WO2014206568A1 - Direct, programmable detection of epigenetic dna cytosine modifications using tal effectors - Google Patents

Direct, programmable detection of epigenetic dna cytosine modifications using tal effectors Download PDF

Info

Publication number
WO2014206568A1
WO2014206568A1 PCT/EP2014/001753 EP2014001753W WO2014206568A1 WO 2014206568 A1 WO2014206568 A1 WO 2014206568A1 EP 2014001753 W EP2014001753 W EP 2014001753W WO 2014206568 A1 WO2014206568 A1 WO 2014206568A1
Authority
WO
WIPO (PCT)
Prior art keywords
interest
cytosine residue
nucleic acid
tale
modification
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2014/001753
Other languages
French (fr)
Inventor
Daniel Summerer
M. Grzegorz KUBIK
Moritz Johannes SCHMIDT
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Universitaet Konstanz
Original Assignee
Universitaet Konstanz
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Universitaet Konstanz filed Critical Universitaet Konstanz
Priority to US14/899,483 priority Critical patent/US9879315B2/en
Priority to EP14747293.0A priority patent/EP3013979B1/en
Publication of WO2014206568A1 publication Critical patent/WO2014206568A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q1/00Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
    • C12Q1/68Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
    • C12Q1/6813Hybridisation assays
    • C12Q1/6827Hybridisation assays for detection of mutation or polymorphism
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q1/00Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
    • C12Q1/68Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
    • C12Q1/6844Nucleic acid amplification reactions
    • C12Q1/6858Allele-specific amplification

Definitions

  • the present invention relates to methods for the differentiation of a 5-hydroxymethyl modification of a cytosine residue of interest in a nucleic acid molecule from (i) a 5-methyl modification of said cytosine residue of interest or (ii) said unmodified cytosine residue of interest, said methods making use of the capability of transcription-activator-like effector (TALE) proteins to preferentially bind with strong affinity to nucleic acid sequences containing non-modified cytosine residues or 5-methyl modified cytosine residues, and to bind, if at all, with only strongly reduced affinity to nucleic acid sequences containing 5-hydroxymethyl modified cytosine residues.
  • TALE transcription-activator-like effector
  • the present invention further relates to respective uses of TALE proteins for the differentiation of a 5-hydroxymethyl modification of a cytosine residue of interest in a nucleic acid molecule from (i) a 5-methyl modification of said cytosine residue of interest or (ii) said unmodified cytosine residue of interest.
  • 5-Methylcytosine ( 5m C, Fig. 1 ) is an essential epigenetic DNA modification that acts as an important factor in the silencing of genes. It has important roles in the regulation of gene expression, genome stability and disease including neurological disorders and various cancer types. In recent years, with the development of epigenetics, high importance has been attached to the selective detection of 5m C in genes, given the strong correlation of this genetic modification with various aspects of gene control, such as gene regulation, genomic imprinting, and X chromosome inactivation, among other effects. It has been reported that a high level of 5m C at CpG islands within promoters and the global hypomethylation of genomic DNA, which induces gene instability, can produce the activation of oncogenes and the high occurrence of various diseases.
  • 5-Hydroxymethylcytosine ( C. Fig. 1 ) was first discovered in the bacteriophages T2, T4 and T6 in 1952. The presence of it in mammalian DNA was suggested not until twenty years later, but has received only little scientific attention. In 2009, 5-hydroxymethyIcytosine was detected in cerebellar Purkinje neurons in the brain. Simultaneously, 5-hydroxymethylcytosine was reported to be present in mouse embryonic stem cells and human embryonic kidney cells.
  • the TET1 (ten-eleven translocation 1 ) protein a fusion partner of histone methyltransferase in acute myeloid leukemia, was identified as a 2-oxoglutarate- and Fe(ll)-dependent enzyme that catalyses the conversion of 5-methylcytosine to 5-hydroxymethylcytosine in vitro, as well as in cultured cells.
  • prokaryotic cytosine-5 methyltransferases were able to produce 5-hydroxymethylcytosine by reversible addition of formaldehyde to cytosine. It was supposed that 5-hydroxymethylcytosine is formed at 5-methylcytosine sites in response to oxidative stress. Further, it has been speculated that 5-hydroxymethylcytosine together with 5-formyldeoxycytosine could be one of the main oxidative degradation products of 5-methylcytosine.
  • the human body consists of over 200 different cell types with diverse functions, yet with almost identical genomes. This phenotypic diversity is determined by differences in gene expression profiles. Central regulatory elements of gene expression are epigenetic DNA modifications that affect local transcriptional activity of the genome by controlling chromatin structure. In contrast to other, rather transient regulatory elements, epigenetic DNA modifications can be preserved or regenerated during cell division, resulting in inheritable imprinting of regulatory states. Among these, methylation of DNA cytosine (C) residues in CpG dinucleotides at the carbon 5-position (5-Methylcytosine, 5m C or mC, Fig. 1 , Fig. 16) is the most common modification in vertebrates.
  • C DNA cytosine
  • hmC is now recognized as key intermediate of mC de-methylation that can either be passively depleted through DNA replication or actively reverted to C, e.g. through iterative oxidation to 5-formylcytosine (fC) and 5-carboxylcytosine (caC) and thymine DNA glycosylase (TDG)-mediated base excision repair (BER, Fig. 16).
  • fC 5-formylcytosine
  • caC 5-carboxylcytosine
  • TDG thymine DNA glycosylase
  • Methylation, oxidation and repair now offer a model for the long searched, complete cycle of dynamic cytosine modification, with paramount importance for cell development, differentiation, and the onset of diseases including cancer.
  • GSTP1 glutathione S-transferase P1
  • MGMT 0 6 -methylguanine- DNA methyltransferase
  • hmC besides being a de-methylation intermediate, is increasingly recognized to have inherent biological functions on its own, indicated by its unique cell-type specific occurrences, genomic distribution patterns and impact on the binding ability of DNA-binding proteins (in contrast, fC and caC are significantly less abundant and their potential biological roles have yet to be discovered).
  • fC and caC are significantly less abundant and their potential biological roles have yet to be discovered.
  • recent studies established hmC and aberrant TET dioxygenase activity as novel biomarkers for various cancers that exhibit large, wide-spread differences in normal and cancer tissue.
  • editing of the hmC-landscape in melanoma cells has been shown to even result in suppression of melanoma growth and to increase tumor-free survival in animal models.
  • a major group of differentiation approaches is based on chemical conversion, i.e. on the selective deamination of C (but not mC/hmC) with bisulfite and subsequent analysis of the resulting C to uridine (U) mutation.
  • This can be coupled with additional conversion steps to achieve a partial selectivity between C, mC and hmC.
  • oxidation with KRuO 4 converts hmC to fC, whereas mC remains unchanged.
  • fC is converted to U in bisulfite treatments, and thus hmC and mC can be indirectly differentiated in comparative assays.
  • hmC can be glycosylated and then reads as C after bisulfite treatment. If this is coupled with an oxidation step using a TET dioxygenase, all other C-modifications will be oxidized to caC and then read as U after bisulfite treatment.
  • a second group of differentiation approaches relies on proteins that bind (and potentially modify) C-modifications directly, i.e. without chemical conversion.
  • proteins that are currently employed for this e.g. antibodies, restriction enzymes, ⁇ -glucosyltransferase
  • exhibit no or constraint sequence-selectivity This prevents their use for direct, locus-specific differentiation and thus they require the coupling to sequence-selective downstream analyses.
  • the technical problem underlying the present invention is to provide improved methods for the differentiation of a 5-hydroxymethyl modification of a cytosine residue of interest in a nucleic acid molecule from (i) a 5-methyl modification of said cytosine residue of interest or (ii) said unmodified cytosine residue of interest, wherein said methods should not compromise the integrity of the nucleic acid molecule and should be fast, easy, sequence- and locus-specific and highly sensitive.
  • the present invention relates to a method for the differentiation of a 5-hydroxymethyl modification of a cytosine residue of interest in a nucleic acid molecule from
  • said method comprising the steps of:
  • TALE transcription-activator-like effector
  • the repeat variable diresidue (RVD) of said TALE protein whose position corresponds to the position of the cytosine residue of interest is a sized reduced RVD.
  • sized reduced RVD relates to RVDs that are sterically smaller in size than RVDs having an average steric size.
  • size reduced RVDs can have a deletion of 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acids.
  • a 5-hydroxymethyl modification of a cytosine residue of interest can be differentiated from (i) a 5-methyl modification of said cytosine residue of interest or (ii) said unmodified cytosine residue of interest without the need for any pretreatment or exogenous chemical modification of the nucleic acid molecule.
  • the method of the present invention is significantly less time-, labor- and cost-intensive compared to methods known in the art relying on pretreatments or exogenous chemical modification of the nucleic acid molecule.
  • the method of the present invention is highly sensitive and thus allows the detection with high resolution, i.e. differentiation of the modification at single cytosine sites.
  • the method allows the differentiation at user-defined sites, owing to the programmability of sequence recognition of TALE proteins that exceeds the programmability of any other known protein.
  • the term "differentiation" as used herein indicates the fact that the method of the present invention allows to determine whether a particular cytosine residue of interest is (i) 5-hydroxymethyl modified, or (ii) 5-methyI modified or unmodified.
  • binding of the TALE protein to the region of said nucleic acid molecule that includes said cytosine residue of interest indicates that said cytosine residue of interest is 5-methyl modified or unmodified, whereas lack of binding or binding with a strongly reduced affinity indicates that said cytosine residue of interest is 5-hydroxymethyl modified.
  • the nucleic acid molecule may be single- stranded or double-stranded.
  • the nucleic acid molecule is a DNA molecule, more preferably a double-stranded DNA molecule.
  • said nucleic acid molecule is in its native state and is not chemically modified by any pretreatment.
  • cytosine residue modifications described herein are physiological cytosine modifications known in the art.
  • said modifications are 5-methylation or 5-hydroxymethylation of said cytosine residue.
  • Respectively modified cytosine residues are labeled herein as 5m C or mC for 5-methylcytosine, and as 5hm C or hmC for 5-hydroxymethylcytosine.
  • cytosine residue of interest points to the fact that with the method of the present invention, any particular cytosine residue in a given nucleic acid molecule can be analyzed for differentiating the modification of said particular residue. This is achieved by providing a TALE protein in step (a) of said method which is capable of binding in a sequence- and locus-specific manner to a region of said nucleic acid molecule that includes said cytosine residue of interest.
  • TALE proteins represent the protein scaffold with the highest modularity and flexibility of sequence- and locus-specific nucleic acid recognition. They consist of concatenated single modules that each recognize one nucleotide in the target nucleic acid. These modules can be flexibly connected to recognize any arbitrary nucleic acid sequence of interest. The recognition is achieved by only two amino acid residues (repeat variable diresidue, RVD) within each module, providing a "code" of recognition.
  • RVD right variable diresidue
  • the most widely used TALE codes are NG for T, Nl for A, NN, NK, NH and HN for G and HD for C.
  • RVD HD interacts with C through a hydrogen bond between the aspartate carboxyl group and the nucleobase 4-amino group. It has been shown that the 5-methylation or 5-hydroxymethylation status of C influences the binding of modules containing the HD code, i.e. affinity is strongly reduced, when a modified C instead of an unmodified C is present in the target sequence.
  • TALEs consist of concatenated modules, each of which recognizes a canonical nucleobase in DNA and this recognition mode is fully programmable.
  • Certain natural or designed TALE modules provide selectivity for mC or hmC and can also provide universality of binding several C-modifications. This makes TALEs the first molecules that hold potential for the direct, fully programmable differentiation of individual C-modifications both in vitro and in vivo. This offers considerable simplifications and performance improvements for typing/profiling in vitro as compared to current approaches.
  • TALE proteins have recently been discovered as a new scaffold for the design of DNA binding domains with programmable sequence selectivity. Besides fixed N- and C-terminal domains, TALEs feature a central DNA-binding domain that consists of concatenated, interchangeable modules each of which recognizes one of the four canonical DNA nucleotides. These modules consist of 34 amino acids (aa) arranged in two a-helices connected by a small loop. Most of these aa are highly conserved, whereas two aa of the loop are variable (the repeat variable diresidue, RVD) and are responsible for selective nucleobase binding.
  • RVD repeat variable diresidue
  • aa 12 (numbering in the module) is an H or N residue (one-letter aa code) that makes a stabilizing intra-loop hydrogen bond.
  • the second residue (aa 13) makes a specific contact to the edge of the nucleobase through the major groove of the DNA duplex. This results in a winding of the TALE into the DNA groove, forming a super-helical structure, where consecutive TALE modules bind all nucleotides of the forward DNA strand.
  • the nucleotide recognition by TALE RVDs follows a simple code, with the RVDs Nl, NN, HD and NG binding the nucleotides A, G, C, and T, respectively.
  • the programmability of TALEs by facile concatenation of individual modules has extensively been proven in various sequence contexts and does not exhibit pronounced context dependencies or sequence constraints.
  • TALEs This fully programmable and selective recognition of canonical nucleobases by TALEs allows the selective recognition of epigenetically modified nucleobases, i.e. C-modifications. This provides a simultaneous, programmable recognition of both DNA sequence and epigenetic C-modification state and thus supersedes any pretreatments that are currently required for differentiation of C-modifications. Indeed, reduced DNA-binding of TALEs is seen at mC- or hmC-containing target sequences.
  • the 5-hydroxymethylation status of C influences the binding of modules containing size reduced RVDs, in particular the N* code, i.e. affinity is strongly reduced when hmC instead of unmodified C or mC is present in the target sequence.
  • TALE modules can be designed that enable differentiation not only between C and mC, but between all three targeted C-modifications including the fully selective sensing of hmC according to the present invention.
  • TALEs containing designer TALE modules with size reduced RVDs, in particular with RVD H* and/or N* represent the first programmable readers for the selective sensing of hmC.
  • TALE proteins can be designed that are capable of binding in a sequence- and locus-specific manner to a region of said nucleic acid molecule that includes said cytosine residue of interest.
  • the term "capable of binding in a sequence- and locus-specific manner to a region of said nucleic acid molecule that includes said cytosine residue of interest” as used herein relates to the fact that the TALE protein is capable of binding to said region in case the cytosine residue of interest is not modified or 5 5-methyl modified.
  • said term relates to the fact that the TALE protein's sequence specificity is directed to the nucleotide sequence of said region wherein the cytosine residue of interest is not modified or 5-methyl modified.
  • the region to which said TALE protein is capable of binding in a sequence-specific manner is from 10 to 30 nucleotides in length, more 10 preferably from 12 to 28 nucleotides in length, and most preferably from 14 to 24 nucleotides in length. Modification of said cytosine residue by 5- hydroxymethylation strongly reduces the affinity of the binding of said TALE protein to said region. Methods for the design and expression of TALE proteins are not particularly limited and are known in the art.
  • TALE proteins can bind to a nucleic acid molecule containing a cytosine residue that is 5-hydroxymethyl modified, although with a strongly reduced affinity as compared to the binding to the same nucleic acid molecule containing a cytosine residue that
  • step (b) of the method of the present invention is performed under conditions that (i) do not allow the binding of the TALE protein to the nucleic acid molecule containing a 5-hydroxymethyl modified cytosine residue, but (ii) allow the binding of the TALE protein to the nucleic acid molecule containing a cytosine residue that is not
  • strongly reduced affinity relates to the effect described above, i.e. that TALE proteins bind to a nucleic acid molecule that does not 0 contain a modified cytosine residue or contains a 5-methyl modified cytosine residue with a first affinity, and bind, if at all, to the same nucleic acid molecule wherein said cytosine residue is 5-hydroxymethyl modified with a second affinity, wherein said second affinity is strongly reduced as compared to said first affinity.
  • said second affinity is 20%, more preferably 10%, more preferably 5%, more preferably 2%, and most preferably 1 % or less of said first affinity.
  • Methods for determining whether the TALE protein binds to said region or does not bind to said region or does bind to said region with a strongly reduced affinity are not particularly limited and are known in the art.
  • said methods are preferably performed at conditions that (i) do not allow the binding of the TALE protein to the nucleic acid molecule containing a 5-hydroxymethyl modified cytosine residue, but (ii) allow the binding of the TALE protein to the nucleic acid molecule containing a cytosine residue that is not modified or a cytosine residue that is 5-methyl modified.
  • Respective conditions are known and can be chosen by the person skilled in the art.
  • the method of the present invention further comprises the step of:
  • said modification is present when said TALE protein does not bind to said region or does bind to said region with a strongly reduced affinity
  • said method allowing for the direct detection of a 5-hydroxymethyl modification of said cytosine residue of interest in said nucleic acid molecule.
  • the terms “direct detection” or “directly detecting” relate to the fact that with the method of the present invention, 5-hydroxymethyl modification of a cytosine residue of interest in a nucleic acid molecule can be detected without the need for any pretreatment or exogenous chemical modification of the nucleic acid molecule.
  • step (b) of the method of the present invention comprises the step of determining whether a specific DNA polymerase reaction using a primer that is capable of binding to the region of said nucleic acid molecule that includes said cytosine residue of interest is inhibited, thus indicating binding of said TALE protein to said region, said method allowing for the direct detection of a 5-hydroxymethyl modification of said cytosine residue of interest in said nucleic acid molecule.
  • binding of the TALE protein to a nucleic acid molecule containing a cytosine residue that is 5-hydroxymethyl modified i.e.
  • step (b) of the method of the present invention comprises the steps of: (b1 ) providing a primer that is capable of binding to the region of said nucleic acid molecule that includes said cytosine residue of interest;
  • said TALE protein does not bind to said region or does bind to said region with a strongly reduced affinity when the parameter detected in step (e) for the first specific DNA polymerase reaction does not differ significantly from the parameter detected in step (e) for the second specific DNA polymerase reaction, and
  • the method of the present invention comprises the steps of:
  • TALE transcription-activator-like effector
  • said TALE protein does not bind to said region or does bind to said region with a strongly reduced affinity when the parameter detected in step (e) for the first specific DNA polymerase reaction does not differ significantly from the parameter detected in step (e) for the second specific DNA polymerase reaction, and
  • said TALE protein binds to said region when the parameter detected in step (e) for the first specific DNA polymerase reaction differs significantly from the parameter detected in step (e) for the second specific DNA polymerase reaction;
  • said modification is present when said TALE protein does not bind to said region or does bind to said region with a strongly reduced affinity
  • the repeat variable diresidue (RVD) of said TALE protein whose position corresponds to the position of the cytosine residue of interest is a sized reduced RVD, preferably the RVD H* or N*.
  • the TALE protein is added to the DNA molecules in a molar ratio of TALE protein to DNA of between 2:1 and 500:1 , more preferably of between 30:1 to 70:1 , more preferably of between 40:1 to 60:1 , and most preferably of 50:1.
  • step (b3) of the method of the present invention two separate specific DNA polymerase reactions are performed with the primer of step (b1 ), the first one using said DNA molecule to which said TALE protein has been added as template, and the second one using said DNA molecule to which no TALE protein has been added as a template.
  • binding of a TALE protein to the region of DNA to which the primer binds abolishes the ability of a DNA polymerase to bind to the DNA-primer complex, thus inhibiting the elongation of the primer.
  • the TALE protein binds to the DNA molecule in the first specific DNA polymerase reaction, thus inhibiting primer extension, whereas in the second specific DNA polymerase reaction, primer elongation occurs. Accordingly, in case a 5-hydroxymethyl modification of the cytosine residue of interest is present, the TALE protein does not bind to the DNA molecule or does bind to said molecule with a strongly reduced affinity in the first specific DNA polymerase reaction, and primer elongation can occur in the same manner as in the second specific DNA polymerase reaction.
  • Suitable DNA polymerase reactions are not particularly limited and are known in the art. They include for example primer extension reaction, arrayed primer extension (APEX), polymerase chain reaction (PCR), rolling circle amplification (RCA) and strand displacement amplification (SDA).
  • step (b3) In order to detect whether (i) primer elongation has occurred in both the first and second specific DNA polymerase reaction of step (b3), thus indicating the presence of a 5-hydroxymethyl modification of the cytosine residue of interest, or (ii) primer elongation has occurred only in the second specific DNA polymerase reaction but not in the first, thus indicating the absence of a modification of the cytosine residue of interest or the presence of a 5-methyl modification of said cytosine residue, at least one parameter, selected from the group consisting of the concentration, size (expressed as molecular weight or as chain-length), and sequence, of each of the products of said first and second specific DNA polymerase reaction is determined in step (b5) of the method of the present invention.
  • step (b4) of the method of the present invention (i) the concentration of the products of said first and second specific DNA polymerase reaction is determined using a method, selected from the group consisting of quantitative polymerase chain reaction (qPCR), fluorescence measurements using nucleic acid binding fluorescent probes, and photometry; and/or (ii) the size of the products of said first and second specific DNA polymerase reaction is determined using a method, selected from the group consisting of polymerase chain reaction (PCR), and gel electrophoresis; and/or (iii) the sequence of the products of said first and second specific DNA polymerase reaction is determined using a method, selected from the group consisting of Sanger sequencing, pyrosequencing, microarray hybridization, next-generation sequencing methods, and next-next-generation sequencing methods, including sequence-by-synthesis, sequencing-by-ligation, single molecule sequencing in zero-mode waveguides and nanopore sequencing.
  • qPCR quantitative polymerase chain reaction
  • PCR polymerase chain reaction
  • PCR polymerase chain
  • step (b4) of the method of the present invention the concentration of the products of said first and second specific DNA polymerase reaction is determined by qPCR, the primer of step (b1 ) is biotinylated, and said products are isolated prior to said step (b4) by a method, comprising the steps of:
  • Respective methods of generating biotinylated DNA polymerase reaction products by using biotinylated primers, of isolating biotinylated products using beads that are coupled to streptavidin, and of removing nucleic acid duplexes are not particularly limited and are known in the art.
  • said primer is 5'-biotinylated
  • said beads are streptavidin-agarose beads
  • the buffer used for washing is a buffer containing 20 mM NaOH.
  • steps (b5) and (c) of the method of the present invention the presence or absence of a 5-hydroxymethyl modification of the cytosine residue of interest is actually detected. This is based on the above finding that primer elongation in the first specific DNA polymerase reaction can only occur in case the TALE protein does not bind to the DNA molecule or does bind to said molecule with a strongly reduced affinity, i.e. in case a respective 5-hydroxymethyl modification is present. Thus, in this case the parameter determined in step (b4) will not differ between the first and second specific DNA polymerase reaction.
  • the TALE protein will bind to the DNA molecule, thus inhibiting primer elongation, so that the parameter determined in step (b4) will differ between the first and second specific DNA polymerase reaction.
  • the term "differ significantly" as used herein relates to a difference of at least 10%, preferably at least 20%, at least 30% or at least 50%.
  • the method of the present invention can not only be used to gain a qualitative result concerning the presence or absence of a 5-hydroxymethyl cytosine modification, but also to gain a quantitative result concerning the degree of 5- hydroxymethyl cytosine modification.
  • a calibration curve using nucleic acid molecules having a known degree of 5-hydroxymethyl cytosine modification can be established, and the degree of 5-hydroxymethyl cytosine modification of the nucleic acid molecule of interest can be determined by linear regression.
  • the method of the present invention further comprises the steps of:
  • step (d) comparing the parameter detected in step (b4) for the first specific DNA polymerase reaction to one or more respective parameters obtained from nucleic acid molecules having a known degree of 5-hydroxymethyl modification of the cytosine residue of interest;
  • the TALE protein provided in step (a) of the method is designed in a way that the RVD whose position corresponds to the position of said cytosine residue of interest, i.e. the RVD that binds to the cytosine of interest in case said cytosine is not modified or is 5-methyl modified, is a size reduced RVD, in particular the RVD H* or N*.
  • size reduced RVDs in particular the RVD H* or NT, have a high binding affinity to C and to mC, but a strongly reduced binding affinity to hmC, this allows the detection of hmC in accordance with the method of the present invention as defined above.
  • the TALE proteins employed in the present invention do not only allow for the differentiation of 5-hydroxymethyl modified cytosine residues from unmodified or 5-methyl modified cytosine residues, but can also be used for a wide range of applications for the detection, manipulation, purification, and analysis of 5-hydroxymethyl modified cytosine residues in nucleic acids.
  • said TALE proteins can be coupled to a variety of compounds, proteins, affinity ligands, and other moieties.
  • Such "coupling moieties” are not particularly limited and can be easily chosen by a person skilled in the art in accordance with the particular application of interest. Examples of such moieties include fluorescent dyes, fluorescent proteins such as e.g. green fluorescent protein (GFP), affinity ligands such as e.g.
  • protein tags include 18A-Tag, ACP-Tag, Avi-Tag, BCCP-Tag, Calmodulin-Tag (CaM-Tag), Chitin-binding-Protein-Tag (CBP-Tag), E-Tag, ELK16-Tag, ELP-Tag, FLAG-Tag, Flash-Tag, poly-glutamic acid-Tag, Glutathion- S-Transferase-Tag (GST-Tag), Green fluorescent protein-Tag (GFP-Tag), Hamagglutinin-Tag (HA-Tag), poly-Histidin-Tag (His-Tag), Isopeptag, Maltose binding protein-Tag (MBP-Tag), Myc-Tag, Nus-Tag, ProtA-Tag, ProtC-Tag, S-Tag, SBP-Tag, Snap-Tag
  • Coupled moieties can be coupled directly or indirectly to the TALE protein, or can be expressed as part of conjugate proteins comprising also the TALE protein.
  • Methods for the coupling of respective “coupling moieties” and for the expression of respective conjugates are not particularly limited and are known in the art. They include methods employing a His-Tag on the expressed conjugates and purification via NiNTA as known in the art.
  • the TALE protein is coupled directly or indirectly to an affinity ligand, said method further comprising the step of:
  • said method allowing for the enrichment of nucleic acid molecules in which a 5- hydroxymethyl modification of said cytosine residue of interest is present.
  • Affinity ligands for use according to this embodiment are not particularly limited and are known in the art. They include for example biotin, digoxigenin, dinitrophenol, magnetic particles, antibodies, including antibody fragments and antibody mimetics, and protein tags, e.g. as indicated above.
  • Methods for the direct or indirect coupling of affinity ligands to TALE proteins are not particularly limited and are known in the art.
  • the term “coupled directly or indirectly” expressly includes the expression of conjugate molecules of TALE proteins and any particular proteinaceous affinity ligands. Further, the term “coupled indirectly” includes any coupling strategies employing linkers, binding via further affinity partners, and the like, which are known in the art.
  • methods for the depletion of nucleic acid molecules in which a 5-methyl modification of said cytosine residue of interest or said unmodified cytosine residue of interest is present via affinity chromatography using said affinity ligands are not particularly limited and are known in the art. Particular methods include the use of His-tags as affinity ligand and depletion of nucleic acids bound to respective TALE proteins via NiNTA-beads, as well as the use of other protein tags as indicated above in connection with the respective affinity binding partners.
  • nucleic acid molecules in which a 5-methyl modification of said cytosine residue of interest and/or said unmodified cytosine residue of interest is present are depleted from a mixture containing nucleic acids in which a 5-hydroxymethyl modification of the cytosine residue of interest is present, as well as nucleic acids in which a 5-methyl modification of said cytosine residue of interest is present and/or in which the cytosine residue of interest is not modified.
  • nucleic acids in which a 5-hydroxymethyl modification of the cytosine residue of interest is present are enriched in the mixture.
  • the TALE protein is coupled directly or indirectly to a protein having nuclease activity, said method further comprising the step of: (c) digesting nucleic acid molecules in which a 5-methyl modification of said cytosine residue of interest or said unmodified cytosine residue of interest is present using said protein having nuclease activity;
  • said method allowing for the differential digestion of nucleic acid molecules in which a 5-methyl modification of said cytosine residue of interest or said unmodified cytosine residue of interest is present, wherein nucleic acid molecules in which a 5-hydroxymethyl modification of said cytosine residue of interest is present remain undigested.
  • Proteins having nuclease activity for use according to this embodiment are not particularly limited and are known in the art. They include for example restriction enzymes and cleavage domains of restriction enzymes, e.g. the cleavage domain of Fokl. Methods for the direct or indirect coupling of proteins having nuclease activity to TALE proteins are not particularly limited and are known in the art.
  • the term “coupled directly or indirectly” expressly includes the expression of conjugate molecules of TALE proteins and any particular proteins having nuclease activity. Further, the term “coupled indirectly” includes any coupling strategies employing linkers, binding via further affinity partners, and the like, which are known in the art.
  • methods for the digestion of nucleic acid molecules in which a 5-methyl modification of said cytosine residue of interest or said unmodified cytosine residue of interest is present using said proteins having nuclease activity are not particularly limited and are known in the art.
  • nucleic acid molecules in which a 5-methyl modification of said cytosine residue of interest and/or said unmodified cytosine residue of interest is present are digested in a mixture containing nucleic acids in which a 5-hydroxymethyl modification of the cytosine residue of interest is present, as well as nucleic acids in which a 5-methyl modification of said cytosine residue of interest is present and/or in which the cytosine residue of interest is not modified.
  • nucleic acids in which a 5-hydroxymethyl modification of the cytosine residue of interest is present are enriched in the mixture.
  • the enriched nucleic acids in which a 5-hydroxymethyl modification of the cytosine residue of interest is present can be further used for any particular application of interest.
  • said nucleic acids can be used for sequencing applications known in the art, including PCR and so- called Next Generation Sequencing methods, microarray analyses, or any methods for the analysis of 5-hydroxymethyl modified nucleic acids known in the art.
  • the present invention relates to a method for the direct detection of a 5-hydroxymethyl modification of a cytosine residue of interest in a nucleic acid molecule, said method comprising the steps of: (a) providing a transcription-activator-like effector (TALE) protein, said TALE protein being capable of binding in a sequence- and locus-specific manner to a region of said nucleic acid molecule that includes said cytosine residue of interest; and
  • TALE transcription-activator-like effector
  • said modification is present when said TALE protein does not bind to said region or does bind to said region with a strongly reduced affinity
  • the repeat variable diresidue (RVD) of said TALE protein whose position corresponds to the position of the cytosine residue of interest is a sized reduced RVD.
  • size reduced RVDs comprise the RVDs H * and N * , wherein N* is particularly preferred.
  • the present invention relates to a method for the enrichment of nucleic acid molecules in which a 5-hydroxymethyl modification of a cytosine residue of interest is present, said method comprising the steps of:
  • TALE transcription-activator-like effector
  • the repeat variable diresidue (RVD) of said TALE protein whose position corresponds to the position of the cytosine residue of interest is a sized reduced RVD.
  • size reduced RVDs comprise the RVDs H* and N * , wherein N* is particularly preferred.
  • the present invention relates to a method for the differential digestion of nucleic acid molecules in which a 5-methyl modification of a cytosine residue of interest or an unmodified cytosine residue of interest is present, wherein nucleic acid molecules in which a 5-hydroxymethyl modification of said cytosine residue of interest is present remain undigested, said method comprising the steps of:
  • TALE transcription-activator-like effector
  • the repeat variable diresidue (RVD) of said TALE protein whose position corresponds to the position of the cytosine residue of interest is a sized reduced RVD.
  • size reduced RVDs comprise the RVDs H * and N*, wherein N* is particularly preferred.
  • the nucleic acid molecule is preferably a DNA molecule, more preferably a double-stranded DNA molecule, (ii) the region to which said TALE protein is capable of binding in a sequence- and locus-specific manner is from 10 to 30 nucleotides in length, preferably from 12 to 28 nucleotides in length, more preferably from 14 to 24 nucleotides in length, (iii) said nucleic acid molecule is in its native state and is not chemically modified by any pretreatment, (iv) the affinity ligands include for example biotin, digoxigenin, dinitrophenol, magnetic particles, antibodies, including antibody fragments and antibody mimetics, and protein tags, and (v) the proteins having nuclease activity include for example restriction enzymes and cleavage domains of restriction enzymes, e.g. the cleavage domain of Fokl.
  • said TALE protein being capable of binding in a sequence- and locus-specific manner to a region of said nucleic acid molecule that includes said cytosine residue of interest.
  • the repeat variable diresidue (RVD) of said TALE protein whose position corresponds to the position of the cytosine residue of interest is a sized reduced RVD.
  • size reduced RVDs comprise the RVDs H* and N*, wherein N * is particularly preferred.
  • this use is further for the direct detection of a 5-hydroxymethyl modification of said cytosine residue of interest in said nucleic acid molecule.
  • this use is further for the enrichment of nucleic acid molecules in which a 5-hydroxymethyl modification of said cytosine residue of interest is present, wherein the TALE protein is coupled directly or indirectly to an affinity ligand.
  • this use is further for the differential digestion of nucleic acid molecules in which a 5-methyl modification of said cytosine residue of interest or said unmodified cytosine residue of interest is present, wherein nucleic acid molecules in which a 5-hydroxymethyl modification of said cytosine residue of interest is present remain undigested, wherein the TALE protein is coupled directly or indirectly to a protein having nuclease activity.
  • the present invention relates to the use of a transcription- activator-like effector (TALE) protein for the direct detection of a 5-hydroxymethyl modification of a cytosine residue of interest in a nucleic acid molecule, said TALE protein being capable of binding in a sequence- and locus-specific manner to a region of said nucleic acid molecule that includes said cytosine residue of interest.
  • TALE transcription- activator-like effector
  • the repeat variable diresidue (RVD) of said TALE protein whose position corresponds to the position of the cytosine residue of interest is a sized reduced RVD.
  • size reduced RVDs comprise the RVDs H * and N * , wherein N* is particularly preferred.
  • the present invention relates to the use of a transcription- activator-like effector (TALE) protein for the enrichment of nucleic acid molecules in which a 5-hydroxymethyl modification of a cytosine residue of interest is present, said TALE protein being capable of binding in a sequence- and locus- specific manner to a region of said nucleic acid molecule that includes said cytosine residue of interest, wherein the TALE protein is coupled directly or indirectly to an affinity ligand.
  • TALE transcription- activator-like effector
  • the repeat variable diresidue (RVD) of said TALE protein whose position corresponds to the position of the cytosine residue of interest is a sized reduced RVD.
  • size reduced RVDs comprise the RVDs H* and N*, wherein N* is particularly preferred.
  • the present invention relates to the use of a transcription- activator-like effector (TALE) protein for the differential digestion of nucleic acid molecules in which a 5-methyl modification of said cytosine residue of interest or said unmodified cytosine residue of interest is present, wherein nucleic acid molecules in which a 5-hydroxymethyl modification of said cytosine residue of interest is present remain undigested, said TALE protein being capable of binding in a sequence- and locus-specific manner to a region of said nucleic acid molecule that includes said cytosine residue of interest, wherein the TALE protein is coupled directly or indirectly to a protein having nuclease activity.
  • TALE transcription- activator-like effector
  • the repeat variable diresidue (RVD) of said TALE protein whose position corresponds to the position of the cytosine residue of interest is a sized reduced RVD.
  • size reduced RVDs comprise the RVDs H* and N*, wherein N* is particularly preferred.
  • the nucleic acid molecule is preferably a DNA molecule, more preferably a double-stranded DNA molecule, (ii) the region to which said TALE protein is capable of binding in a sequence- and locus-specific manner is from 10 to 30 nucleotides in length, preferably from 12 to 28 nucleotides in length, more preferably from 14 to 24 nucleotides in length, (iii) said nucleic acid molecule is in its native state and is not chemically modified by any pretreatment, (iv) the affinity ligands include for example biotin, digoxigenin, dinitrophenol, magnetic particles, antibodies, including antibody fragments and antibody mimetics, and protein tags, and (v) the proteins having nuclease activity include for example restriction enzymes and cleavage domains of restriction enzymes, e.g.
  • the present invention describes the sensitive discrimination of 5-hydroxymethyl modified cytosine residues over unmodified cytosine residues or 5-methyl modified cytosine residues in nucleic acid target sequences by binding of TALE proteins. Additionally, it has been discovered that the binding of TALE proteins effectively inhibits the activity of a DNA polymerase that binds the same site. In this way, the modification status, of the target nucleic acid can be used to control DNA synthesis. This results in the possibility to link e.g. the sequence or concentration of a nucleic acid molecule that has been synthesized in a DNA polymerase-promoted primer extension to the cytosine modification status of the sample nucleic acid (cf. the scheme provided in Fig. 3).
  • Figure 2 shows a PAGE electrophoretic analysis of such a primer extension controlled by 5m C-dependent binding of a TALE protein.
  • the described TALE protein- based discrimination step can be directly integrated into various analytic methods such as PCR, qPCR, gel electrophoresis, array hybridization of obtained products, direct primer extensions on arrays using labeled dNTP, Sanger sequencing, Pyrosequencing and different approaches of Next- and Next-Next-Generation sequencing.
  • This also includes sequence-by-synthesis, sequencing-by-ligation, single molecule sequencing in zero-mode waveguides and nanopore sequencing.
  • TALE proteins are highly modular and provide sufficient selectivity to be applicable in large, eukaryotic genomes. This strongly distinguishes them from previously employed, methylation-specific binding proteins. TALE proteins are additionally fully flexible in terms of target sequences and can be constructed and expressed with technical ease, providing the opportunity for high and ultra-high throughput approaches involving many TALE proteins in combination with one sample. Further, DNA polymerases are highly flexible in respect to the sequence of target nucleic acids that serve as primer/template complexes. Combined, this offers a very high potential of the present invention to be used in combination with various methods of nucleic acid sequence detection, various target sequences and different parallelization grades from single target assays to ultra-high throughput approaches.
  • TALE proteins with a variety of compounds, proteins, affinity ligands, and other moieties allows for a wide range of applications for the detection, manipulation, purification, and analysis of 5-hydroxy methyl modified cytosine residues in nucleic acids.
  • TALEs Recognition of thymine, C and 5m C in DNA by TALEs.
  • A Interaction of RVD NG (positions 12 and 13 of repeat) with thymine (top) and of RVD HD with C (bottom) in a crystal structure (pdb entry 3V6T). Hydrogen bond is shown as dotted line.
  • C EMSA assay using 5 ' - 32 P-labelled DNA containing either C or 5m C as shown in B and TALE_97 with a TALE / target DNA ratio of 10 and 6, respectively. TALE-DNA complex is marked with an arrow.
  • TALE-controlled DNA replication A: General principle. Left: Binding of TALE to a primer-template complex containing a C opposite RVD HD inhibits primer extension by KF- (gray protein surface). Right: presence of 5m C (underlined) prevents TALE-inhibition, leading to the synthesis of a DNA strand by KF- as signal (bar). B: Dependence of TALE-inhibition on the number and position of 5m C. PAGE analysis of primer extension reactions containing 0.125 U KF-, 8.325 nM primer-template complex with 5m C at indicated positions in presence or absence of 832.5 nM TALE_97. Primer and respective extension product are marked with a black and gray arrow, respectively. C: Sequence selectivity of TALE-inhibition. Experiments were conducted as in Figure 5B using three different TALE proteins that target sequences present (TALE_97) or absent (TALE_57, _58) from the template strand.
  • TALE DNA replication inhibition by TALE, highly resolved detection of 5m C-modification level and influence of genomic DNA.
  • A Concentration dependence of KF— inhibition by TALE_97. Experiments were performed as in Figure 5B with varying TALE_97 / target DNA ratios and templates.
  • B Plot of primer extension product formation against TALE_97 concentration. Data for t97 and t97_C6 mC are shown as black triangles and gray squares, respectively.
  • C Dependence of TALE inhibition on 5m C modification level at a single nucleotide position. Experiments were performed as in Figure 5B with mixes of t97 and t97_C6 mC.
  • Primer template complexes were incubated with a TAL effector protein binding to the 5hmC/5mC/C containing sequence and subsequently, a primer extension was conducted as shown in Figure 3.
  • C Kl-graph for TALE 1297 containing RVD N* at position 5.
  • D Kl-graph for TALE 1297 containing RVD NG at position 5.
  • TET ten-eleven translocation dioxygenase
  • TDG thymine DNA glycosylase
  • BER base excision repair
  • Fragments containing the N- and C-terminal sequences of a Xanthomonas axonopodis pathovar citri TALE with variable numbers of internal repeats were amplified from plasmids TALEN1297, TALEN1257 and TALEN1258 (Addgene plasmids 32279, 32280, 32281 ) with primers oDaS308 (dHax_hom_Kpnl_fwd, SEQ ID NO: 1 ) and oDaS231 (dHax_hom_Notl_His6_rev, SEQ ID NO: 2) and cloned into the Kpnl and Eagl sites of plasmid pET32a-TRX (Addgene plasmid 11516).
  • E. coli BL21 (DE3) Gold was transformed with pET_TRX_TAL1257_short, pET_TRX_TAL1258_short or pET_TRX_TAL1297_short and a single clone was picked and was grown overnight in Luria Broth (LB) media supplemented with 50 g/ml carbenicillin at 37 °C and 200 rpm shaking. This culture was diluted 50-fold into LB medium supplemented with 50 g/ml carbenicillin and the culture was incubated at 37 °C and 200 rpm shaking until an OD600 of -0.6 was reached.
  • LB Luria Broth
  • Protein expression was induced with 1 mM IPTG and the culture was harvested after 3 h of incubation by centrifugation (10 min, 3320 x g, room temperature). The pellet was lysed with B-Per lysis reagent (Thermo Scientific) containing 1x complete (-EDTA) protease inhibitors (Roche) and shaking at room temperature at 1400 rpm for 20 min. The suspension was pelleted by centrifugation (5 min, 20817 x g, room temperature) and the supernatant was discarded. Protein was extracted from pellet under denaturing conditions and bound to Ni-NTA (Qiagen) according to the manufacturer's protocol.
  • B-Per lysis reagent Thermo Scientific
  • -EDTA 1x complete protease inhibitors
  • TALE proteins Purity and quantity of TALE proteins was analyzed by SDS PAGE and staining with Gelcode blue (Thermo Scientific) ( Figure 9) and a BCA assay (Pierce) and proteins were stored in aliquots at -80 °C in TALE storage buffer including 0.1 mg/ml bovine serum albumin (BSA, New England Biolabs). Electromobility Shift Assays.
  • Oligonucleotides 97_C2/5/6/1 1 /12/14 mC_rev (SEQ ID NO: 5) and 97_T3/4/8/9/10/16 mC_rev (SEQ ID NO: 8) were 5 ' - 32 P-end labeled using ⁇ - 32 ⁇ - ATP and T4 polynucleotide kinase (Fermentas) and purified using a G-25 gel filtration column (GE Healthcare).
  • TALE proteins with various RVDs at position 5 were added in 6 ⁇ TALE storage buffer (200 mM NaCI, 20 mM Tris-HCI (pH 7.5), 1 mM DTT, 10 % glycerol) at varying concentrations and mixtures were incubated at room temperature for 30 min. 12 ⁇ of a mixture of 25 mU Klenow Fragment of E.
  • primer extension reactions were conducted as above with primer Bio-p97_rev (SEQ ID NO: 15) replacing 5 ' -32P-radiolabelled primer p97_rev. Reactions were quenched with 12 pL of 20 mM EDTA. Mixtures were diluted with water to 500 pL and 10 pL of streptavidin-agarose beads (Sigma- Aldrich, pre-incubated 4 h in 20 mM NaOH) were added. Suspensions were shaken for 30 min and agarose beads were washed 4 times with 20 mM NaOH, 2 times with water and 2 times with PBS buffer (each 00 pL).
  • streptavidin agarose was used in a 400-fold excess of biotin binding sites over molecules of added primer.
  • agarose beads were diluted in PBS to contain 1/10 5 of above primer extension reactions in 10 pL of bead suspension.
  • PCR reactions (50 pL) were conducted with using 25 pL GoTaq qPCR Master Mix containing BRYT Green dye, 200 nM of each primer qp97_fwd (oGrK_621 , SEQ ID NO: 16) and primer qp97_rev (oGrK_622, SEQ ID NO: 17) and 10 ⁇ _ of above diluted bead suspension in a BioRad i-Cycler with filters FAM-490 using the following program: 2 min 95 °C, then 60 cycles of 0:15 min 95°C, 1 :00 min 60 °C. Reproduction experiment to obtain standard deviations of CT values included the complete experimental procedure starting from primer extension reactions.
  • Example 1 It was aimed to get deeper insights into the binding of TALE proteins to C and C and to exploit it for the development of a methodology for programmable, locus- specific 5m C-detection.
  • TALE_97 was designed and expressed, a construct targeting a 17 nt sequence of the zebrafish (Danio rerio) hey2 gene derived from a natural TALE scaffold from Xanthomonas axonopodis.
  • To evaluate the general discrimination ability of TALE_97 its binding to DNA containing its target sequence ("97", Figure 4B) with either C or 5m C at six scattered positions opposite six NG or HD RVDs was analyzed in electromobility shift assays (EMSA, Figure 4C).
  • Example 1 Next it was investigated whether the discrimination found in Example 1 could be exploited for sensitive and highly resolved 5m C-detection. For that purpose, it was aimed to couple TALE-binding to DNA replication by DNA polymerase. Newly synthesized DNA molecules with defined sequence could then provide a signal for 5m C-modification that can be quantitatively detected by selective and sensitive analysis techniques. Though TALEs and DNA polymerases generally recognize DNA differently, i.e. through the opposing major and minor grooves, they directly and indirectly compete for phosphate- and nucleobase-interactions, and induce differential conformations in bound DNA. TALEs could thus indeed be able to control DNA polymerase-catalyzed DNA synthesis by inhibitive binding (Figure 5A).
  • a 79 nt DNA oligonucleotide template consisting of a region of the hey2 gene with sequence 97 ( Figure 4B) at the 3 ' -terminus (t97) was hybridized with a reverse complement, 5 ' -32P-labelled primer (p97_rev) and the complex incubated with or without 100 equivalents of TALE_97. Then dNTP and the Klenow fragment of E. coli DNA polymerase I (3 ' -5 ' -exo-, KF-) was added, the mixture incubated and subsequently resolved by denaturing polyacrylamide gel electrophoresis (PAGE). Primer extension was observed when TALE_97 was absent, but was completely abolished in its presence ( Figure 5B, lanes 1-2), indicating that this protein is indeed an effective inhibitor of KF-catalyzed DNA synthesis.
  • TALE_57 and _58 Two additional TALEs based on the identical scaffold as used for TALE_97 were constructed and expressed (TALE_57 and _58). These recognize sequences in the hey2 gene adjacent to sequence 97 and in the gria3a gene of zebrafish, respectively, that are both absent from t97. Primer extension reactions were performed using templates t97 and t97_C6 mC in presence of either TALE_97, _57, or _58 ( Figure 5C).
  • TALE_97 still effectively discriminated against the single 5m C position ( Figure 5C, lanes 1-2), and the presence of either TALE_57 or _58 did not reduce primer extension, regardless of the presence of C or 5m C in the template ( Figure 5C, lanes 3-6). This indicates that inhibition of KF- by TALEs is indeed sequence- selective.
  • Example 5
  • Example 6 DNA-associated, 5m C-dependent processes are not only controlled by the status but also by the level of 5m C-modification. An ideal 5m C-detection method should thus allow analysis of this parameter.
  • Primer extension reactions were performed with TALE_97 and mixed t97 and t97_C6 mC templates, resulting in 5m C- modification levels between 0 and 100 % in increments of 10 % ( Figure 6C). Over the complete range, the dependence of primer extension product formation on the 5m C-modification level of the single analyzed nucleotide position was strictly linear (Figure 6C). This offers highly resolved, quantitative analysis.
  • an 5m C-detection method should offer high robustness towards the presence of excess genomic DNA (gDNA).
  • Primer extension reactions were performed as above in presence of salmon sperm gDNA (up to a viscosity limit of a 3 x 10 4 -fold mass excess over primer) during the hybridization step. Above 3 x 10 2 , no full- length primer extension product was obtained (Figure 7), suggesting masking of KF- activity.
  • Figure 6D shows masking of KF- activity.
  • Figure 6D From an amount of 5 units per reaction, both primer extension and high 5m C-discrimination were fully restored (a similar result was obtained by increasing the primer extension time, Fig. 7).
  • This high robustness towards the presence of gDNA offers promising perspectives for a direct application with complex biological samples.
  • Example 8 To test, if the chosen signaling strategy would provide high sensitivity, it was aimed to read out primer extension products by qPCR. Reactions with templates t97 and t97_C6 mC were repeated as above using a 5 ' -biotin labeled primer (Bio- p97_rev). Subsequently, the reactions were incubated with an excess of streptavidin-agarose beads and non-biotinylated template removed by extensive washing with 20 mM NaOH. Then, 1/10 5 of the beads were used in a qPCR experiment using generic fluorescence signaling with primers targeting the hey2 sequence that was expected to be present in the primer extension products.
  • a 5 ' -biotin labeled primer Bio- p97_rev
  • TALE_037 and TALE_038 were assembled providing RVD N* or NG respectively opposite of C6 in the target sequence.
  • Primer extension reactions were performed as above with a TALE : target DNA ratio of 50:1 with templates containing 5hm C, 5m C or C at position 6.
  • NG RVD limited inhibition of primer extension was observed for 5hm C modified and unmodified DNA and stronger inhibition for DNA containing 5m C at position 6, indicating that TALE_038 provides ability for discrimination of 5hm C/C and 5m C ( Figure 14 lanes 4-6).
  • IC 50 (C) 60 ⁇ 4 nM
  • IC 50 (mC) 51 ⁇ 2 nM
  • Figure 15C a reduction in primer extension efficiency for target DNA containing 5hm C at position 6 to 50 % was observed at an approximate TALE concentration of 1500 nM, confirming highly effective 5hm C and 5m C/C discrimination.
  • TALE proteins that enables the detection of a chemical DNA modification with high resolution.
  • the methodology offers the direct, conversion-free detection of the status and level of 5m C- modification in a strand-specific manner, at single nucleotide positions and with excellent resolution ( ⁇ 10 % of the 5m C-modification level).
  • TALEs provide sufficient sequence-selectivity to be applicable in large, eukaryotic genomes and at the same time are not known to exhibit inherent sequence constraints. Combined with the universal process of enzymatic DNA synthesis as signal output, this flexibility should result in a high scope of applicable target sequences.
  • the signaling strategy should enable the combination with quantitative and sensitive DNA analysis techniques that offer throughputs beyond the one of qPCR, e.g. microarrays and next generation sequencing.
  • the availability of endogenous, programmable proteins that exhibit 5m C- sensitive DNA-binding and repressive function opens up exciting perspectives to detect 5m C directly in living cells and to regulate DNA-associated processes distinct from DNA replication.
  • t97_C2- mC (oGrK_515): TGG ATT CCC ACT CTT CAG CCC CAG CGT TAC AGC ATC TTC AGT GGC TTC TTC CAC CGT GAG CTC TTC CGT TTC CAC ATC C
  • t57_C13 ⁇ mC (oGrK_792): ACA TTT AAA TCC AAC ATT TAA AAC GCT CCC ACT TCA GTT CCC CAC GGT CGG TAT GGT TTA CTG CTG CTC CCG CT

Landscapes

  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Health & Medical Sciences (AREA)
  • Biophysics (AREA)
  • General Engineering & Computer Science (AREA)
  • Immunology (AREA)
  • Microbiology (AREA)
  • Molecular Biology (AREA)
  • Analytical Chemistry (AREA)
  • Physics & Mathematics (AREA)
  • Genetics & Genomics (AREA)
  • Biochemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biotechnology (AREA)
  • General Health & Medical Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)

Abstract

The present invention relates to methods for the differentiation of a 5-hydroxymethyl modification of a cytosine residue of interest in a nucleic acid molecule from (i) a 5-methyl modification of said cytosine residue of interest o,r (ii) said unmodified cytosine residue of interest, said methods making use of the capability of transcription-activator-like effector (TALE) proteins to preferentially bind with strong affinity to nucleic acid sequences containing non-modified cytosine residues or 5-methyl modified cytosine residues, and to bind, if at all, with only strongly reduced affinity to nucleic acid sequences containing 5-hydroxymethyl modified cytosine residues. The present invention further relates to respective uses of TALE proteins for the differentiation of a 5-hydroxymethyl modification of a cytosine residue of interest in a nucleic acid molecule from (i) a 5-methyl modification of said cytosine residue of interest or (ii) said unmodified cytosine residue of interest.

Description

Direct, programmable detection of epigenetic DNA cytosine modifications
using TAL effectors
The present invention relates to methods for the differentiation of a 5-hydroxymethyl modification of a cytosine residue of interest in a nucleic acid molecule from (i) a 5-methyl modification of said cytosine residue of interest or (ii) said unmodified cytosine residue of interest, said methods making use of the capability of transcription-activator-like effector (TALE) proteins to preferentially bind with strong affinity to nucleic acid sequences containing non-modified cytosine residues or 5-methyl modified cytosine residues, and to bind, if at all, with only strongly reduced affinity to nucleic acid sequences containing 5-hydroxymethyl modified cytosine residues. The present invention further relates to respective uses of TALE proteins for the differentiation of a 5-hydroxymethyl modification of a cytosine residue of interest in a nucleic acid molecule from (i) a 5-methyl modification of said cytosine residue of interest or (ii) said unmodified cytosine residue of interest.
5-Methylcytosine (5mC, Fig. 1 ) is an essential epigenetic DNA modification that acts as an important factor in the silencing of genes. It has important roles in the regulation of gene expression, genome stability and disease including neurological disorders and various cancer types. In recent years, with the development of epigenetics, high importance has been attached to the selective detection of 5mC in genes, given the strong correlation of this genetic modification with various aspects of gene control, such as gene regulation, genomic imprinting, and X chromosome inactivation, among other effects. It has been reported that a high level of 5mC at CpG islands within promoters and the global hypomethylation of genomic DNA, which induces gene instability, can produce the activation of oncogenes and the high occurrence of various diseases. Thus, methods for the direct assessment of the 5mC level and status in genes with high resolution at user-defined genomic loci are of broad interest for diagnosis and therapy, e.g. for the early detection and treatment of many tumors. However, because of the subtle differences between the respective nucleotides containing C or 5mC (i.e. deoxycytidine (dC) and 5-methyl-2'-deoxycytidine (5mdC)), distinguishing 5mdC from dC is a difficult and challenging task.
5-Hydroxymethylcytosine ( C. Fig. 1 ) was first discovered in the bacteriophages T2, T4 and T6 in 1952. The presence of it in mammalian DNA was suggested not until twenty years later, but has received only little scientific attention. In 2009, 5-hydroxymethyIcytosine was detected in cerebellar Purkinje neurons in the brain. Simultaneously, 5-hydroxymethylcytosine was reported to be present in mouse embryonic stem cells and human embryonic kidney cells. The TET1 (ten-eleven translocation 1 ) protein, a fusion partner of histone methyltransferase in acute myeloid leukemia, was identified as a 2-oxoglutarate- and Fe(ll)-dependent enzyme that catalyses the conversion of 5-methylcytosine to 5-hydroxymethylcytosine in vitro, as well as in cultured cells. Moreover, it has been shown that prokaryotic cytosine-5 methyltransferases were able to produce 5-hydroxymethylcytosine by reversible addition of formaldehyde to cytosine. It was supposed that 5-hydroxymethylcytosine is formed at 5-methylcytosine sites in response to oxidative stress. Further, it has been speculated that 5-hydroxymethylcytosine together with 5-formyldeoxycytosine could be one of the main oxidative degradation products of 5-methylcytosine.
The human body consists of over 200 different cell types with diverse functions, yet with almost identical genomes. This phenotypic diversity is determined by differences in gene expression profiles. Central regulatory elements of gene expression are epigenetic DNA modifications that affect local transcriptional activity of the genome by controlling chromatin structure. In contrast to other, rather transient regulatory elements, epigenetic DNA modifications can be preserved or regenerated during cell division, resulting in inheritable imprinting of regulatory states. Among these, methylation of DNA cytosine (C) residues in CpG dinucleotides at the carbon 5-position (5-Methylcytosine, 5mC or mC, Fig. 1 , Fig. 16) is the most common modification in vertebrates.
Key to the epigenetic regulation of gene expression is the introduction (methylation, "writing") and removal (de-methylation, "erasing") of methyl-groups. However, while the process of DNA methylation catalyzed by DNA methyltransferases (Dmnt) is well characterized, the process of de-methylation is not and the enzymes that are involved in this process have long remained elusive. As stated above, ten-eleven translocation (TET) family dioxygenases have recently been discovered to oxidize mC to 5-hydroxymethylcytosine (5hmc or hmC, Fig. 1 , Fig. 16). hmC is now recognized as key intermediate of mC de-methylation that can either be passively depleted through DNA replication or actively reverted to C, e.g. through iterative oxidation to 5-formylcytosine (fC) and 5-carboxylcytosine (caC) and thymine DNA glycosylase (TDG)-mediated base excision repair (BER, Fig. 16). Methylation, oxidation and repair now offer a model for the long searched, complete cycle of dynamic cytosine modification, with paramount importance for cell development, differentiation, and the onset of diseases including cancer.
In fact, numerous studies have revealed alterations in mC modification patterns between normal and cancer cells that affect transcriptional up- or down-regulation of oncogenes and tumor-suppressor genes, respectively. These data include examples from all classes of human neoplasia and have highlighted the existence of a unique profile of mC that defines each type of cancer. It has thereby been shown that aberrant mC patterns occur early in tumorigenesis, with implications for early detection of cancer. Consequently, mC has become an important biomarker for a large number of cancer tissues. For example, typing promoter methylation in the glutathione S-transferase P1 (GSTP1 ) and 06-methylguanine- DNA methyltransferase (MGMT) genes in prostate cancer and glioma provides excellent perspectives for diagnosis and for determining appropriate therapies.
Importantly, hmC, besides being a de-methylation intermediate, is increasingly recognized to have inherent biological functions on its own, indicated by its unique cell-type specific occurrences, genomic distribution patterns and impact on the binding ability of DNA-binding proteins (in contrast, fC and caC are significantly less abundant and their potential biological roles have yet to be discovered). Indeed, recent studies established hmC and aberrant TET dioxygenase activity as novel biomarkers for various cancers that exhibit large, wide-spread differences in normal and cancer tissue. Moreover, editing of the hmC-landscape in melanoma cells has been shown to even result in suppression of melanoma growth and to increase tumor-free survival in animal models. These data illustrate the considerable potential of mC/hmC analysis as novel approaches for cancer diagnosis.
To date, several initiatives have attempted to address the challenge of 5mC detection by indirect detection strategies. Chemical methods involving the conversion of either C or 5mC residues in DNA have been proposed. For instance, the Maxam-Gilbert chemical modification was applied to identify the 5mC residues indirectly by means of the interference of the methyl group in the reaction with hydrazine. Moreover, OsO4 has been assessed as a potential reagent for differentiating between 5mC and C since OsO4 reacts differently to the distinct nucleophilicities of the double bonds in 5mC and C. However, the Os04 technique cannot address situations involving the oxidation of thymidines. Other combinations, such as the V2Os/LiBr or NalO^LiBr pairings and N-Halogeno-N- sodiobenzenesulfonamide reagents, have partially solved the aforementioned detection difficulties, but the sensitivity of these assays requires additional improvement.
Various methods based on indirect detection of 5mC after conversion of the sample DNA with bisulfite have been developed and are currently the gold standard. These include methyl-specific PCR (MSP), bisulfite Sanger sequencing, pyrosequencing and next-generation sequencing, microarray-based methods and others. However, bisulfite treatment is time-consuming and cumbersome, can harm the sample and results in reduction of sequence complexity, which complicates analysis. Further, direct approaches based on enzymatic reactions and/or selective binding have been developed utilizing a range of methyl-CpG- binding domains, antibodies or restriction enzymes, but these suffer from the poor modularity and constraints of sequence recognition of employed proteins and are thus neither flexible nor specific for single target sites. Furthermore, even the single molecule real time sequencing (SMRT) technique, which can directly detect DNA methylation without bisulfite conversion, possesses the problem of a high error rate and is technically extremely demanding.
The paramount importance of dynamic, epigenetic modification of cytosine has created a considerable need for methods that can delineate both regional patterns (typing) and broader profiles (profiling) of C-modification in genomes. These have important implications for understanding why specific regions of a genome can be expressed in different developmental contexts and how epigenetic changes enable aberrant expression patterns and the onset of disease. In particular, the identification of a vast number of mC positions as cancer biomarkers (and the emerging role of hmC in the same context) has opened excellent perspectives for cancer diagnosis, prognosis and the determination of suited therapies in mass applications.
Consequently, a large number of different C-modification typing and profiling assays have been developed. These however rely on only few, highly limited and complicated strategies to address the molecular key step of any such approach, which is the differentiation of the nucleobases C, mC and hmC. These limitations arise from the inferior analytic accessibility of epigenetic C-modifications compared to modifications of the DNA sequence itself: unlike DNA sequence information that can be reliably amplified, transcribed or cloned, DNA epigenetic information is erased by such molecular biology techniques, and it is not revealed by Watson-Crick-hybridization. Therefore, C-modification-dependent pretreatments of DNA were developed for differentiation. After genomic DNA has been treated, various molecular biology techniques including qPCR and DNA sequencing can be used to reveal the location of C-modifications.
A major group of differentiation approaches is based on chemical conversion, i.e. on the selective deamination of C (but not mC/hmC) with bisulfite and subsequent analysis of the resulting C to uridine (U) mutation. This can be coupled with additional conversion steps to achieve a partial selectivity between C, mC and hmC. For example, oxidation with KRuO4 converts hmC to fC, whereas mC remains unchanged. fC is converted to U in bisulfite treatments, and thus hmC and mC can be indirectly differentiated in comparative assays. Alternatively, hmC can be glycosylated and then reads as C after bisulfite treatment. If this is coupled with an oxidation step using a TET dioxygenase, all other C-modifications will be oxidized to caC and then read as U after bisulfite treatment.
Though bisulfite-based approaches have been widely used since more than 20 years, they suffer from severe drawbacks: Despite extensive optimization efforts, the conversion is still laborious and time-consuming (i.e. 4-16 h without subsequent DNA purification). The applied conditions are harsh and can lead to the destruction of -95% of the sample DNA. Moreover, the sequence complexity of the sample is widely reduced to only three nucleotides (A, G, U(T)), because of the C to U conversion. This strongly reduces the selectivity of Watson-Crick hybridization (e.g. in PCR, sequencing or microarrays) and consequently often requires tedious optimization of downstream analyses. Moreover, the reduction interferes with bio-informatic alignments. These drawbacks prevent in vivo applications and severely complicate the development of straightforward cancer diagnostic assays.
A second group of differentiation approaches relies on proteins that bind (and potentially modify) C-modifications directly, i.e. without chemical conversion. However, proteins that are currently employed for this (e.g. antibodies, restriction enzymes, β-glucosyltransferase) exhibit no or constraint sequence-selectivity. This prevents their use for direct, locus-specific differentiation and thus they require the coupling to sequence-selective downstream analyses.
As a third group of differentiation approaches, protein nanopores and DNA polymerases have recently been introduced. These act as "processive readers", i.e. they offer the direct and combined analysis of DNA sequence and C-modifications in a processive manner. However, though highly appealing for sequencing, these approaches are technically demanding and restricted to single molecule techniques in vitro. Moreover, they require DNA pretreatments for high confidence analysis. ln fact, none of the available approaches provides inherent, programmable sequence selectivity. This severely complicates in vitro analyses and does not provide perspectives for in vivo applications, since it is not possible to directly differentiate C and C-modifications at user-defined genomic loci.
In view of the aforementioned problems with traditional detection methods, it is vitally important to develop rapid and sensitive methods for the direct, accurate detection of cytosine 5-modifications such as 5mC and 5hmC in nucleic acid molecules at user-defined genomic loci.
Accordingly, the technical problem underlying the present invention is to provide improved methods for the differentiation of a 5-hydroxymethyl modification of a cytosine residue of interest in a nucleic acid molecule from (i) a 5-methyl modification of said cytosine residue of interest or (ii) said unmodified cytosine residue of interest, wherein said methods should not compromise the integrity of the nucleic acid molecule and should be fast, easy, sequence- and locus-specific and highly sensitive.
The solution to the above technical problem is achieved by the embodiments characterized in the claims.
In particular, in a first aspect, the present invention relates to a method for the differentiation of a 5-hydroxymethyl modification of a cytosine residue of interest in a nucleic acid molecule from
(i) a 5-methyl modification of said cytosine residue of interest or
(ii) said unmodified cytosine residue of interest,
said method comprising the steps of:
(a) providing a transcription-activator-like effector (TALE) protein, said TALE protein being capable of binding in a sequence- and locus-specific manner to a region of said nucleic acid molecule that includes said cytosine residue of interest; and
(b) determining whether said TALE protein binds to said region; wherein
(i) a 5-hydroxymethyl modification of said cytosine residue of interest is present when said TALE protein does not bind to said region or does bind to said region with a strongly reduced affinity, and
(ii) a 5-methyl modification of said cytosine residue of interest or said unmodified cytosine residue of interest is present when said TALE protein binds to said region.
In preferred embodiments of the method of the present invention, the repeat variable diresidue (RVD) of said TALE protein whose position corresponds to the position of the cytosine residue of interest is a sized reduced RVD. As used herein, the term "sized reduced RVD" relates to RVDs that are sterically smaller in size than RVDs having an average steric size. In particular, size reduced RVDs can have a deletion of 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acids. Preferably, size reduced RVDs comprise RVDs X*, wherein X is any proteinogenic amino acid, preferably the RVDs H* and N*, wherein N* is particularly preferred (* = aa deletion).
According to the present invention, a 5-hydroxymethyl modification of a cytosine residue of interest can be differentiated from (i) a 5-methyl modification of said cytosine residue of interest or (ii) said unmodified cytosine residue of interest without the need for any pretreatment or exogenous chemical modification of the nucleic acid molecule. Accordingly, the method of the present invention is significantly less time-, labor- and cost-intensive compared to methods known in the art relying on pretreatments or exogenous chemical modification of the nucleic acid molecule. Moreover, the method of the present invention is highly sensitive and thus allows the detection with high resolution, i.e. differentiation of the modification at single cytosine sites. Finally, the method allows the differentiation at user-defined sites, owing to the programmability of sequence recognition of TALE proteins that exceeds the programmability of any other known protein.
The term "differentiation" as used herein indicates the fact that the method of the present invention allows to determine whether a particular cytosine residue of interest is (i) 5-hydroxymethyl modified, or (ii) 5-methyI modified or unmodified. In particular, binding of the TALE protein to the region of said nucleic acid molecule that includes said cytosine residue of interest indicates that said cytosine residue of interest is 5-methyl modified or unmodified, whereas lack of binding or binding with a strongly reduced affinity indicates that said cytosine residue of interest is 5-hydroxymethyl modified.
According to the present invention, the nucleic acid molecule may be single- stranded or double-stranded. In a preferred embodiment, the nucleic acid molecule is a DNA molecule, more preferably a double-stranded DNA molecule. Further, in accordance with the above, in a preferred embodiment, said nucleic acid molecule is in its native state and is not chemically modified by any pretreatment.
The cytosine residue modifications described herein are physiological cytosine modifications known in the art. In particular, said modifications are 5-methylation or 5-hydroxymethylation of said cytosine residue. Respectively modified cytosine residues are labeled herein as 5mC or mC for 5-methylcytosine, and as 5hmC or hmC for 5-hydroxymethylcytosine.
The term "cytosine residue of interest" as used herein points to the fact that with the method of the present invention, any particular cytosine residue in a given nucleic acid molecule can be analyzed for differentiating the modification of said particular residue. This is achieved by providing a TALE protein in step (a) of said method which is capable of binding in a sequence- and locus-specific manner to a region of said nucleic acid molecule that includes said cytosine residue of interest.
In this context, TALE proteins (TALEs) to date represent the protein scaffold with the highest modularity and flexibility of sequence- and locus-specific nucleic acid recognition. They consist of concatenated single modules that each recognize one nucleotide in the target nucleic acid. These modules can be flexibly connected to recognize any arbitrary nucleic acid sequence of interest. The recognition is achieved by only two amino acid residues (repeat variable diresidue, RVD) within each module, providing a "code" of recognition. The most widely used TALE codes are NG for T, Nl for A, NN, NK, NH and HN for G and HD for C. RVD HD interacts with C through a hydrogen bond between the aspartate carboxyl group and the nucleobase 4-amino group. It has been shown that the 5-methylation or 5-hydroxymethylation status of C influences the binding of modules containing the HD code, i.e. affinity is strongly reduced, when a modified C instead of an unmodified C is present in the target sequence.
As indicated above, TALEs consist of concatenated modules, each of which recognizes a canonical nucleobase in DNA and this recognition mode is fully programmable. Certain natural or designed TALE modules provide selectivity for mC or hmC and can also provide universality of binding several C-modifications. This makes TALEs the first molecules that hold potential for the direct, fully programmable differentiation of individual C-modifications both in vitro and in vivo. This offers considerable simplifications and performance improvements for typing/profiling in vitro as compared to current approaches.
TALE proteins have recently been discovered as a new scaffold for the design of DNA binding domains with programmable sequence selectivity. Besides fixed N- and C-terminal domains, TALEs feature a central DNA-binding domain that consists of concatenated, interchangeable modules each of which recognizes one of the four canonical DNA nucleotides. These modules consist of 34 amino acids (aa) arranged in two a-helices connected by a small loop. Most of these aa are highly conserved, whereas two aa of the loop are variable (the repeat variable diresidue, RVD) and are responsible for selective nucleobase binding. In the majority of natural TALEs, aa 12 (numbering in the module) is an H or N residue (one-letter aa code) that makes a stabilizing intra-loop hydrogen bond. The second residue (aa 13) makes a specific contact to the edge of the nucleobase through the major groove of the DNA duplex. This results in a winding of the TALE into the DNA groove, forming a super-helical structure, where consecutive TALE modules bind all nucleotides of the forward DNA strand. The nucleotide recognition by TALE RVDs follows a simple code, with the RVDs Nl, NN, HD and NG binding the nucleotides A, G, C, and T, respectively. The programmability of TALEs by facile concatenation of individual modules has extensively been proven in various sequence contexts and does not exhibit pronounced context dependencies or sequence constraints.
This fully programmable and selective recognition of canonical nucleobases by TALEs allows the selective recognition of epigenetically modified nucleobases, i.e. C-modifications. This provides a simultaneous, programmable recognition of both DNA sequence and epigenetic C-modification state and thus supersedes any pretreatments that are currently required for differentiation of C-modifications. Indeed, reduced DNA-binding of TALEs is seen at mC- or hmC-containing target sequences.
Interestingly, RVD NG binds mC better than C, and size reduced RVDs, in particular RVD N* (* = aa deletion), bind C and mC with comparable affinities. This demonstrates that it is possible to design universal TALE modules that are able to ignore certain C-modifications at user-defined positions of a target. The present invention further expands this concept from mC to hmC. In particular, a strong differentiation between hmC and mC/C by size reduced RVDs, in particular RVD N*, and between hmC/C and mC by RVD NG was discovered.
More specifically, the 5-hydroxymethylation status of C influences the binding of modules containing size reduced RVDs, in particular the N* code, i.e. affinity is strongly reduced when hmC instead of unmodified C or mC is present in the target sequence. This shows for the first time that TALE modules can be designed that enable differentiation not only between C and mC, but between all three targeted C-modifications including the fully selective sensing of hmC according to the present invention. In fact, TALEs containing designer TALE modules with size reduced RVDs, in particular with RVD H* and/or N* represent the first programmable readers for the selective sensing of hmC.
Thus, in the method of the present invention, TALE proteins can be designed that are capable of binding in a sequence- and locus-specific manner to a region of said nucleic acid molecule that includes said cytosine residue of interest. In this context, the term "capable of binding in a sequence- and locus-specific manner to a region of said nucleic acid molecule that includes said cytosine residue of interest" as used herein relates to the fact that the TALE protein is capable of binding to said region in case the cytosine residue of interest is not modified or 5 5-methyl modified. In other words, said term relates to the fact that the TALE protein's sequence specificity is directed to the nucleotide sequence of said region wherein the cytosine residue of interest is not modified or 5-methyl modified. In a preferred embodiment, the region to which said TALE protein is capable of binding in a sequence-specific manner is from 10 to 30 nucleotides in length, more 10 preferably from 12 to 28 nucleotides in length, and most preferably from 14 to 24 nucleotides in length. Modification of said cytosine residue by 5- hydroxymethylation strongly reduces the affinity of the binding of said TALE protein to said region. Methods for the design and expression of TALE proteins are not particularly limited and are known in the art.
Ί 5
In this context, it should be noted that under certain conditions, TALE proteins can bind to a nucleic acid molecule containing a cytosine residue that is 5-hydroxymethyl modified, although with a strongly reduced affinity as compared to the binding to the same nucleic acid molecule containing a cytosine residue that
20 is not modified or 5-methyl modified. Therefore, in a preferred embodiment, step (b) of the method of the present invention is performed under conditions that (i) do not allow the binding of the TALE protein to the nucleic acid molecule containing a 5-hydroxymethyl modified cytosine residue, but (ii) allow the binding of the TALE protein to the nucleic acid molecule containing a cytosine residue that is not
25 modified or 5-methyl modified. Respective conditions are known and can be chosen by the person skilled in the art.
The term "strongly reduced affinity" as used herein relates to the effect described above, i.e. that TALE proteins bind to a nucleic acid molecule that does not 0 contain a modified cytosine residue or contains a 5-methyl modified cytosine residue with a first affinity, and bind, if at all, to the same nucleic acid molecule wherein said cytosine residue is 5-hydroxymethyl modified with a second affinity, wherein said second affinity is strongly reduced as compared to said first affinity. Preferably, said second affinity is 20%, more preferably 10%, more preferably 5%, more preferably 2%, and most preferably 1 % or less of said first affinity.
Methods for determining whether the TALE protein binds to said region or does not bind to said region or does bind to said region with a strongly reduced affinity are not particularly limited and are known in the art. In this context, said methods are preferably performed at conditions that (i) do not allow the binding of the TALE protein to the nucleic acid molecule containing a 5-hydroxymethyl modified cytosine residue, but (ii) allow the binding of the TALE protein to the nucleic acid molecule containing a cytosine residue that is not modified or a cytosine residue that is 5-methyl modified. Respective conditions are known and can be chosen by the person skilled in the art.
In a preferred embodiment, the method of the present invention further comprises the step of:
(c) detecting a 5-hydroxymethyl modification of said cytosine residue of interest, wherein
(i) said modification is present when said TALE protein does not bind to said region or does bind to said region with a strongly reduced affinity, and
(ii) said modification is absent when said TALE protein binds to said region,
said method allowing for the direct detection of a 5-hydroxymethyl modification of said cytosine residue of interest in said nucleic acid molecule.
As used herein, the terms "direct detection" or "directly detecting" relate to the fact that with the method of the present invention, 5-hydroxymethyl modification of a cytosine residue of interest in a nucleic acid molecule can be detected without the need for any pretreatment or exogenous chemical modification of the nucleic acid molecule.
In a preferred embodiment, step (b) of the method of the present invention comprises the step of determining whether a specific DNA polymerase reaction using a primer that is capable of binding to the region of said nucleic acid molecule that includes said cytosine residue of interest is inhibited, thus indicating binding of said TALE protein to said region, said method allowing for the direct detection of a 5-hydroxymethyl modification of said cytosine residue of interest in said nucleic acid molecule. In this context, binding of the TALE protein to a nucleic acid molecule containing a cytosine residue that is 5-hydroxymethyl modified, i.e. binding with a strongly reduced affinity, does not inhibit the above specific DNA polymerase reaction using a primer that is capable of binding to the region of said nucleic acid molecule that includes said cytosine residue of interest. More preferably, step (b) of the method of the present invention comprises the steps of: (b1 ) providing a primer that is capable of binding to the region of said nucleic acid molecule that includes said cytosine residue of interest;
(b2) adding said TALE protein to a first aliquot of the nucleic acid molecule;
(b3) performing a first specific DNA polymerase reaction with said primer using said first aliquot of the nucleic acid molecule as template, and performing a second specific DNA polymerase reaction with said primer using a second aliquot of the nucleic acid molecule as template to which no TALE protein has been added;
(b4) determining at least one parameter, selected from the group consisting of the concentration, size, and sequence of each of the products of said first and second specific DNA polymerase reaction; and
(b5) determining whether said TALE protein binds to said region, wherein
(i) said TALE protein does not bind to said region or does bind to said region with a strongly reduced affinity when the parameter detected in step (e) for the first specific DNA polymerase reaction does not differ significantly from the parameter detected in step (e) for the second specific DNA polymerase reaction, and
(ii) said TALE protein binds to said region when the parameter detected in step (e) for the first specific DNA polymerase reaction differs significantly from the parameter detected in step (e) for the second specific DNA polymerase reaction. ln this context, in a particularly preferred embodiment, the method of the present invention comprises the steps of:
(a) providing a transcription-activator-like effector (TALE) protein, said TALE protein being capable of binding in a sequence- and locus-specific manner to a region of said nucleic acid molecule that includes said cytosine residue of interest;
(b1 ) providing a primer that is capable of binding to the region of said nucleic acid molecule that includes said cytosine residue of interest;
(b2) adding said TALE protein to a first aliquot of the nucleic acid molecule;
(b3) performing a first specific DNA polymerase reaction with said primer using said first aliquot of the nucleic acid molecule as template, and performing a second specific DNA polymerase reaction with said primer using a second aliquot of the nucleic acid molecule to which no TALE protein has been added as template;
(b4) determining at least one parameter, selected from the group consisting of the concentration, size, and sequence of each of the products of said first and second specific DNA polymerase reaction;
(b5) determining whether said TALE protein binds to said region, wherein
(i) said TALE protein does not bind to said region or does bind to said region with a strongly reduced affinity when the parameter detected in step (e) for the first specific DNA polymerase reaction does not differ significantly from the parameter detected in step (e) for the second specific DNA polymerase reaction, and
(ii) said TALE protein binds to said region when the parameter detected in step (e) for the first specific DNA polymerase reaction differs significantly from the parameter detected in step (e) for the second specific DNA polymerase reaction; and
(c) detecting said modification of said cytosine residue of interest, wherein
(i) said modification is present when said TALE protein does not bind to said region or does bind to said region with a strongly reduced affinity, and
(ii) said modification is absent when said TALE protein binds to said region. ln particularly preferred embodiments of this method, the repeat variable diresidue (RVD) of said TALE protein whose position corresponds to the position of the cytosine residue of interest is a sized reduced RVD, preferably the RVD H* or N*. In step (b2) of the method of the present invention, the TALE protein is added to the DNA molecules in a molar ratio of TALE protein to DNA of between 2:1 and 500:1 , more preferably of between 30:1 to 70:1 , more preferably of between 40:1 to 60:1 , and most preferably of 50:1. In step (b3) of the method of the present invention, two separate specific DNA polymerase reactions are performed with the primer of step (b1 ), the first one using said DNA molecule to which said TALE protein has been added as template, and the second one using said DNA molecule to which no TALE protein has been added as a template. In this context, it has been found that binding of a TALE protein to the region of DNA to which the primer binds abolishes the ability of a DNA polymerase to bind to the DNA-primer complex, thus inhibiting the elongation of the primer. Therefore, in case no modification of the cytosine residue of interest is present, or a 5-methyl modification of the cytosine residue of interest is present, the TALE protein binds to the DNA molecule in the first specific DNA polymerase reaction, thus inhibiting primer extension, whereas in the second specific DNA polymerase reaction, primer elongation occurs. Accordingly, in case a 5-hydroxymethyl modification of the cytosine residue of interest is present, the TALE protein does not bind to the DNA molecule or does bind to said molecule with a strongly reduced affinity in the first specific DNA polymerase reaction, and primer elongation can occur in the same manner as in the second specific DNA polymerase reaction. Suitable DNA polymerase reactions are not particularly limited and are known in the art. They include for example primer extension reaction, arrayed primer extension (APEX), polymerase chain reaction (PCR), rolling circle amplification (RCA) and strand displacement amplification (SDA).
In order to detect whether (i) primer elongation has occurred in both the first and second specific DNA polymerase reaction of step (b3), thus indicating the presence of a 5-hydroxymethyl modification of the cytosine residue of interest, or (ii) primer elongation has occurred only in the second specific DNA polymerase reaction but not in the first, thus indicating the absence of a modification of the cytosine residue of interest or the presence of a 5-methyl modification of said cytosine residue, at least one parameter, selected from the group consisting of the concentration, size (expressed as molecular weight or as chain-length), and sequence, of each of the products of said first and second specific DNA polymerase reaction is determined in step (b5) of the method of the present invention. Methods for the detection of the above parameters are not particularly limited and are known in the art. In a preferred embodiment, in step (b4) of the method of the present invention, (i) the concentration of the products of said first and second specific DNA polymerase reaction is determined using a method, selected from the group consisting of quantitative polymerase chain reaction (qPCR), fluorescence measurements using nucleic acid binding fluorescent probes, and photometry; and/or (ii) the size of the products of said first and second specific DNA polymerase reaction is determined using a method, selected from the group consisting of polymerase chain reaction (PCR), and gel electrophoresis; and/or (iii) the sequence of the products of said first and second specific DNA polymerase reaction is determined using a method, selected from the group consisting of Sanger sequencing, pyrosequencing, microarray hybridization, next-generation sequencing methods, and next-next-generation sequencing methods, including sequence-by-synthesis, sequencing-by-ligation, single molecule sequencing in zero-mode waveguides and nanopore sequencing.
In a particularly preferred embodiment, in step (b4) of the method of the present invention, the concentration of the products of said first and second specific DNA polymerase reaction is determined by qPCR, the primer of step (b1 ) is biotinylated, and said products are isolated prior to said step (b4) by a method, comprising the steps of:
(i) incubating said products with beads that are coupled to streptavidin;
(ii) removing non-biotinylated template by washing in a buffer that denatures nucleic acid duplexes; and
(iii) using said beads having the biotinylated products bound thereto in said qPCR. Respective methods of generating biotinylated DNA polymerase reaction products by using biotinylated primers, of isolating biotinylated products using beads that are coupled to streptavidin, and of removing nucleic acid duplexes are not particularly limited and are known in the art. In preferred embodiments, said primer is 5'-biotinylated, said beads are streptavidin-agarose beads, and the buffer used for washing is a buffer containing 20 mM NaOH.
In steps (b5) and (c) of the method of the present invention, the presence or absence of a 5-hydroxymethyl modification of the cytosine residue of interest is actually detected. This is based on the above finding that primer elongation in the first specific DNA polymerase reaction can only occur in case the TALE protein does not bind to the DNA molecule or does bind to said molecule with a strongly reduced affinity, i.e. in case a respective 5-hydroxymethyl modification is present. Thus, in this case the parameter determined in step (b4) will not differ between the first and second specific DNA polymerase reaction. In case a respective modification is not present or a 5-methyl modification is present, the TALE protein will bind to the DNA molecule, thus inhibiting primer elongation, so that the parameter determined in step (b4) will differ between the first and second specific DNA polymerase reaction. In this context, the term "differ significantly" as used herein relates to a difference of at least 10%, preferably at least 20%, at least 30% or at least 50%.
The method of the present invention can not only be used to gain a qualitative result concerning the presence or absence of a 5-hydroxymethyl cytosine modification, but also to gain a quantitative result concerning the degree of 5- hydroxymethyl cytosine modification. To this end, a calibration curve using nucleic acid molecules having a known degree of 5-hydroxymethyl cytosine modification can be established, and the degree of 5-hydroxymethyl cytosine modification of the nucleic acid molecule of interest can be determined by linear regression. Accordingly, in a preferred embodiment, the method of the present invention further comprises the steps of:
(d) comparing the parameter detected in step (b4) for the first specific DNA polymerase reaction to one or more respective parameters obtained from nucleic acid molecules having a known degree of 5-hydroxymethyl modification of the cytosine residue of interest; and
(e) thereby determining the degree of 5-hydroxymethyl modification of the cytosine residue of interest in the nucleic acid molecule.
According to the present invention, the TALE protein provided in step (a) of the method is designed in a way that the RVD whose position corresponds to the position of said cytosine residue of interest, i.e. the RVD that binds to the cytosine of interest in case said cytosine is not modified or is 5-methyl modified, is a size reduced RVD, in particular the RVD H* or N*. As size reduced RVDs, in particular the RVD H* or NT, have a high binding affinity to C and to mC, but a strongly reduced binding affinity to hmC, this allows the detection of hmC in accordance with the method of the present invention as defined above. The TALE proteins employed in the present invention do not only allow for the differentiation of 5-hydroxymethyl modified cytosine residues from unmodified or 5-methyl modified cytosine residues, but can also be used for a wide range of applications for the detection, manipulation, purification, and analysis of 5-hydroxymethyl modified cytosine residues in nucleic acids. To this end, said TALE proteins can be coupled to a variety of compounds, proteins, affinity ligands, and other moieties. Such "coupling moieties" are not particularly limited and can be easily chosen by a person skilled in the art in accordance with the particular application of interest. Examples of such moieties include fluorescent dyes, fluorescent proteins such as e.g. green fluorescent protein (GFP), affinity ligands such as e.g. biotin, digoxigenin, dinitrophenol, magnetic particles, antibodies, including antibody fragments and antibody mimetics known in the art, and protein tags, and proteins having enzymatic activities such as nuclease activities. Suitable protein tags in this respect include 18A-Tag, ACP-Tag, Avi-Tag, BCCP-Tag, Calmodulin-Tag (CaM-Tag), Chitin-binding-Protein-Tag (CBP-Tag), E-Tag, ELK16-Tag, ELP-Tag, FLAG-Tag, Flash-Tag, poly-glutamic acid-Tag, Glutathion- S-Transferase-Tag (GST-Tag), Green fluorescent protein-Tag (GFP-Tag), Hamagglutinin-Tag (HA-Tag), poly-Histidin-Tag (His-Tag), Isopeptag, Maltose binding protein-Tag (MBP-Tag), Myc-Tag, Nus-Tag, ProtA-Tag, ProtC-Tag, S-Tag, SBP-Tag, Snap-Tag, SpyTag, SofTag 1 and 3, Streptavidin-Tag (Strep-Tag), Strep-ll-Tag, Tandem Affinity Purification-Tag (TAP-Tag), TC-Tag, Thioredoxin- Tag (TRX-Tag), Ty-Tag, V5-Tag, VSV-Tag, and Xpress-Tag, which are known in the art. Such "coupling moieties" can be coupled directly or indirectly to the TALE protein, or can be expressed as part of conjugate proteins comprising also the TALE protein. Methods for the coupling of respective "coupling moieties" and for the expression of respective conjugates are not particularly limited and are known in the art. They include methods employing a His-Tag on the expressed conjugates and purification via NiNTA as known in the art.
Applications of respectively coupled TALE proteins are not particularly limited and can be easily devised by the person skilled in the art in accordance with the respective application or scientific problem to be addressed. In accordance with the above, in a preferred embodiment of the method of the present invention, the TALE protein is coupled directly or indirectly to an affinity ligand, said method further comprising the step of:
(c) depleting nucleic acid molecules in which a 5-methyl modification of said cytosine residue of interest or said unmodified cytosine residue of interest is present via affinity chromatography using said affinity ligand;
said method allowing for the enrichment of nucleic acid molecules in which a 5- hydroxymethyl modification of said cytosine residue of interest is present.
Affinity ligands for use according to this embodiment are not particularly limited and are known in the art. They include for example biotin, digoxigenin, dinitrophenol, magnetic particles, antibodies, including antibody fragments and antibody mimetics, and protein tags, e.g. as indicated above. Methods for the direct or indirect coupling of affinity ligands to TALE proteins are not particularly limited and are known in the art. In this context, the term "coupled directly or indirectly" expressly includes the expression of conjugate molecules of TALE proteins and any particular proteinaceous affinity ligands. Further, the term "coupled indirectly" includes any coupling strategies employing linkers, binding via further affinity partners, and the like, which are known in the art. Moreover, methods for the depletion of nucleic acid molecules in which a 5-methyl modification of said cytosine residue of interest or said unmodified cytosine residue of interest is present via affinity chromatography using said affinity ligands are not particularly limited and are known in the art. Particular methods include the use of His-tags as affinity ligand and depletion of nucleic acids bound to respective TALE proteins via NiNTA-beads, as well as the use of other protein tags as indicated above in connection with the respective affinity binding partners.
According to this embodiment of the method of the present invention, nucleic acid molecules in which a 5-methyl modification of said cytosine residue of interest and/or said unmodified cytosine residue of interest is present are depleted from a mixture containing nucleic acids in which a 5-hydroxymethyl modification of the cytosine residue of interest is present, as well as nucleic acids in which a 5-methyl modification of said cytosine residue of interest is present and/or in which the cytosine residue of interest is not modified. In this manner, nucleic acids in which a 5-hydroxymethyl modification of the cytosine residue of interest is present are enriched in the mixture.
Also in accordance with the above, in a further preferred embodiment of the method of the present invention, the TALE protein is coupled directly or indirectly to a protein having nuclease activity, said method further comprising the step of: (c) digesting nucleic acid molecules in which a 5-methyl modification of said cytosine residue of interest or said unmodified cytosine residue of interest is present using said protein having nuclease activity;
said method allowing for the differential digestion of nucleic acid molecules in which a 5-methyl modification of said cytosine residue of interest or said unmodified cytosine residue of interest is present, wherein nucleic acid molecules in which a 5-hydroxymethyl modification of said cytosine residue of interest is present remain undigested.
Proteins having nuclease activity for use according to this embodiment are not particularly limited and are known in the art. They include for example restriction enzymes and cleavage domains of restriction enzymes, e.g. the cleavage domain of Fokl. Methods for the direct or indirect coupling of proteins having nuclease activity to TALE proteins are not particularly limited and are known in the art. In this context, the term "coupled directly or indirectly" expressly includes the expression of conjugate molecules of TALE proteins and any particular proteins having nuclease activity. Further, the term "coupled indirectly" includes any coupling strategies employing linkers, binding via further affinity partners, and the like, which are known in the art. Moreover, methods for the digestion of nucleic acid molecules in which a 5-methyl modification of said cytosine residue of interest or said unmodified cytosine residue of interest is present using said proteins having nuclease activity are not particularly limited and are known in the art.
According to this embodiment of the method of the present invention, nucleic acid molecules in which a 5-methyl modification of said cytosine residue of interest and/or said unmodified cytosine residue of interest is present are digested in a mixture containing nucleic acids in which a 5-hydroxymethyl modification of the cytosine residue of interest is present, as well as nucleic acids in which a 5-methyl modification of said cytosine residue of interest is present and/or in which the cytosine residue of interest is not modified. In this manner, nucleic acids in which a 5-hydroxymethyl modification of the cytosine residue of interest is present are enriched in the mixture.
The enriched nucleic acids in which a 5-hydroxymethyl modification of the cytosine residue of interest is present, obtained according to the above two preferred embodiments of the method of the present invention, can be further used for any particular application of interest. For examples, said nucleic acids can be used for sequencing applications known in the art, including PCR and so- called Next Generation Sequencing methods, microarray analyses, or any methods for the analysis of 5-hydroxymethyl modified nucleic acids known in the art.
In a second aspect, the present invention relates to a method for the direct detection of a 5-hydroxymethyl modification of a cytosine residue of interest in a nucleic acid molecule, said method comprising the steps of: (a) providing a transcription-activator-like effector (TALE) protein, said TALE protein being capable of binding in a sequence- and locus-specific manner to a region of said nucleic acid molecule that includes said cytosine residue of interest; and
(b) detecting a 5-hydroxymethyl modification of said cytosine residue of interest, wherein
(i) said modification is present when said TALE protein does not bind to said region or does bind to said region with a strongly reduced affinity, and
(ii) said modification is absent when said TALE protein binds to said region.
In preferred embodiments of the method of the present invention according to this second aspect, the repeat variable diresidue (RVD) of said TALE protein whose position corresponds to the position of the cytosine residue of interest is a sized reduced RVD. Preferably, size reduced RVDs comprise the RVDs H* and N*, wherein N* is particularly preferred.
In a third aspect, the present invention relates to a method for the enrichment of nucleic acid molecules in which a 5-hydroxymethyl modification of a cytosine residue of interest is present, said method comprising the steps of:
(a) providing a transcription-activator-like effector (TALE) protein, said TALE protein being capable of binding in a sequence- and locus-specific manner to a region of said nucleic acid molecule that includes said cytosine residue of interest, wherein the TALE protein is coupled directly or indirectly to an affinity ligand; and
(b) depleting nucleic acid molecules in which a 5-methyl modification of said cytosine residue of interest or said unmodified cytosine residue of interest is present via affinity chromatography using said affinity ligand.
In preferred embodiments of the method of the present invention according to this third aspect, the repeat variable diresidue (RVD) of said TALE protein whose position corresponds to the position of the cytosine residue of interest is a sized reduced RVD. Preferably, size reduced RVDs comprise the RVDs H* and N*, wherein N* is particularly preferred.
In a fourth aspect, the present invention relates to a method for the differential digestion of nucleic acid molecules in which a 5-methyl modification of a cytosine residue of interest or an unmodified cytosine residue of interest is present, wherein nucleic acid molecules in which a 5-hydroxymethyl modification of said cytosine residue of interest is present remain undigested, said method comprising the steps of:
(a) providing a transcription-activator-like effector (TALE) protein, said TALE protein being capable of binding in a sequence- and locus-specific manner to a region of said nucleic acid molecule that includes said cytosine residue of interest, wherein the TALE protein is coupled directly or indirectly to a protein having nuclease activity; and
(b) digesting nucleic acid molecules in which a 5-methyl modification of said cytosine residue of interest or said unmodified cytosine residue of interest is present using said protein having nuclease activity.
In preferred embodiments of the method of the present invention according to this fourth aspect, the repeat variable diresidue (RVD) of said TALE protein whose position corresponds to the position of the cytosine residue of interest is a sized reduced RVD. Preferably, size reduced RVDs comprise the RVDs H* and N*, wherein N* is particularly preferred. All of the relevant definitions, explanations, and preferred embodiments defined above for the method according to the first aspect of the present invention expressly apply in an analogous manner also to the methods according to the second, third, and fourth aspect of the present invention. In particular, in preferred and independent embodiments, (i) the nucleic acid molecule is preferably a DNA molecule, more preferably a double-stranded DNA molecule, (ii) the region to which said TALE protein is capable of binding in a sequence- and locus-specific manner is from 10 to 30 nucleotides in length, preferably from 12 to 28 nucleotides in length, more preferably from 14 to 24 nucleotides in length, (iii) said nucleic acid molecule is in its native state and is not chemically modified by any pretreatment, (iv) the affinity ligands include for example biotin, digoxigenin, dinitrophenol, magnetic particles, antibodies, including antibody fragments and antibody mimetics, and protein tags, and (v) the proteins having nuclease activity include for example restriction enzymes and cleavage domains of restriction enzymes, e.g. the cleavage domain of Fokl.
In a fifth aspect, the present invention relates to the use of a transcription- activator-like effector (TALE) protein for the differentiation of a 5-hydroxymethyl modification of a cytosine residue of interest in a nucleic acid molecule from
(i) a 5-methyl modification of said cytosine residue of interest or
(ii) said unmodified cytosine residue of interest,
said TALE protein being capable of binding in a sequence- and locus-specific manner to a region of said nucleic acid molecule that includes said cytosine residue of interest.
In preferred embodiments of the use of the present invention according to this fifth aspect, the repeat variable diresidue (RVD) of said TALE protein whose position corresponds to the position of the cytosine residue of interest is a sized reduced RVD. Preferably, size reduced RVDs comprise the RVDs H* and N*, wherein N* is particularly preferred.
According to a preferred embodiment, this use is further for the direct detection of a 5-hydroxymethyl modification of said cytosine residue of interest in said nucleic acid molecule.
According to another preferred embodiment, this use is further for the enrichment of nucleic acid molecules in which a 5-hydroxymethyl modification of said cytosine residue of interest is present, wherein the TALE protein is coupled directly or indirectly to an affinity ligand. According to yet another preferred embodiment, this use is further for the differential digestion of nucleic acid molecules in which a 5-methyl modification of said cytosine residue of interest or said unmodified cytosine residue of interest is present, wherein nucleic acid molecules in which a 5-hydroxymethyl modification of said cytosine residue of interest is present remain undigested, wherein the TALE protein is coupled directly or indirectly to a protein having nuclease activity.
In a sixth aspect, the present invention relates to the use of a transcription- activator-like effector (TALE) protein for the direct detection of a 5-hydroxymethyl modification of a cytosine residue of interest in a nucleic acid molecule, said TALE protein being capable of binding in a sequence- and locus-specific manner to a region of said nucleic acid molecule that includes said cytosine residue of interest.
In preferred embodiments of the use of the present invention according to this sixth aspect, the repeat variable diresidue (RVD) of said TALE protein whose position corresponds to the position of the cytosine residue of interest is a sized reduced RVD. Preferably, size reduced RVDs comprise the RVDs H* and N*, wherein N* is particularly preferred. In a seventh aspect, the present invention relates to the use of a transcription- activator-like effector (TALE) protein for the enrichment of nucleic acid molecules in which a 5-hydroxymethyl modification of a cytosine residue of interest is present, said TALE protein being capable of binding in a sequence- and locus- specific manner to a region of said nucleic acid molecule that includes said cytosine residue of interest, wherein the TALE protein is coupled directly or indirectly to an affinity ligand.
In preferred embodiments of the use of the present invention according to this seventh aspect, the repeat variable diresidue (RVD) of said TALE protein whose position corresponds to the position of the cytosine residue of interest is a sized reduced RVD. Preferably, size reduced RVDs comprise the RVDs H* and N*, wherein N* is particularly preferred. ln an eighth aspect, the present invention relates to the use of a transcription- activator-like effector (TALE) protein for the differential digestion of nucleic acid molecules in which a 5-methyl modification of said cytosine residue of interest or said unmodified cytosine residue of interest is present, wherein nucleic acid molecules in which a 5-hydroxymethyl modification of said cytosine residue of interest is present remain undigested, said TALE protein being capable of binding in a sequence- and locus-specific manner to a region of said nucleic acid molecule that includes said cytosine residue of interest, wherein the TALE protein is coupled directly or indirectly to a protein having nuclease activity.
In preferred embodiments of the use of the present invention according to this eighth aspect, the repeat variable diresidue (RVD) of said TALE protein whose position corresponds to the position of the cytosine residue of interest is a sized reduced RVD. Preferably, size reduced RVDs comprise the RVDs H* and N*, wherein N* is particularly preferred.
All of the relevant definitions, explanations, and preferred embodiments defined above for the method according to the first aspect of the present invention expressly apply in an analogous manner also to the uses according to the fifth, sixth, seventh, and eighth aspect of the present invention.
In particular, in preferred and independent embodiments, (i) the nucleic acid molecule is preferably a DNA molecule, more preferably a double-stranded DNA molecule, (ii) the region to which said TALE protein is capable of binding in a sequence- and locus-specific manner is from 10 to 30 nucleotides in length, preferably from 12 to 28 nucleotides in length, more preferably from 14 to 24 nucleotides in length, (iii) said nucleic acid molecule is in its native state and is not chemically modified by any pretreatment, (iv) the affinity ligands include for example biotin, digoxigenin, dinitrophenol, magnetic particles, antibodies, including antibody fragments and antibody mimetics, and protein tags, and (v) the proteins having nuclease activity include for example restriction enzymes and cleavage domains of restriction enzymes, e.g. the cleavage domain of Fokl. The present invention describes the sensitive discrimination of 5-hydroxymethyl modified cytosine residues over unmodified cytosine residues or 5-methyl modified cytosine residues in nucleic acid target sequences by binding of TALE proteins. Additionally, it has been discovered that the binding of TALE proteins effectively inhibits the activity of a DNA polymerase that binds the same site. In this way, the modification status, of the target nucleic acid can be used to control DNA synthesis. This results in the possibility to link e.g. the sequence or concentration of a nucleic acid molecule that has been synthesized in a DNA polymerase-promoted primer extension to the cytosine modification status of the sample nucleic acid (cf. the scheme provided in Fig. 3). Figure 2 shows a PAGE electrophoretic analysis of such a primer extension controlled by 5mC-dependent binding of a TALE protein.
Since there are numerous well-established methods to detect e.g. the sequence or concentration of specific nucleic acid molecules, the described TALE protein- based discrimination step can be directly integrated into various analytic methods such as PCR, qPCR, gel electrophoresis, array hybridization of obtained products, direct primer extensions on arrays using labeled dNTP, Sanger sequencing, Pyrosequencing and different approaches of Next- and Next-Next-Generation sequencing. This also includes sequence-by-synthesis, sequencing-by-ligation, single molecule sequencing in zero-mode waveguides and nanopore sequencing.
Additionally, the present invention provides very high flexibility and scope in respect to the target sequences. TALE proteins are highly modular and provide sufficient selectivity to be applicable in large, eukaryotic genomes. This strongly distinguishes them from previously employed, methylation-specific binding proteins. TALE proteins are additionally fully flexible in terms of target sequences and can be constructed and expressed with technical ease, providing the opportunity for high and ultra-high throughput approaches involving many TALE proteins in combination with one sample. Further, DNA polymerases are highly flexible in respect to the sequence of target nucleic acids that serve as primer/template complexes. Combined, this offers a very high potential of the present invention to be used in combination with various methods of nucleic acid sequence detection, various target sequences and different parallelization grades from single target assays to ultra-high throughput approaches.
Finally, the possibility to couple TALE proteins with a variety of compounds, proteins, affinity ligands, and other moieties allows for a wide range of applications for the detection, manipulation, purification, and analysis of 5-hydroxy methyl modified cytosine residues in nucleic acids.
The figures show:
Figure 1 :
Chemical structures of cytosine (C), 5-methylcytosine (5mC) and 5- hydroxymethylcytosine (5hmC). Figure 2:
PAGE analysis of a Primer Extension using a 5'-radiolabelled primer hybridized to a target DNA strand opposite a 5mC (left lane) or C (right lane). Primer template complexes were incubated with a TAL effector protein binding to the 5mC/C containing sequence and subsequently, a primer extension was conducted as shown in Figure 3.
Figure 3:
Principle and work flow of the method for detection of 5-modification status of C in dsDNA samples according to the present invention. Left: Binding of TALE to a primer-template complex containing a C opposite RVD HD inhibits primer extension by KF- (gray ellipse). Right: Presence of 5mC (shown as underlined C) prevents TALE-inhibition, leading to the synthesis of a DNA strand by KF- as signal (thick black bar in lower right part of the Figure). Figure 4:
Recognition of thymine, C and 5mC in DNA by TALEs. A: Interaction of RVD NG (positions 12 and 13 of repeat) with thymine (top) and of RVD HD with C (bottom) in a crystal structure (pdb entry 3V6T). Hydrogen bond is shown as dotted line. B: Target DNA sequence 97 of TALE_97 and variants containing 5mC at six C positions and C or 5mC at six thymine positions of 97 (nt = nucleotide position, only forward strands are shown). C: EMSA assay using 5'-32P-labelled DNA containing either C or 5mC as shown in B and TALE_97 with a TALE / target DNA ratio of 10 and 6, respectively. TALE-DNA complex is marked with an arrow.
Figure 5:
TALE-controlled DNA replication. A: General principle. Left: Binding of TALE to a primer-template complex containing a C opposite RVD HD inhibits primer extension by KF- (gray protein surface). Right: presence of 5mC (underlined) prevents TALE-inhibition, leading to the synthesis of a DNA strand by KF- as signal (bar). B: Dependence of TALE-inhibition on the number and position of 5mC. PAGE analysis of primer extension reactions containing 0.125 U KF-, 8.325 nM primer-template complex with 5mC at indicated positions in presence or absence of 832.5 nM TALE_97. Primer and respective extension product are marked with a black and gray arrow, respectively. C: Sequence selectivity of TALE-inhibition. Experiments were conducted as in Figure 5B using three different TALE proteins that target sequences present (TALE_97) or absent (TALE_57, _58) from the template strand.
Figure 6:
DNA replication inhibition by TALE, highly resolved detection of 5mC-modification level and influence of genomic DNA. A: Concentration dependence of KF— inhibition by TALE_97. Experiments were performed as in Figure 5B with varying TALE_97 / target DNA ratios and templates. B: Plot of primer extension product formation against TALE_97 concentration. Data for t97 and t97_C6 mC are shown as black triangles and gray squares, respectively. C: Dependence of TALE inhibition on 5mC modification level at a single nucleotide position. Experiments were performed as in Figure 5B with mixes of t97 and t97_C6 mC. Inset shows linear regression of primer extension product formation plotted against t97 / t97_C6 mC ratio in %. D: 5mC-discrimination in presence of excess gDNA. Experiments were performed as in Figure 5B with 3 x 104-fold mass excess of gDNA and varying amounts of KF-. Fiqure 7:
Primer extension experiments with maximized gDNA content. Experiments were carried out as in Figure 6D with reagent amounts as described in the figure. Upper Gel: Amount of salmon sperm genomic DNA in the reactions was varied between 0.1 and 10 μg μL as shown in the figure. Lower Gel: Reaction was conducted as in Figure 6D with reagent amounts as described in the figure and with 10 μg/μL salmon sperm genomic DNA added to the reaction. Aliquots were removed at time points as shown in the figure (in hours) and analyzed by PAGE as shown. Figure 8:
Example reaction curves of qPCR analysis of 5mC-dependent primer extensions. Curve 1 : t97_C6→mC (oGrK_465), ct 23.3; curve 2: t97 (oGrK_476), ct 29.7; curve 3: no template, ct 37.3. Figure 9:
SDS PAGE analysis of exemplary TALE expression and Ni-NTA-purification (pET_TRX_TAL1297_short). Lane 1 : ladder; lane 2: pellet of expression culture, non-induced; lane 3: pellet of expression culture, induced with 1 mM IPTG; lane 4: combined wash fractions (buffer C); lane 5: combined elution fractions (buffer D); lane 6: combined elution fraction (buffer E).
Figure 10:
qPCR concentration calibration with t97. Cj values of calibration PCR reactions using t97 (oGrK_476, SEQ ID NO: 9) are shown as squares and of PCR reaction using agarose bead-immobilized primer extension products as circles, respectively.
Figure 11 :
PAGE analysis of a Primer Extension using a 5'-radiolabelled primer hybridized to a target DNA strand opposite a 5mC (lanes 2-8 and 10-14) at different positions within the target sequence or C (lane 1 +9). All investigated positions show discrimination ability, with highest discrimination for C11 , C13 and C14 and lowest discrimination for positions C17 and C8. Primer template complexes were incubated with a TAL effector protein binding to the 5mC/C containing sequence and subsequently, a primer extension was conducted as shown in Figure 3. Figure 12:
PAGE analysis of a Primer Extension using a 5'-radiolabelled primer hybridized to a target DNA strand opposite a 5hmC (lane 1 ), 5mC (Iane2) or C (lane 3). TALEs discriminate between 5hmC and C as well. Primer template complexes were incubated with a TAL effector protein binding to the 5hmC/5mC/C containing sequence and subsequently, a primer extension was conducted as shown in Figure 3.
Figure 13:
PAGE analysis of a Primer Extension using a 5'-radioIabelled primer hybridized to a target DNA strand opposite a 5hmC (lanes 1 , 4, 7, 10, 13, 16), 5mC (lanes 2, 5,
8, 1 1 , 14, 17) or C (lanes 3, 6, 9, 12, 15, 18) after Incubation with TALE_97.
Reducing KF amount reveals that discrimination for 5hmC is higher than for 5mC.
Primer template complexes were incubated with a TAL effector protein binding to the 5hmC/5mC/C containing sequence and subsequently, a primer extension was conducted as shown in Figure 3.
Figure 14:
Diagram of primer extension inhibition by TALE_1297 containing RVDs N* or NG at position 5, binding to their target sequence bearing a C, mC or hmC opposite the RVD of position 5. Top: PAGE analysis. Bottom: Same experiment with mixture of DNAs containing the target sequence bearing a C, mC or hmC opposite the RVD of position 5. Mixture is indicated under the graphs, named modification level in %. X-axis: % extension product, i.e. Phosphorimager signals of individual lanes of PAGE gels for full-length primer extension product divided through full signal of the lane in %. Figure 15:
A: Top: Table of Ki values for TALE_1297 containing RVDs HD, N* or NG at position 5, binding to their target sequence bearing a C, mC or hmC opposite the RVD of position 5. Bottom: Diagram of primer extension inhibition by TALEs as above with target DNA used above at constant TALE-DNA ratios. X-axis: Extension Product. B: Kl-graph for TALE 1297 containing RVD HD at position 5.- C: Kl-graph for TALE 1297 containing RVD N* at position 5. D: Kl-graph for TALE 1297 containing RVD NG at position 5. Figure 16:
Current model for the complete cycle of dynamic cytosine modification as central mechanism for the regulation of gene expression. TET: ten-eleven translocation dioxygenase. TDG: thymine DNA glycosylase. BER: base excision repair. The present invention will now be further illustrated in the following examples without being limited thereto.
Examples
Experimental procedures:
Construction of TALE expression plasmids.
Fragments containing the N- and C-terminal sequences of a Xanthomonas axonopodis pathovar citri TALE with variable numbers of internal repeats were amplified from plasmids TALEN1297, TALEN1257 and TALEN1258 (Addgene plasmids 32279, 32280, 32281 ) with primers oDaS308 (dHax_hom_Kpnl_fwd, SEQ ID NO: 1 ) and oDaS231 (dHax_hom_Notl_His6_rev, SEQ ID NO: 2) and cloned into the Kpnl and Eagl sites of plasmid pET32a-TRX (Addgene plasmid 11516). This resulted in plasmids pET_TRX_TAL1257_short, pET_TRX_TAL1258_short and pET_TRX_TAL1297_short coding for the respective TALE proteins with N-terminal thioredoxin (TRX) tag and S-tag, and a C-terminal His6 tag. Expression and Purification of TALE proteins.
E. coli BL21 (DE3) Gold was transformed with pET_TRX_TAL1257_short, pET_TRX_TAL1258_short or pET_TRX_TAL1297_short and a single clone was picked and was grown overnight in Luria Broth (LB) media supplemented with 50 g/ml carbenicillin at 37 °C and 200 rpm shaking. This culture was diluted 50-fold into LB medium supplemented with 50 g/ml carbenicillin and the culture was incubated at 37 °C and 200 rpm shaking until an OD600 of -0.6 was reached. Protein expression was induced with 1 mM IPTG and the culture was harvested after 3 h of incubation by centrifugation (10 min, 3320 x g, room temperature). The pellet was lysed with B-Per lysis reagent (Thermo Scientific) containing 1x complete (-EDTA) protease inhibitors (Roche) and shaking at room temperature at 1400 rpm for 20 min. The suspension was pelleted by centrifugation (5 min, 20817 x g, room temperature) and the supernatant was discarded. Protein was extracted from pellet under denaturing conditions and bound to Ni-NTA (Qiagen) according to the manufacturer's protocol. Ni-NTA was washed 2 times with 500 μΙ Buffer C (Qiagen) and eluted with buffer D (Qiagen) and then 3 times with buffer E (Qiagen). Pooled elution fractions were added to a Slide-A-Lyzer dialysis tube (Thermo Scientific) and dialyzed against TALE Storage Buffer (20 mM Tris-HCI pH = 7.5, 200 mM NaCI, 10 % Glycerol, 1 mM DTT). Purity and quantity of TALE proteins was analyzed by SDS PAGE and staining with Gelcode blue (Thermo Scientific) (Figure 9) and a BCA assay (Pierce) and proteins were stored in aliquots at -80 °C in TALE storage buffer including 0.1 mg/ml bovine serum albumin (BSA, New England Biolabs). Electromobility Shift Assays.
Oligonucleotides 97_C2/5/6/1 1 /12/14 mC_rev (SEQ ID NO: 5) and 97_T3/4/8/9/10/16 mC_rev (SEQ ID NO: 8) were 5'-32P-end labeled using γ-32Ρ- ATP and T4 polynucleotide kinase (Fermentas) and purified using a G-25 gel filtration column (GE Healthcare). Oligonucleotides were hybridized pairwise (97 / 97_C2/5/6/ 1/12/14 mC_rev (SEQ ID NO: 3 / SEQ ID NO: 5); 97_C2/5/6/1 1 /12/14 mC / 97_C2/5/6/1 1/12/14 mC_rev (SEQ ID NO: 4 / SEQ ID NO: 5); 97_T3/4/8/9/10/16 C / 97_T3/4/8/9/10/16 mC_rev (SEQ ID NO: 6 / SEQ ID NO: 8); 97_T3/4/8/9/10/16 mC / 97_T3/4/8/9/10/16 mC_rev (SEQ ID NO: 7 / SEQ ID NO: 8)) at a concentration of 12.5 nM, respectively, by incubating at 95 °C for 5 min and subsequently at room temperature for 30 min in Hybridization buffer (40 mM Tris-HCI (pH = 8.0), 100 mM NaCI, 10 mM MgCI2, 100 ng/μΙ salmon sperm DNA (Ambion), 0.2 mg/ml BSA, 10 % glycerol). For TALE-binding, to 6 μΐ_ of the hybridized DNA duplexes, 6 μΙ_ of TALE storage buffer (20 mM Tris-HCI pH = 7.5, 200 mM NaCI, 10 % Glycerol, 1 mM DTT) with varying concentrations of TALE proteins were added and mixtures were incubated at room temperature for 30 min. Mixtures were loaded onto an analytical, non-denaturing PAGE-gel (0.5 mm, 50 cm length) that was run in 0.25 x TB buffer at 12 W and room temperature. Gel was dried and data recorded on a phosphorimager.
Primer Extension Reactions.
Templates as shown in Figure 2 (SEQ ID NOs: 9 to 14) and primer p97_rev (SEQ ID NO: 15; 5'-32P-end labeled as above) were diluted from 5x stocks (500 nM and 166.5 nM, respectively) into 6 iL Hybridization buffer (40 mM Tris-HCI (pH 8.0), 100 mM NaCI, 10 mM MgCI2) 0.2 mg/ml BSA, 10 % glycerol) to final concentrations of 100 nM and 33.3 nM and hybridized by incubating at 95 °C for 5 min and subsequently at room temperature for 30 min. TALE proteins with various RVDs at position 5 were added in 6 μί TALE storage buffer (200 mM NaCI, 20 mM Tris-HCI (pH 7.5), 1 mM DTT, 10 % glycerol) at varying concentrations and mixtures were incubated at room temperature for 30 min. 12 μί of a mixture of 25 mU Klenow Fragment of E. coli DNA polymerase I (3'-5'- exo", New England Biolabs) and 200 μΜ of each dNTP in Binding buffer (30 mM Tris-HCI (pH 8.0), 150 mM NaCI, 5 mM MgCI2) 0.1 mg/ml BSA, 0.5 mM DTT, 7.5 % glycerol) were added, resulting in final concentrations of 8.325 nM and 25 nM for primer and template, respectively. These mixtures were incubated at room temperature for additional 15 min. 12 ί of PAGE loading buffer (80% formamide, 2 mM EDTA) were added, the mixtures were incubated at 95 °C for 5 min and cooled to 4 °C. Mixtures were loaded onto a pre-run, analytical denaturing PAGE gel (9 M urea, 0.5 mm, 50 cm length) and gel was run in 1 x TBE at 120 W and 40 - 50 °C. Gel was dried and data recorded on a phosphorimager. For IC50 determination (Figure 6B), fitting was performed in Origin 8.6.0G (Originlab) using the Dose Response function without initial parameters or by linear regression in MS Excel.
To investigate the influence of additional genomic DNA (gDNA), the hybridization of templates and primer p97_rev were conducted as above using Hybridization buffer containing 0.1 - 10 pg/pl salmon sperm DNA in a 6 μΙ total volume. This corresponds to a mass ratio of 2.89 x 102 - 2.89 x 104, calculated with the molecular weight of double stranded target sequence 97 (10379.9 g/mol, Figure 4B, SEQ ID NO: 3). 6 μΙ of a 1.665 μΜ TALE_97 solution in TALE storage buffer were added resulting in a TALE/target DNA ratio of 50:1. Mixtures were incubated at room temperature for 30 min. 12 pL of Binding buffer containing 0.125 to 10.0 U Klenow Fragment of E. coli DNA polymerase I (3'-5'-exo-, New England Biolabs) and 200 μΜ of each dNTP were added and the resulting mixtures were incubated at room temperature for additional 15 to 720 min. 12 pL of PAGE loading buffer were added, the mixtures were incubated at 95 °C for 5 min and cooled to 4 °C. Mixtures were loaded onto a pre-run, analytical denaturing PAGE gel (9 M urea, 0.5 mm, 50 cm length) and gel was run in 1 x TBE at 120 W and 40 - 50 °C. Gel was dried and data recorded on a phosphorimager. qPCR Experiments.
For qPCR experiments, primer extension reactions were conducted as above with primer Bio-p97_rev (SEQ ID NO: 15) replacing 5'-32P-radiolabelled primer p97_rev. Reactions were quenched with 12 pL of 20 mM EDTA. Mixtures were diluted with water to 500 pL and 10 pL of streptavidin-agarose beads (Sigma- Aldrich, pre-incubated 4 h in 20 mM NaOH) were added. Suspensions were shaken for 30 min and agarose beads were washed 4 times with 20 mM NaOH, 2 times with water and 2 times with PBS buffer (each 00 pL). To not introduce bias into copy numbers of primer extension products, streptavidin agarose was used in a 400-fold excess of biotin binding sites over molecules of added primer. For PCR reactions, agarose beads were diluted in PBS to contain 1/105 of above primer extension reactions in 10 pL of bead suspension. PCR reactions (50 pL) were conducted with using 25 pL GoTaq qPCR Master Mix containing BRYT Green dye, 200 nM of each primer qp97_fwd (oGrK_621 , SEQ ID NO: 16) and primer qp97_rev (oGrK_622, SEQ ID NO: 17) and 10 μΙ_ of above diluted bead suspension in a BioRad i-Cycler with filters FAM-490 using the following program: 2 min 95 °C, then 60 cycles of 0:15 min 95°C, 1 :00 min 60 °C. Reproduction experiment to obtain standard deviations of CT values included the complete experimental procedure starting from primer extension reactions. For quantification of copy numbers present in agarose bead PCR reactions, a calibration curve was generated using the same PCR conditions and dilutions of t97 (oGrK_476) (Figure 10). Copy numbers were obtained by linear regression. PCR products were additionally analyzed by agarose gel electrophoresis and staining with ethidium bromide.
Example 1 : It was aimed to get deeper insights into the binding of TALE proteins to C and C and to exploit it for the development of a methodology for programmable, locus- specific 5mC-detection. TALE_97 was designed and expressed, a construct targeting a 17 nt sequence of the zebrafish (Danio rerio) hey2 gene derived from a natural TALE scaffold from Xanthomonas axonopodis. To evaluate the general discrimination ability of TALE_97, its binding to DNA containing its target sequence ("97", Figure 4B) with either C or 5mC at six scattered positions opposite six NG or HD RVDs was analyzed in electromobility shift assays (EMSA, Figure 4C). No difference in binding was observed when either C- or 5mC-containing nucleotides were placed opposite NG RVDs (data not shown). In contrast, for HD RVDs, binding was observed for DNA containing C, but not for DNA containing 5mC (Figure 4C). Example 2:
Next it was investigated whether the discrimination found in Example 1 could be exploited for sensitive and highly resolved 5mC-detection. For that purpose, it was aimed to couple TALE-binding to DNA replication by DNA polymerase. Newly synthesized DNA molecules with defined sequence could then provide a signal for 5mC-modification that can be quantitatively detected by selective and sensitive analysis techniques. Though TALEs and DNA polymerases generally recognize DNA differently, i.e. through the opposing major and minor grooves, they directly and indirectly compete for phosphate- and nucleobase-interactions, and induce differential conformations in bound DNA. TALEs could thus indeed be able to control DNA polymerase-catalyzed DNA synthesis by inhibitive binding (Figure 5A).
A 79 nt DNA oligonucleotide template consisting of a region of the hey2 gene with sequence 97 (Figure 4B) at the 3'-terminus (t97) was hybridized with a reverse complement, 5'-32P-labelled primer (p97_rev) and the complex incubated with or without 100 equivalents of TALE_97. Then dNTP and the Klenow fragment of E. coli DNA polymerase I (3'-5'-exo-, KF-) was added, the mixture incubated and subsequently resolved by denaturing polyacrylamide gel electrophoresis (PAGE). Primer extension was observed when TALE_97 was absent, but was completely abolished in its presence (Figure 5B, lanes 1-2), indicating that this protein is indeed an effective inhibitor of KF-catalyzed DNA synthesis.
Example 3:
Next it was investigated if this inhibition potential of TALE_97 could be combined with its observed discrimination of multiple 5mC-positions opposite HD RVDs (Figure 4C) to enable 5mC-dependent DNA synthesis. To test if the resolution of 5mC-detection could be enhanced compared to the one observed in EMSA, a primer extension reaction was performed as above with a template that contained only three instead of six 5mC at the positions 2, 6 and 14 (t97_C2/6/14 mC). No inhibition of primer extension was observed (Figure 5B, lane 3), indicating that TALE_97 provides higher 5mC-discrimination ability than observed before. To test if this resolution could be increased even further, reactions were performed using templates containing only two or one 5mC at different positions (t97_C2/6 mC, t97_C2 mC, t97_C6 mC, t97_C14 mC; Figure 5B, lanes 4-7). TALE_97 was able to discriminate 5mC in all cases. However, when testing t97_C14 mC having an mC position close to the C-terminus, reduced primer extension was observed, indicating that a certain degree of TALE-binding was occurring, despite the presence of 5mC at position 14. This suggests that there are no strict constraints regarding the repeat position used for discrimination, but that repeats in the middle and N-terminal region may have superior discrimination ability than repeats in the C-terminal region.
Example 4:
To be useful for locus-specific 5mC-detection, the observed 5mC-dependent inhibition of KF- by TALEs has to be strictly sequence-selective under conditions that are compatible with KF-catalyzed DNA synthesis. Two additional TALEs based on the identical scaffold as used for TALE_97 were constructed and expressed (TALE_57 and _58). These recognize sequences in the hey2 gene adjacent to sequence 97 and in the gria3a gene of zebrafish, respectively, that are both absent from t97. Primer extension reactions were performed using templates t97 and t97_C6 mC in presence of either TALE_97, _57, or _58 (Figure 5C). TALE_97 still effectively discriminated against the single 5mC position (Figure 5C, lanes 1-2), and the presence of either TALE_57 or _58 did not reduce primer extension, regardless of the presence of C or 5mC in the template (Figure 5C, lanes 3-6). This indicates that inhibition of KF- by TALEs is indeed sequence- selective. Example 5:
To gain quantitative insights into the C-discrimination ability of TALE_97, primer extension reactions were performed with templates t97 and t97_C6 mC with varying TALE_97/target DNA ratios (Figure 6A).
For t97, primer extension declined with increasing TALE concentrations. Inhibition was visible from a ratio of 5 and was virtually complete at an optimum ratio of 50 (IC50 = 106.4 ±11 nM, Figure 6B). In contrast, no effect was observed for t97_C6 mC even at the highest ratio, confirming highly effective discrimination.
Example 6: DNA-associated, 5mC-dependent processes are not only controlled by the status but also by the level of 5mC-modification. An ideal 5mC-detection method should thus allow analysis of this parameter. Primer extension reactions were performed with TALE_97 and mixed t97 and t97_C6 mC templates, resulting in 5mC- modification levels between 0 and 100 % in increments of 10 % (Figure 6C). Over the complete range, the dependence of primer extension product formation on the 5mC-modification level of the single analyzed nucleotide position was strictly linear (Figure 6C). This offers highly resolved, quantitative analysis.
Example 7:
For direct application to biological samples without target sequence enrichment, an 5mC-detection method should offer high robustness towards the presence of excess genomic DNA (gDNA). Primer extension reactions were performed as above in presence of salmon sperm gDNA (up to a viscosity limit of a 3 x 104-fold mass excess over primer) during the hybridization step. Above 3 x 102, no full- length primer extension product was obtained (Figure 7), suggesting masking of KF- activity. We repeated the experiment with a 3 x 104-fold excess of gDNA and increasing amounts of KF- (Figure 6D). From an amount of 5 units per reaction, both primer extension and high 5mC-discrimination were fully restored (a similar result was obtained by increasing the primer extension time, Fig. 7). This high robustness towards the presence of gDNA offers promising perspectives for a direct application with complex biological samples.
Example 8: To test, if the chosen signaling strategy would provide high sensitivity, it was aimed to read out primer extension products by qPCR. Reactions with templates t97 and t97_C6 mC were repeated as above using a 5'-biotin labeled primer (Bio- p97_rev). Subsequently, the reactions were incubated with an excess of streptavidin-agarose beads and non-biotinylated template removed by extensive washing with 20 mM NaOH. Then, 1/105 of the beads were used in a qPCR experiment using generic fluorescence signaling with primers targeting the hey2 sequence that was expected to be present in the primer extension products. For reactions conducted with t97_C6 mC and t97, fluorescence threshold cycles (CT) of 23.9 ±0.9 and CT of 30.7 ±1.3 were obtained, respectively (Figure 8). This corresponds to a 71 -fold difference in template copy number. For comparison, a 78-fold difference in full-length primer extension product was obtained by PAGE and phosphorimager quantification as above. This shows that the mC- discrimination by TALE_97 in primer extensions can be quantitatively reflected by qPCR, which offers to significantly increase the sensitivity of the method.
Example 9:
Next, the position-dependence of discrimination was further analyzed using TALE_57 under primer extension conditions as used in the experiments of Figure 5B. Primer extension reactions were conducted with a TALE : target DNA ratio of 50:1 and 25:1. Discrimination was observed in all cases (Figure 11 ). Example 10:
Next, discrimination of the epigenetic cytosine modification 5- hydroxymethylcytosine (5hmC) by TALE_97 was tested and compared with the discrimination of 5mC. Primer extension reactions were conducted as in the experiments shown in Figure 5B with a TALE : target DNA ratio of 50:1. These experiments show that 5hmC can also be discriminated by the approach (Figure 12). To assess if the discrimination ability of TALE_97 was different for 5mC and 5hmC, primer extension reactions under conditions as for the experiments shown in Figure 5B were conducted with a TALE : target DNA ratio of 100:1 and varying amounts of KF-. These experiments revealed a stronger discrimination for 5hmC than. for 5mC (Figure 13).
Example 11 :
Next it was investigated if the slight discrimination ability of TALE_97 between 5hmC and 5mC could be improved by placing less sterically demanding RVDs opposite the investigated C. TALE_037 and TALE_038 were assembled providing RVD N* or NG respectively opposite of C6 in the target sequence. Primer extension reactions were performed as above with a TALE : target DNA ratio of 50:1 with templates containing 5hmC, 5mC or C at position 6. In case of NG RVD limited inhibition of primer extension was observed for 5hmC modified and unmodified DNA and stronger inhibition for DNA containing 5mC at position 6, indicating that TALE_038 provides ability for discrimination of 5hmC/C and 5mC (Figure 14 lanes 4-6). This could be already used for sequence specific determination of 5hmC by comparison to primer extension results using TALE_97. In case of N* RVD no inhibition of primer extension was observed for 5hmC modified DNA and strong inhibition for DNA containing 5mC and C at position 6, indicating that TALE_037 provides high ability for discrimination of 5hmC and 5mC/C (Figure 14 lanes 1-3). To gain quantitative insights into the 5hmC/5mC/C discrimination ability of TALE_037 and TALE_038, primer extension reactions were performed with templates t97, t97_C6 mC and t97_C6 hmC with varying TALE/target DNA ratios (Figure 15 C and D).
For t97 and t97_C6 mC, primer extension declined with increasing TALE concentrations till full inhibition. TALE_037 provides a similar binding affinity to target DNA containing 5mC and C (IC50(C) = 60 ±4 nM, IC50(mC) = 51 ±2 nM, Figure 15C). In contrast, a reduction in primer extension efficiency for target DNA containing 5hmC at position 6 to 50 % was observed at an approximate TALE concentration of 1500 nM, confirming highly effective 5hmC and 5mC/C discrimination. Under use of TALE_038 primer extension for t97 and t97_C6 mC declined with increasing TALE concentrations till full inhibition but with a ~2-fold difference between IC5o values for t97 (IC50(C) = 357 ± 33 nM, Figure 15D) and t97_C6 mC (IC50(mC) = 163 ± 5 nM, Figure 15D). Again, a reduction in primer extension efficiency for target DNA containing 5hmC at position 6 to 50 % was estimated to an approximate TALE concentration of 2000 nM, confirming highly effective 5hmC/C and 5mC discrimination.
Discussion:
In summary, the first application of TALE proteins is presented that enables the detection of a chemical DNA modification with high resolution. The methodology offers the direct, conversion-free detection of the status and level of 5mC- modification in a strand-specific manner, at single nucleotide positions and with excellent resolution (< 10 % of the 5mC-modification level). In contrast to all proteins that have previously been employed for 5mC-discrimination, TALEs provide sufficient sequence-selectivity to be applicable in large, eukaryotic genomes and at the same time are not known to exhibit inherent sequence constraints. Combined with the universal process of enzymatic DNA synthesis as signal output, this flexibility should result in a high scope of applicable target sequences. Furthermore, the signaling strategy should enable the combination with quantitative and sensitive DNA analysis techniques that offer throughputs beyond the one of qPCR, e.g. microarrays and next generation sequencing. Finally, the availability of endogenous, programmable proteins that exhibit 5mC- sensitive DNA-binding and repressive function opens up exciting perspectives to detect 5mC directly in living cells and to regulate DNA-associated processes distinct from DNA replication.
Sequence data:
The following DNA sequences are disclosed in the present application. 5- Methylcytosine nucleotides are marked as C, 5-Hydroxymethylcytosine nucleotides as C. SEQ ID NO: 1
dHax_hom_Kpnl_fwd (oDaS308):
TTT TTG GTA CCG TGG ACT TGA GGA CAC TCG GTT ATT CGC AAC AGC
SEQ ID NO: 2
dHax_hom_Notl_His6_rev (oDaS231 ):
TTT TGC GGC CGC TCA GTG ATG GTG ATG GTG ATG TTC CAG CAG ATG GTC ATT CG
SEQ ID NO: 3
97 (oGrK_415):
AGA CGG CAT ACG ATC TTC CGT TTC CAC ATC CAC CAC ATC CCA ACA GAG CAG CGG GAG CAG CAG TAA AGA TCG GAA GAG C
SEQ ID NO: 4
97_C2/5/6/ 1/12/14→mC (oGrK_416):
AGA CGG CAT ACG ATC TTC CGT TTC CAC ATC CAC CAC ATC CCA ACA GAG CAG CGG GAG CAG CAG TAA AGA TCG GAA GAG C SEQ ID NO: 5
97_C2/5/6/11/12/14→mC_rev (oGrK_417):
GCT CTT CCG ATC TTT ACT GCT GCT CCC GCT GCT CTG TTG GGA TGT GGT GGA TGT GGA AAC GGA AGA TCG TAT GCC GTC T .
SEQ ID NO: 6
97_T3/4/8/9/10/16→C (oGrK_418):
AGA CGG CAT ACG ATC CCC CGC CCC CAC ACC CAC CAC ATC CCA ACA GAG CAG CGG GAG CAG CAG TAA AGA TCG GAA GAG C
SEQ ID NO: 7
97_T3/4/8/9/10/16→mC (oGrK_419):
AGA CGG CAT ACG ATC CCC CGC CCC CAC ACC CAC CAC ATC CCA ACA GAG CAG CGG GAG CAG CAG TAA AGA TCG GAA GAG C
SEQ ID NO: 8
97_T3/4/8/9/10/16→mC_rev (oGrK_420):
GCT CTT CCG ATC TTT ACT GCT GCT CCC GCT GCT CTG TTG GGA TGT GGT GGG TGT GGG GGC GGG GGA TCG TAT GCC GTC T
SEQ ID NO: 9
t97 (oGrK_476):
TGG ATT CCC ACT CTT CAG CCC CAG CGT TAC AGC ATC TTC AGT GGC TTC TTC CAC CGT GAG CTC TTC CGT TTC CAC ATC C
SEQ ID NO: 10
t97_C6→mC (oGrK_465):
TGG ATT CCC ACT CTT CAG CCC CAG CGT TAC AGC ATC TTC AGT GGC TTC TTC CAC CGT GAG CTC TTC CGT TTC CAC ATC C
SEQ ID NO: 11
t97_C2- mC (oGrK_515): TGG ATT CCC ACT CTT CAG CCC CAG CGT TAC AGC ATC TTC AGT GGC TTC TTC CAC CGT GAG CTC TTC CGT TTC CAC ATC C
SEQ ID NO: 12
t97_C14→mC (oGrK_516):
TGG ATT CCC ACT CTT CAG CCC CAG CGT TAC AGC ATC TTC AGT GGC TTC TTC CAC CGT GAG CTC TTC CGT TTC CAC ATC C
SEQ ID NO: 13
t97_C2/6-»mC (oGrK_517):
TGG ATT CCC ACT CTT CAG CCC CAG CGT TAC AGC ATC TTC AGT GGC TTC TTC CAC CGT GAG CTC TTC CGT TTC CAC ATC C
SEQ ID NO: 14
t97_C2/6/14→mC (oGrK_518):
TGG ATT CCC ACT CTT CAG CCC CAG CGT TAC AGC ATC TTC AGT GGC TTC TTC CAC CGT GAG CTC TTC CGT TTC CAC ATC C
SEQ ID NO: 15
p97_rev (oGrK_466):
GGA TGT GGA AAC
Bio-p97_rev (oGrK_467):
5'-Biotin-GGA TGT GGA AAC GGA AGA
SEQ ID NO: 16
qp97Jwd (oGrK_621 ):
CCC ACT.CTT CAG CCC CA
SEQ ID NO: 17
qp97_rev (oGrK_622):
GGT GGA AGA AGA GCT CAC G SEQ ID NO: 18
t97_C6→hmC (oGrK_520):
TGG ATT CCG ACT CTT CAG CCC CAG CGT TAC AGC ATC TTC AGT GGC TTC TTC CAC CGT GAG CTC TTC CGT TTC CAC ATC C
SEQ ID NO: 19
t97_C2→hmC (oGrK_519):
TGG ATT CCC ACT CTT CAG CCC CAG CGT TAC AGC ATC TTC AGT GGC TTC TTC CAC CGT GAG CTC TTC CGT TTC CAC ATC C
SEQ ID NO: 20
t57 (oGrK_702):
ACA TTT AAA TCC AAC ATT TAA AAC GCT CCC ACT TCA GTT CCC CAC GGT CGG TAT GGT TTA CTG CTG CTC CCG CT
SEQ ID NO: 21
t57_C8→mC (oGrK_703):
ACA TTT AAA TCC AAC ATT TAA AAC GCT CCC ACT TCA GTT CCC CAC GGT CGG TAT GGT TTA CTG CTG CTC CCG CT
SEQ ID NO: 22
t57_C5→mC (oGrK_790):
ACA TTT AAA TCC AAC ATT TAA AAC GCT CCC ACT TCA GTT CCC CAC GGT CGG TAT GGT TTA CTG CTG CTC CCG CT
SEQ ID NO: 23
t57_C11→mC (oGrK_791 ):
ACA TTT AAA TCC AAC ATT TAA AAC GCT CCC ACT TCA GTT CCC CAC GGT CGG TAT GGT TTA CTG CTG CTC CCG CT
SEQ ID NO: 24
t57_C13→mC (oGrK_792): ACA TTT AAA TCC AAC ATT TAA AAC GCT CCC ACT TCA GTT CCC CAC GGT CGG TAT GGT TTA CTG CTG CTC CCG CT
SEQ ID NO: 25
t57_C14→mC (oGrK_793):
ACA TTT AAA TCC AAC ATT TAA AAC GCT CCC ACT TCA GTT CCC CAC GGT CGG TAT GGT TTA CTG CTG CTC CCG CT
SEQ ID NO: 26
t57_C15→mC (oGrK_794):
ACA TTT AAA TCC AAC ATT TAA AAC GCT CCC ACT TCA GTT CCC CAC GGT CGG TAT GGT TTA CTG CTG CTC CCG CT
SEQ ID NO: 27
t57_C17→mC (oGrK_795):
ACA TTT AAA TCC AAC ATT TAA AAC GCT CCC ACT TCA GTT CCC CAC GGT CGG TAT GGT TTA CTG CTG CTC CCG CT
SEQ ID NO: 28
p57_rev (oGrK_787):
GCA GCG GGA GCA GCA GTA AA
The following is the amino acid sequence of TALE_97: SEQ ID NO: 29
TALE_97:
MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCK IAPILDEIADEYQGKLTVAKLNI DQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGSGSGERQH DSP DLGTVDLRTLGYSQQQQEKIKPKVRSTVAQHHEALVGHGFTHAHIVALSQHPAALGTVAVK YQDMIAALPEATHEAIVGVGKQWSGARALEALLTVAGELRGPPLQLDTGQLLKIAKRGGVT AVEAVHAWRNALTGAPLNLTPDQVVAIASHDGGKQALETVQRLLPVLCQDHGLTPEQVVAI ASNGGGKQALETVQRLLPVLCQAHGLTPDQVVAIASNGGGKQALETVQRLLPVLCQAHGLT PAQVVAIASHDGGKQALETVQRLLPVLCQDHGLTPDQVVAIASHDGGKQALETVQRLLPVL CQDHGLTPEQVVAIANNNGGKQALETVQRLLPVLCQAHGLTPDQVVAIASNGGGKQALETV QRLLPVLCQAHGLTPAQVVAIASNGGGKQALETVQRLLPVLCQDHGLTPDQVVAIASNGGG KQALETVQRLLPVLCQDHGLTPEQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPDQVVA IASHDGGKQALETVQRLLPVLCQAHGLTPAQVVAIASNIGGKQALETVQRLLPVLCQDHGL TPDQVVAIASHDGGKQALETVQRLLPVLCQDHGLTPEQVVAIASNIGGKQALETVQRLLPV LCQAHGLTPDQVVAIASNGGGKQALETVQRLLPVLCQAHGLTPAQVVAIASHDGGKQALET VQRLLPVLCQDHGLTPEQVVAIASNGGGRPALESIVAQLSRPDPALAALTNDHLLEHHHHH H

Claims

Claims
1. A method for the differentiation of a 5-hydroxymethyl modification of a cytosine residue of interest in a nucleic acid molecule from
(i) a 5-methyl modification of said cytosine residue of interest or
(ii) said unmodified cytosine residue of interest,
said method comprising the steps of:
(a) providing a transcription-activator-like effector (TALE) protein, said TALE protein being capable of binding in a sequence- and locus- specific manner to a region of said nucleic acid molecule that includes said cytosine residue of interest; and
(b) determining whether said TALE protein binds to said region;
wherein
(i) a 5-hydroxymethyl modification of said cytosine residue of interest is present when said TALE protein does not bind to said region or does bind to said region with a strongly reduced affinity, and
(ii) a 5-methyl modification of said cytosine residue of interest or said unmodified cytosine residue of interest is present when said TALE protein binds to said region.
2. The method of claim 1 , wherein the repeat variable diresidue (RVD) of said TALE protein whose position corresponds to the position of the cytosine residue of interest is a size reduced RVD.
3. The method of claim 1 or 2, wherein the repeat variable diresidue (RVD) of said TALE protein whose position corresponds to the position of the cytosine residue of interest is the RVD H* or the RVD N*.
4. The method of any one of claims 1 to 3, further comprising the step of:
(c) detecting a 5-hydroxymethyl modification of said cytosine residue of interest, wherein (i) said modification is present when said TALE protein does not bind to said region or does bind to said region with a strongly reduced affinity, and
(ii) said modification is absent when said TALE protein binds to said region,
said method allowing for the direct detection of a 5-hydroxy methyl modification of said cytosine residue of interest in said nucleic acid molecule.
The method of any one of claims 1 to 4, wherein step (b) comprises the step of determining whether a specific DNA polymerase reaction using a primer that is capable of binding to the region of said nucleic acid molecule that includes said cytosine residue of interest is inhibited, thus indicating binding of said TALE protein to said region, said method allowing for the direct detection of a 5-hydroxymethyl modification of said cytosine residue of interest in said nucleic acid molecule.
The method of claim 5, wherein step (b) comprises the steps of:
(b1 ) providing a primer that is capable of binding to the region of said nucleic acid molecule that includes said cytosine residue of interest;
(b2) adding said TALE protein to a first aliquot of the nucleic acid molecule;
(b3) performing a first specific DNA polymerase reaction with said primer using said first aliquot of the nucleic acid molecule as template, and performing a second specific DNA polymerase reaction with said primer using a second aliquot of the nucleic acid molecule as template to which no TALE protein has been added;
(b4) determining at least one parameter, selected from the group consisting of the concentration, size, and sequence of each of the products of said first and second specific DNA polymerase reaction; and
(b5) determining whether said TALE protein binds to said region, wherein (i) said TALE protein does not bind to said region or does bind to said region with a strongly reduced affinity when the parameter determined in step (b4) for the first specific DNA polymerase reaction does not differ significantly from the parameter detected in step (b4) for the second specific DNA polymerase reaction, and (ii) said TALE protein binds to said region when the parameter detected in step (b4) for the first specific DNA polymerase reaction differs significantly from the parameter detected in step (b4) for the second specific DNA polymerase reaction.
7. The method of claim 6, wherein in step (b4)
(i) the concentration of the products of said first and second specific DNA polymerase reaction is determined using a method, selected from the group consisting quantitative polymerase chain reaction (qPCR), fluorescence measurements using nucleic acid binding fluorescent probes, and photometry; and/or
(ii) the size of the products of said first and second specific DNA polymerase reaction is determined using a method, selected from the group consisting of polymerase chain reaction (PCR), and gel electrophoresis; and/or
(iii) the sequence of the products of said first and second specific DNA polymerase reaction is determined using a method, selected from the group consisting of Sanger sequencing, pyrosequencing, microarray hybridization, next-generation sequencing methods, and next-next- generation sequencing methods.
8. The method of claim 6 or 7, further comprising the steps of:
(d) comparing the parameter detected in step (b4) for the first specific DNA polymerase reaction to one or more respective parameters obtained from nucleic acid molecules having a known degree of modification of the cytosine residue of interest; and
(e) thereby determining the degree of modification of the cytosine residue of interest in the nucleic acid molecule.
9. The method of any one of claims 1 to 3, wherein the TALE protein is coupled directly or indirectly to an affinity ligand, said method further comprising the step of:
(c) depleting nucleic acid molecules in which a 5-methyl modification of said cytosine residue of interest or said unmodified cytosine residue of interest is present via affinity chromatography using said affinity ligand; said method allowing for the enrichment of nucleic acid molecules in which a 5-hydroxymethyl modification of said cytosine residue of interest is present.
10. The method of any one of claims 1 to 3, wherein the TALE protein is coupled directly or indirectly to a protein having nuclease activity, said method further comprising the step of:
(c) digesting nucleic acid molecules in which a 5-methyl modification of said cytosine residue of interest or said unmodified cytosine residue of interest is present using said protein having nuclease activity; said method allowing for the differential digestion of nucleic acid molecules in which a 5-methyl modification of said cytosine residue of interest or said unmodified cytosine residue of interest is present, wherein nucleic acid molecules in which a 5-hydroxymethyl modification of said cytosine residue of interest is present remain undigested.
11. Use of a transcription-activator-like effector (TALE) protein for the differentiation of a 5-hydroxymethyl modification of a cytosine residue of interest in a nucleic acid molecule from
(i) a 5-methyl modification of said cytosine residue of interest or
(ii) said unmodified cytosine residue of interest,
said TALE protein being capable of binding in a sequence- and locus- specific manner to a region of said nucleic acid molecule that includes said cytosine residue of interest.
12. The use of claim 11 , wherein the repeat variable diresidue (RVD) of said TALE protein whose position corresponds to the position of the cytosine residue of interest is a size reduced RVD.
13. - The use of claim 11 or 12, wherein the repeat variable diresidue (RVD) of said TALE protein whose position corresponds to the position of the cytosine residue of interest is the RVD H* or the RVD N*.
14. The use of any one of claims 11 to 13, which is further for the direct detection of a 5-hydroxymethyl modification of said cytosine residue of interest in said nucleic acid molecule.
15. The use of any one of claims 11 to 13, which is further for the enrichment of nucleic acid molecules in which a 5-hydroxymethyl modification of said cytosine residue of interest is present, wherein the TALE protein is coupled directly or indirectly to an affinity ligand.
16. The use of any one of claims 11 to 13, which is further for the differential digestion of nucleic acid molecules in which a 5-methyl modification of said cytosine residue of interest or said unmodified cytosine residue of interest is present, wherein nucleic acid molecules in which a 5-hydroxymethyl modification of said cytosine residue of interest is present remain undigested, wherein the TALE protein is coupled directly or indirectly to a protein having nuclease activity.
PCT/EP2014/001753 2013-06-26 2014-06-26 Direct, programmable detection of epigenetic dna cytosine modifications using tal effectors Ceased WO2014206568A1 (en)

Priority Applications (2)

Application Number Priority Date Filing Date Title
US14/899,483 US9879315B2 (en) 2013-06-26 2014-06-26 Direct, programmable detection of epigenetic DNA cytosine modifications using TAL effectors
EP14747293.0A EP3013979B1 (en) 2013-06-26 2014-06-26 Direct, programmable detection of epigenetic dna cytosine modifications using tal effectors

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
EP13003252.7 2013-06-26
EP13003252 2013-06-26

Publications (1)

Publication Number Publication Date
WO2014206568A1 true WO2014206568A1 (en) 2014-12-31

Family

ID=48700259

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2014/001753 Ceased WO2014206568A1 (en) 2013-06-26 2014-06-26 Direct, programmable detection of epigenetic dna cytosine modifications using tal effectors

Country Status (3)

Country Link
US (1) US9879315B2 (en)
EP (1) EP3013979B1 (en)
WO (1) WO2014206568A1 (en)

Cited By (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP3214183A1 (en) * 2016-03-01 2017-09-06 Universität Konstanz Transcription activator-like effector (tale)-based decoding of cytosine nucleobases by selective modification response
CN111278848A (en) * 2017-08-04 2020-06-12 北京大学 A TALE RVD that specifically recognizes methylated DNA bases and its application
CN112708661A (en) * 2021-01-27 2021-04-27 西安交通大学 Visualization analysis method and system for intracellular 5-aldehyde uracil
US11624077B2 (en) 2017-08-08 2023-04-11 Peking University Gene knockout method

Families Citing this family (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2010037001A2 (en) 2008-09-26 2010-04-01 Immune Disease Institute, Inc. Selective oxidation of 5-methylcytosine by tet-family proteins
ES2669214T3 (en) 2011-12-13 2018-05-24 Oslo Universitetssykehus Hf Procedures and kits for the detection of methylation status
ES2786984T3 (en) 2012-11-30 2020-10-14 Cambridge Epigenetix Ltd Oxidizing agent for modified nucleotides
WO2017059245A2 (en) 2015-09-30 2017-04-06 Trustees Of Boston University Deadman and passcode microbial kill switches
CN110079583B (en) * 2019-05-27 2023-10-27 重庆博艾迈迪森生物科技有限公司 Immunochromatography detection method and detection kit for nucleic acid and application of detection kit
CA3187549A1 (en) 2020-07-30 2022-02-03 Cambridge Epigenetix Limited Compositions and methods for nucleic acid analysis

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20100041057A1 (en) * 2008-08-18 2010-02-18 Life Technologies Corporation Dna methylation detection methods
WO2012054730A1 (en) * 2010-10-22 2012-04-26 Oslo Universitetssykehus Hf Methods and kits for detection of 5-hydroxymethylcytosine
WO2013016486A1 (en) * 2011-07-27 2013-01-31 The Board Of Trustees Of The University Of Illinois Nanopore sensors for biomolecular characterization

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20100041057A1 (en) * 2008-08-18 2010-02-18 Life Technologies Corporation Dna methylation detection methods
WO2012054730A1 (en) * 2010-10-22 2012-04-26 Oslo Universitetssykehus Hf Methods and kits for detection of 5-hydroxymethylcytosine
WO2013016486A1 (en) * 2011-07-27 2013-01-31 The Board Of Trustees Of The University Of Illinois Nanopore sensors for biomolecular characterization

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
DONG DENG ET AL: "Recognition of methylated DNA by TAL effectors", CELL RESEARCH, vol. 22, no. 10, 1 October 2012 (2012-10-01), pages 1502 - 1504, XP055084118, ISSN: 1001-0602, DOI: 10.1038/cr.2012.127 *
MIAO YU ET AL: "Base-Resolution Analysis of 5-Hydroxymethylcytosine in the Mammalian Genome", CELL, vol. 149, no. 6, 1 June 2012 (2012-06-01), pages 1368 - 1380, XP055064960, ISSN: 0092-8674, DOI: 10.1016/j.cell.2012.04.027 *

Cited By (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP3214183A1 (en) * 2016-03-01 2017-09-06 Universität Konstanz Transcription activator-like effector (tale)-based decoding of cytosine nucleobases by selective modification response
CN111278848A (en) * 2017-08-04 2020-06-12 北京大学 A TALE RVD that specifically recognizes methylated DNA bases and its application
EP3663310A4 (en) * 2017-08-04 2021-08-11 Peking University TALE-RVD WITH SPECIFIC DETECTION OF A DNA BASE MODIFIED BY METHYLATION AND APPLICATION OF IT
US11897920B2 (en) 2017-08-04 2024-02-13 Peking University Tale RVD specifically recognizing DNA base modified by methylation and application thereof
US11624077B2 (en) 2017-08-08 2023-04-11 Peking University Gene knockout method
CN112708661A (en) * 2021-01-27 2021-04-27 西安交通大学 Visualization analysis method and system for intracellular 5-aldehyde uracil
CN112708661B (en) * 2021-01-27 2022-07-12 西安交通大学 Visualization analysis method and system for intracellular 5-aldehyde uracil

Also Published As

Publication number Publication date
US20160138094A1 (en) 2016-05-19
US9879315B2 (en) 2018-01-30
EP3013979B1 (en) 2017-04-05
EP3013979A1 (en) 2016-05-04

Similar Documents

Publication Publication Date Title
US9879315B2 (en) Direct, programmable detection of epigenetic DNA cytosine modifications using TAL effectors
US12077811B2 (en) Compositions of toehold primer duplexes and methods of use
US20260015668A1 (en) COMPOSITION AND METHODS RELATED TO MODIFICATION OF 5 HYDROXYMETHYLCYTOSINE (5-hmC)
EP2694686B1 (en) COMPOSITION AND METHODS RELATED TO MODIFICATION OF 5-METHYLCYTOSINE (5mC)
EP2297346B1 (en) METHODS AND REAGENTS FOR DETECTING CpG METHYLATION WITH A METHYL CpG BINDING PROTEIN (MBP)
JP2004537257A (en) Methods and probes for detecting and / or quantifying nucleic acid sequences
US6653079B2 (en) Methods for detection of differences in nucleic acids
EP3214183B1 (en) Transcription activator-like effector (tale)-based decoding of cytosine nucleobases by selective modification response
WO2014020124A1 (en) Means and methods for the detection of dna methylation
JP7541586B2 (en) PCR method and PCR kit for enhancing allele discrimination
Conze et al. Analysis of genes, transcripts, and proteins via DNA ligation
KR20260047611A (en) Method to amplify methylated DNA
JP5167485B2 (en) Simple detection method for methylcytosine
CA3164057C (en) Pcr method and pcr kit for increasing allelic discrimination
KR20260026601A (en) DNA sequencing methods
WO2025198958A1 (en) Use of variant-signaling primers for the detection of genetic rearrangements and modifications
US20040235004A1 (en) Methods for detection of differences in nucleic acids
WO2013133402A1 (en) Method for detecting single nucleotide polymorphism in nucleic acid
CA2402483A1 (en) Methods for detection of differences in nucleic acids
AU2001245634A1 (en) Methods for detection of differences in nucleic acids
JP2006280333A (en) Method for analyzing gene insertion site

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 14747293

Country of ref document: EP

Kind code of ref document: A1

REEP Request for entry into the european phase

Ref document number: 2014747293

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2014747293

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 14899483

Country of ref document: US

NENP Non-entry into the national phase

Ref country code: DE