskers show standard error of the mean, Each time point (28, 30, 60, 90, 120, 180 days) shows broadly cross-neutralizing antibody responses against all four serotypes.
Figures 4A-B, For the DENV-3/1 mutants, the EDI-II hinge defined by the monoclonal antibody 1 F4 footprint from DENV1 ( estPae '74) was transplanted into a DENV-3 background (3001) creating a DENV- 1/3 hinge mutant. This transplant was
executed for three different viruses, (1F4S, 1F4R, and 1F4E), with, each variant representing a larger epitope region. The ΕΪ3Ϊ-1Ϊ hinge from rDENV-3 was put. into a recombinant rDENV-1 virus. Th s figure shows enzyme linked immunosorbent -assay (ELISA) data with relative binding of antibody by optical density (OD) on the Y-axis, and increasing antibody concentration on the X-axis, A) Binding of mAb 1-F4 to 30G1-1F4S, R and E. The rising C rve against fee chimeric virus shows binding of the antibody, in contrast to parental 3001, which does not bind mAb IF4. B) Binding of mAb 5J7 to parental 3001 , 3001-1F4S, R and -E. 5J7 binding is preserved in these viruses, whereas epitope donor icWestPac '74 does not bind 5J7.
Figures 5A-B. This figure shows primary DENV-i and DENV-3 human immune sera tested against DENV-1, DENV-3 and the hinge chimeric virus 3001-1 F4E. The Y - axis shows fold dilution of immune sera required to neutralize 50% of input vims in tissue culture. The higher values indicate more potent serum. A) DB V-l primary immune sera potently neutralizes DENV-1 but not DENV-3, 3001 1F4E is sensitive to neutralization by DENV-1 immune sera at concentrations similar to .DENV- 1 , indicating that in contrast to the parental DENV-3 virus, the chimeric virus displays epitopes recognized by DENV-1 immune sera. B) DENV-3 primary immune sera does not neutralize DENV-1 but neutralizes DENV-3, 3001 1F4E is neutralized b DENV-3 primary immune sera at concentrations similar to DENV-3, indicating that the chimeric virus 3001-1F4E preserves the critical DENV-3 epitopes targeted by DENV-3 antibodies in DENV-3 human immune sera.
Figure 6. I munogenicity of 3001-1 F4E in rhesus macaques, Only one time point is provided, showing broadly cross-neutralizing antibodies,, consistent- ith what was found for WestPac-3001 hinge. SUMMARY OF THE INVENTION
The present invention provides a chimeric dengue virus E glycoprotein comprising a dengue virus E glycoprotein backbone thai comprises amino acid substitutions feat introduce an- epitope mat is recognized by an antibody that is reactive with a dengue vims serotype that is different from the dengue virus serotype of the dengue virus E glycoprotein backbone. In one embodiment, the dengue vims E glycoprotein backbone is from dengue virus serotype 1 and in one embodiment, the dengue vims E glycoprotein backbone is from dengue vims serotype 3. In some embodiments, the antibody is reactive with dengue virus serotype 3 (e.g., monoclonal antibody 5J7) and in other embodiments, the antibody is reactive with dengue virus serotype 1 (e.g., monoclonal antibody 1F4).
The present invention further provides a chimeric dengue virus E glycoprotein, comprising the amino acid sequence:
MRCVGIGNRDFVEGl^GAT VDVVLEHGSCVTT AKDKPTLDIELLKTE 'QLATLR LC lEAKISNTTTDSRCPTQGEfiTLVEEQDTNFVCR FVDRGKGKGCGLFGKGSLITCAKF CVT IEGKWQYENLKYSVIV VHTGDQBQVGNETTEHGT.IATITPQAP' SEIQLTDYGA LTLDCSPRTGLDF EMILLTMKNKAWMVHRQWFLDLPLPWTSGASTSQETWNRQD K AIAK QEVVVLGSQEGA HTAI, GATEIQM3GGTSIFAGHLKCRL MD LTLKG]vSSYy MCTGSF LEKEVftETQHGTVLVQVKYEGTDAPC IPFSSQDEKGVT NGRLITANPIV?D KEKPVNIEAEPPFGESYI GAGE ALKLSWFKKG
Also provided herein is a chimeric dengue virus E glycoprotein, comprising the amino acid sequence:
MRCVGIGNRDFVEGLSGAT VDVVLEHGGCVTTMA N PTLDIELF TEV KPAVLRKLCIE
GKITNITTDSRCPT2GEAVLPESQDQWYVCKHTYVDRGWGNGCGLFGKGSLVTCAKFQCLEP IEGKWQYENLKYSVIVTVHTGDQHQVGNETTEHGTIATITPQAPTSEIQL DYGAkGLECS PR GLDFNE¾ILLTMKN A¾MVnRQ¾FFDLPLPWTSGATTETPTWNRKELLVTF NAHAK Q EVVvLGSQEGAMHTALTGATElQ^SG lrAGHLKCRL MD LELKGMSYAMCTNTFVL K EVSETQHGTILIKVEYKGEDAPCKIPFSTEDGQGKAHNGRLITANPVVT KEEPVNIEAEPP FGES Iv IGIGD ALKI WYKKG
Additionally provided herein is flavivirus particle or virus like particle (VLP) comprising the E glycoprotein of this invention.
An isolated nucleic acid molecule encoding the E glycoprotein of this invention is also provided herein, as well as an isolated nucleic acid molecule encoding the flavivirus particle or VLP of this invention.
The present invention also provides a composition comprising the E glycoprotein of this invention in a pharmaceutically acceptable carrier and provides a composition comprising the nucleic acid molecule of this invention in a phamiaceutically acceptable carrier,
Furthermore, the present invention provides a method of producing an immune response to a dengue virus in a subject (e.g., a subject in need thereof), comprising administering to the subject an effective amount of the E glycoprotein of this invention, the flavivirus particle of this invention, the nucleic acid molecule of this invention and or the composi ion of this invention and any combination thereof,
The present invention also provides a method of treating a. dengue virus infection in a subject in need thereof, comprising administering to the subject an effective amount of the E glycoprotein of this invention, the flavivirus particle of this, invention, the nucleic acid molec ule of any of this invention and/or the composition of this invention and any combination thereof
Additionally 'provided herein is a method of preventing a dengue virus infection in a subject (e.g., a subject in need thereof), comprising -administering to the subject an effective amount of the E glycoprotein of this invention, the flavivirus particle of this invention, the nucleic acid molecule of any of this invention and/or the composition of ibis invention and any combination thereof.
A method is also provided herein of protecting a subject (e.g. , a subject in need thereof), from the effects of dengue vims infection, comprising administering to the subject an effective amount of the E glycoprotein of this invention, the flavivirus particle of this in vention, the nucleic acid molecule of any of this invention and/'or the composition of this invention and any combination thereof.
The present invention further provides the E glycoprotein of this invention, the flavivirus particle of this invention, the nucleic acid molecule of this invention and/or the composition of this invention for use in the manufacture of a medicament for producing an immune response to a dengue -virus in a subject, for treating a dengue virus infection in a subject in need thereof, for preventing a dengue vims infection in a subject and/or for protecting a subject from the effects of dengue virus infection,
Also provided herein is the use- f the E glycoprotein of this invention, the flavi virus particle of this invention, the nucleic acid molecule of this invention and/or the composition of this invention for use in producing an immune response to a dengue virus in a subject, in treating a dengue virus infection in a subject in need thereof, in preventing a dengue virus infection in a subject and/or in protecting a subject from the effects of dengue virus- infection.
DETAILED DESCRIPTION OF THE INVENTION
The present invention is based on the unexpected discovery that epitope regions that -define a DENY serotype can be transferred into a 'protein backbone of a different DENY serotype to create a chimeric molecule that contains antibody targets for both serotypes, thereby functioning as a bivalent vaccine that can induce neutralizing antibodies against two different DENY serotypes from a single source. Thus, in one embodiment, the present invention provides a platform for construction of a chimeric dengue virus E glycoprotein backbone that comprises amino acid substitutions that introduce epitopes that are recognized by an antibody that is reactive with -a. dengue virus serotype that is different from th dengue virus serotype of the dengue virus E glycoprotein backbone.
In some embodiments, that dengue vims E glycoprotein backbone is from dengue virus serotype 1 , In some embodiments, the dengue virus E glycoprotein backbone can be from dengue virus serotype 2, dengue virus serotype 3 or dengue virus serotype 4,
In some- embodiments, the antibody that is reactive with a dengue virus serotype that is different from the dengue virus serotype of the dengue virus E glycoprotein backbone is an antibody that Is reactive with dengue vims serotype 3. A nonlimiting example of such an antibody is monoclonal antibody 5J7.
in other embodiments, the antibody that is reactive with a dengue virus serotype that is different from the dengue virus serotype of the dengue virus E glycoprotein backbone is an antibody that is reactive with dengue virus serotype 1, dengue virus serotype 2 or dengue virus serotype 4,
It would be understood that any combination of a first dengue virus serotype for the dengue virus E glycoprotein backbone and a second dengue virus serotype thai is the target of the antibody thai recognizes the epitope introduced into the E glycoprotein backbone can be used, provided that the first dengue virus serotype and the second dengue vims serotype are different (i.e., not the same serotype).
In some embodiments, the chimeric dengue virus E glycoprotein of this invention can comprise, consist essentially of or consist of the amino acid sequence:
WestPac74 ~3O01 hinge ( rDEKV-1 /3 )
MRCVGIGNRDFVBGLSGA WVDVVLEHGSCVTTi^KDKPTLDIELLKTPATQLASLRKLC lEA ISNTTTDSRCPTQGEATLVSEQDTNFVCRRTFVDRG GNGCGLFG GSLITCA F C TKIEG WQYENLKYSVIVTVHTGDQHQVGNETTEHGTIATITPQAPTSEIQLTDYGA LTLQCSFRTGLDFNEMILLTMKNK^^
KTAHAKKQEV LGSQEG¾MHTALTGATEI'QNSGGTSIFAGHL CRL MDKtTi GMSYV CTGSFKLSKEVAETQHGTVLVQV YEGTDAPCKIPFSSQDEKGVTQNGRLI ANPIVTD KE PVMl BAEPPFGESYI WGAGE ALKLS F'KKG .
in some embodiments, the chimeric dengue virus E glycoprotein of this invention can comprise, consist essentially of or consist of the amino acid sequence:
30Q1-1F4E (rDENV-3/1)
MRCVOIG¾DFVEGLSGA WDVVLBR
GKITNITTDSRCPTQGEAVLPEEQDQNYVCKHTYVDRGWGNGCGLFGKGSLVTCAKFQCLE? lEG QYENLKYSVIVTVHTGDQHQVGNETTESGTIATITPQAFTSEIQLTDYGALGLECS PRTGLDFNEMILL MKNKAWMVHRQSFFDLPLPKTSGATTETPTWNR ELLVTFKNAHA Q EVVVLGSQEGA HTALTGATEIQS?SG TSIFAGHLKCRLKMDKLELKGMSYAMCTNTFVL K EVSETQHGTILIKVEYKGEDAPCKIPFSTEDG.QG AHNGRLITANPVVTKKEEPVNIEAEPP FGESNIVIGIGD NAL-KIN»YKKG
The present invention also provides a fiavivirus particle or vims like particle (VLP) comprising the chimeric E glycoprotein of this invention.
Production of the chimeras of thi s invention can be carried out by introducing some (e.g., I, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, etc.) or all of the amino acid substitutions identified in Table 1 into a dengue vims E glycoprotein backbone or flavivirus E
glycoprotein backbone. Not every amino acid identified -in Table 1 is required to be substituted to produce a chimeric protein of this invention. For example, in some embodiments further substitutions and/or omission of substitutions of about 1, 2, 3, 4 or 5 amino acids at either end of the contiguous amino acid sequences identified in Table 1 as the respective epitope regions can be included in prod-action of a chimera of this invention. The number of substitutions neces sary to produce the desired conformational epitope can be readily determined by one of ordinary skill in the art according to the teachings herein and according to protocols well known in the art. The amino acid position numbering in Table 1 is based on the amino acid sequence of WestPac74 (DENV-1), or the amino acid sequence of UNC 3001 (DENV-3), as provided herein. However it -would be readily understood by one of ordinary skill in the art that Che equivalent amino acid positions in other dengue vims E glycoprotein amino acid sequences or other flavivirus E glycoprotein amino acid sequences can 'be readily identified and employed in the production of the chimeric proteins of this invention.
Table 2 shows one example of modifications that can be made to the nucleotide sequence encoding the DENV-1 E glycoprotein to introduce the epitope that is recognized by the monocionai antibody 5J7S which is reactive with DENV-3, The amino acid sequence that results from translation of a nucleotide sequence comprising these substitutions is:
MRCVGIGNRDFVEGLSGATWVDWLEKGSC'VTTMA DKPTLDIELLKTEATQLATLRKLC I EAKI SNTT-T DS RC PTQGEATL VEEQDTN FVCRRT FVDRGWGNGCGLFGKG-S L I TCAKFK -CVT IEGK QYENLKYSVIV VH GDQHQVGNETTEHGTIATITPQAPTSEIQLTDYGA LTLDCSPRTGLDFNEMILLTMKNKAWMVHRQ FLDLPLP TSGASTSQETWNRQDLLYTF KTAHA KQEWVLGSQEGJ^HTALTGATEIQHSGGTSIFAGHLKCRLKMDKLTL GMSYV' MCTGSF.KLE E VAETQHGT VLVQVK YEGT DAPCKI P FS SQOEKGVTQNGRLITAN P-I T D
KEKPVNIEAEPPFGESYIVVGAGE ALKLS FK G.
It would be understood that the modifications provided in Table 2 provide one example of how the amino acid sequence above can be ob tained and that, due to the degeneracy of the amino acid codons, numerous other modifications can be made to the nucleotide sequence encoding the DENY -3 E glycoprotein to obtain this amino acid sequence.
Table 3 shows that WestPac'74 3001 -hinge is infectious in rhesus macaques infected subctttaneously with 500,000 infectious units of vims. The reported values for each day are log transformed monkey serum virus titers quantified by imraunofocus assay.
Table 4, Attenuation of 30O1-1F4E in rhesus macaques. This table shows that 3001- 1F4E is infectious in rhesus niacaques infected subcutaneously with 500,000 infectious units of virus. However, this vims was below -quantitative level of detection (50 Infectious virus mL serum). A more sensitive assay, the delayed focus assay, is capable of detecting virus <5.0 infectious units/mL, but is: not capable of quantifyin the low level of virus present. Consequently days for which virus was detected by our most sensitive assay are scored as positive with "+". Total number of days infected are shown in the left column. The low level ofviremia and low mean number of days infected (2,25 days) are consistent with vims attenuation in macaques.
Table S. To further characterize the chimeric virus DENY 1/3, it was probed, with a DE V-1 specific monoclonal antibody, 1F4. 1F4 is serotype specific and its target epitope is in the BDi-II hinge, if the transplanted DENV-3 EDI-II hinge disrupts the IF4 epitope, 1F4 should no longer neutralize the chimeric WestPac74/3001 virus.
in some embodiments, the present invention provides a chimeric flavivirus E glycoprotein in which amino acid substitutions are made to introduce a dengue virus epitope into a flavivirus E glycoprotein from a flavivirus that is not a dengue virus, Thus, n some embodiments, the present invention provides a flavivirus E glycoprotein comprising a chimeric E glycoprotein comprising a flavivirus E glycoprotein backbone that is not a- dengue virus E glycoprotein backbone, wherein the flavivirus E glycoprotein backbone comprises amino acid substitutes that introduce an epitope that is recognized by an antibody that is reactive with a dengue virus.
Nonlimiting examples of flaviviruses that can be used include yellow fever virus (YFV) (e.g., GeriBank®' Database Accession No. JX503529) Japanese encephalitis virus (JEV) (e.g.. GenBank® Database Accession No. U14163), West Nile vims (WNV) (e.g., GenBank'^ Database Accession No. DQ21 1652) and any other flavivirus now known or later identified.
It is. known in the art that many attempts to produce dengue virus vaccines result in the production of non-neutralizing antibodies, which may increase the likelihood of pathology upon subsequence exposure to natural .infection or vaccine. Another approach to provide an engineered epitope is to deliver all or a portion of the dengue virus -E protein incorporated into another flavivirus particle or VLP. In representative embodiments, the heterologous flavivirus is West Nile virus or Yellow Fever virus. Portions of the E protein can be grafted into the E protein of the heterologous flavivirus backbone, e.g., to reduce the
generation of non-neutralizing dengue vires antibodies to non-neutralizing epitopes present in the dengue virus E protein and/or other dengue vims structural proteins.
Thus, a chimeric flavivirus or chimeric flavivirus VLP can present the quaternary dengue virus epitope in proper conformation while reducing the generation ofnon- neutralizing an tibodies to other portions of the dengue virus E protein -and/of other structural proteins that, are not presented ia the chimeric flavivirus or flavivirus VLP.
In some embodiments of the invention the indi vidual and conformational epitopes of the flavivirus E glycoprotein or dengue virus E glycoprotein can be presented on a synthetic backbone or support structure so that the epitopes within the synthetic backbone or support stractore mimic the conformation and arrangement of the epitopes within the structure of the E glycoprotein, virus particle or VLP,
In still further embodiments of the invention, the present invention provides peptide miraitopes (see Meloen et ai. (2000) J. Mot R cogn , 13, 352-359) that mimic the individual and conformational epitopes of the E glycoproteins of the invention, Mtmi opes may be identified using any technique known in the art, such as by surface stimulation, random peptide l braries or phage display libraries, using an antibody or antibodies to the individual, and conformational epitopes of the E glycoproteins of the invention.
The invention further provides a nucleic acid (e.g., isolated nucleic acid) encoding a dengue virus epitope or a polypeptide of the invention,
The invention .further provides a nucleic acid ( g., an isolated nucleic acid) encoding a chimeric flavivirus VLP or a chimeric flavivirus particle (e.g., a viral coat of the flavivirus particle) of the invention.
Also provided are vectors encoding the nucleic acids of the invention,
Also provided are ceils comprising the vectors, nucleic acids, dengue virus epitopes, polypeptides, chimeric flavivirus VLPs or chimeric flavivirus particles of the invention.
The invention also provides immunogenic compositions comprising the cells, vectors, nucleic acids, dengue virus epitopes, polypeptides, chimeric flavivirus VLPs or chimeric flavivirus particles of the invention, in embodiments, the immunogenic composition is monovalent. In embodiments, the immunogenic composition is multivalent (e.g. , tetravalent) for dengue virus serotypes DEN! , DEN2, DEN 3 and/or DEN4.
The invention encompasses methods of producing an immune response to a dengue virus in a subject, die method comprising administering to the subject an effective amount of a dengue virus epitope, a polypeptide, a chimeric■ flavivirus VLP or chimeric flavivirus particle, nucleic acid, vector, cell or immunogenic composition of the invention.
Further,, the present invention can advantageously be practiced to induce an immune response against one, two, three or ail four of DENI, DEN2, DEN 3 and PEN4. It is well- known in the art that effective and safe multivalent dengue vaccines have been, a challenge to design because of the problem of interference among serotypes. For example, the immune response may be predominantly directed against only some of the target serotypes. Multiple vaccinations are then required to try to achieve a response against all serotypes; however, in the case of dengue virus, this approach can be dangerous because repeated administrations to a subject with pre-existing antibodies can lead to dengue hemorrhagic fever,
A still further aspect of the inven tion is a method of treating a dengue virus infection, comprising administering to the subject an effective amount of a dengue virus epitope, a polypeptide, a chimeric flavivirus V'LP or chimeric fiavivirus particle, nucleic acid, vector, ceil, or immunogenic composition of the invention,
A still farther aspect of the invention is a method of preventing a dengue virus infection, comprising administering to the subject an effective amount of a dengue virus epitope, a polypeptide, a chimeric flavivirus VLP or chimeric flavivirus particle, nucleic acid, vector, cell, or immunogenic composition of the invention.
A stilt further aspect of th invention is a method of protecting a subject from the effects of dengue virus infection, comprising administering to the subject, an effective amount of a dengue virus epitope, a polypeptide, a chimeric flavi virus VLP or chimeric flavivirus particle, nucleic acid, vector, ceil, or immunogenic composition of the invention.
There are four serotypes of dengue virus (DBNV~15 DENV-2, DENV-3 and DENV- 4). Within each serotype there are a number of different strains or genotypes. The dengue virus antigens and epitopes of the invention can be derived from any dengue virus, including all serotypes, strains and genotypes, now known or later identified.
In embodiments of the invention, the dengue virus is UNCI 017 strain (DENI), West
Pacific 74 strain (DENI), SI 6803 strain (DEN2), UNC2005 strain (DEN2), UNC3001 strain (DEN3), UNC3043 (DEN3 strain 0S9.AP-2 from Philippines, 1984), UNC3009 strain (DEN3, D2863, Sri Lanka 1989), U C3066 (DEN3, strai 1342 from Puerto Rico 1977), CHS3489 strain (DENS), UNC4019 strain (DEN4), or TVP-360 (DEN4).
In embodiments of the invention, an "irnmunogenically active fragment" of a dengue vims polypeptide (e.g., the E protein) comprises, consists essentially of or consists of at least about 6, 8, 10, 12, 15, 20, 30, 50, 75, 100, 125, 150, 200, 250. 300, 350, 400, 450 or more amino acids, optionally contiguous amino acids, and or less than about 495, 475, 450, 425, 400, 350, 300, 250, 200, 150, 100, 75 or 50 amino acids, optionally contiguous amino acids,
including any combination of the foregoing as long as the lower limit is less than the upper limit, and the "iram nogenjcaliy active fragment" induces an immune response {e.g., lgG and/of IgA that react with the native antigen), optionally a protective immune response, against dengue virus in a host and induces the production of antibodies that specifically bind to the quaternary dengue virus epitope newly identified by the inventors.
The term "epitope" as used herein means a specific amino acid sequence that, when present in the proper conformation, provides a reactive site for an antibody (e.g., B ceil epitope) or T cell receptor {e.g., T ceil epitope).
Portions of a given polypeptide that include a B-cell epitope can he identified using any number of epitope mapping techniques thai are known in the art, (See, e.g. , Ep|iO >e Mapping Protocols in Methods, in Moje^ar B^logj;, Vol. 66, Glenn E, Morris, Ed., 1996, Humana Press, Toiowa, N.J.). For example, linear epitopes can be determined by, e.g., concurrently synthesizing large numbers of peptides on solid -supports, the peptides corresponding to portions of the protein molecule,, and reacting the peptides with antibodies while the peptides are still attached to the supports. Such techniques are known in the art and described in, e.g. , U.S. Pat. No, 4,708,871; Geysen et al. (1984) Proc. Natl Acad. ScL USA 81 :3998-4002; Geysen et al. (1986) Moke. Immunol 23:709-715,
'Similarly, conformational epitopes can he readily identified by determining spatial conformation of amino acids such as by, e.g.,- x-ray crystallography and 2-dimensional nuclear magnetic resonance. Antigenic regions of proteins can also be identified using standard antigenicity and hydropathy plots, such as those calculated using, e.g., the Orniga version 1 .0 software program available from the Oxford Molecular Group. This computer program employs the Hopp/ oods method (Hopp et al., Proc. Natl. Acad Sci USA (Γ981) 78:3824-3828) .for determining antigenicity profiles and the yte-Doolittle -technique ( yte et al, J. MoL Biol (1982) 157:105-132) for hydropathy plots.
Generally, T-eell epitopes that are involved in stimulating the cellular arm of a subject's immune system are short peptides of about 8-25 amino acids. A common way to identify T-ceil. epitopes is to use overlapping synthetic peptides and analyze pools of these peptides, or the individual ones, that are recognized by T cells from animals that are immune to the antigen of interest, using, for example, an enzyme-linked immunospot assay
(ELISPOT), These overlapping peptides can also be used in other assays such as the stimulation of cytokine release or secretion, or evaluated by constructing major
histocompatibility (MH -tetrarners containing the peptide. Such immunogenically active
fragments can also be identified based on their ability to stimulate lymphocyte proliferation in response to stimulation by various fragments front the antigen of interest.
The present invention can be practiced for prophylactic, therapeutic and/or diagnostic purposes. In addition, the invention can be practiced to produce antibodies for any purpose, such, as diagnostic or research purposes, or for passive immunization by transfer to another subject.
The present invention further provides a kit. comprising one or more compositions of this invention, It would be well understood by one of ordinary skill in the art that the kit of this invention can comprise one or more containers and/or receptacles to hold the reagents (e.g., antibodies, antigens, nucleic acids) of the kit, along with appropriate buffers and/or diluents and/or other solutions and directions for using the kit, as would be well known in the art. Such kits can further comprise -adjuvants- and/or other immunostirauktory or
immunomodulating agents, as are well known in the art.
The compositions and kits of the present invention can also include other medicinal agents, pharmaceutical agents, -carriers, diluents, immunostimulatory cytokines, etc. Actual methods of preparing such dosage forms are known, or will be apparent to those skilled in this art.
Administration to a subject can be by any route known in the art. As non-limiting examples, the route of administration can be by inhalation (e.g., oral and/or nasal inhalation), oral, buccal {e.g., sublingual), rectal, vaginal, topical (including administration to the airways), intraocular, transdermal, by parenteral {e.g., intramuscular [e.g., administration to skeletal muscle], intravenous, mtra-arteriaL intraperitoneal- and the like), subcutaneous (including administration into the footpad), intradermal, intrapleural, intracerebral, and/or intrathecal routes,
The epitopes, polypeptides, VLPs and viral, vectors of the invention can be delivered per se or by delivering a nucleic acid (e.g., DNA) that encodes the same.
Immunomodulatory compounds, such as immunomodulatory chemokines and cytokines (preferably, CTL inductive cytokines) can be administered concurrently to a subject,
Cytokines may be administered by any method known in the art. Exogenous cytokines may be administered to the subject, or alternatively, a nucleic acid encoding cytokine may be delivered to the subject using a suitable vector, and the cytokine produced in vivo. In particular embodiments, a viral adjuvant expresses the cytokine.
In embodiments of the invention, multiple dosages (e.g., two, three or mote) of a composition of the invention can be administered without detectable pathogenicity (e.g.. Dengue Shock Syndrome/Dengue Hemorrhagic Fever).
In embodiments of the invention, the multivalent vaccines of the in vention do not result in immune interference, e.g. , a balanced immune response Is induced against all antigens presented. In embodiments of the invention, the balanced response results in protective immunity against DENV-1, DENV--2, DENY--3 and DENV-4.
In embodiments of the invention, the multivalent vaccine can be administered to a subject that has anti -dengue maternal antibodies present.
It should be appreciated that the invention can be embodied in different forms and should not be construed as limited to the embodiments set forth herein. Rather, these embodiments are provided so that this disclosure will be thorough and complete, and will fully convey the scope of the invention to those skilled in the art.
Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. The terminology used in the description of the invention herein is for the purpose of descri bing particular embodiments only and is not intended to be limiting .of the invention.
As used herein, "a." "an" or "the" can mean one or more than one. For example, "a" ceil can mean a single ceil or a multiplicity of cells.
Also. as used, herein, "and/or" refers to and encompasses any and all possible combinations of one or more of the associated listed items, as well as the lack of
combinations when interpreted in the alternative ("or").
The term "about," as used herein when referring to a measurable value such as an amoun of dose (e.g. , an amount of a fatty acid) and the like, is meant to encompass variations oft 20%, ± 10%, ± 5%, ± 1%, ± Q.5%, or even ± 0.1% of the specified amount.
As used herein, the transitional phrase "consisting essentially of means that the scope of a claim is to be interpreted to encompass the specified materials or steps recited in the claim, "and those that do not materially affect the basic
claimed invention. See, In re Hen, 537 F.2d 549, 551-52, 190 U.S.P.Q. 461, 463 (CCPA 1976) (emphasis in the original); see also MP.EP § 21.11.03, Thus, the term "consisting essentially of when used in a claim of this invention is not intended to be interpreted to be equivalent to "comprising."
As used herein, the term "nucleic acid" encompasses both RNA and DNA, including cD A, . genomic DNA, synthetic (e.g., chemically synthesized) DNA and chimeras of RNA and DNA. The nucleic acid may be double-stranded or single-stranded. The nucleic acid may be synthesized using nucleotide analogs or derivatives (e.g., inosine or phosphorotbioate nucleotides). Such nucleotides can be used, for example, to prepare nucleic acids that have altered base-pairing abilities or increased resistance to nucleases .
As used herein, the term "polypeptide" encompasses both peptides and proteins (including fusion proteins), unless indicated otherwise,
A "'fusion protein" is a polypeptide produced when two heterologous nucleotide sequences or fragments thereof coding for two (or more) different polypeptides not found fused together in nature are fused together in the correct iransiationai reading frame.
A "recombinant" nucleic acid, polynucleotide or nucleotide sequence is one produced by genetic engineering techniques.
A "recombinant" polypeptide is produced from a recombinant nucleic acid, polypeptide or nucleotide sequence.
As used herein, an "isolated" polynucleotide {e.g., an "isolated nucleic acid" or an "isolated nucleotide sequence") means a polynucleotide at least partially separated from at least some of the other components of the naturally occurring organism or vims, for example, the cell or viral structural components or other polypeptides or nucleic acids commonly found associated with the polynucleotide. Optionally, but not necessarily, the "isolated'1 polynucleotide is present at a greater concentration {i.e., is enriched) as compared with the starting material (e.g., at least about a two-fold, three-fold, four-fold, ten-fold, twenty- fold, fifty-fold, one-hundred-fold,, five-hundred-fold, one thousand- old, ten thousand-fold or greater concentration), in representative embodiments, the isolated polynucleotide is at least about 1%, 5%, 10%, 20%, 30%, 40%, .50%, 60%, 70%, 80%, 90%, 95% or more pure.
An ''isolated" polypeptide means a polypeptide that is at least partially separated from at least some of the other components of the naturally occurring organism or virus, for example, the cell or viral structural components or other polypeptides or nucleic acids commonly found associated with the polypeptide. Optionally, but. not necessarily, the "isolated" polypeptide is present at a greater concentration {i.e., is enriched) as compared with the stalling material {e.g., at least about a two-fold, three-fold, four-fold, ten-fold, twenty-fold, fifty-fold, oae-hundred-fold, five-hundred-fold, one thousand-fold, ten thousandfold or greater concentration). In representative embodiments, the isolated polypeptide is at least about 1%, S%5 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95% or more pure.
Furthermore, an "isolated" cell is a cell that has been partially or completely separated from other components with which it is normally associated in nature. For example, aft isolated- cell can be a cell in culture medium and/or a cell in a pharmaceutically acceptable earner.
The terms "immufiogeti" and "antigen" are used interchangeably herein and mean any compound (including polypept des) to which a cellular and/or humoral immune response can be directed. In- particular embodiments, an immxsaogen or antigen can induce a protective immune response against the effects of dengue virus infection.
"Effective amount" as used herein refers to -an amount of a vector, nucleic acid, epitope, polypeptide, cell, particle, VLP, composition or formulation of the invention that is sufficient to produce a desired effect, which can be a therapeutic and/or beneficial effect. The effective amount will vary with the age, general condition of the subject, the severity of the condition being treated, the particular agent administered, the duratio of the treatment, the nature of any concurrent treatment, the pharmaceutically acceptable carrier used, and like factors within the knowledge and expertise of those skilled in the art. As appropriate, an "effective amount" . in an individual case can be determined by one of ordinary skill in the an by reference to the pertinent texts and literature and/or by using routine experimentation.
The term "immunogenic amount" or "'effective immunizing dose," as used herein, unless otherwise indicated, means an amount or dose sufficient to induce an immune response (which can optionally be a protective response) in the treated subject that is greater than the inherent immunity of non-immunized subjects. An immunogenic amount or effective immunizing dose in arty particular context can be routinel determined using methods known in the art.
The terms "vaccine," "vaccination" and "immunization" are well-understood in the art, and are used interchangeably herein. For example, the terms vaccine, vaccination or immunization can be understood to be a process or -Composition that increases a subject's immune reaction to an immynogen {e.g. , by providing an active immune response), and therefore its ability to resist, overcome and/or recover from -infection (i.e., a protective immune response},
By the terms "treat." "treating" or "treatment of" (and grammatical variations thereof) it is meant thai the severity of the subject's condition is reduced,, at least partially improved or ameliorated and/or that some alleviation, mitigation or decrease- in at least one clinical symptom is achieved and/or there is a delay in the progression of the disease or disorder, in representative embodiments, the terms "treat," "treating" or "treatment of (and grammatical
variations thereof) refer to a reduction in the severity of viremia and/or a delay in the progression of viremia, with or without other signs of clinical disease.
A "treatment effective" amount as used herein is an amount that is sufficient to treat (as defined herein) the subject. Those skilled in the art will appreciate tha , the therapeutic effects need' not be complete or curative, as long as 'some benefit is provided to the subject.
The term "prevent" "preventing" or "prevention of ? (and grammatical' variations thereof) refe to prevention and/or delay of the onset and/or progression of a disease, disorder and or a clinical syniptom(s) in a subject and or a reduction in the severity of the onset and/or progression of the disease, disorder and/or clinical symptom(s) relative to what would occur in the absence of the methods of the invention. In representative embodiments, the terms "prevent," "preventing" or "prevention of (and grammatical variations thereof) refer to prevention and/or delay of the onset and/or progression of viremia in the subject, with or without other signs of clinical disease. The prevention can be complete, e.g., the total absence of the disease, disorder and/or clinical symptom(s). The prevention, can also be partial, such that the occurrence of the disease, disorder and/or clinical symptom(s) in the subject and/or the severity of onset and/or the .progression is less than what would occur in the absence of the present invention.
A ''prevention effective" amount as used herein is an amount that is sufficient to prevent (as defined herein) the disease, disorder and/or clinical symptom in the subject. Those skilled in the art will appreciate that the level of prevention: need not be complete, as long as some benefit is provided to the subject.
The efficacy of treating and/or preventing dengue virus infection by the methods of the present invention can he determined by detecting a clinical improvement as indicated by a change in the subject's symptoms and/or clinical parameters (e.g., viremia), as would be well known to one of skill in the art.
Unless indicated otherwise, the terms "protect " "protecting," "protection" and "protective" (and grammatical variations thereof) encompass both methods of preventing and treating dengue virus infection in a subject whether against one or multiple strains- genotypes or serotypes of dengue virus.
The terms "protective" immune response or "protective" immunity as used herein indicates that the immune response confers some benefit to the subject in that it prevents or reduces the incidence and/or severity and/or duration of disease or any other manifestation of infection. For example, in representative embodiments, a protective immune response or protective immunity results in reduced viremia, whether or not accompanied by clinical
disease. Alternatively, a protective immune response or protective immunity may be useful in. the therapeutic treatment of existing disease.
An "active immune response" or "active immunity" is characterized by "participation of host tissues and cells after an encounter with the immunogen. It involves differentiation and proliferation of immunocompetent cells in lymphoreticular tissues, which lead to synthesis of antibody or the development of cell-mediated reactivity, or both." Herbert B. Herscowitz, Immunophysio!ogy: Ceil Function and Cellular Interactions in Antibody
Formation, in IMMUNOLOGY: BASIC PROCESSES 117 (Joseph A. Beilanti ed.s 1985). Alternatively stated,. an active immune response is mounted by the host after exposure to immimogens by infection or by vaccination. Active immunity can be contrasted with passive immunity, which is acquired through the "transfer of preformed substances (antibody, transfer factor, thymic graft, interleukin-2) from an actively immunized host to a non-immune host." Id.
A "subject" of the invention includes any animal susceptible to dengue virus infection. Such a subject is generally a mammalian subject (e.g. , a laboratory animal such as a rat, mouse, guinea pig, rabbit, primates, etc.), a farm or commercial animal (e.g., a cow, horse, goat, donkey, sheep, etc.), or a domestic animal (e.g., cat, dog, ferret, etc.). in particular embodiments, the subject is a primate subject, a non-human primate subject (e.g., a chimpanzee, baboon, monkey, gorilla, etc.) or a human. Subjects of the invention can be a subject kno or believed to be at risk of infection by dengue virus. Alternatively, a subject according to the invention can also include a subj ct not previously known or suspected to be infected by dengue virus or in need of treatment for dengue vims infection.
Subjects may be treated for any purpose, such as for eliciting a protective immune response, or for eliciting the production of antibodies in that subject, which antibodies can be collected and used for other purposes such as research or diagnostic purposes or for administering to other subjects to produce passive immunity therein, etc.
Subjects include males and/or females of any age, including neonates, juvenile, mature and geriatric subjects. With respect to human subjects, in representative embodiments, the subject can be an infant (e.g., less than, about 12 months, 10 months, 9 months, 8 months, 7 months, 6 months, or younger), a toddler (e.g., at least about 12, 18 or 24 months and/or less than about 36, 30 or 24 months), or a child (e.g., at least about 1, 2, 3, 4 or 5 years of age and/or less than about 14, 12, 10, 8, 7, 6, 5, or 4 years of age), in embodiments of the invention, the subject is a human subject that is from about 0 to 3, 4, 5, 6, 9, 12, 15, 18. 24, 30, 36, 48 or 60 months of age, from about 3 to 6, 9, 12, 15, 18, 24, 30, 36, 48 or 60 months
of age, from about 6 to 9, 12, 15, 18, 24, 30s 36» 48 or 60 months of age, from about 9 to 12, 15, 18, 24, 30, 36, 48 Or 60 months of age, from about 12 to 18, 24, 36, 48 or 60 months of age, from about 18 to 24, 30, 36, 48 or 60 months of age, or from about 24 to 30, 36, 48 or 60 months of age.
In embodiments of the invention, the subject has maternal antibodies to dengue virus.
A ''subject in need" of the methods of the invention can be a subject known, to be. or suspected of being, infected with, or at risk of being infected with, dengue virus.
Pharmaceutical formulations (e.g., immunogenic formulation) comprising the dengue virus epitopes, polypeptides, chimeric flavivirus VLPs or chimeric flavivirus particles, nucleic acids, vectors, cells or compositions of the invention and a pharmaceutically acceptable carrier are also provided, and can be formulated for administration in a pharmaceutical carrier in accordance with known techniques. See, e.g., Remington. The Science And Practice of Pharmacy (latest edition), in the manufacture of a pharmaceutical composition according to embodiments of the present invention, the composition of the invention is typically admixed with, inter alia, a pharmaceutically acceptable earner. By "pharmaceutically acceptable carrier" is meant a carrier that is compatible with other ingredients in the pharmaceutical composition and that is not harmful or deleterious to the subject. The carrier may be a solid or a liquid, or both, and is preferably formulated with the composition of the invention as a unit-dose formulation, for example, a tablet, which may contain from about 0.01 or 0,5% to about 95% or 99% by weight of the composition. The pharmaceutical compositions are prepared by any of the well-known techniques of pharmacy including, but not limited to, admixing the components, optionally including one or more accessory ingredients, in certain embodiments, the pharmaceutically acceptable carrier is sterile and would be deemed suitable for administration into human subjects according to regulator)' guidelines for pharmaceutical compositions comprising the carrier.
Furthermore, a "pharmaceutically acceptable" component such as a salt, carrier, excipient or. diluent of a composition according to the present invention is a component that (i) is compatible with the other ingredients of the composition in that it can be combined with the compositions of the present invention without rendering the composition unsuitable for its intended purpose, and (ii) is suitable for use with subjects as provided herein without undue adverse side effects (such as toxicity, irritation, and allergic response). Side effects are "undue" when their risk outweighs the benefit provided by the composition. Non-limiting examples of pharmaceutically acceptable components include any of the s tandard
pharmaceutical carriers such as phosphate buffered saline solutions, water, -emulsions such as oil/water emulsion, microemulsions and various types of wetting agents.
In some embodiments, the compositions of the invention can further comprise one or more than one adjuvant. The adjuvants of the- present invention can be in the form of an amino acid sequence, and/or in the form or a nucleic acid encoding an adjuvant. When in the form of a nucleic acid, the adjuvant can be a component of a nucleic acid encoding the poi peptide(s) or fragments) or epiiopc(s) and/or a separate component of the composition comprising the nucleic acid encoding the polypeptide(s) or fragment(s) or epitope(s) of the invention. According to the present invention, the adjuvant can also be an amino acid sequence that is a peptide, a protein fragment or a whole protein that functions as an adjuvant, and/or the adjuvant can be a nucleic acid encoding a peptide, protein fragment or whole protein that functions as an adjuvant As used herein, "adjuvant" describes a substance, which can he any immunomodulating substance capable of being combined with a composition of the invention to enhance, improve or otherwise modulate an immune response in a subject.
In lurfher embodiments,, the adjuvant can be, but is not limited to, an
iiiimunostimulatory cytokine (including, but not limited to, GM/CSF, interleukin-2, interleukm- 2, inteiferon-garnma, interleukin- , tumor necrosis factor-alpha, interleukin-l, hematopoietic factor flt3L, CD40L. B'7,1 co-stimulatory molecules and B7.2 co-stimulatory molecules), SYNTEX adjuvant formulation 1 (SAF-1) composed of 5 percent (wt/vol) sqttaiene (DASF, Parsippany, NJ.)> 2,5 percent Plutonic, LI 21 polymer (Aldrich Chemical, Milwaukee), and 0,2 percent polysorbate (Tween 80, Sigma) in phosphate-buffered saline. Suitable adjuvants also include an aluminum salt such as aluminum hydroxide gel (alum), aluminum phosphate, -or algannmulim but may also be a salt of calcium, iron or zinc, or may¬ be an insoluble suspension of acylated tyrosine, or acylated sugars, cationieaUy or arhoniealiy dertvatized polysaccharides, or poiyphosphazenes.
Other adjuvants are well known in the art and include without limitation MF 59, LT- 635 LT-R72 (Pal et al.s Vaccine 24(6);766-7S (2005)), QS-21, Fretaid's adjuvant (complete and incomplete), aluminum hydroxide. N-acetyl-mwamyl-L-threonyl-D-isoglutamine (Ihr- MDP), N-acetyl-normuraBiyS'-L-alariyl-D-isogiuiaiiiine (CGP 11637, referred to as nor- MDP), N-aceiyJmuramyi«L~danyl-^^ - gIycero-3-hydroxyphosphoryloxy)-ethylamine (CGP 19835A, referred to as MTP-PE) and RIBI. 'which contains three components extracted from bacteria, monophosphoryl lipid A,
trealose dimyeolate and cell wall skeleton (MPL+TD +CWS) in 2% sqiiafene/Tween 80 emulsion,
Additional adjuvants can include, for example, a' combination of monophosphoryl lipid A, preferably 3-de-0-acyIated monophosphoryl lipid A (3D- PL) together with an aluminum salt. An enhanced adjuvant. system involves the combination of a monophosphoryl lipid A and saponin derivative, particularly the combination of QS21 and 3D-MPL as disclosed in PCX publication number WO 94/00153, or a less reactogenic composition where the QS2I is quenched with cholesterol as disclosed in PCX publication number WO
96/33739. A particularly potent adjuvant formulation involving QS21 3D-MPL & tocopherol in an. oil in water emulsion is described in PCX publication number WO 95/17210. in addition, the nucleic acid compositions of the invention can include an adjuvant by comprising a nucleotide sequence encoding the antigen and a nucleotide sequence that, provides an adjuvant function, such as CpG sequences. Such CpG sequences, or motifs, are well known in the art.
An adjuvant for use with the present invention, such as, for example, an
irnmunostimulatory cytokine, can be administered before, concurrent with, and/or within a few hours, several hows, and/or 1, 2, 3, 4, 5, 6, 7, 8, 9, and/or 10 days before and/or after the administration of a composition of the invention to a subject.
Furthermore, any combination of adjuvants, such as immunostimuiatpry cytokines, can be co-administered to the subject before, after and/or concurrent with the administratio of an immunogenic composition of the invention. For example, combinations of
immiraostimulatory cytokines, can consist of two or more immunostimulatory cytokines, such as GM/CSF, mterkukm-25 interieukin-12, interferon-gamnsa,. mtefieukifi-4, tumor necrosis factor-alpha, mterleukin-l, hematopoietic factor ACL, CD40L, B7.1 co-stimulatory molecules and B7.2 co-stimulatory molecules, The effectiveness of an adjuvant or combination of adjuvants can be determined by measuring the immune response produced in response to administratio of a composition of this invention to a subject with and without the adjuvant or combination of adjuvants, using standard procedures, as described herein and as known in the art.
In embodiments of the invention, the adjuvant comprises an a!phavirus adjuvant as described, for example in U.S. 7,862,829.
Boosting dosages can- further be administered over a time course of days, weeks, months or years, In chroni infection, initial high doses followed by boosting doses may be advantageous.
The pharmaceutical formulations of the invention can optionally comprise other medicina! agents, pharmaceutical agents, stabilizing agents, buffers, carriers, diluents, salts, tonicity adjusting agents, wetting agents, and the like, for example, sodium acetate, sodium lactate, sodium chloride, potassium chloride, calcium chloride, sorbftan monoiaurate, Methanol amine oieate, etc.
For injection, the carrier will typically be a liquid. For other methods of
administration, the carrier may be either solid or liquid. For inhalation administration, the carrier will he respirable, and is typically in a solid or liquid particulate form,
The compositions of the invention can 'be formulated for administration in a pharmaceutical carrier in accordance with known techniques. See, e.g., Remington, The Science And Practice of Pharmacy (9th Ed. 1 95). In the manufacture of a pharmaceutical composition according to. the invention, the VLPs are typically admixed. with, inter alia, an acceptable carrier. The carrier can be a solid or a liquid, or both;, and is optionally formulated with the compound as a unit-dose formulation, for example, a tablet A variety of pharmaceutically acceptable aqueous earners can be used, e.g., water, buffered water, 0.9% saline, 0,3% glycine, hyaluronic acid, pyrogen-free water, p rogen-free phosphate-buffered saline solution, bacteriostatic water, or Cremophor ELfRl (BASF, Parsippany, NX), and the like. These compositions can be sterilised by conventional techniques. The formulations of the invention can be prepared by any of the well-known techniques of pharmacy,
The pharmaceutical formulations can be packaged for use as is, or iyophi!ized, the lyopMlized preparation generally being combined with a sterile aqueous solution prior to administration. The compositions can further be packaged in unit/dose or multi-dose containers, for example, in sealed ampoules and vials.
The pharmaceutical 'formulations can be formulated for administration by any method known in the art according to conventional techniques of pharmacy, For example, the compositions can be formulated to be administered intranasally, by inhalation (e.g. , oral inhalation), orally, buccally (e.g. , sublingually), rectally, vaginally, topically, intrathecally, intraoeukriy, transdermaiiy, by parenteral administration (e.g. , intramuscular [e.g. , skeletal muscle], intravenous, subcutaneous, intradermal, .intrapleural, intracerebral arid intra-arterial, intrathecal), or topically (e.g. , to both skin and mucosal surfaces, including airway surfaces).
For intranasal or inhalation administration, the pharmaceutical formulation can be formulated as an aerosol (this term including both liquid and dry powder aerosols). For example, the pharmaceutical formulation can be pro vided in a finely di vided form along with a surfactant and propellan Typical percentages of the composition are 0,01 -20% by weight,
preferably 1-10%. The surfactant is generally nontoxic and soluble in the propeliant Representative of such agents are the esters or partial esters of fatty acids containing from 6 to 22 carbon atoms, such as caproic, octanoic, Jauric, palmitic, stearic, linoleic, !inolenic, olesieric and oleic acids with an aliphatic polyhydric alcohol or its cyclic anhydride. Mixed esters, such as mixed or natural glycerides may be employed. The surfactant may constitute 0,1-20% by weight of the composition, preferably 0.25-5%. The balance of the composition is ordinarily propeliant A carrier can also be included, if desired, as with lecithin for intranasal delivery. Aerosols of liquid particles can be produced by any suitable means, such as with a pressure-driven aerosol nebulizer or an ultrasonic nebulizer, as is known to those of skill in the art. See, e.g., U.S. Patent No. 4,501,729, Aerosols of solid particles can likewise be produced with any solid particulate medicament aerosol generator, by techniques known in the pharmaceutical art. Intranasal administration can also be by droplet administration to a nasal surface.
injectable formulations can be prepared in conventional forms, either as liquid solutions or suspensions, solid forms suitable for solution or suspensio in liquid prior to injection, or as emulsions. Alternatively, one can administer the pharmaceutical formulations in a local rather than systemic manner, for example, in a depot or sustained-release formulation.
Extemporaneous injection solutions and suspensions can be prepared from sterile powders, grannies and tablets of the kind previously described. For example, an injectable, stable, sterile formulation of the invention in a unit dosage form in a sealed container can be provided. 'The formulation can be provided in the form of a lyophilizate, which ca be reconstituted with a suitable pharmaceutically acceptable carrier to form a liquid composition suitable for injection into a subject The unit dosage form can be from about 1 ug to about. 10 grams of the formulation. When the formulation is substantially water-insoluble, a sufficient amount of emulsifying agent which is pharmaceutically acceptable, can be included- in sufficient quantity to emulsify the formulation in an aqueous carrier. One such useful emulsifying agent is phosphatidyl choline.
Pharmaceutical formulations suitable for oral administration can be presented in discrete units, such as capsules, cachets, lozenges, or tables, as a powder or granules; as a solution or a suspension in an aqueous or non-aqueous liquid; or as an osHn-waier or water- in-oil. emulsion. Oral deliver can be performed by complexing. a compound(s) of the present invention to a carrier capable of withstanding degradation by digestive enzymes in the gut of an animal. Examples of such carriers include plastic capsules or tablets, as known in the art.
Such formulations are prepared by any suitable method of pharmacy, which includes the step of bringing into association the protein(s) and a suitable carrier (which may contain one or more accessory ingredients as noted above), In general, the pharmaceutical formulations are prepared by umformiy and intimately admixing the compound(s) with a liquid or finely divided solid carrier, or both, and then, if necessary, shaping the resulting mixture. For example, a tablet can be prepared by compressing or molding a powder or granules, optionally with one or more accessory ingredients. Compressed tablets are prepared by compressing, i a suitable machine, the formulation in. a free-flowing form, such as a powder or granules optionally mixed with a binder, lubricant, inert diluent, and/or surface active/dispersing agent(s). Molded tablets are made by molding, in a suitable machines the powdered protein moistened with an inert liquid binder.
Pharmaceutical formulations suitable for buccal (sub-lingual) administration include lozenges comprising the compound(s) In a flavored base, usually sucrose and acacia or tragaeanfh; and pastilles in an inert base such as gelatin and glycerin or sucrose and acacia.
Pharmaceutical' formulations suitable for parenteral administration can comprise sterile aqueous and non-aqueous injection solutions, which preparations are preferably isotonic with the blood of the intended recipient, These preparations can contain antioxidants, buffers, bacteriostats and solutes, which render the composition isotonic with the blood of the intended recipient. Aqueous and non-aqueous sterile suspensions, solutions and emuls ons can include suspending agents and thickening agents. Exam les of nonaqueous solvents are propylene glycol, polyethylene glycol, vegetable oils such as olive oil, and injectable organic esters such as ethyl oleate. Aqueous carriers include water,
aicohoiic/aqueous solutions, emulsions or suspensions, including saline and buffered media. Parenteral vehicles include sodium chloride solution, Ringer's dextrose, dextrose and sodium chloride, laetated Ringer's, or fixed oils, Intravenous vehicles include fluid and nutrient replenishes, electrolyte replenishes^ (such as those based on Ringer's dextrose), and the like, Preservatives and oilier additives may also be present such as, for example, antimicrobials, antioxidants, chelating agents, and inert gases and the like.
Pharmaceutical formulations suitable for rectal administration are optionally presented as unit dose suppositories, These can be prepared by admixing the active agent with one or more conventional solid carriers, such as for example, cocoa butter and then shaping the resulting mixture.
Pharmaceutical formulations suitable for topical application to the skin preferably take the form of an ointment, cream, lotion, paste, gel, spray, aerosol, or oil. Carriers thai can
be used include, but are not limited to, petroleum jelly, lanolme, polyethylene glycols, alcohols, transdermal enhancers, and combinations of two or more thereof, in some embodiments, for example, topical delivery can be performed by mixing a pharmaceutical forrrmlation of the present invention with a lipophilic reagent {e.g., DMS0) that is capable of passing into the skin.
Pharmaceutical formulations suitable for transdermal administration can be in the form of discrete patches adapted to remain in intimate contact with the epidermis of the subject for a prolonged period of time. Formulations suitable for transdermal administration can also be delivered by iontophoresis (see, for example, Pharmaceutical Research 3:318 (1986)) and typically take the form of a buffered aqueous solution of the compound{s). Suitable formulations can comprise citrate
or ethanol/water and can contain from 0.1 to 0.2M active ingredient.
In embodiments of the invention, the dosage of a virus particle of this invention can be in a range of about 1.04 to about 10'' plaque forming units (PFUs). In embodiments of this invention, the dosage of a VLP of this invention can be in a range of about 500 micrograms to about 5 milligrams, in embodiments of this invention, the dosage of a protein of this invention can he in a range of about 10° to about 10' micrograms■+/- adjuvant
Further, the composition can be formulated as a liposomal fonnuktion. The lipid layer employed can be of any conventional composition and can either contain cholesterol or can be ebo!esiero!-free. The liposomes that ate produced can be reduced in size, for example, through the use of standard sonication and homogenization techniques.
The liposomal formulations can be iyophilized to produce a lyophilizate which can be reconstituted with & pharmaceutically acceptable carrier, such as water, to regenerate a liposomal suspension.
The immunogenic formulations of the invention can optionally be sterile, and can further be provided in a closed pathogen-impermeable container.
EXAMPLES
Synthetic biology offers unparalleled genetic control over the genome structure, expression and organization of viral genomes. The dengue virus (DENV) complex consists of four closely related viruses designated DENV serotypes 1-4, which are amigenically similar yet induce complex patterns of cross reactive neutralizing and enhancing antibody responses in human populations. To study the antigenic relationships among the DENV serotypes, we describe the construction and characterization of a panel of stable DENV 1-4
molecular clones and recombinant vimses based on a low passage clinical isolates.
Recombinant vimses replicated like wild type viruses and encoded appropriate marker mutations. To evaluate the role of natural variation in DENV3, four synthetically designed isogenic constructs were made by replacing the parent envelope (E) glycoprotein gene with E genes based on the four genetically and geographically distinct DENV-3 genotypes.
Recombinant viruses were viable, evaluated for growth on insect and mammalian hosts, and monoclonal and polyclonal neutralization tests demonstrate that natural fflicrovariation among DENS neutralization influences cross neutralization susceptibility patterns. To e valuate the use of recombinant 'DNA technology to map defined epitopes, we used escape mutations and epitope mapping to map the coordinates of several epitopes, Then, we exchanged these epitopes between strains. Recombinant vimses were viable and gain and loss of function assays with monoclonal and polyclonal sera revealed antigenic patterns that reveal important considerations in vaccine design.
The anti-dengue virus (DENV) human monoclonal antibody (mAb) 5J7 potently neutralizes DENV serotype 3 (DENV-3) by binding to an epitope on the DENV-3 envelope (E) glycoprotein. This epitope spans the E region known as the E domain Hi (EDI-ii) hinge. Using a DENV infection, clone platform, the DENV-3 5 7 epitope was transplanted into a DENV serotype 1 (DENV-l) E glycoprotein. This transplant makes the recombinant DENV- 1/3 virus sensitive to neutralization by mAb 5J7. Significantly, the transplant does not disrupt the native DENV-l antigenic structure, and the recombinant vims is sensitive to both DENV-l and DENV-3 human polyclonal sera. This sensitivity indicates that the DENV- 1/3 chimeric E glycoprotein may function as a bivalent vaccine capable of inducing neutralizing antibodies against two virus serotypes > DENV-l and DENV-3.
The foregoing is illustrative of the present invention, and is not to be construed as limiting thereof. The invention is defined by the following claims, with equivalents of the claims to be included therein.
AH publications, patent applications, patents and oilier references cited herein are incorporated by reference in their entireties for the teachings relevant to the sentence and/or paragraph in which the reference is presented.
t-- 00
«
.S3
SB
WesiPac'74 T A A C C T C G T G
DENV- 1/3 hinge C C C A T G G A C A. fit, Position 1103 1105 1108 1111 1307 1309 1311 1318 1319 1321
WestPac'74 c c A G C G A G A A
DENV- 1/3 hinge A G G A A A G A G G nt. Position 1324 1416 1510 1513 1519 1523 1525 2528 2529 1531
WesiPac'74 C C C T G G G G T G
DENV -1/3 hinge 0 T T C A A C A C A nt Position 1538 1543 1547 1553 1555 1558 156! 1563 1724 1729
WestPac'74 G A T C C C C A T T
DENV- 1/3 hinge A C G A G A. T G c A nt. Position 1735 1749 1750 1753 175? 1758 1759 1764 1765 1774
O
at
ON
ON
Q
ON.
o
p +
Q
TABLE 5.
Mabs B nor Virus rE EDI II DV1
Binding
1B.19 IIDI84 Complex + 1.2 1.8
IB22 HD184 Complex >!.0 >10 >10 >10
1B23 19 Complex 4- 4- 7.7 9.77 3.1 18.6
1C6 Harris Acute Complex. >10 >10 1.55 >10
10000 HD184 Complex + i- 1.1 I 3.4 4
1F4 HD184 DENV-1 0.11 >10 >10 >10
1F16.2 Harris Acute Complex + 4- 3.93 5 12 20.9
1G10 Haixis Acute Complex. >io >1.0 0.093 >10
!HIO HD184 Complex >!0 >10 037 4.3
1HI6 Harris Acute Complex - >10 >10 >10 >.10
1112 HD184 Complex _ >10 >10 0.36 >10
1L6 HD184 Complex + 2.34 6.7 1.1 6.25 ..' ΐ 3 Vaccine Complex - >10 10 0.24 >10
1M19 1 Complex + 4.6 6,7 0.28 5,9
1N5 1-1 arris Acute Complex + 0.27 .04 0.98 0.85
INS HD184 Complex + 4,5 4.1 7.65 5.95
2MH HD184 Complex. + 1.72 2.62 3.61 4.36
3B4 HD184 Complex + 1.77 2.23 1.26 1. 1
5C8 H 184 Complex + 1.07 1.65 0.95 3.31
5J7 105 Complex >10 >i0 0.09 >1
5K17 HI) 184 Complex + 2.28: 3.1.6 6.21 4.71
SEQUENCES
UNC 3001 (DENV-3) AMINO ACID SEQUENCE
MRCVGIGNRDFVEGLSGATWVD LEHGGCV TMAKNKPTLDIELQ TEATgXjAILRKLC IEGKITNITTDSRCPTQGEAVLPEEQDQNYVCKHTYVDRGWGNGCGLFGKGSLVTGAKFQ CLEPIEG VVQYEKLKY-TVIIT-VHTGDQHQVGNETQG¥TAII- —PQAS-TTEAILPEYGT LGLECSPRTGLDFNE ILLTM^K WMVHRQWFFDLPLPW SGATTETPT NR ELLV F KNAHAK QEVvVLGSQEGAMHTAL GATEICJ SGGTSIHAGKLKCRL MDKLEL GKISYA MCTNTFVLKKEVSETQHGTLLL VEYKGEDAPC IPFSTEDGQG AHNGRLITANPWTK KEE VNIE E FGESNIVIGI DN L INWYKKG
WestPac:74 (DSNV-1) AMINO ACID SEQUENCE
MRCVGIGNRDFVEGLSGATWDWLEHGSCVTTMAKDKPTLBIELLKTEWKPAVLRKLG
lEAKISNTTTDSRCPTQGEATLVEEQDTNFVCRRTFVDRG GNGCGLFG GSLITCA F CWKLEGKIVQYENLKYSVIVTVHTGDQHQVGNETTEHGTTATITPQAPTSEIQLTDYGA
LTLDCSPRTGLDFNEMVLL ll¾ ^LVHKQ FLDLPLPWTSGAS?SQETS RQDLLVTF KTAHAKKQEVWLGSQEGAMH ALTGATEIQ SG TTI FAGHLKCRLKJMD LTLKGMSYV MCTGSFKLEKEVAETQHG VLVQVKYEG DAPCKIPFSSQDEKGVTQNGRLI A PIV D KEKPVNIEAEPPFGES I GAGEKALKLS FK G stPac?4 hinge ( D'S V 1/3) AMINO ACID SEQUENCE
MRCVGIGNRDFVEGLSGATWVDVVLEHGSCVT HAKD PTLDIELI<TEAT^A LRKLC lEA ISKT TDSRCPTQGEATLVEEQDTNFVCRRTFVD GWGNGCGLFGKGSLITCAKFK CVT IEG WQYE LKYSVIVTVHTGDQHQVGNETTEHGTrATITPQAPTSExQLTDYGA LTLDCSPR GLDFNEMXLLTti^ AW HRQWE'LDEPLPWTSGASTSQETWNRQDLLY'IF KTAHAKKQEWVLGSQEGA HTALTGATEI¾SGSTSIFAGHLKCRLKMD LTLKGMSYV MCTGSFKLB EVAETQKGTVLV-QV YEGTDAPCKI FSSQ'DE GVTQNGRLITANPIVTD EKPVNIE EPPFGESYIWGAGS ALKLSWFK G
3001-1F4E ( DENV 3/1} AMINO ACID SEQUENCE
MRCVGIGNRDFVEGLSGATWVDWLEEGGCVT'TftA KKPTLDI EXJKTEVTHPAVlAKLCIEGK
ITNITTDSRCPTQGEAVLPEEQDQNYVCKHTYVDRGWGNGCGLFGKGSLVTCAKFQCLEPIEGK VVQYENLKYSVIVTVHTGDQHQVGNETiESG^IA^ITPQAPTSEIQL DYGALGLECSPRTGLD ETiEMILLTMKNKA MVHRQWFFD^PLPWTSGATTETPTWNR EtLVTFKNAHA KQEV LGSQ
EGAMHTALTGATEIQTSG TTIFAGHLKCREKMDKLELKGMSYAMCTNTFVLKKEVSETQHG I LI KVEYKGEDAPGKIPFSTEDGQG Ai-INGRLITANP VTKKEEPVNrEAEPPFGESNIVIGIGD NAL INWYKKG
icDenguelll WC 3001
agttgttagt ctacgtggac -cgacaagaae agtttcgact cggaagcttg- ctta.acgtag 60 tgctaacag tttttattag agagcagate tctgatgaac aaecaacgga agaagacggg- 120 aaaaccgtct atcaatatgc tgaaacgcgt gagaaaecgc gt.gtcaactg gaccacagtt 180 ggcgaagaga ttctcaaaag gactgctgaa eggccaggga ecaatgaaat tggttatggc 240 gttcatagct ttcctcagat ctc agccat tccacqaaca gcaggagtct tggctagatg 300 gggaaccttc aagaagtcgg gageeattaa ggtcctgaaa ggcttcaaga aggagatctc 360 aaacatgctg agcataatca acaaacggaa aaagacatcg ct.ctgter.ca tgatgatatt 420 gcGagcagca cttgct tcc acttgact c aogagatgga gagccgcgca tgattgtggg 480 gaagaatgaa agaggaaaa ccGtactttt aagacagcc tctggaa ta acatgtgoac 540 actcataqcc atggac tgg gagagatgtg tgatgacacg gtcacttaca aatgccccca 600 cattaccgaa gfcggaacctg aagacattga ctgc.tggt.gc aaccttattat. caacatgggt 660 gacttatgga aegtgcaatc aagctggaga geatagacgc gacaaaagat cagtggcgtt 720 agctcctcat gtcggcatgg gactggacac acgcacccaa acctggar.gt cgjctgaagg 780 agcttggaga caagtcgaga aggtagagac atgggccctc aggcacceag ggttcaccat 840 actagcccta t'ttc tgece attacatagg caettec tq acoeagaagg tggttatttt 900 tatactacta atgctggtca cc datccac gacaa gaga tgtgtgggaa taggaaacag S60 agattt gcg gaaggtctai: caggagctac gtgggctgac gtggtgc cg agcacggggg. 1020 gtgtgtgact accatggcta agaacaagcc; cacgctgga atagagcttc agaagaccga 1080 ggceacccaa ctggcgaccc taaggaaget atgeattgag gggaaaatta ccaacataac 1140 aactgactca agatgtcct cccaagggga agcggtt tg cctgaggage aggaccagaa 1200 etacgtgtqt aagcatacat acgtagacag aggc'oggggg aacggttgtg gcttgtttgg 1260 caagggaagc ttggtaacgt g gcgaaa t.caatgcctg gaaccaatag agggaaaagt 1320 ggtgcaatat gagaacctca aatacaccgt oa oa t:ta.ca gtgcacacag gagaccaaea 1380 ccaggtagga aatgaaacge agggagccac ggc gagata acacctcagg catcaaccac 1440 tgaagccafcc ttgcctgaat atggaacect gggc agaa tgctcaccac ggacaggttt 1500 ggatttcaat gaaatgatet tac aacaat gaagaacaaa gcatggatgg taeatsgaca 1560 atggtttttt gacctacctc taceatggac accaggaqct aeaacagaaa cgccaacctg 1620 gaacaggaag gagcttcttg tgscattcaa aaaegeaca gcgaaaaaao aagaagtagt 1680 cgtccttgga tcgcaagagg gag aatgca tacegcactg acaggagcca cagaaatcca 1740 aaactcagga ggcacaagca tttttgcggg gcac taaaa tgtagaetta agatgg'acaa 1800 attggaactc aaggggatga gctatgcaat g gcacgaat accr. tgtgt tgaagaaaga 1860 agtctcagaa acgcagcatg ggacaatact cattaagg c gagtacaagg gggaagatgc 1920 qccttgcaag attccittct ccacagagga tggacaaggg aaagctcaca atggcagact 1980 gatcacagcc aacccagtg'g cgactaagaa ggaggagcc gtcaatattg aggctgaacc 2040; tccttttggg gaaagtaata tagtaattgg aattggagac a cgccttga aaateaactg 2100 gtacaagaag ggaagctcta ctgggaagat gttcgaggcc actgceagag gtgcaaggcg 2160 catggecatc ttgggagaca eagcttggga c ttqgatca gtgggtggtg t.tctgaacrc 2220 attaggcaaa atggtgcacc aaa attcgg aagtgcttae acagccctat cagtggagt 2280 ctcttgggtg atgaaaa tg gaataggtgt tctcttgact tggatagggt tgaattcaaa 2340 aaacacatcc atgtcatttt catgcattgc gataggaa c attacaetec atctgggagc 2400 tgtggtacaa gctgacatgg ggtgtgtca aaactggaaa ggcaaagaac teaaatgtgg 2460 aagtggaatt ttcgtcacca acgaggtcca tacctggaca gagcaataca aattccaagc. 2520 agactcccca aaaa attgg cgacagcca tgcaggcgct tgggaqaatg gagtgtgcgg 25S0 aattaggtca acaaccagaa tggagaatct cctgtggaag caaatageca atgaaetgaa 26-10 ctacatatta tgggaaaaca atatcaaa i: a'acg'gtagtt gtgggcgata caattggggt 27Q0 cttagagcaa ggaaaaagaa cactaacacc acaacccatg gagctaaaat ac catggaa 2780 aacatgggga aaggcaaaaa tagtgacagc tgaaacacaa aattcct ct tcacaataga 2820 cgggccaaac acaccggagfc gtccaagtgc ctcaagagca tggaatgtgt gggaggtgga 2880 agattacgq Ctcggagtct tcacaaecaa catatggctg aaactccgag atgtgtacac 2940 ccaactatgt gaccataggc aatgtcggc agccg caag gatgagaggg ccgtacacgc 3000 cgacacgggc tat.tggatag aaagecaaaa gaatggaagr tggaagctag aaaaagcatc 3060 pctcatagag gtgaaaacct gcacatggcc aaaa cacac actctttgga gcaatggtgt 3120 gctagagagt gacatgatca tcccaaagag cct.cgctggc cctatttcgc aacacaacta 3180 caggcctggg taecacaccc aaacagcagg accctggcac ttaggaaaat tggagctgga 3240 cttcaactat tgtgaaggaa caacagttgt catcacagaa aactgtggga caagaggcec 3300 atcattgaoa acaacaacag tgtcagggaa gttgatacac gaa ggugut gccgctcgtg 3360 cacactfccct cccctgcgat acatgggaga agaaggctgc tggtatggca tggaaatcag 3420 acccatcagt gagaaagaag agaacatgg aaagtcttta gtctcagcgg gaagt.ggaaa 3480 qqtggacaac ttcacaatgg gtgtcttgtg tttgg aatc ctctttgaag aggtciatgag 3S40
aggaaaattt gggaagaaac acatgattgc; aggggttctc ttcacgtttg tgctecttct 3600 ctcagggeaa ataacatgga gagacatggc g acacacta ataatgattg ggtccaacgc 3660 ctcfcgacagg a gggaatgg gcgtcacc a cctagcttta a tgcaacat ttaaaatcca 3720 gccattettg gcfcttgggat t t.tcctaag aaaaetgaca tctagagaaa atttatt.gtt 3780 aggagttggg ctggctatgg caacaacgtt acaactgcoa gaggacattg aacaaatggc 3840 aaatggaatc gcr.ctgggg tcatggctct taaactga a acacaatufcg aaacatacca 3900 a tatggacg gcattag ct ccttaacgtg ttcaaataca atucttacgt. tgactgttgc 3S6C ctggagaaca gocaccctga ttttggccgg agt t tcgott ttaccagtgfc gccagtcttc 4020 gagcatgsgg aaaacagacfc ggcttccaat gacagtggea getatgggag ttccacccct 4080 aeeacttttt ac t taget tgaaagacac actcaaaagg agaagctggc cactgaatga 4140 aggggtgatg gctgt gggc ttgtgagcat tctggc agt tccc cctta gaaatgatgt 4200 geccatggct ggaccattag tggccgg'ggg cttgctqata gcgtgetacg tcat actgg 4260 cacgtcagca gaeetcactg tggaaaaagc agcagatgta acatgggagg aagaggctga 4320 gcaaacag a gtgteccaca acttaatgat eacagttgat gatgatggaa caatgagaat: 4380 aaaagatgat gagaccgaga acatcctaac agtgetttta aaaacagcat tactaa.tagt 4440 a caggeatc trt ccatact cca acccgc aacattgttg gtctggca':a e tggcagaa 4500 gcaaacccaa aggtccggcg ttctgfcggga cgtacccagc eccccagaga cacagaaagc 4560 agaacrggaa gaaggggtt a -aggatcaa acagcaagga at cttggga aaacccaagt 4620 aggggttgga gtaeagaaag aaggagtctt ccacaccatg tggcacgtea caagaggqgc 4680 ag g tgaca cataatggga aaagactgga aecaaactgg gctagcgtga a aaagatc't 4740 gatt catac ggaggaggat. ggagattgag cgegoaatgg caaaaggggg aggaggtgca 4800 ggttattqee g ggagcetq ggaagaaccc aaagaacttt caaacca gc caggcacttt 4860 tcagactaca aeaggggaaa taggagcaat tgcactggat tccaagcctg gaacttcagg S20 atctcctatc ataaacagag aqqgaaaggt agtggqactg tatggcaatg gagtggttac 4980 aaagaatggt ggctacg ca gcggaatagc gcaaacaaat gcagaaccag arggaccgac 5040 accagagttg gaagaagaga. tgttcaaaaa gcgaaatcta aceataacgg atcttcatce 5100 gggtcagga aagacacgga aatacctt.Cc. agctattgtt agagaggcaa tcaagagacg 5160 tttaagaact ctaattttgg caccgacaag ggcgg-ttgca g.etgaga fcgg aagaagcatt 5220 gaaagggctc ccaaCaaggt aeeaaacaac agcaacaaaa tctgaacaca caggaagaga 5280 gat.tgttgat ctaatgtgcc acgcaacgtc cacaatgcgc ttgctgtcac cagttagggt 5340 tccaaat at aacttgataa taatggatg ggcccatttc acagacccag ccagca agc 5400 ggctagaggg taca-tatcaa ctcgtgttgg aatgggagag gcagccgcaa tttcatgac 5460 agcaacgccc cc ggaacag ctgatgccti fccctcagagc aacgctccaa. ttcaagatga 5520 agaaagggae ataccagaac gctcatggaa t caggcaat gaatggatta ccgacttcgc 5580 tgggaaaacg gtgtggtttg tccccagcat taaagccgga aatgacatag -caaactgctt 5640 gcggaaaaac ggaaaaaaqq tcattcaacc r.agtaggaag actttr.gaca cagaat ca 5700 gaagactaaa ctgaatgatt gggscttcgt ggtgacaact gacatttcag aaatgggggc 5760 caatttcaaa gcagatagaq tgatcgaccc aagaagatg. ctcaaaccag tgatcctga'c 5820 agatjcjacca gagcgggt.ga tcctggctgg accaatgcca gtcaccgcgg cgagtgctgc 588.0 gcaaaggaga ggaagagttg gqaggaaccc aca'aaaagaa aatgaccagt acatattcac 5940 gggccagcct ctcaacaatg a gaagacca tgctcactgg acagaagcaa aaatgctgct 6000 ggaaaacatt aaeacaccaq aagggattat accagctctc tttgaaceag aaagggagaa 6060 gtcagccgcc atagacggtg agt.atcgcct gaaggg gag tccaggaaga. ctttcgtgga 6120 actcatgagg aggggtgacc ttcoagt r g gttagcccat aaagtagcat caga gggat 618 Q caaatataca gatagaaaat ggtgctttga tggacaacgc aataa caaa ttttagagga 6240 gaacatggat gtggaaatct ggacaaagga aggagaaaag aaaaaattga gacctagg g 6300 gcttgatgcc cgcacttatt cagatccctt agcacrca-ag gaatttaagg actttgcggc 6360 tggcagaaag tcaatcgccc tt.gatct.tgt gacagaaata ggaagagtgc cttcacacct 6420 agcccacaga acgagaaacg ctctggacaa t.ctggtga g ctgcatacgt cagaacatgg 6480 cggtagggcc ta.caggcatg cggtggagga actaccagaa acaatggaaa cacttttact 6540 cttgggactc atgatcttgt tgacaggtgg agcaatgctt; ttcttgatat caggaaaagg 6600 gatcggaaag ac tcaatag gactca ttg t.gtaattg c tccagcggca tgtt.gtggat 6660 ggccgaaatc ccactccagt ggatcgcgt.c ggctatag c c ggagtttt ttatgatggt 6720 gttgcttata ccagaaccag aaaagcagag aaccccccaa gacaaccaac tcgcatatgt 6780 cgtgataggc atacttacau tggctgcaat aatagcagcc aatgaaatgg gactgttgga 6840 aact.aca.aag agaqa ttag gaatgtctaa ggagccaggt gttgt tctc caac.cagcta 6SO0 tttggatgtg gacttgcacc cagcatcagc ctggacattg tacgccgtgg ccactacagt 6960 aataacacca atgttaagac ataccacaga gaattctada gcaaatqtgt ccctgg6ago 7020 tatagccaac caggcactgg tcctgatggg tttggacaaa ggatggccaa tatcaaaaat 7080 ggacttaggc gtaccactac t.ggca tcjgg ttgqt ttca eaagtgaacc cactgactct 7140 aacagcggca gtacttttgc taatcacaca ttatgctatt ataggtccag gattgcaggc 7200
aaaagccact cgtgaagc c agaaaaggac agctgctgga ataatgaaga atccaacggt 7260 ggatgggata atgacaatag acctagatcc tgtaatatat gattcaaaat ttgaaaagca 7320 actgggacag gttatg.ctcc tggttttgtg rgcagttcaa cttttgttaa tgagaacatc 7380 atgggccttg tgtgaagctt taactc.tagc tacaggacca. ataacaacac tctgggaagg 7440 atcacctgga aagtttcgga acaccacgat agctgtttoc atggcgaaca tttt agagg 7500 gagctattta gcaggagctg ggcttgcttt ttecatfcatg aaatcagttg gaacaggaaa 7560 aagaggaaea ggttcaaaag gcgaaacttt aggagaaaaa tggaaaaaga aattaaatca 7€20 attatcccgg aaagagtttg acctttacaa gaaatctgga atcactgaag tggatagaac 7680 agaagccaaa gaagggttga aaagaggaga aataacacat catgccgt.gt ccagaggtag 7740 cgcaaaactt caatggtttg tggagagaaa canggtcatt cccgaaggaa gagtcataga 7800 cttgggetgt ggaagaggag gctggtcata ctactgtgca ggactgaaaa aagtcacaga 7860 agtgcgagga tacacaaaag gcggtccagg acac.gaagaa ccagtaccta tgtctacata 7S20 tggatggaae atagttaagt taatgagtgg aaaggatgtg t tta-tcttc cacctgaaaa 7980 gtgtgatacc etgttgtgtg acatcggaga atcttcacca agcccaacag tggaagaaag 8040 cagaactata agagttttga agatggttga accatggcta aaaaacaacc agttttgcat 8.100 taaagtattg aacccttaca tgccaactgt gattgagcac ctagaaagac tacaaaggaa 8160 acatggagga atgcttgtga gaaatccaet ttcacgaaac tcoacgcacg aaatgtactg 8220 gatatctaat ggcacaggta acattgtctc ttcagtcaac atgg atcta ga tgctact 8280 gaacaggttc acgatgacac acaggagscc taccatagag aaagatgtgg atttaggagc 8340 aggaactcga .catgttaatg cggaaccaga aacacccaac atggatgtca ttggggaaag 8400 aataaaaagg atcaaggagg agcacaat c aacatggcac tatgatgacg aaaaccccta 8460 caaaacgtgg gottaccacg gatcctatga agtcaaagcc aoaggctcag cctectccat 8520 gataaatgga gtcgrgaaac tcctcactaa accatgggat gtggrgecca tggtgacaca 8580 gatggcaatg acagatacaa c ccatt-tgg ocagcagaga gtctttaaag agaaagtgga 8640 caecaggaca eccaggccca tgccagggac aagaaaggtt atggqgatca cagcggagtg 8700 gctctggaga accctgggaa ggaacaaaag acccaggtta tgcacaaggg aagagtttac 8760 aaaaaaggtc agaactaacg cagccatggg cgccgtt'ttc aaagaggaga accaatggga 8820 eagtgcgaaa gctgctgttg aggatgaag attttggaaa cttgtggaca gagaacgtga 8880 actceacaaa ttgggcaagt gtggaagctg tgtttacaac atgatgggca agagagagaa 8940 gaaac tgga gagtttggca aagcaaaagg cagtagagct atatggtaca tgtggttggg 9000 agccaggtac cttgagttcg aagcccttgg attcctaaat gaagaccact ggttctcgcg 9060 tgaeaactct tacagtggag tagaaggaga aggactgcac aagctaggct acatattaag 9120 ggacatttcc aagatacccg gaggagctat gtatgctgat gacacagetg gttgggacae 9180 aagaataaca gaagatgacc tgcacaatga ggaaaagatc acacagcaaa tggaccctga 8240 acacaggcag ttagcgaac ctatatttaa gcteacatac caaaacaaag tggtcaaagt 9300 caacgaccg actccaacgg gcacggtaat ggacatcata tctaggaaag aecaaagagg 3360 cagtggacag gtgggaactt atggtctgaa tacattcacc aacatggaag tccagttagt 9420 cagacaaatg gaaggagaag gtgtgctgtc .aaaggcagac ctcgagaacc ctcatctgcc 9480 agsgaagaaa attacacaat ggttggaaac caaaggagtg gagagg taa aaagaatggc 9540 cattageggg gatgattgtg t'agtgaaacc aatcgatgac aggttcgcta atgccctgct 9600 tgetctgaac gatatgggaa aggttcggaa agacataoct caatggeagc catcaaaggg 9660 atggcatgat tggcaacagg ttcctttctg ct-cccaccac tttcatgaat tgatcatgaa 9720 agatggaaga aagttagtgg ttccctgtag acccoaggac gaaetaatag gaagagcaag 9780 aatctctcaa ggagcgggat ggagccttag agagaccgca tgtctgggga aagcctacgc 9840 tcaaatgtgg agtctcatgt actttcacag aagaga.tc.tc agactagcat ccaacgpcat 9900 atgttcagca gtaccagtcc. actgggtccc cacaagtaga acgacatggt ctattcatgc 9960 tcaccatcag tggatgacta cagaagacat gcttactgtc tggaacaggg tgtggatcga 10020 ggacaatcca tggatggaag acaaaactcc agttacaacc tgggaaaatg ttccatatct 10080 agggaagaga gaagaccaat gqtgcggatc acttattggt cteacetcca gagcaacctg 10140 ggcccagaac atacccacag caattcaaca ggtgagaagt cttataggga atgaagagt't 10200 t'cfcg.gattac atgccttcaa gaagagatt caggaaggag gaggagtcgg aaggagccat 10260 t ggtaaacg taggaagtga aaaagaggca aactgtcagg ccaccttaag ccacagtacg 10320 gaagaagctg tgctgcctgt gagceccgtc caaggacgtt aaaagaagaa gtcaggcccc 10380 aaaaccacgg tttgagcaaa ccgtgctgcc tgtagctcccj tcgtggggac gtaaaacctg 10440 ggaggctgca aactgtggaa gctgtacgca cggtgtagca gactagcggt tagaggaga 10500 ccctcccatg acacaacgca gcagcggggc ccgagcactg agggaagctg tacctccttg 10560 caaaggacta gaggttagag gagac'ccccc gcaaaca'aaa acagcatatt gacgctggga 10620 gagaccagag atcctgctgt ctcctcagca tcattccagg cacagaacgc cagaaaatgg 10680 aatggtgctg ttgaatcaae aggttettaa aagagacg 10718
icDeagyel WestPac' 74
agttgttagt ctacgcggac cgacaagaae agtttcgaat eggaagcttg cttaacgtag 60 ttctaacagt tr.tttattag agageagatc tctgatgaac aaccaaegga aaaacjacggg 120 t.egaocgtct ttcaatatgc tgaaacgcge gagaaaccge gfcgtcaactg t.tteacagtt 180 ggcgaagaga ttctcaaaag gattgcttte aggacaaggs cccatgaaa fc tggtgatggc 240 fct.ttar.agca ttce aagat ttctagccat acct caaca gcaggaat.t tggct gatg 300 gggctcattc aagaagaatg gagcgatcaa agtgttacgg ggt.tteaaga. aagaaatctc 360 aa catgttg aacaf.aatga acaggaggaa aagatctgtg accatgctce tcatgctgc 42.Q gcccacagcc ctggcgttcc atcfcgaccae ccgaggggga gageegca.ca tgatagttag 480 eaagcaggaa agaggaaaat cacttttgtt caagacetet gcaggtgtca acatgtgcac 540 ccttattgca atggatttgg gaqaqttatg tgaggacaca atgacetaca. aatgcccccg 600 gatcaetgag acggaaccag atgaogttga ctgttggtge aatgccacgg agacatgggt 660 gaectatgga acatgttctc aaactggtga acaccgacga g.aeaaacgtt. ccgtcgcact 720 ggcaccacac gtagggcttg gtctagaaac sagaaccgaa acgtggatgt cctctgaagg 780 cg tfcggaaa caaataeaaa aaqtggagac. ctgggctctg agacacccag gattcacggt 840 ga agccctt tttctageac atgeeatagg aacatccatc acccagaaag ggateattt.t SCO tattttgccg atgctggcaa ctccatccat ggcca gcgg tgcgtgggaa taggcaacag 960 aqact.tcgtg gaaggactgt caggagctac gtgggtggat gtggta tgg agcatggaag 1020 ttgcgtcact: aecatggcaa aagacaaacc aacactggac atfcgaacsct tgaagacgga 1080 ggtcacaaac eetgccgtcc tgcgcaaact g gcattgaa gctaaaatat caaacaccac 1140 caccgat!icg agatgtccaa cacaaggaga agcoaoqctg gtggaagaac aggacacgaa 1200 c tgtgtgt cgacgaacgt tcgtggacag aggc ggggc aatggttgtg ggctattcgg .1260 aaaaggtagc ttaataacgt gtgctaagtt taagtgtgtg acaaaactgg aaggaaagat 1320 agtcca t t. gaaaactt.aa aat ttcag gatagtcacc gt cacactg gagaccagca 1380 ecaag gga aatgagacca cagaacatgg aaoaattgca aecataaeae ctcaagctcc 1440 cacgtcggaa atacagctga cagactacgg agct.ctaaca ttggattgtt cacctagaac 1S00 agggcr.agac ttta.atgaga tggt.gt.t.gtt gacaatgaaa aaaaaar.ca ggct.cgtc.ca 1560 caaacaatgg tttotagaet taccactgcc ttggacctcg ggggcttcaa- eateocaaga 1620 gacttggaat agacaagact tgctggtcac attfcaagaea gctcatgc a aaaagcagga 1680 agtagtogta ctaggatcac aagaaggagc aatgcaeaet qcgttgactg gagcSgacaga 1740 aatocaaacg tetggaacga eaacaatttt tgcagcjacac ctgaaatgca gactaaaaat 1.800 ggataaactg ac ttaaaag ggacgccata tgtaatgtgc acagggtcat tcaagttaga 1860 gaaggaagtg gctgagacec agcatggaac tgr.tetagtg eaggttaaat acgaaggaac 1920 agatgcacca tgcaagatcc cctfcctcgtc ccaagatgag aagggagtaa cecagaatgg .1980 g.aga tgata aeagecaacc ccatagtcac tgacaaagaa .aaaccagt.ca acattgaagc 2040 ggagccacct tttggtgaga gctacatCgt ggtaggagca ggtgaaaaag ctt cgaaact 2100 aagctggtte aagaagggaa gcagtatagg gaaaatgttt gaagcaacfcg cccgtggagc 2160 acgaaggacg gccatcctgg gagacacfcgc atgggactce ggttctatag gaggggtgtt. 2220 cacgtctgtg ggaaaact.ga tacaeeagat ttttqggact gcgtatggag ttttgttcag 22B0 cggtgtttct tggaeeatga agataggaat agggattctg ctgacatggo taggattaaa 2340 ctcaaggagc acgtcccttt caatgacgtg catcqcagtt ggcatggtea cgctgtacct 2400 aggagtcatg g tcaggcgg acr.cgggatg tgtaatcaac tggaaaggca gagaactcaa 2460 atgtggaagc. ggca fc tttg tcac'caatga agtccacaee tggacagagc aatataaatt 2520 ccaggccgac tcccctaaga gactatcagc ggccattggg aaggcatggg aggagggtgt 2580 gtgtggaatt cqatcagcca ctcgtetega gaacatcatg tggaageaaa tat.caaat.ga 2640 attaaaccac atcttacttg aaaatgacat gaaatttaca gtggtegtag gagacgttag 2700 tggaatcttg gcccaaggaa agaaaatgat taqgccacaa cccacggaac. acaaat.ac.tc 2760 gtggaaaagc tggggaaaag ccaaaatqat aggagcagat gtacagaata ccaccttcat 2820 catcgacggc ccaaacaccc cagaatgccc tgataac.caa agagcatgga ac.atttggga 288.0 agttgaagac tatggafcttg gaattttcar. gacaaacata tggttgaaat gcc^tgactc 2940 c.acactcaa gtgtgtgacc accggctaar gtcagctgcc accaaggata gcaaagcagt 3000 ccatgctgac atggggtatt ggat.agaaag tgaaaagaac gagacttgga agttggcaag 3060 agcctccttc cagaagtta agacatgcat c q ccaaaa tcccacactc tatggagcaa 3120 tggagtcctg gaaagtgaga tgataatccc aaagatatat ggaggaccaa tatctcagca 3180 caactacaga ccaggatatt tcaoacaaac agcagggccg tggcacutgg- gcaagttaga 3240 actagatttt gatttatgtg aaggt ccac tgt.tgtr.gtg gatgaacatt gtggaaatcg 3300 aggaccatc cttagaacca caacagtcac aggaaagaca atccaugaat ggtgetgtag 3360 atcttgcacg ttaccccccc tacgtttcaa aggagaagac gggtgctggt acggcatgga 3420 aatcagacca gtcaaggaga aggaagagaa cctagttaag tcaa ggtct: ctgeagggte 3480 aggagaagtg gacagttttt cactaggact. gctatgcata tcaataatga tcgaagaggt 3540
aa gaga cc agatggagca gaaaaatgct. gatgactgga acattggctg tgttcetcet 3600 tcttacaatg ggacaattga catggaatga tcga cagg ctatgtatca tggttggagc 3560 caacgcttca gacaagatgg ggatgggaac aacgtaccta gctttgatgg eeaetttcag: 3720 aatgagacca atgttegcag tegggctaet gtttcgcaga ttaacatcta gagaagttct 3780 tcttcttaca gttggattga gtctggtggc atc gt gaa otaccaaatt ecttagagga 3840 getaggggat ggaettgcaa tgggcat.cat gatgttgaaa ttactgact.g attttcagtc 3900 acatcageta tgggctacct tgctgtcttt aacatttgtc aaaacaactt titcattgea 3960 c acgca gg aagacaatgg etatgataet g caattgta tctet.cttcc ctttatgcct 4020 gtc'Cacgact tctcaaaaaa caacatggct c.cggtgt g ctgggatcte. ttggatgcaa 4080 accactaaco atgtttcccs taacagaaaa caaaatctgg ggaaggaaaa gctggoctct 4140 eaatgaagga atr.atggetg ttggaatagt tagcattc t et agttca.e t etcaagaa 4200 fcgatgtgcca ctagctggcc caetaatagc tggaggca g ctaatageat gttatgtcat 4260 atctggaagc toggccgatt tatcactgga gaaagcggci; gaggtctcet gggaagaaga 4320 agcaqaacac tctggtgcqt cacaeaaeat actaqtggag gtccaagatg at.ggaaceat 4380 gaagataaag gatqaagaga gagatgacac ac oaocat ctccteaaag caactctgct 4440 agcaatctea ggggtacacc caatgteaat accggcgacc etctttqtgt ggtatttttg 4500 g agaaaaag aaacagagat cag agtgct atgggacaca eccagcccuc oagaagtgga 4560 aagagcagtc cttgatgatg gcatttatag aattctccaa agaggattgt- tgggcaggtc 4620 teaagtagga gtaggagttt tfceaagaagg agtgttccac acaatgtgge acgtcaccag 680 gggagctg c ctcatgfcacc aagggaagag actggaacca agt gggeca gtgtcaaaaa 4740 agacccgatc tcatatggag gaggttggag gtttcaagga tcctggaacg cgggagaaga 4600 agtgcaggtg attgc gttg aaccggggaa gaaccccaaa aatgtacaga cagcgccggg 4860 taccttcaag acccctgaag gcgaagttgg agccatagct etagacttta aaccoggcac 4920 atctggatct cctatcg ga acagagaggq aaaaatagfca ggtetttatg- gaaatggagt 4980 ggtgacaaoa agtggtacct acgtcagtgc catageteaa gctaaagcac cacsagaagg 5040 gcctctacca gagai gagg acgaggcgtt: taggaaaaga aact aacaa taatggacct 510Q acatccagga tegggaaaaa csagaagata ectteeagcc atagtccgtig aggccataaa 5160 aagaaagctg cgcacgctag tcttagc cc cacaagag t gtcgct. ctg aaatggcaga 5220 ggegctcaag ggaatgceaa taaggtataa gacaacagca gtgaagagfcg aacacacggg 5280 aaaggagats gtbgacctta tgtgtcacgc cactttcact. at.gcgt.ctec tgtctcctgt S3 C gagagttccc aattataata tgattatcat. ggai:gaagca catttcaccg atccagccag 5400 catagcag.cc agagggtata tctcaacccg agtgggtatg ggtgaagcag c.tgcgatttt 54'6C cat acagcc acteceeccg atcggtgga ggcctf.tcoa cagagcaa g cagttatcca 5-520 agatgaggaa agagacattc etgaaagatc atggaa tca ggctatgact ggatcactga 5580 tttcccaggt aaaaaagtet ggtttgttcc aagcatcaaa t.caggaaatg acattgccaa 5640 atgttta .ga aagaatggga aacgggtggt ccaattgagc agaaaaact ttgacactga 5700 qtaccagaaa acaaaaaata acgactggga ct cgttgtc acaacagaca tatocgaaat 5760 gggagcaaac ttccgag'ccg acagggtaat agaceegagg cggtgcctga aacoggtaat 5820 actaaaagat: ggcccagagc gtgtcattct agceggaccg atgccagtga ctgtggctag 5880 cgccgcccag aggagaggaa gaattggaag gaaccaaaat aaggaaggcg atcagtatat 5S40 ttacatggga cagcctetaa acaatgatga ggaccacqcc cattggacag aagcaaaaat 6000 gotoofctgas aacataaaca caccagaagg gattatccca gccctctttg agccggagag S060 agaaaagagt gcagcaatag acggggaata cagac acgg ggtgaagcqa ggaaaacgtt 6120 cg ggagc c atgagaagag gaga ttacc- tgtctggcta i:c;ctacaaag ttg.cctcaga 6180 aggcttccag tactccgaca gaaggtggtg ccttgatqgg gaaaggaaca accaggt.gtt 6240 ggaggagaac atggacgtgg agar.c ggac aaaagaagga gaaagaaaga aactacgacc 6300 ocgctggctg gatgccagaa catactctga cccaotggc ctgcgcgaat t.caaagagtfe 6360 cgcag agga agaagaagcg tcccaggtga cctaatatta gaaataggga aacttccaca 6420 acatttaacg caaagggccc agaacgcctt ggacaatctg gttatgttgc acaactctga 6480 acaaggagga aaagcctata. gacacgccat ggaagaacta ccagacacca tagagacgtt 6540 aatgctccta gctt gatag ctgtgctgac tggtggagtg aegctgttct tcctatcagg 6600 aaggggtcta ggaaaaacat: qcattggcct act.ct.gcgtg attgcctcaa gtgcactgtt 6660 atggatggce agtgtggaac ccaattggat agcggcctct. steataetgg agttctttct 6720 gatggtgttg cttattccag agccggacag acagcgcact ccacaagacs accagctagc €780 atacgtggtg ataqgtctgt tattcatga'c attgacagtg gcagccaatg agatgggatt 6840 actggaaacc acaaagaagg acctggggat tggtcatgca gctgctgaaa accaccatca 6900 tgctgcaatg ctggacgtag acctacaccc agcttcagcc tggactctct. atgcagtggc 6960 cacaacaatt atcaotccca- tgatgagaca cacaattgaa aacacaacgg cgaatatttc 7020 actgacagct a gcaaacc aggeagetat. attgatggga ettgacaagg gatggccaat 70S0 atcaaagatg gacataggag ttccacttct cgccttgggg tgctattctc aggtgaaccc 7140 gctgacgctg acagcggcgg tatttatgct agtggctcat t tgccataa ttggacccgg 7200
ctgcaagca aaagctacta gagaagctca aaaaaggsca geagceggaa taatgaaaaa 7260 cecaactgtc gaegggaccg ttgeaa aga tttggaccct gtggt tacg atgeaaaatt 7320 gaaaaacag ot ggecaaa taat.gttgtt gatactttgc acatcaqaga tcctcctgat 7380 gcqgaccaca tgggcettgt gtgaatccat cacactagec actggacctc tgactacget 7440 ttgggaggga tetccaggaa aatfcctggaa eaccacgata gcggtgteca tggcaaacat 7500 fctfcfcagggga agtfeatccag e ggagc g tctggccttt teat taatga aatc;:ctagg 7560 aggaggtagg agaggcaegg gageccaagg ggaaacactg ggagaaaaat gqaaaagaca 7620 gctaaaccaa t gagcaagt; cagaa tcaa caettaca a aggagtqgga ttatagaggt 7680 ggatagatct gaagccaaag aggggttaaa aagaggagaa acgactaaac acgcagtgtc 7740 gagaggaacg gecaaactg ggtggtr.tgt ggagaggaac cttgtgaaac cagaagggaa 7800 agteatagac ctcggttgtg gaagaggtgg ctggtcatat tat.tgcgetg ggctgaagaa 7860 agtcaea'gaa g gaaag t acacg a gg aggaactgga catgaggaac caa ccc at 7920 ggcaacctat ggatggaacc tagtaaaget a ac ceggg aaagatgtat tctttacacc 7380 ac gagaaa gcgacaccc tcttgcg g tattggtgag tcc ctccga acccaact t 8040 agaagaaqga ag egttae gtgttctaaa gstggtggaa ccatggctca gaggaaacca 8100 attt gcata aaaat ctaa atccctat t gccgagfcgfcg gtaqaaactt tggagoa t. 8160 gcaaaqaaaa catggaggaa tgctagtgcg aaatccactc tcaagaaact ccactcatga 8220 aatgtactgg giittcatgtg gaacaggaaa cattgtgcea gcagtaaaaa tgacatctag 8280 aatgctgcta aatcgattca caatggctca caqgaageca acatatgaaa gagacgtgga 8340 cttaggcgcc gga eaag c tgtggc gt agaaccagag gtggccaaco tagat tc t 8400
Cggc agagg at gagaae aaaaaatga ac caa tca acatggcatt atgatgagga 8460 caatceatac aaa catggg eetateatgg ateatatgag gtcaagecat cagg tcage 8520
■etcatcea g gteaatggtg tggtgagact gctaaccaaa ccatgggatg tca teeeat 8580 ggtcacacaa atagceatga ctgacaccac acccttcgga caacagaggg t tttaaaga 8640 gaaagttgac acgcgtacac caaaagegaa aegaggcaca gcacaaa ta tggaggtgac 8700 agccaggtgg htat'.ggggtt ttctctctag aaacaaaaaa cccagaatct gc ca gaga 8760 ggagttcaca agaaaagcea ggtcaaaogc agctattgga gca ii' cg tcgatgaaaa 8820 tcaatggaac tcagcaaaag aggcagtgga agatgaaegg ttctgggacc " g gcacag 8880 agagagggag etteataaae aaggaaaatg tgccacgtgt gtctacaaca tgatgggaaa 8940 gag.agagaaa aaattaggag agCtcggaaa ggcaaaaqga agtcgcgcaa uatggtacat 9000 gtggttggga gegegct tt tagagtttga agcccttggt ttcatgaatg aagatcactg 906Ό gtccagcaga gagaa tcac tcagtggagt ggaaggaqaa ggactccaca aacttggata 9120 catactcaga gacacatcaa agattccagq gggaaatatg tatgeagatg acacagccgg 9180 a gggacaca agaataacag agga tgatct teagaat:gag gecaaaatea ctgac cat 92 0 ggaacctgaa catgccctat tg'g-ocacgtc aatctttaag ctaaoctaGC aaaacaaggt 93C0 ag aagggtg cagag ccag cg aaatgg aaccg qatg gatgtea at ccagacgtga 9360 ccagagagga agtggacagg t.t.ggaaccta ggcttaaac acct caeca acatggaggc 9420 coaactaat agacaaatgg agectgaggg aatctt'ttca cccagcgaat tggaaacccc 9480 aaatctagcc gaaagagtcc tcgactggtt gaaaaaaeat ggcaccgaga ggctgaaaag 9540 aa tggcaatc agtggagatg actgtgtggt ga ccaatt gatgacagar. tgeaacagc. 9600 cttaacagcfc ttgaatgaca tgggaaaggt aagaaaagac atacegcaat gggaaccttc 9660 aa ggatgg aatgattggc aacaag gee tttetgttca caccatttcc acca ctgat 9720 tatgaagga gggagggaga t gtggtgcc tgecgeaac caagatgaac ttgtaggtag 9780 qqccagagta teaeaaggcg cc g tggag ctttgagagaa actgcatgc t ggcaa tc 98 0 at tgcacaa atgtggcagc l.gatgtactt ccacaggaga gacttgagat. tageggctaa 9S00 tgctatctgt tcageegttc eagttgattg gg cccaacc agccgtacca cctggtcgat 9960 ccatgecc e aatcaatgga tgacaacaga agacatgttg tcagtcttgga atagggtttg 10020 gatagaggaa a cecatgga tggaggacaa gacccatg g. tccagttggg aagacgttcc 10030 atacc gga aa agggaag atcaacqgtg tggatcccta a agg.cttaa cagcacgagc 10140 cacctgggee aeeaacatac aagtggccat aaaccaagtg aga ggctca ttgggaatga 10200 gaa tateta gacttcatga catcaatgaa gagatteaaa a cgagagtg atc cgaagg 10260 agcaotctgg taagccaact cattcacaaa ata ggaaa ataaaaaato aaacaaggca 10320 agaagtcagg ccggattaag ccat gcacg gtaagagc a gctgcx;tgt gagceccgtc 10380 caaggacgta aaacgaagtc aggecgaaag ecaeggttcg agcaagocgt gctgcctgta 10440 gctccatcgt ggggatgt a aaaccc;ggga ggctgeaaac catggaagct gtacc/catgg 10500 ggtagcagac "agtggt ag aggagacccc tcccaagaca caacgcagca gcggggc.cca 10560 acaecagggg aagctgtaec ctggtggtaa ggaetagagg ttagaggaga ccccccgcac 10620 aacaacaaao agcata tqa cgctgggaga qaccagagat catgetgect. ctacagcatc 10680 a tccaggca cagaacgeca ga a tggaa ggtgctg i: gaa tcaacag gt.tctaaacg 10740 aagagc 10746
Claims
What is claimed sj
1. A chimeric dengue virus E glycoprotein comprising a dengue virus E glycoprotein backbone that comprises amino acid substitutions that mtroduce an epitope thai is recognized by an antibody that is reactive with a dengue vims serotype that is different from the dengue virus serotype of the dengue virus E glycoprotein backbone.
2. The chimeric dengue virus E glycoprotein of claim 1 , wherein the dengue virus E glycoprotein backbone is from dengue virus serotype 1.
3. The chimeric .dengue virus E glycoprotein of claim 1 , wherein the dengue virus £ glycoprotein backbone is from dengue virus serotype 3,
4. The chimeric dengue virus E glycoprotein of claim 1 or claim 2, wherei the antibody is reactive with dengue virus serotype 3.
5. The chimeric dengue vims E glycoprotein of claim 1 or 3, wherein the antibody is reactive with dengue virus serotype 1.
6. The chimeric dengue vims E glycoprotein of claim 4, wherein the antibody is monoclonal antibody 5J7,
7. Th chimeric dengue virus E glycoprotein of claim 5. wherein the antibody is monoclonal antibody 1 F4.
8. The chimeric dengue virus E glycoprotein of claim L comprising the amino: acid sequence:
RCVGIGNRDFVEGLSGATKVDVVLEHGSCVTTMAKDKPTLDIELLKTEATQLATLRKLC
lEA ISKT TIvSRCP QQSATLVEEQDTNFVCRRTFVDRGWGNGCGLFGKGSLITCAKFK
CVT lEG WQYENLKYSVIVTVHTGDQHQVGNETTEHGTlA lTPQAPTSEIQLTDYGA LTLDCSPRTGLDFNEMILLT KK AWMVHRQWFLDLPLPWTSGASTSQETWNRQDLLVTF KTAHAKKQEVVVLGSQEGAHHTALTGATEIQNSGGTSIFAGHL CRL MDKLTLKGMSYV MCTGSFKLEKEVAETQHGTVLVQVKYEGTDAPCKIPFSSQBEKGVT-QNGRLITANPIVTD KE.KPWIEAEPPFGESYIVVGAGEKALKLSWFK G
9. The chimeric dengue vims E glycoprotein of claim 1, comprising the amino acid sequence:
MRCVGIGNRDFVBGLSGATWVDWLEHGGCVTTmKNKPTLDIELFKTEVTlsrPAVLRKLClEG
ITNITTDSRCPTQGEAVLPEEQDQNYVC HTyVDRG GNGCGLFG GSLV CA QCLEPIEGK
QYENLKYSyTVTVHTGDQHQVGNETTEHG XA I PQAPTSEIQLTDYGALGLECSPRTGLD FNEMTLLTMKMKAWMVHRQWHTDLPLPWTSGATTETPTWNRKELLVTF NAHAKKQEVVVLGSQ EGAMHTALtGATEIQ SG TTIFAGHLKCRLKMDKLELKGMSYAMCTNTFVLKKEVSETQHGTI LIKVEYKGEDAPCKIPFSTEDGQG AHMGRLITA PVVTK EEPVNIEAEI^PFGESNIVIGIGD NALKIN YKKG
10, A flavivirus particle or virus like particle (VLB) comprising the E glycoprotein of any of claims 1-9.
1 1, An isolated nucleic acid molecule encoding the E glycoprotein of any of claims 1-9,
12, An isolated nucleic acid molecule encoding the flavivirus particle or VLP of claim 10.
13 , A composition comprising the E glycoprotein of any of claims 1 -9 in a pharmaceutically acceptable carrier.
1 , A composition comprising the nucleic acid molecule of claim 11 or 12 in a
pharmaceutically acceptable carrier,
.15. A method of producing an immune response to a dengue vims in subject, comprising administering to the subject an effective amount of the E glycoprotein of any of claims. 1-9, the flavivirus particle of claim 10, the nucleic acid molecule of any of claims 11-12 and/or the composition of any of claims 13-14 and any combination thereof.
16, A method of treating a dengue virus infection in a subject, comprising- admmistering to the subject an effective amount of the E glycoprotein of any of claims 1 -9, the flavivirus particle of claim 10, the nucleic acid molecule of any of claims 11-12 and/or the composition of any of claims 13-14 and any combination thereof.
17. A method of preventing a dengue vims infection- in a subject, comprising administering to the subject an effective amount of the E glycoprotein of any of claims 1-9, the flavivirus particle of claim 10, the nucleic acid molecule of any of claims 11-12 and/or the composition of any of claims 13-14 and any combination thereof.
18. A method of protecting a subject from the effects of dengue virus infsctioti, comprising administering to the subject an effective amount of ihe E glycoprotein of any of claims 1 -9, the flavi virus particle of claim 10, the nucleic acid molecule of any of claims 1 1-12 and/or the composition of any of claims 13-34 and any combination thereof.
Priority Applications (14)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| ES14817079T ES2745431T3 (en) | 2013-06-26 | 2014-06-26 | Dengue virus vaccine compositions and their use |
| CA2918644A CA2918644A1 (en) | 2013-06-26 | 2014-06-26 | Methods and compositions for dengue virus vaccines |
| EP19176621.1A EP3590955A1 (en) | 2013-06-26 | 2014-06-26 | Methods and compositions for dengue virus vaccines |
| CN201480047442.XA CN105473603B (en) | 2013-06-26 | 2014-06-26 | Method and composition for dengue virus vaccine |
| SG11201510617WA SG11201510617WA (en) | 2013-06-26 | 2014-06-26 | Methods and compositions for dengue virus vaccines |
| AU2014302282A AU2014302282B2 (en) | 2013-06-26 | 2014-06-26 | Methods and compositions for dengue virus vaccines |
| US14/392,127 US10053493B2 (en) | 2013-06-26 | 2014-06-26 | Methods and compositions for dengue virus vaccines |
| KR1020167001891A KR20160027019A (en) | 2013-06-26 | 2014-06-26 | Methods and compositions for dengue virus vaccines |
| MX2016000235A MX365957B (en) | 2013-06-26 | 2014-06-26 | Methods and compositions for dengue virus vaccines. |
| EP14817079.8A EP3013852B1 (en) | 2013-06-26 | 2014-06-26 | Compositions for dengue virus vaccines and their use |
| BR112015032388A BR112015032388A8 (en) | 2013-06-26 | 2014-06-26 | glycoprotein and chimeric dengue virus, their uses, flavivirus particle, isolated nucleic acid molecule, and compositions |
| JP2016524209A JP6525984B2 (en) | 2013-06-26 | 2014-06-26 | Methods and compositions for dengue virus vaccine |
| US16/105,346 US10870682B2 (en) | 2013-06-26 | 2018-08-20 | Methods and compositions for dengue virus vaccines |
| AU2018278927A AU2018278927A1 (en) | 2013-06-26 | 2018-12-12 | Methods and compositions for dengue virus vaccines |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201361839687P | 2013-06-26 | 2013-06-26 | |
| US61/839,687 | 2013-06-26 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US14/392,127 A-371-Of-International US10053493B2 (en) | 2013-06-26 | 2014-06-26 | Methods and compositions for dengue virus vaccines |
| US16/105,346 Continuation US10870682B2 (en) | 2013-06-26 | 2018-08-20 | Methods and compositions for dengue virus vaccines |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2014210358A1 true WO2014210358A1 (en) | 2014-12-31 |
Family
ID=52142690
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2014/044410 WO2014210358A1 (en) | 2013-06-26 | 2014-06-26 | Methods and compositions for dengue virus vaccines |
Country Status (12)
| Country | Link |
|---|---|
| US (2) | US10053493B2 (en) |
| EP (2) | EP3590955A1 (en) |
| JP (2) | JP6525984B2 (en) |
| KR (1) | KR20160027019A (en) |
| CN (2) | CN105473603B (en) |
| AU (2) | AU2014302282B2 (en) |
| BR (1) | BR112015032388A8 (en) |
| CA (1) | CA2918644A1 (en) |
| ES (1) | ES2745431T3 (en) |
| MX (2) | MX365957B (en) |
| SG (1) | SG11201510617WA (en) |
| WO (1) | WO2014210358A1 (en) |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP3212672A4 (en) * | 2014-11-02 | 2018-04-25 | The University of North Carolina at Chapel Hill | Methods and compositions for recombinant dengue viruses for vaccine and diagnostic development |
| EP3535398A4 (en) * | 2016-10-27 | 2020-09-09 | Day-Yu Chao | Dengue virus-like particle, antibody against dengue virus, and composition comprising the same |
| WO2023056335A1 (en) * | 2021-09-30 | 2023-04-06 | The University Of North Carolina At Chapel Hill | Methods and compositions for recombinant dengue viruses for vaccine and diagnostic development |
Families Citing this family (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2018217906A1 (en) * | 2017-05-23 | 2018-11-29 | The University Of North Carolina At Chapel Hill | Methods and compositions for dengue virus serotype 4 epitopes |
| WO2018231974A1 (en) * | 2017-06-14 | 2018-12-20 | Thomas Jefferson University | Composition and administration of chimeric glycoprotein lyssavirus vaccines for coverage against rabies |
| CN116716322B (en) * | 2023-05-12 | 2024-05-31 | 中山大学 | DENV-3 full-length infectious clone and construction method and application thereof |
Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2001003729A2 (en) * | 1999-07-13 | 2001-01-18 | Hawaii Biotechnology Group, Inc. | Recombinant envelope vaccine against flavivirus infection |
| US20110059131A1 (en) * | 2004-07-27 | 2011-03-10 | The Gov. Of The Usa As Represented By The Secretary Of The Dept. Of Health & Human Services | Localization and characterization of flavivirus envelope glycoprotein cross-reactive epitopes and methods for their use |
| WO2011119716A2 (en) * | 2010-03-24 | 2011-09-29 | Research Development Foundation | Flavivirus host range mutations and uses thereof |
| EA015907B1 (en) * | 2004-10-20 | 2011-12-30 | Санофи Пастер Байолоджикс Ко. | Recombinant flavivirus and use thereof |
Family Cites Families (13)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4501729A (en) | 1982-12-13 | 1985-02-26 | Research Corporation | Aerosolized amiloride treatment of retained pulmonary secretions |
| CA1247080A (en) | 1983-03-08 | 1988-12-20 | Commonwealth Serum Laboratories Commission | Antigenically active amino acid sequences |
| PL170980B1 (en) | 1992-06-25 | 1997-02-28 | Smithkline Beecham Biolog | Vaccine |
| GB9326253D0 (en) | 1993-12-23 | 1994-02-23 | Smithkline Beecham Biolog | Vaccines |
| UA56132C2 (en) | 1995-04-25 | 2003-05-15 | Смітклайн Бічем Байолоджікалс С.А. | Vaccine composition (variants), method for stabilizing qs21 providing resistance against hydrolysis (variants), method for manufacturing vaccine |
| CU22683A1 (en) * | 1997-01-15 | 2001-07-20 | Inst De Medicina Tropical Pedro Kouri | EPITHES OF THE PRE-M / M PROTEIN OF THE DENGUE VIRUS, SYNTHETIC PEPTIDES, CHEMICAL PROTEINS AND THEIR USES |
| CA2572921C (en) | 2004-07-09 | 2017-01-03 | The University Of North Carolina At Chapel Hill | Replication-competent and propagation-defective venezuelan equine encephalitis (vee) viral adjuvants |
| CU23586A1 (en) * | 2005-11-22 | 2010-10-30 | Ct Ingenieria Genetica Biotech | METHODS AND PROTEINS FOR THE PROPHLACTIC AND / OR THERAPEUTIC TREATMENT OF THE FOUR SEROTYPES OF THE DENGUE VIRUS AND OTHER FLAVIVIRUS |
| WO2011146933A2 (en) * | 2010-05-21 | 2011-11-24 | University Of Pittsburgh-Of The Commonwealth System Of Higher Education | Universal dengue virus sequences and methods of use |
| WO2012027473A2 (en) | 2010-08-24 | 2012-03-01 | The University Of North Carolina At Chapel Hill | Immunogenic compositions comprising alphavirus vectored dengue virus e protein antigens |
| US9376486B2 (en) * | 2010-12-14 | 2016-06-28 | National University Of Singapore | Human monoclonal antibody with specificity for Dengue virus serotype 1 E protein and uses thereof |
| AU2012326079B2 (en) | 2011-10-20 | 2017-01-12 | The Government Of The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Dengue virus E-glycoprotein polypeptides containing mutations that eliminate immunodominant cross-reactive epitopes |
| EP2834265A4 (en) * | 2012-04-02 | 2015-10-14 | Univ North Carolina | Methods and compositions for dengue virus epitopes |
-
2014
- 2014-06-26 AU AU2014302282A patent/AU2014302282B2/en not_active Ceased
- 2014-06-26 EP EP19176621.1A patent/EP3590955A1/en not_active Withdrawn
- 2014-06-26 MX MX2016000235A patent/MX365957B/en active IP Right Grant
- 2014-06-26 SG SG11201510617WA patent/SG11201510617WA/en unknown
- 2014-06-26 US US14/392,127 patent/US10053493B2/en not_active Expired - Fee Related
- 2014-06-26 CN CN201480047442.XA patent/CN105473603B/en not_active Expired - Fee Related
- 2014-06-26 EP EP14817079.8A patent/EP3013852B1/en not_active Not-in-force
- 2014-06-26 CN CN201910931774.9A patent/CN110734500A/en active Pending
- 2014-06-26 WO PCT/US2014/044410 patent/WO2014210358A1/en active Application Filing
- 2014-06-26 BR BR112015032388A patent/BR112015032388A8/en not_active IP Right Cessation
- 2014-06-26 ES ES14817079T patent/ES2745431T3/en active Active
- 2014-06-26 JP JP2016524209A patent/JP6525984B2/en not_active Expired - Fee Related
- 2014-06-26 KR KR1020167001891A patent/KR20160027019A/en not_active Application Discontinuation
- 2014-06-26 CA CA2918644A patent/CA2918644A1/en not_active Abandoned
-
2016
- 2016-01-07 MX MX2019007252A patent/MX2019007252A/en unknown
-
2018
- 2018-08-20 US US16/105,346 patent/US10870682B2/en active Active
- 2018-12-12 AU AU2018278927A patent/AU2018278927A1/en not_active Abandoned
-
2019
- 2019-05-07 JP JP2019087452A patent/JP2019195328A/en active Pending
Patent Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2001003729A2 (en) * | 1999-07-13 | 2001-01-18 | Hawaii Biotechnology Group, Inc. | Recombinant envelope vaccine against flavivirus infection |
| US20110059131A1 (en) * | 2004-07-27 | 2011-03-10 | The Gov. Of The Usa As Represented By The Secretary Of The Dept. Of Health & Human Services | Localization and characterization of flavivirus envelope glycoprotein cross-reactive epitopes and methods for their use |
| EA015907B1 (en) * | 2004-10-20 | 2011-12-30 | Санофи Пастер Байолоджикс Ко. | Recombinant flavivirus and use thereof |
| WO2011119716A2 (en) * | 2010-03-24 | 2011-09-29 | Research Development Foundation | Flavivirus host range mutations and uses thereof |
Non-Patent Citations (1)
| Title |
|---|
| See also references of EP3013852A4 * |
Cited By (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP3212672A4 (en) * | 2014-11-02 | 2018-04-25 | The University of North Carolina at Chapel Hill | Methods and compositions for recombinant dengue viruses for vaccine and diagnostic development |
| US10398768B2 (en) | 2014-11-02 | 2019-09-03 | The University Of North Carolina At Chapel Hill | Methods and compositions for recombinant dengue viruses for vaccine and diagnostic development |
| EP3535398A4 (en) * | 2016-10-27 | 2020-09-09 | Day-Yu Chao | Dengue virus-like particle, antibody against dengue virus, and composition comprising the same |
| US11046754B2 (en) | 2016-10-27 | 2021-06-29 | Day-Yu Chao | Dengue virus-like particle, antibody against dengue virus, and composition comprising the same |
| WO2023056335A1 (en) * | 2021-09-30 | 2023-04-06 | The University Of North Carolina At Chapel Hill | Methods and compositions for recombinant dengue viruses for vaccine and diagnostic development |
Also Published As
| Publication number | Publication date |
|---|---|
| CA2918644A1 (en) | 2014-12-31 |
| US10053493B2 (en) | 2018-08-21 |
| MX2016000235A (en) | 2016-08-11 |
| US20160257719A1 (en) | 2016-09-08 |
| CN105473603A (en) | 2016-04-06 |
| EP3590955A1 (en) | 2020-01-08 |
| JP2019195328A (en) | 2019-11-14 |
| US20190225654A1 (en) | 2019-07-25 |
| MX2019007252A (en) | 2019-08-16 |
| EP3013852A4 (en) | 2017-02-15 |
| AU2014302282B2 (en) | 2018-09-13 |
| AU2014302282A1 (en) | 2016-02-11 |
| AU2018278927A1 (en) | 2019-01-17 |
| US10870682B2 (en) | 2020-12-22 |
| KR20160027019A (en) | 2016-03-09 |
| EP3013852B1 (en) | 2019-06-19 |
| SG11201510617WA (en) | 2016-01-28 |
| ES2745431T3 (en) | 2020-03-02 |
| JP2016523912A (en) | 2016-08-12 |
| BR112015032388A2 (en) | 2017-07-25 |
| BR112015032388A8 (en) | 2020-01-14 |
| EP3013852A1 (en) | 2016-05-04 |
| MX365957B (en) | 2019-06-20 |
| CN110734500A (en) | 2020-01-31 |
| CN105473603B (en) | 2019-10-25 |
| JP6525984B2 (en) | 2019-06-05 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US10117924B2 (en) | Chimeric dengue virus E glycoproteins comprising mutant domain I and domain II hinge regions | |
| US10870682B2 (en) | Methods and compositions for dengue virus vaccines | |
| JP2018090618A (en) | Immunogenic composition and vaccine kit against dengue virus | |
| JP6671364B2 (en) | Methods and compositions for recombinant dengue virus for vaccine and diagnostic development | |
| US11241491B2 (en) | Methods and compositions for dengue virus serotype 4 epitopes | |
| WO2019079594A1 (en) | Methods and compositions for norovirus vaccines and diagnostics | |
| JP2002517200A (en) | Nucleic acid vaccine for prevention of flavivirus infection | |
| WO2023056335A1 (en) | Methods and compositions for recombinant dengue viruses for vaccine and diagnostic development | |
| EP4010355A1 (en) | Methods and compositions for stabilized recombinant flavivirus e protein dimers | |
| CA2370278C (en) | Chimeric lyssavirus nucleic acids and polypeptides | |
| EP1721982B1 (en) | Chimeric lyssavirus nucleic acids and polypeptides | |
| WO2023178310A1 (en) | Compositions comprising modified flavivirus e glycoproteins and methods of making and using the same | |
| EP3621645A1 (en) | Bivalent dengue/hepatitis b vaccines |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| WWE | Wipo information: entry into national phase |
Ref document number: 201480047442.X Country of ref document: CN |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 14817079 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 14392127 Country of ref document: US |
|
| ENP | Entry into the national phase |
Ref document number: 2016524209 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2016/000235 Country of ref document: MX |
|
| ENP | Entry into the national phase |
Ref document number: 2918644 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2014817079 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 20167001891 Country of ref document: KR Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: IDP00201600452 Country of ref document: ID |
|
| ENP | Entry into the national phase |
Ref document number: 2014302282 Country of ref document: AU Date of ref document: 20140626 Kind code of ref document: A |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112015032388 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 112015032388 Country of ref document: BR Kind code of ref document: A2 Effective date: 20151223 |