WO2014205111A1 - Toxoid peptides derived from phenol soluble modulin, delta toxin, superantigens, and fusions thereof - Google Patents

Toxoid peptides derived from phenol soluble modulin, delta toxin, superantigens, and fusions thereof Download PDF

Info

Publication number
WO2014205111A1
WO2014205111A1 PCT/US2014/042999 US2014042999W WO2014205111A1 WO 2014205111 A1 WO2014205111 A1 WO 2014205111A1 US 2014042999 W US2014042999 W US 2014042999W WO 2014205111 A1 WO2014205111 A1 WO 2014205111A1
Authority
WO
WIPO (PCT)
Prior art keywords
peptide
seq
amino acid
oligopeptide
acid sequence
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2014/042999
Other languages
French (fr)
Inventor
Mohammad Javad Aman
Rajan Prasad ADHIKARI
Sergey Shulenin
Frederick Wayne Holtsberg
Hatice KARAUZUM
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Integrated BioTherapeutics Inc
Original Assignee
Integrated BioTherapeutics Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Family has litigation
First worldwide family litigation filed litigation Critical https://patents.darts-ip.com/?family=52105236&utm_source=google_patent&utm_medium=platform_link&utm_campaign=public_patent_search&patent=WO2014205111(A1) "Global patent litigation dataset” by Darts-ip is licensed under a Creative Commons Attribution 4.0 International License.
Application filed by Integrated BioTherapeutics Inc filed Critical Integrated BioTherapeutics Inc
Priority to DK14813512.2T priority Critical patent/DK3010535T3/en
Priority to EP14813512.2A priority patent/EP3010535B1/en
Priority to US14/899,993 priority patent/US9815872B2/en
Priority to JP2016521549A priority patent/JP6632974B2/en
Priority to CA2916231A priority patent/CA2916231C/en
Publication of WO2014205111A1 publication Critical patent/WO2014205111A1/en
Anticipated expiration legal-status Critical
Priority to US15/810,419 priority patent/US10174085B2/en
Ceased legal-status Critical Current

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • C07K14/305—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Micrococcaceae (F)
    • C07K14/31—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Micrococcaceae (F) from Staphylococcus (G)
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/02—Bacterial antigens
    • A61K39/085—Staphylococcus
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00—Drugs for disorders of the respiratory system
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/04—Antibacterial agents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00—Drugs for immunological or allergic disorders
    • A61P37/02—Immunomodulators
    • A61P37/04—Immunostimulants
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55511—Organic adjuvants
    • A61K2039/55572—Lipopolysaccharides; Lipid A; Monophosphoryl lipid A
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/70—Multivalent vaccine
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides

Definitions

  • Staphylococcus aureus is a Gram-positive human pathogen that causes a wide range of infections from skin and soft tissue infections (SSTI) to life threatening sepsis and pneumonia. It is a leading cause of hospital- and community-associated infections worldwide (Barrio, et ah, 2006, Microbes Infect, 8 (8):2068-2074; Brown, et ah, 2009 Clin Microbiol Infect, 15 (2):156-164; Colin, et ah 1994, Infect Immun, 62 (8):3184-3188).
  • the range of pathologies reflects the diverse abilities of SA to escape the immune response using a plethora of virulence factors: the superantigenic and pore-forming toxins, coagulase, capsular polysaccharide, adhesins, proteases, complement inactivating exoproteins, and other innate response modifiers (Barrio, et al, 2006, Microbes Infect, 8 (8):2068-2074; Deurenberg and Stobberingh, 2008, Infect Genet Evol, 8 (6):747-763).
  • Alpha hemolysin (a-toxin, Hla) is a major virulence factor in SA pneumonia and SSTI (Bubeck Wardenburg and Schneewind, 2008, J Exp Med, 205 (2):287-294; Kennedy, et al, 2010, J Infect Dis, 202 (7):1050-1058).
  • PSMs phenol soluble modulins
  • delta hemolysin or delta toxin 5toxin
  • delta hemolysin or delta toxin 5toxin
  • a recent epidemiological study in a cohort of patients with SA bacteremia shows inverse correlation between probability of sepsis and pre-existing antibodies to Hla, PSM-a3, as well as ⁇ -toxin (Adhikari, et al, 2012, J Infect Dis, 206 (6):915-923).
  • Staphylococcal superantigens induce a massive release of cytokines and chemokines, enhanced expression and activation of adhesion molecules, increased T-cell proliferation, and ultimately T-cell apoptosis/anergy.
  • TSS Toxic Shock Syndrome
  • aureus vaccines including superantigens is that there are more than 20 different SAgs and there is a wide range of variability in SAg presence in clinical isolates because most SEs are on mobile genetic elements, such as plasmids or pathogenicity islands (Staphylococcal enterotoxin K(sek), (Staphylococcal enterotoxin Q seq), lysogenic phages (Staphylococcal enterotoxin A (sea), or antibiotic resistance cassettes, like SCCmec (Staphylococcal enterotoxin H (seh) (Omoe, et al., 2002, J Clin Microbiol, 40 (3):857-862).
  • SCCmec Staphylococcal enterotoxin H (seh)
  • Superantigens appear to be toxic shock syndrome toxin 1 (TSST- 1) and (Staphylococcal enterotoxin C (SEC), followed by (Staphylococcal enterotoxin A (SEA), (Staphylococcal enterotoxin D (SED), and (Staphylococcal enterotoxin B (SEB). More recent studies show the emergence of (Staphylococcal enterotoxin K (SEK) and (Staphylococcal enterotoxinQ (SEQ), primarily due to circulation of the USA300 clone.
  • Attenuated Superantigen toxoids for (Staphylococcal enterotoxin (SEA), (Staphylococcal enterotoxin B (SEB), and TSST-1 have been designed and tested in animal models of toxic shock. These mutants are deficient in binding to MHC class II protein and therefore lack superantigenic activity (subject of patents 6, 713,284; 6,399,332; 7,087,235; 7, 750,132; 7,378,257, and 8,067,202). A simplified superantigen toxoid vaccine capable of inducing broad neutralizing antibodies is therefore highly is needed to be practical for inclusion into a multivalent S. aureus vaccine.
  • Phenol Soluble modulins (PSMs) and Delta-Hemolysin( -toxin) S. aureus secretes four short ( ⁇ 20 amino acids, a-type) and two longer ( ⁇ 40 amino acids, ⁇ -type) cytolytic peptides, known as phenol soluble modulin (PSM) (Wang, et al., 2007, Nat Med, 13 (12):1510-1514).
  • PSM phenol soluble modulin
  • SA produces 6-toxin, which is similar to the a-type PSMs.
  • PSM-mec staphylococcal methicillin resistance mobile genetic element SCCmec
  • PSMs are lytic towards neutrophils, the first line of host defense against SA (Wang, et ah, 2007, Nat Med, 13 (12):1510-1514). Furthermore, recent studies indicate a synergistic effect on hemolytic activity of ⁇ -hemolysin (Cheung, et al., 2012, Microbes Infect, 14 (4):380-386). A key role of PSMs in pathogenesis has been shown in mouse models of bacteremia and SSTI using deletion mutants (Wang, et al., 2007, Nat Med, 13 (12):1510-1514).
  • ⁇ -Toxin is encoded by the hid gene located within RNAIII transcript of agr locus.
  • RNAIII is a regulatory RNA and plays a major role in regulation of SA quorum-sensing system for the expression of various virulence genes (Novick, 2003, Mol Microbiol, 48 (6):1429-1449; Novick, et al, 1993, EMBO J, 12 (10):3967-3975). With increased expression of RNAIII, the level of extracellular ⁇ -toxin is increased reaching almost half the amount of total exoproteins at the stationary phase (Kreger, et al, 1971, Infect Immun, 3
  • aureus from phago-endosomes of human epithelial and endothelial cells in the presence of beta-toxin (Giese, et al, 201 1, Cell Microbiol, 13 (2):316-329) by acting as a costimulator of human neutrophil oxidative burst (Schmitz, et al, 1997, J Infect Dis, 176 (6): 1531-1537).
  • S. aureus alpha hemolysin (Hla): The pore forming toxins form oligomeric beta barrel pores in the plasma membrane and play an important role for bacterial spread and survival, immune evasion and tissue destruction.
  • SA alpha-toxin (Bhakdi and Tranum- Jensen, 1991, Microbiol Rev, 55 (4):733-751) targets many cells such as lymphocytes, macrophages, pulmonary epithelial cells and endothelium, and erythrocytes (Bhakdi and Tranum-Jensen, 1991, Microbiol Rev, 55 (4):733-751; McElroy, et al, 1999, Infect Immun, 67 (10):5541-5544).
  • Hla is encoded by a chromosomal determinant (Brown and Pattee, 1980, Infect Immun, 30 (l):36-42), and expressed in most SA isolates (Aarestrup, et ah, 1999, APMIS, 107 (4):425-430;Bhakdi and Tranum-Jensen, 1991, Microbiol Rev, 55 (4):733-751; Husmann, et al., 2009, FEBS Lett, 583 (2):337-344; Shukla, et al., 2010, J Clin Microbiol, 48 (10):3582-3592); ii) A partially attenuated Hla (H35L) and antibodies to Hla protect mice against SA pneumonia and skin infections (Kennedy, et al., 2010, J Infect Dis, 202 (7):1050-1058; Bubeck Wardenburg and Schneewind, 2008,
  • WO 2012/109167 A 1 describes a rationally designed mutant vaccine for Hla referred to as AT62. Immunization of mice with AT62 protected the animals against S. aureus lethal sepsis and pneumonia (Adhikari, et al., 2012, PLoS One, 7 (6):e38567). Furthermore, antibodies raised against AT62 protected mice from lethal sepsis induced by S. aureus (Adhikari, et al., 2012, PLoS One, 7 (6):e38567).
  • PVL Panton- Valentine Leukocidin
  • cytolytic toxins known as leukotoxins that is produced by several CA-MRSA lineages (Diep and Otto, 2008, Trends Microbiol, 16 (8):361-369).
  • the bi-component hemolysins and leukotoxins play an important role in staphylococcal immune evasion. These toxins kill key immune cells and cause tissue destruction, thereby often weakening the host during the first stage of infection and promoting bacterial dissemination and metastatic growth in distant organs.
  • the two PVL components LukS-PV and LukF-PV are secreted separately, and form the pore-forming octameric complex upon binding of LukS-PV to its receptor and subsequent binding of LukF-PV to LukS-PV (Miles, et al, 2002, Protein Sci, 11 (4):894-902; Pedelacq, et al, 2000, Proc Natl Acad Sci U S A, 109 (4): 1281-1286).
  • Targets of PVL are polymorphonuclear phagocytes (PMN), monocytes, and macrophages.
  • PVL is associated with primary skin infections, such as furunculosis and severe necrotizing pneumonia that rapidly progresses towards acute respiratory distress syndrome.
  • the role of PVL in skin, bone, and lung infections has been shown in animal models (Brown, et al, 2009 Clin Microbiol Infect, 15 (2):156-164; Cremieux, et al, 2009, PLoS ONE, 4 (9):e7204; Diep, et al, 2010, Proc Natl Acad Sci USA, 107 (12):5587-5592; Tseng, et al, 2009 PLoS ONE, 4 (7):e6387; Varshney, et al, 2010, J Infect Dis l;201(l):92-6).
  • PVL-positive CA-MRSA affect healthy children or young adults that had neither any recent contact with health care facilities nor with any risk factors with a mortality of up to 75% (Gillet, et al., 2002, Lancet, 359 (9308):753-759; Lina, et al, 1999, Clin Infect Dis, 29 (5): 1128-1132).
  • PCT application No. PCT/US 12/67483 discloses rationally designed mutants vaccine for LukS-PV and LukF-PV. Immunization of mice with these mutants protected the animals against S. aureus lethal sepsis (Karauzum, et al, 2013, PLoS ONE, 8 (6):e65384). Furthermore, antibodies raised against LukS-PV mutant protected mice from lethal sepsis induced by S. aureus (Karauzum, et al, 2013, PLoS ONE, 8 (6):e65384).
  • Staphylococcus aureus enterotoxins Superantigens (SAgs) constitute a large family of pyrogenic toxins composed of staphylococcal enterotoxins (SEs) and toxic shock syndrome toxin 1 (TSST-1) (Johns and Khan, 1988, J Bacteriol, 170 (9):4033-4039).
  • SEs staphylococcal enterotoxins
  • TSST-1 toxic shock syndrome toxin 1
  • TSS Toxic Shock Syndrome
  • Antibodies play an important role in protection against TSS (Bonventre, et al, 1984, J Infect Dis, 150 (5):662-666; Notermans, et al, 1983, J Clin Microbiol, 18 (5):1055-1060), thus individuals that do not seroconvert towards the offending toxin due to hyporesponsive T-cells (Mahlknecht, et al, 1996, Hum Immunol, 45 (l):42-4) and/or T-cell dependent B-cell apoptosis (Hofer, et al, 1996, Proc Natl Acad Sci U S A, 93 (11):5425- 5430) are more likely to experience recurring bouts.
  • CD4 T cells can further impair effective antibody response to other S. aureus antigens. Furthermore, at lower non-TSS inducing concentrations SAgs impact the virulence of S. aureus strains through induction of a local excessive inflammatory response. Attenuated mutants of SEs and TSST- 1 have been developed that are deficient in binding to MHC-class II molecules. These mutants can serve as a vaccine for S. aureus infections as well as toxic shock syndrome by inducing neutralizing antibodies against superantigens.
  • the disclosure provides a recombinant peptide that can include a
  • Staphylococcus aureus delta toxin peptide or a mutant, fragment, variant or derivative thereof DT
  • a Staphylococcus aureus phenol soluble modulin peptide or a mutant, fragment, variant or derivative thereof PSM
  • a fusion of a DT and a PSM where the peptide is attenuated relative to wild-type DT, PSM, or both, and where the peptide can elicit an anti- Staphylococcus aureus immune response when administered to a subject.
  • surfactant properties of the DT, PSM, or both is reduced, while maintaining immunogenicity.
  • hydrophobicity is reduced while maintaining the peptide's alpha-helical structure.
  • At least one hydrophobic amino acid is replaced with a less hydrophobic amino acid, for example, valine (V), leucine (L), isoleucine (I), phenylalanine (F), or methionine (M) can be replaced with glycine or alanine.
  • V valine
  • L leucine
  • I isoleucine
  • F phenylalanine
  • M methionine
  • the disclosure provides a DT that includes the amino acid sequence
  • X 5 is isoleucine (I), glycine (G) or alanine (A)
  • X 6 is I, G, or A
  • X 9 is I, G, or A
  • X 12 is leucine (L)
  • G, or V is valine (V)
  • G, or A X 16 is I, G, or A
  • X 17 is I, G, or A
  • X 20 is V, G, or A.
  • the peptide includes the amino acid sequence SEQ ID NO: 2. In certain aspects the peptide includes the amino acid sequence SEQ ID NO: 4. In certain aspects the peptide includes the amino acid sequence SEQ ID NO: 3. In certain aspects the peptide includes the amino acid sequence SEQ ID NO: 5.
  • the disclosure further provides a PSM that can be PSMal, PSMa2, PSMa3, PSMa4,
  • PSMpi PSMp2, PSM-mec, or any combination of two or more PSMs.
  • the disclosure provides a PSMal mutant including the amino acid sequence
  • M methionine
  • the disclosure provides a PSMa2 mutant including the amino acid sequence X 1 GX 3 X 4 AGX 7 X 8 KX 1 oX 11 KGXi 4 X 15 EKX 18 TG (SEQ ID NO: 41), where at least one of Xi, X 3 , X4, X 7 , Xg, X 10 , Xn, XM , ⁇ 15 , or X ⁇ $ includes an amino acid substitution relative to SEQ ID NO: 12, and where is M, G, or A, X 3 is I, G, or A, X 4 is I, G, or A, X 7 is I, G, or A, Xg is I, G, or A, X 10 is F, G, or A, Xn is I, G, or A, X 14 is L, G, or A, X) 5 is I, G, or A, and Xi 8 is F, G, or A.
  • the disclosure provides a PSMa3 mutant including the amino acid sequence X 1 EX 3 X 4 AKX7X8KX 1 oXnKDX 1 4Xi 5 GKX 18 X 19 GNN (SEQ ID NO: 42), where at least one of X l5 X 3 , 3 ⁇ 4, X 7 , Xg, X 10 , Xn, X 14 ,X 15 , X 18 , or X 19 includes an amino acid substitution relative to SEQ ID NO: 6, and where X ⁇ is M, G, or A, X 3 is F, G, or A, * is V, G, or A, X 7 is L, G, or A, Xs is F, G, or A, X 10 is F, G, or A, Xn is F, G, or A, Xi 4 is L, G, or A, X 15 is L, G, or A, Xj 8 is F, G, or A, and X 19 is L, G, or A.
  • the peptide includes the amino acid sequence SEQ ID NO: 7. In certain aspects the peptide includes the amino acid sequence SEQ ID NO: 9. In certain aspects the peptide includes the amino acid sequence SEQ ID NO: 8. In certain aspects the peptide includes the amino acid sequence SEQ ID NO: 10. In certain aspects the peptide includes the amino acid sequence e SEQ ID NO: 11.
  • the disclosure provides a PSMa4 mutant including the amino acid sequence XiAX 3 3 ⁇ 4GTX 7 X 8 KX 1 oXnKAXi4X 1 5DX 17 X 1 8AK (SEQ ID NO: 43), where at least one of Xi, X 3 , X4, X 7 , X 8 , X 10 , Xn, n ,Xi5, Xn, or X 18 includes an amino acid substitution relative to SEQ ID NO: 14, and where Xi is M, G, or A, X 3 is I, G, or A, X4 is V, G, or A, X 7 is I, G, or A, X 8 is I, G, or A, X 10 is I, G, or A, Xn is I, G, or A, X 14 is I, G, or A, X 15 is I, G, or A, X17 is I, G, or A, and X 18 is F, G, or A.
  • the disclosure provides
  • MEGX 4 X 5 NAX 8 KDTX 12 TAAX 16 NNDGAKLGTSIVNIVENGVGLLSKLFGF (SEQ ID NO: 44), where at least one of X4, X5, X 8 , X 12 , or Xi 6 includes an amino acid substitution relative to SEQ ID NO: 15, and where X4 is L, G, or A, X 5 is F, G, or A, X 8 is I, G, or A, X 12 is V, G, or A, and Xi 6 is I, G, or A.
  • the disclosure provides a PSMP2 mutant including the amino acid sequence MTGX4AEAX 8 ANTX 12 QAAQQHDSVKX 23 GTSIVDIVANGVGLLGKLFGF (SEQ ID NO: 45), where at least one of X4, Xg, X 12 , or X 23 includes an amino acid substitution relative to SEQ ID NO: 16, and where X4 is L, G, or A, X 8 is I, G, or A, X 12 is V, G, or A, and X 23 is L, G, or A.
  • the disclosure further provides a multivalent oligopeptide that includes a fusion of two or more Staphylococcus aureus-fenved peptides, or mutants, fragments, variants, or derivatives thereof arranged in any order, where the two or more Staphylococcus aureus- derived peptides, or mutants, fragments, variants, or derivatives thereof can be the same or different, and where the multivalent oligopeptide includes two or more of: a wild-type DT, or a mutant DT, e.g., as described herein; a wild-type PSM, or a mutant PSM, e.g., as described herein; an alpha hemolysin polypeptide or mutant, fragment, variant, or derivative thereof; a leukocidin polypeptide or mutant, fragment, variant, or derivative thereof; or a superantigen (SAg) polypeptide, or mutant, fragment, variant, or derivative thereof.
  • SAg superantigen
  • a multivalent oligopeptide as provided herein can include an alpha hemolysin polypeptide or mutant, fragment, variant, or derivative thereof such as the amino acid sequence SEQ ID NO: 46 (AT-62).
  • a multivalent oligopeptide as provided herein can include a Panton- Valentine leukocidin (PVL) LukS-PV subunit such as an amino acid sequence at least 90% identical to SEQ ID NO: 47, a LukS-Mut9 (SEQ ID NO: 54), a Panton- Valentine leukocidin (PVL) LukF-PV subunit such as an amino acid sequence at least 90% identical to SEQ ID NO: 48, a LukF-Mut-1 (SEQ ID NO: 55), or a combination thereof.
  • PVL Panton- Valentine leukocidin
  • PVL Panton- Valentine leukocidin
  • LukF-PV subunit such as an amino acid sequence at least 90% identical to SEQ ID NO: 48, a LukF-M
  • a multivalent oligopeptide as provided herein can include a staphylococcal enterotoxin B (SEB) or mutant, fragment, variant, or derivative thereof such as an amino acid sequence at least 90% identical to SEQ ID NO: 49, a staphylococcal enterotoxin A (SEA) or mutant, fragment, variant, or derivative thereof such as an amino acid sequence at least 90% identical to SEQ ID NO: 50, a staphylococcal toxic shock syndrome toxin- 1 or mutant, fragment, variant, or derivative thereof such as an amino acid sequence at least 90% identical to SEQ ID NO: 51, or any combination thereof.
  • SEB staphylococcal enterotoxin B
  • SEA staphylococcal enterotoxin A
  • a multivalent oligopeptide as provided herein can include linkers connecting the two or more Staphylococcus awrews-derived peptides, or mutants, fragments, variants, or derivatives thereof are associated via a linker.
  • the linker can include, e.g., at least one, but no more than 50 amino acids selected from the group consisting of glycine, serine, alanine, and a combination thereof.
  • the linker includes (GGGS) n or (GGGGS) thread, where n is a integer from 1 to 10.
  • Exemplary multivalent oligopeptides provided by the disclosure include, without limitation, the amino acid sequence SEQ ID NO: 18, SEQ ID NO: 20, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 26, SEQ ID NO: 29, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO. 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, or any combination thereof.
  • Any peptide or oligopeptide provided by the disclosure can further include a heterologous peptide or polypeptide including, but not limited to a His-tag, a ubiquitin tag, a NusA tag, a chitin binding domain, a B-tag, a HSB-tag, green fluorescent protein (GFP), a calmodulin binding protein (CBP), a galactose-binding protein, a maltose binding protein (MBP), cellulose binding domains (CBD's), an avidin/streptavidin/Strep-tag, trpE, chloramphenicol acetyltransferase, lacZ ( ⁇ -Galactosidase), a FLAGTM peptide, an S-tag, a T7-tag, a fragment of any of the heterologous peptides, or a combination of two or more of the heterologous peptides.
  • the heterologous peptide or polypeptide including
  • any peptide or oligopeptide provided by the disclosure can further include an immunogenic carbohydrate, e.g., a saccharide.
  • the immunogenic carbohydrate can be a capsular polysaccharide or a surface polysaccharide.
  • the immunogenic carbohydrate can include, without limitation, capsular polysaccharide (CP) serotype 5 (CP5), CP8, poly-N- acetylglucosamine (PNAG), poly-N-succinyl glucosamine (PNSG), Wall Teichoic Acid (WTA), Lipoteichoic acid (LTA), a fragment of any of the immunogenic carbohydrates, and a combination of two or more of the immunogenic carbohydrates.
  • the immunogenic carbohydrate is conjugated to the oligopeptide.
  • the disclosure further provides an isolated polynucleotide that includes a nucleic acid any peptide or oligopeptide provided herein, and any combination thereof.
  • the polynucleotide can further include a heterologous nucleic acid, e.g., a. promoter operably associated with the nucleic acid encoding the multivalent oligopeptide, DT, PSM, or any combination thereof.
  • the disclosure provides a vector that includes the polynucleotide provided by the disclosure, e.g., a plasmid.
  • the disclosure provides a host cell that includes a vector provided by the disclosure.
  • the host cell can be, e.g., a bacterium, e.g., Escherichia coli, an insect cell, a mammalian cell or a plant cell.
  • the disclosure further provides a method of producing a multivalent oligopeptide
  • DT, PSM, or any combination thereof as provided herein, that includes culturing the host cell of any one of claims 61 to 63, and recovering the oligopeptide, DT, PSM, or any combination thereof.
  • the disclosure further provides a composition that includes any peptide, oligopeptide, or combination thereof provided by the disclosure, and a carrier.
  • the composition further includes an adjuvant that can be, without limitation, alum, aluminum hydroxide, aluminum phosphate, or a glucopyranosyl lipid A-based adjuvant.
  • the composition further includes an immunogen that can be, without limitation, a bacterial antigen such as a pore forming toxin, a superantigen, a cell surface protein, a fragment of any of the bacterial antigens, or a combination of two or more of the bacterial antigens.
  • the disclosure further provides a method of inducing a host immune response against
  • the immune response is an antibody response, an innate response, a humoral response, a cellular response, and a combination of two or more of the immune responses.
  • the disclosure further provides a method of preventing or treating a Staphylococcal, Streptococcal, or Enterococcal disease or infection in a subject that includes administering to a subject in need thereof the composition of the disclosure.
  • the infection can be, e.g., a localized or systemic infection of skin, soft tissue, blood, or an organ, or can be auto-immune in nature.
  • the disease is a respiratory disease, e.g., pneumonia.
  • the disease is sepsis.
  • a subject to be treated by the methods of the disclosure can be a mammal, e.g., a human, bovine, or canine.
  • the composition can be administered to the subject via intramuscular injection, intradermal injection, intraperitoneal injection, subcutaneous injection, intravenous injection, oral administration, mucosal administration, intranasal administration, or pulmonary administration.
  • the disclosure further provides a method of producing a vaccine against S. aureus infection that includes: isolating a peptide or oligopeptide as provided by this disclosure, or any combination thereof; and combining the peptide, oligopeptide, or any combination thereof with an adjuvant.
  • Figurel A) Helical wheel representation of PSM-al-4, PSM-pl&2, and ⁇ -toxin showing the hydrophobic and hydrophilic surfaces.
  • Polar amino acids are represented in red (D, E: - charge) and blue (R, K: + charge); Polar amino acids in pink/ violet (Q, N, T); Hydrophobic in yellow (F, L, I) and such that are not disturbing hydrophobicity are marked in grey (A) or in green (P) for their aromatic side-chain.
  • Figure 2 Delta toxin mutants toxicity assay. WT and mutants at concentration of 12.5 ⁇ g/ml were tested in different % of horse RBC. Hemolysis ODs were measured at 416nm.
  • Figure 3 DT-ala2 mutant is highly attenuated while retaining binding to human neutralizing antibodies (compare 3 rd and 7 th bar).
  • Figure 4 PSM mutants toxicity assay. WT and mutants at different concentration were tested in different 5 % of horse RBC. Hemolysis ODs were measured at 416nm.
  • Figure 5 A) Schematic of three fusion proteins generated with flexible linkers (G4S, denoted as L) and a 6xHis tag. B) Schematic of the secondary structure of AT62-DT-PSM construct. C) Candidate peptides were expressed in E. coli and tested by Western blot using an AT62 specific mAb. Lanes 1 and 2: AT62_DT_PSM; 3 and 4: AT62_PSM; 5 and 6: AT62_DT (Two clones for each construct are shown).
  • Figure 6 Antibody response of mice immunized with AT62-PSM and AT62-DT against wild type peptides or full length alpha hemolysin (Hla).
  • Figure 7 A) Schematic of three fusion proteins: AT-62, rSEB and DT generated with flexible linkers (G4S, denoted as L).
  • Figure 8 Human antibodies to SEA, SEB, and TSST-1 were affinity purified from human IVIG and used in toxin neutralization assays with human PBMC against the SAgs shown on the X axes.
  • the Y axis shows the molar ratio of antibody to toxin required for 50% inhibition of superantigenic activity of the respective SAg on the X axis.
  • the panel titled Cocktail shows the activity of the combination of the three antibodies. Note that lower molar ratio indicates higher neutralizing activity towards the respective toxin. DETAILED DESCRIPTION
  • a or “an” entity refers to one or more of that entity; for example, “a polynucleotide,” is understood to represent one or more polynucleotides.
  • the terms “a” (or “an”), “one or more,” and “at least one” can be used interchangeably herein.
  • Amino acids are referred to herein by their commonly known three letter symbols or by the one-letter symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission. Nucleotides, likewise, are referred to by their commonly accepted single-letter codes.
  • nucleic acid or “nucleic acid fragment” refers to any one or more nucleic acid segments, e.g., DNA or RNA fragments, present in a polynucleotide or construct.
  • Two or more nucleic acids of the disclosure can be present in a single polynucleotide construct, e.g., on a single plasmid, or in separate (non-identical) polynucleotide constructs, e.g., on separate plasmids.
  • any nucleic acid or nucleic acid fragment can encode a single polypeptide, e.g., a single antigen, cytokine, or regulatory polypeptide, or can encode more than one polypeptide, e.g., a nucleic acid can encode two or more polypeptides.
  • a nucleic acid can encode a regulatory element such as a promoter or a transcription terminator, or can encode a specialized element or motif of a polypeptide or protein, such as a secretory signal peptide or a functional domain.
  • polynucleotide is intended to encompass a singular nucleic acid or nucleic acid fragment as well as plural nucleic acids or nucleic acid fragments, and refers to an isolated molecule or construct, e.g., a virus genome (e.g., a non-infectious viral genome), messenger RNA (mRNA), plasmid DNA (pDNA), or derivatives of pDNA (e.g., minicircles as described in (Darquet, A-M et al, Gene Therapy 4:1341-1349, 1997) comprising a polynucleotide.
  • virus genome e.g., a non-infectious viral genome
  • mRNA messenger RNA
  • pDNA plasmid DNA
  • derivatives of pDNA e.g., minicircles as described in (Darquet, A-M et al, Gene Therapy 4:1341-1349, 1997) comprising a polynucleotide.
  • a polynucleotide can be provided in linear (e.g., mRNA), circular (e.g., plasmid), or branched form as well as double-stranded or single-stranded forms.
  • a polynucleotide can comprise a conventional phosphodiester bond or a non-conventional bond (e.g., an amide bond, such as found in peptide nucleic acids (PNA)).
  • PNA peptide nucleic acids
  • polypeptide is intended to encompass a singular
  • polypeptide as well as plural “polypeptides,” and comprises any chain or chains of two or more amino acids.
  • a "peptide,” an “oligopeptide,” a “dipeptide,” a “tripeptide,” a “protein,” an “amino acid chain,” an “amino acid sequence,” “a peptide subunit,” or any other term used to refer to a chain or chains of two or more amino acids are included in the definition of a "polypeptide,” (even though each of these terms can have a more specific meaning) and the term “polypeptide” can be used instead of, or interchangeably with any of these terms.
  • the term further includes polypeptides which have undergone post- translational modifications, for example, glycosylation, acetylation, phosphorylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage, or modification by non-naturally occurring amino acids.
  • phenol-soluble modulin PSM
  • PSMal PSMa2, PSMa3, PSMa4, PSMpi, PSMP2, and PSM-mec
  • wild-type phenol-soluble modulin peptides as well as mutants, fragments, variants or derivatives thereof.
  • corresponding wild-type DT or “corresponding wild-type PSM” is meant the native DT or PSM peptide from which a mutant peptide subunit was derived.
  • multivalent oligopeptide refers to a fusion protein comprising two or more staphylococcal proteins, e.g., DT, PSM, alpha hemolysin, leukocidin, superantigen, or any fragments, variants, derivatives, or mutants thereof fused together as a single polypeptide in any order.
  • An oligopeptide can include other heterologous peptides as described elsewhere herein.
  • Other peptides for inclusion in a multivalent oligopeptide provided herein include various other staphylococcal toxins or mutants fragments, variants, or derivatives thereof, described elsewhere herein or in PCT Publication Nos. WO 2012/109167A1 and WO 2013/082558 Al, which are both incorporated by reference herein in their entireties.
  • This disclosure provides specific DT and PSM peptides as well as multivalent oligopeptides that can, but do not necessarily include either a wild-type or mutant DT, PSM, or any combination thereof.
  • the collection of peptides and oligopeptides provided by the disclosure are collectively referred to herein as a "multivalent oligopeptide, DT, and/or PSM," or a "multivalent oligopeptide, DT, PSM, or any combination thereof.”
  • These collective references are meant to include, without limitation, any one peptide or oligopeptide as provided herein, or two, three, four, or more peptides or oligopeptides as provided herein.
  • fragment when referring to a multivalent oligopeptide, DT, and/or PSM of the present disclosure include any polypeptide which retains at least some of the immunogenicity or antigenicity of the source protein or proteins.
  • Fragments of multivalent oligopeptides, DTs, and/or PSMs as described herein include proteolytic fragments, deletion fragments or fragments that exhibit increased solubility during expression, purification, and/or administration to an animal.
  • Fragments of multivalent oligopeptides, DTs, and/or PSMs as described herein further include proteolytic fragments or deletion fragments which exhibit reduced pathogenicity or toxicity when delivered to a subject.
  • Polypeptide fragments further include any portion of the polypeptide which comprises an antigenic or immunogenic epitope of the source polypeptide, including linear as well as three-dimensional epitopes.
  • An “epitopic fragment” of a polypeptide is a portion of the polypeptide that contains an epitope.
  • An “epitopic fragment” can, but need not, contain amino acid sequence in addition to one or more epitopes.
  • variant refers to a polypeptide that differs from the recited polypeptide due to amino acid substitutions, deletions, insertions, and/or modifications.
  • Non- naturally occurring variants can be produced using art-known mutagenesis techniques.
  • variant polypeptides differ from an identified sequence by substitution, deletion or addition of three amino acids or fewer.
  • Such variants can generally be identified by modifying a polypeptide sequence, and evaluating the antigenic or pathogenic properties of the modified polypeptide using, for example, the representative procedures described herein.
  • variants of a multivalent oligopeptide, DT, and/or PSM form a protein complex which is less toxic than the wild-type complex.
  • Polypeptide variants disclosed herein exhibit at least about 85%, 90%, 94%, 95%,
  • Variant polypeptides can comprise conservative or non-conservative amino acid substitutions, deletions or insertions.
  • Variants can comprise multivalent oligopeptides, DTs, and/or PSMs identical to the various wild-type staphylococcal proteins except for at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or more amino acid substitutions, including specific mutations described elsewhere herein, where the substitutions render complex less toxic than a corresponding wild-type protein complex.
  • Derivatives of multivalent oligopeptides, DTs, and/or PSMs as described herein are polypeptides which have been altered so as to exhibit additional features not found on the native polypeptide.
  • Examples include fusion proteins.
  • An analog is another form of a multivalent oligopeptide, DT, and/or PSM described herein.
  • An example is a proprotein which can be activated by cleavage of the proprotein to produce an active mature polypeptide.
  • Variants can also, or alternatively, contain other modifications, whereby, for example, a polypeptide can be conjugated or coupled, e.g., fused to a heterologous amino acid sequence, e.g., a signal (or leader) sequence at the N-terminal end of the protein which co- translationally or post-translationally directs transfer of the protein.
  • the polypeptide can also be conjugated or produced coupled to a linker or other sequence for ease of synthesis, purification or identification of the polypeptide (e.g., 6-His), or to enhance binding of the polypeptide to a solid support.
  • the polypeptide can be conjugated or coupled to an immunoglobulin Fc region.
  • the polypeptide can also be conjugated or coupled to a sequence that imparts or modulates the immune response to the polypeptide (e.g., a T-cell epitope, B-cell epitope, cytokine, chemokine, etc.) and/or enhances uptake and/or processing of the polypeptide by antigen presenting cells or other immune system cells.
  • the polypeptide can also be conjugated or coupled to other polypeptides/epitopes from Staphylococcus sp. and/or from other bacteria and/or other viruses to generate a hybrid immunogenic protein that alone or in combination with various adjuvants can elicit protective immunity to other pathogenic organisms.
  • the polypeptide can also be conjugated or coupled to moieties which confer greater stability or improve half life such as, but not limited to albumin, an immunoglobulin Fc region, polyethylene glycol (PEG), and the like.
  • the polypeptide can also be conjugated or coupled to moieties (e.g., immunogenic carbohydrates, e.g., a capsular polysaccharide or a surface polysaccharide) from Staphylococcus sp. and/or from other bacteria and/or other viruses to generate a modified immunogenic protein that alone or in combination with one or more adjuvants can enhance and/or synergize protective immunity.
  • the polypeptide described herein further comprises an immunogenic carbohydrate.
  • the immunogenic carbohydrate is a saccharide.
  • polysaccharide throughout this specification can indicate polysaccharide or oligosaccharide and includes both.
  • Polysaccharides of the disclosure can be isolated from bacteria and can be sized by known methods. For example, full length polysaccharides can be "sized" (e.g., their size can be reduced by various methods such as acid hydrolysis treatment, hydrogen peroxide treatment, sizing by EMULSIFLEX® followed by a hydrogen peroxide treatment to generate oligosaccharide fragments or microfluidization).
  • Polysaccharides can be sized in order to reduce viscosity in polysaccharide samples and/or to improve filterability for conjugated products.
  • Oligosaccharides have a low number of repeat units (e.g., 5-30 repeat units) and are typically hydrolyzed polysaccharides. Polysaccharides of the disclosure can be produced recombinantly.
  • S. aureus capsular antigens are surface associated, limited in antigenic specificity, and highly conserved among clinical isolates.
  • the immunogenic carbohydrate of the disclosure is a capsular polysaccharide (CP) of S. aureus.
  • CP capsular polysaccharide
  • a capsular saccharide can be a full length polysaccharide, however in other embodiments it can be one oligosaccharide unit, or a shorter than native length saccharide chain of repeating oligosaccharide units.
  • Type 5 and 8 capsular polysaccharides purified from the prototype strains Reynolds and Becker, respectively, are structurally very similar to each other and to the capsule made by strain T, described previously by Wu and Park (Wu and Park. 1971. J. Bacteriol. 108:874-884).
  • Type 5 has the structure ( ⁇ 4)-3-0-Ac-B-D- ManNAcA-(l ⁇ 4)- «-L-FucNAc-(l ⁇ 3)-B-D-FucNAc-(l ⁇ ) subject (Fournier, J. M., et al, 1987. Ann. Inst. Pasteur Microbiol.
  • Type 5 and 8 polysaccharides differ only in the linkages between the sugars and in the sites of O-acetylation of the mannosaminuronic acid residues, yet they are serologically distinct.
  • Type 5 and 8 CP conjugated to a detoxified recombinant Pseudomonas aeruginosa exotoxin A carrier were shown to be highly immunogenic and protective in a mouse model (A Fattom et al, Infect Immun. 1993 March; 61(3): 1023-1032; A Fattom et al, Infect Immun. 1996 May; 64(5): 1659-1665 ) and passive transfer of the CP5-specific antibodies from the immunized animals induced protection against systemic infection in mice (Lee et al, Infect Immun. 1997 October; 65(10): 4146-4151) and against endocarditis in rats challenged with a serotype 5 S.
  • the recombinant peptide or multivalent oligopeptide of the disclosure is combined with or conjugated to an immunogenic carbohydrate ⁇ e.g., CP5, CP8, a CP fragment or a combination thereof).
  • an immunogenic carbohydrate ⁇ e.g., CP5, CP8, a CP fragment or a combination thereof.
  • PNSG poly-N-succinyl glucosamine
  • PNSG is also made by S. aureus, where it is an environmentally regulated, in v vo-expressed surface polysaccharide and similarly serves as a target for protective immunity (McKenney D. et al. , J. Biotechnol.
  • the immunogenic carbohydrate is a surface polysaccharide, e.g., poly-N-acetylglucosamine (PNAG), poly-N- succinyl glucosamine (PNSG), a surface polysaccharide fragment or a combination thereof.
  • PNAG poly-N-acetylglucosamine
  • PNSG poly-N- succinyl glucosamine
  • Wall Teichoic Acid is a prominent polysaccharide widely expressed on S. aureus strains (Neuhaus, F.C. and J. Baddiley, Microbiol Mol Biol Rev, 2003. 67(4):686- 723) and antisera to WTA have been shown to induce opsonophagocytic killing alone and in presence of complement ((Thakker, M., et al., Infect Immun, 1998. 66(11):5183-9), and Fattom et al, US Patent 7, 754,225).
  • WTA is linked to peptidoglycans and protrudes through the cell wall becoming prominently exposed on non-encapsulated strains such as US A300 responsible for most cases of community acquired MRSA (CA MRSA) in the US (Hidron, A.I., et al, Lancet Infect Dis, 2009. 9(6):384-92).
  • CA MRSA community acquired MRSA
  • Lipoteichoic acid is a constituent of the cell wall of Gram-positive bacteria, e.g., Staphylococcus aureus. LTA can bind to target cells non-specifically through membrane phospholipids, or specifically to CD14 and to Toll-like receptors. Target-bound LTA can interact with circulating antibodies and activate the complement cascade to induce a passive immune kill phenomenon. It also triggers the release from neutrophils and macrophages of reactive oxygen and nitrogen species, acid hydrolases, highly cationic proteinases, bactericidal cationic peptides, growth factors, and cytotoxic cytokines, which can act in synergy to amplify cell damage.
  • LTA Lipoteichoic acid
  • a surface polysaccharide is combined with or conjugated to a polypeptide of the disclosure.
  • the surface polysaccharide is, e.g., poly-N-acetylglucosamine (PNAG), poly-N-succinyl glucosamine (PNSG), Wall Teichoic Acid (WTA), Lipoteichoic acid (LP A), a fragment of any of said surface polysaccharides, or a combination of two or more of said surface polysaccharides.
  • sequence identity refers to a relationship between two or more polynucleotide sequences or between two or more polypeptide sequences. When a position in one sequence is occupied by the same nucleic acid base or amino acid in the corresponding position of the comparator sequence, the sequences are said to be “identical” at that position.
  • the percentage “sequence identity” is calculated by determining the number of positions at which the identical nucleic acid base or amino acid occurs in both sequences to yield the number of "identical” positions.
  • the number of "identical” positions is then divided by the total number of positions in the comparison window and multiplied by 100 to yield the percentage of "sequence identity.” Percentage of "sequence identity” is determined by comparing two optimally aligned sequences over a comparison window and a homologous polypeptide from another isolate. In order to optimally align sequences for comparison, the portion of a polynucleotide or polypeptide sequence in the comparison window can comprise additions or deletions termed gaps while the reference sequence is kept constant. An optimal alignment is that alignment which, even with gaps, produces the greatest possible number of "identical” positions between the reference and comparator sequences.
  • Sequence identity between two sequences can be determined using the version of the program "BLAST 2 Sequences" which is available from the National Center for Biotechnology Information as of September 1, 2004, which program incorporates the programs BLASTN (for nucleotide sequence comparison) and BLASTP (for polypeptide sequence comparison), which programs are based on the algorithm of Karlin and Altschul (Proc. Natl. Acad. Sci. USA 90(12):5873-5877, 1993).
  • BLASTN for nucleotide sequence comparison
  • BLASTP for polypeptide sequence comparison
  • epitope refers to portions of a polypeptide having antigenic or immunogenic activity in an animal, for example a mammal, for example, a human.
  • An "immunogenic epitope,” as used herein, is defined as a portion of a protein that elicits an immune response in an animal, as determined by any method known in the art.
  • antigenic epitope is defined as a portion of a protein to which an antibody or T-cell receptor can immunospecifically bind its antigen as determined by any method well known in the art. Immunospecific binding excludes non-specific binding but does not necessarily exclude cross-reactivity with other antigens. Whereas all immunogenic epitopes are antigenic, antigenic epitopes need not be immunogenic.
  • a "coding region” is a portion of nucleic acid which consists of codons translated into amino acids. Although a “stop codon” (TAG, TGA, or TAA) is not translated into an amino acid, it can be considered to be part of a coding region, but any flanking sequences, for example promoters, ribosome binding sites, transcriptional terminators, and the like, are outside the coding region.
  • codon optimization is defined herein as modifying a nucleic acid sequence for enhanced expression in the cells of the host of interest by replacing at least one, more than one, or a significant number, of codons of the native sequence with codons that are more frequently or most frequently used in the genes of that host.
  • Various species exhibit particular bias for certain codons of a particular amino acid.
  • compositions containing immunogenic polypeptides of the disclosure can include compositions containing immunogenic polypeptides of the disclosure along with e.g., adjuvants or pharmaceutically acceptable carriers, excipients, or diluents, which are administered to an individual already suffering from S. aureus infection or an individual in need of immunization against S. aureus infection.
  • compositions that are, within the scope of sound medical judgment, suitable for contact with the tissues of human beings and animals without excessive toxicity or other complications commensurate with a reasonable benefit/risk ratio.
  • pharmaceutically acceptable refers to compositions that are, within the scope of sound medical judgment, suitable for contact with the tissues of human beings and animals without excessive toxicity or other complications commensurate with a reasonable benefit/risk ratio.
  • the polypeptides, polynucleotides, compositions, and vaccines described herein are pharmaceutically acceptable.
  • an "effective amount” is that amount the administration of which to an individual, either in a single dose or as part of a series, is effective for treatment or prevention.
  • An amount is effective, for example, when its administration results in a reduced incidence of S. aureus infection relative to an untreated individual, as determined, e.g., after infection or challenge with infectious 5.
  • aureus including, but is not limited to reduced bacteremia, reduced toxemia, reduced sepsis, reduced symptoms, increased immune response, modulated immune response, or reduced time required for recovery.
  • a single dose is from about 10 ⁇ g to 10 mg/kg body weight of purified polypeptide or an amount of a modified carrier organism or virus, or a fragment or remnant thereof, sufficient to provide a comparable quantity of recombinantly expressed multivalent oligopeptide, DT, and/or PSM as described herein.
  • peptide vaccine or "subunit vaccine” refers to a composition comprising one or more polypeptides described herein, which when administered to an animal are useful in stimulating an immune response against staphylococcal (e.g., S. aureus) infection.
  • staphylococcal e.g., S. aureus
  • the term "subject” is meant any subject, particularly a mammalian subject, for whom diagnosis, prognosis, immunization, or therapy is desired.
  • Mammalian subjects include, but are not limited to, humans, domestic animals, farm animals, zoo animals such as bears, sport animals, pet animals such as dogs, cats, guinea pigs, rabbits, rats, mice, horses, cattle, bears, cows; primates such as apes, monkeys, orangutans, and chimpanzees; canids such as dogs and wolves; felids such as cats, lions, and tigers; equids such as horses, donkeys, and zebras; food animals such as cows, pigs, and sheep; ungulates such as deer and giraffes; rodents such as mice, rats, hamsters and guinea pigs; and so on.
  • the subject is a human subject.
  • a "subject in need thereof refers to an individual for whom it is desirable to treat, i.e., to prevent, cure, retard, or reduce the severity of staphylococcal (e.g., S. aureus) disease symptoms, or result in no worsening of disease cause by S. aureus over a specified period of time, or both.
  • staphylococcal e.g., S. aureus
  • priming or “primary” and “boost” or “boosting” as used herein to refer to the initial and subsequent immunizations, respectively, i.e., in accordance with the definitions these terms normally have in immunology. However, in certain embodiments, e.g., where the priming component and boosting component are in a single formulation, initial and subsequent immunizations are not be necessary as both the “prime” and the “boost” compositions are administered simultaneously.
  • oligopeptide fusion proteins comprised of peptide subunits derived from staphylococcal toxins and superantigens.
  • an oligopeptide as provided herein comprises a mutant or wild-type delta toxin peptide (DT) or a mutant or wild-type phenol-soluble modulin peptide (PSM). Wild-type DT and the six forms of PSM are presented in Table 1.
  • the disclosure provides a recombinant peptide comprising a
  • Staphylococcus delta toxin peptide or a mutant, fragment, variant or derivative thereof DT
  • a Staphylococcus phenol soluble modulin peptide or a mutant, fragment, variant or derivative thereof PSM
  • a fusion of a DT and a PSM a DT or PSM as provided herein can be mutated to reduce toxicity, e.g., surfactant properties, while retaining antigenicity.
  • a recombinant DT, PSM, or both as provided by this disclosure can be attenuated relative to wild-type DT, PSM, or both, and yet the peptide can elicit an anti- Staphylococcus aureus immune response when administered to a subject.
  • the antigenicity of DT and PSM can rely on maintenance of the peptide's alpha-helical structure, where the surfactant properties can rely on the toxin having a hydrophobic face.
  • the disclosure provides a DT, a PSM or both, where hydrophobicity of the peptide is reduced relative to the wild-type peptide.
  • hydrophobicity can be reduced by replacing at least one, e.g., one, two, three, four, five or more hydrophobic amino acids which make up the hydrophobic face of the toxin with less hydrophobic amino acids.
  • Hydrophobic amino acids include, but are not limited to valine (V), leucine (L), isoleucine (I), phenylalanine (F), and methionine (M).
  • a hydrophobic amino acid is replaced with a small amino acid that would not be expected to alter the alpha helical structure of the peptide.
  • the hydrophobic amino acid can be replaced with alanine (A) or glycine (G).
  • the disclosure provides a recombinant peptide comprising a mutated
  • DT comprises the amino acid sequence:
  • X 5 , X 6 , X9, X 12 , X 13 , X 16 , X 17 , or X 20 comprises an amino acid substitution relative to SEQ ID NO: 1.
  • the DT is not wild-type DT.
  • X 5 can be isoleucine (I), glycine (G) or alanine (A), X 6 can be I, G, or A, X 9 can be I, G, or A, X 12 can be leucine (L), G, or V, X 13 can be valine (V), G, or A, X 16 can be I, G, or A, X 17 can be I, G, or A, and X 20 can be V, G, or A.
  • only a single amino acid from among X5, X 6 , X9, Xi2, Xi3, Xi6, Xn, or X 20 is substituted relative to SEQ ID NO: 1.
  • X 12 is the single substituted amino acid.
  • X 12 can be G, and the peptide comprises the amino acid sequence SEQ ID NO: 2, or X 12 can be A and the peptide comprises the amino acid sequence SEQ ID NO: 4.
  • two amino acids from among X 5 , X 6 , X 9 , X12, X13, Xi6, 3 ⁇ 4?, or X 20 are substituted relative to SEQ ID NO: 2.
  • X12 and X 20 can be substituted, and can be G or A.
  • X 12 can independently be G or A
  • X 20 can independently be G or A
  • the DT can comprise the amino acid sequence SEQ ID NO: 3, or the amino acid sequence SEQ ID NO: 5.
  • Other amino acid substitutions can easily be visualized and constructed by a person of ordinary skill in the art according to this disclosure.
  • the disclosure provides a recombinant peptide comprising a mutated
  • PSM e.g., a mutant PSMal, PSMa2, PSMa3, PSMa4, PSMpi, ⁇ 8 ⁇ 2, PSM-mec, or any combination of two or more PSMs.
  • the peptide comprises a mutant PSMal comprising the amino acid sequence:
  • at least one of X ls X 3 , X4, X 7 , X 8 , X 10 , Xn, X14 ,Xis, or Xj 8 comprises an amino acid substitution relative to SEQ ID NO: 38.
  • the PSMal is not wild-type PSMal According to this aspect, X !
  • X 3 can be I, G, or A
  • X4 can be I, G, or A
  • X 7 can be I, G, or A
  • X 8 can be I, G, or A
  • X 10 can be V, G, or A
  • Xn can be I, G, or A
  • X 14 can be L, G, or A
  • X 15 can be I, G, or A
  • X 18 can be F, G, or A.
  • only a single amino acid from among X 1; X 3 , X4, X 7 , X 8 , X 10 , Xn, X 14 ,X 15 , and X 18 is substituted relative to SEQ ID NO: 38.
  • Xi X3, X4, X 7 , X 8 , X 10 , X , X 14 , ⁇ 5 , and X 18 is G or A.
  • two amino acids from among X l5 X 3 , X4, X 7 , X 8 , X 10 , Xn, X 14 ,X 15 , and Xi are substituted relative to SEQ ID NO: 38.
  • amino acid substitutions in PSMal either single, or multiple substitutions, can easily be visualized and constructed by a person of ordinary skill in the art according to this disclosure.
  • the peptide comprises a mutant PSMa2 comprising the amino acid sequence:
  • At least one of X ls X3, X4, X 7 , X 8 , X 10 , Xn, X 14 ,X 15 , or X 18 comprises an amino acid substitution relative to SEQ ID NO: 12.
  • the PSMa2 is not wild-type PSMa2.
  • Xi can be M, G, or A
  • X 3 can be I, G, or A
  • X can be I, G, or A
  • X 7 can be I, G, or A
  • X 8 can be I, G, or A
  • X 10 can be F, G, or A
  • Xn can be I, G, or A
  • X 14 can be L, G, or A
  • X 15 can be I, G, or A
  • X 18 can be F, G, or A.
  • a single amino acid from among X l5 X 3 , X 4 , X 7 , X 8 , X10, Xn, Xi 4 ,X 15 , and X 18 is substituted relative to SEQ ID NO: 12.
  • Xi, X 3 , X , X 7 , X 8 , X 10 , Xn, X 14 ,X 15 , and X 18 is G or A.
  • two amino acids from among X ls X 3 , X4, X 7 , X 8 , X 10 , Xn, X 14 ,X 15 , and X 18 are substituted relative to SEQ ID NO: 12.
  • amino acid substitutions either single, or multiple substitutions, can easily be visualized and constructed by a person of ordinary skill in the art according to this disclosure.
  • the peptide comprises a mutant PSMa3 comprising the amino acid sequence:
  • At least one of X l9 X 3 , X4, X7, Xs, X10, Xn, X14 ,Xis, Xi8, or X 19 comprises an amino acid substitution relative to SEQ ID NO: 6.
  • the PSMa3 is not wild-type PSMa3.
  • Xi can be M, G, or A
  • X 3 can be F, G, or A
  • X 4 can be V
  • X 7 can be L
  • X 8 can be F
  • X 10 can be F, G, or A
  • Xn can be F
  • X 14 can be L, G, or A
  • X 15 can be L, G, or A
  • X [8 can be F, G, or A
  • X19 can be L, G, or A.
  • X 14 is the single substituted amino acid.
  • X 14 can be G, and the peptide comprises the amino acid sequence SEQ ID NO: 9, or Xj 4 can be A and the peptide comprises the amino acid sequence SEQ ID NO: 7.
  • two amino acids from among X l5 X 3 , X4, X 7 , X 8 , X 10 , n, X14 ,X 15 , X 18 , and X 19 are substituted relative to SEQ ID NO: 6.
  • 4 and X 14 can be substituted, and can be G or A.
  • X4 can independently be G or A
  • XH can independently be G or A.
  • the PSMa3 can comprise the amino acid sequence SEQ ID NO: 8, the amino acid sequence SEQ ID NO: 10, or the amino acid sequence SEQ ID NO: 11..
  • Other amino acid substitutions either single, or multiple substitutions, can easily be visualized and constructed by a person of ordinary skill in the art according to this disclosure.
  • the peptide comprises a mutant PSMa4 comprising the amino acid sequence:
  • At least one of X ls X 3 , X4, X 7 , X 8 , X10, Xn, X14 ,Xi5, Xn, or X 18 comprises an amino acid substitution relative to SEQ ID NO: 14.
  • the PSMa4 is not wild-type PSMa4.
  • X 3 can be I, G, or A, 4 can be V, G, or A, X 7 can be I, G, or A, X 8 can be I, G, or A, X 10 can be I, G, or A, X can be I, G, or A, X 1 can be I, G, or A, X 15 can be I, G, or A, X 17 can be I, G, or A, and X 18 can be F, G, or A.
  • Xi, X 3 , X4, X 7 , Xs, X10, X11, Xi4 ,Xi5, Xn, and X 18 is substituted relative to SEQ ID NO: 14.
  • Xi, X 3 , X4, X7, Xs, X10, X11, X14 ,Xi 5 , X17, and X 18 is G or A.
  • two amino acids from among X l5 X 3 , X 4 , X 7 , X 8 , X 10 , Xn, X 14 ,X 15 , Xn, and X 18 are substituted relative to SEQ ID NO: 14.
  • Other amino acid substitutions, either single, or multiple substitutions, can easily be visualized and constructed by a person of ordinary skill in the art according to this disclosure.
  • the peptide comprises a mutant PSM i comprising the amino acid sequence: MEGX 4 X 5 NAX 8 KDTX 12 TAAX 16 NNDGAKLGTSIVNIVENGVGLLSKLFGF
  • At least one of 3 ⁇ 4, X 5 , X 8 , X 12 , or X 16 comprises an amino acid substitution relative to SEQ ID NO: 15.
  • the PSMpi is not wild- type PSMpi.
  • X4 can be L, G, or A
  • X 5 can be F
  • X 8 can be I
  • X 12 can be V
  • X 16 can be I, G, or A.
  • only a single amino acid from among X4, X 5 , Xg, X 12 , and Xi 6 is substituted relative to SEQ ID NO: 15.
  • X , X5, X 8 , X 12 , and X 16 is G or A.
  • two amino acids from among X4, X 5 , Xg, Xi 2 , and Xj 6 are substituted relative to SEQ ID NO: 15.
  • Other amino acid substitutions, either single, or multiple substitutions, can easily be visualized and constructed by a person of ordinary skill in the art according to this disclosure.
  • the peptide comprises a mutant PSMP2 comprising the amino acid sequence:
  • At least one of X 4 , Xs, X 12 , or X 2 3 comprises an amino acid substitution relative to SEQ ID NO: 16.
  • the PSMP2 is not wild- type PSMp2.
  • X 4 can be L, G, or A
  • Xg can be I, G, or A
  • Xj 2 can be V, G, or A
  • X 23 can be L, G, or A.
  • only a single amino acid from among t , X 8 , X 12 , and X23 is substituted relative to SEQ ID NO: 16.
  • only one of X 4 , Xg, X 12 , and X 23 is G or A.
  • two amino acids from among X 4 , Xg, X 12 , and X 23 are substituted relative to SEQ ID NO: 16.
  • Other amino acid substitutions either single, or multiple substitutions, can easily be visualized and constructed by a person of ordinary skill in the art according to this disclosure.
  • the peptide comprises a mutant PSM-mec comprising the amino acid sequence:
  • At least one of X3, X 6 , X7, X10, n, Xi3, Xi4, Xn, or Xj comprises an amino acid substitution relative to SEQ ID NO: 52.
  • the PSM-mec is not wild-type PSM-mec.
  • X 3 can be F, G, or A
  • X 6 can be V
  • X 7 can be I
  • X 10 can be I, G, or A
  • Xn can be I, G, or A
  • X 13 can be L
  • X 14 can be I, G, or A
  • Xn can be C, G, or A
  • Xig can be I, G, or A.
  • only a single amino acid from among X 3 , X 6 , X 7 , X 10 , Xu, Xi 3 , X 14 , Xi , or X 18 is substituted relative to SEQ ID NO: 52.
  • X 3 , X 6 , X?, Xio, Xu, X13, XM, X17, or Xi 8 is G or A.
  • two amino acids from among X ls X 3 , X4, X 7 , X 8 , X 10 , X n , X 14 ,X 15 , and X 18 are substituted relative to SEQ ID NO: 52.
  • Various amino acid substitutions in PSM-mec either single, or multiple substitutions, can easily be visualized and constructed by a person of ordinary skill in the art according to this disclosure.
  • the disclosure further provides a multivalent oligopeptide comprising a fusion of two or more, e.g., two, three, four, five, six, seven, eight, nine, ten or more Staphylococcus aureus-derived peptides, or mutants, fragments, variants, or derivatives thereof arranged in any order.
  • the two or more Staphylococcus aureus-denved peptides, or mutants, fragments, variants, or derivatives thereof can be the same or different.
  • a multivalent oligopeptide as provided herein can include, without limitation, two or more of:
  • a a wild-type DT, a mutant DT as described above, or any fragment, variant, or derivative thereof;
  • a leukocidin polypeptide or mutant, fragment, variant, or derivative thereof including, without limitation, a Panton- Valentine leukocidin (PVL) LukS-PV subunit comprising an amino acid sequence at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 47, a Panton-Valentine leukocidin (PVL) LukF-PV subunit comprising an amino acid sequence at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 48, or a combination thereof, or other leukocidin peptides as described elsewhere herein and in PCT Publication No. WO 2013/082558, including, without limitation, LukS-Mut9 (SEQ ID NO: 54) and/or LukF-Mut-1 (SEQ ID NO: 55); or
  • the peptides comprising the multivalent oligopeptide can be directly fused to each other.
  • the peptides comprising the multivalent oligopeptide can be associated via a peptide linker.
  • Suitable peptide linkers can be chosen based on their ability to adopt a flexible, extended conformation, or a secondary structure that can interact with joined epitopes, or based on their ability to increase overall solubility of the fusion polypeptide, or based on their lack of electrostatic or water-interaction effects that influence joined peptide regions.
  • a linker for use in a multivalent oligopeptide as provided herein can include at least one, but no more than 50 amino acids, e.g., small amino acids that provide a flexible chain, e.g., glycine, serine, alanine, or a combination thereof.
  • a linker for use in a multivalent oligopeptide as provided herein can include (GGGS) n or (GGGGS) n , wherein n is a integer from 1 to 10.
  • the multivalent oligopeptide includes AT-62 and DT, in any order, where AT-62 and DT can be fused together via a linker sequence.
  • the multivalent oligopeptide comprises, consists of, or consists essentially of AT62 DT (SEQ ID NO: 18), or an oligopeptide comprising, consisting, or consisting essentially of an amino acid sequence at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 18.
  • the multivalent oligopeptide includes AT-62 and a PSM, in any order, where AT-62 and PSM can be fused together via a linker sequence.
  • the multivalent oligopeptide comprises, consists of, or consists essentially of AT62 PSM (SEQ ID NO: 20), or an oligopeptide comprising, consisting, or consisting essentially of an amino acid sequence at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 20.
  • the multivalent oligopeptide includes AT-62, DT, and a PSM, in any order, where AT-62, DT, and PSM can be fused together via linker sequences.
  • the multivalent oligopeptide comprises, consists of, or consists essentially of AT62_DT_PSM (SEQ ID NO: 22), or an oligopeptide comprising, consisting, or consisting essentially of an amino acid sequence at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 22.
  • the multivalent oligopeptide includes AT-62 and a recombinant
  • the multivalent oligopeptide comprises, consists of, pr consists essentially of AT62_rSEB (SEQ ID NO: 23), or an oligopeptide comprising, consisting, or consisting essentially of an amino acid sequence at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 23.
  • the multivalent oligopeptide comprises, consists of, or consists essentially of rSEB_ AT62 (SEQ ID NO: 26), or an oligopeptide comprising, consisting, or consisting essentially of an amino acid sequence at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 26.
  • the multivalent oligopeptide includes AT-62, a recombinant SEB or mutant, fragment, variant, or derivative thereof, and DT, in any order, where AT-62, SEB, and DT can be fused together via a linker sequence.
  • the multivalent oligopeptide comprises, consists of, or consists essentially of AT62_rSEB DT (SEQ ID NO: 29), or an oligopeptide comprising, consisting, or consisting essentially of an amino acid sequence at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 29.
  • the provided oligopeptide includes a staphylococcal SAg or mutant, fragment, variant, or derivative thereof
  • the SAg can include, without limitation, SEB, SECl-3, SEE, SEH, SEI, SEK, TSST-1, SpeC, SED, SpeA, or any mutant, fragment, variant, or derivative thereof, or any combination thereof, in any order.
  • the oligopeptide includes a staphylococcal enterotoxin B (SEB) or mutant, fragment, variant, or derivative thereof.
  • the SEB mutant is the attenuated toxoid SEBL 45 R/Y89A Y94A (SEQ ID NO: 49), or a polypeptide comprising an amino acid sequence at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 49.
  • the oligopeptide includes a staphylococcal enterotoxin A (SEA) or mutant, fragment, variant, or derivative thereof.
  • the SEA mutant is the attenuated toxoid SEAL 4 8R/D70R/Y92A (SEQ ID NO: 50), or a polypeptide comprising an amino acid sequence at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 50.
  • the oligopeptide includes a staphylococcal toxic shock syndrome toxin-1 (TSST-1) or mutant, fragment, variant, or derivative thereof.
  • the TSST-1 mutant is the attenuated toxoid TSST-1 L3OR/D27A/I46A (SEQ ID NO: 51), or a polypeptide comprising an amino acid sequence at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 51.
  • the SAg toxoids can be linked together in any order, either with our without linkers.
  • the multivalent oligopeptide includes SEBL 45 R/Y 8 9A/Y94A ("B"), SEAL ⁇ R/DTORA ⁇ A (“A”), and TSST-1 L30 R/D27A/I4 6 A (“T”), in any order, where the toxoids can be fused together via linker sequences.
  • the multivalent oligopeptide comprises, consists of, or consists essentially of a "BAT” fusion (SEQ ID NO: 32), or an oligopeptide comprising, consisting, or consisting essentially of an amino acid sequence at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 32.
  • the multivalent oligopeptide comprises, consists of, or consists essentially of a "BTA” fusion (SEQ ID NO: 33), or an oligopeptide comprising, consisting, or consisting essentially of an amino acid sequence at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 33.
  • the multivalent oligopeptide comprises, consists of, or consists essentially of a "ABT" fusion (SEQ ID NO: 34), or an oligopeptide comprising, consisting, or consisting essentially of an amino acid sequence at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 34.
  • the multivalent oligopeptide comprises, consists of, or consists essentially of a "ATB” fusion (SEQ ID NO: 35), or an oligopeptide comprising, consisting, or consisting essentially of an amino acid sequence at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 35.
  • the multivalent oligopeptide comprises, consists of, or consists essentially of a "TAB" fusion (SEQ ID NO: 36), or an oligopeptide comprising, consisting, or consisting essentially of an amino acid sequence at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 36.
  • the multivalent oligopeptide comprises, consists of, or consists essentially of a "TBA" fusion (SEQ ID NO: 37), or an oligopeptide comprising, consisting, or consisting essentially of an amino acid sequence at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 37.
  • the multivalent oligopeptide comprises, consists of, or consists essentially of the amino acid sequence SEQ ID NO: 18, SEQ ID NO: 20, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 26, SEQ ID NO: 29, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO. 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, or any combination thereof.
  • the multivalent oligopeptide, DT, and/or PSM as described herein can be attached to a heterologous polypeptide.
  • Various heterologous polypeptides can be used, including, but not limited to an N- or C-terminal peptide imparting stabilization, secretion, or simplified purification, such as a hexa-Histidine-tag, a ubiquitin tag, a NusA tag, a chitin binding domain, ompT, ompA, pelB, DsbA, DsbC, c-myc, KSI, polyaspartic acid, (Ala-Trp-Trp-Pro)n, polyphenyalanine, polycysteine, polyarginine, a B-tag, a HSB-tag, green fluorescent protein (GFP), influenza virus hemagglutinin (HAI), a calmodulin binding protein (CBP), a galactose-
  • GFP green fluorescent
  • Heterologous polypeptides can also include any pre- and/or pro- sequences that facilitate the transport, translocations, processing and/or purification of a multivalent oligopeptide, DT, and/or PSM as described herein from a host cell or any useful immunogenic sequence, including but not limited to sequences that encode a T-cell epitope of a microbial pathogen, or other immunogenic proteins and/or epitopes.
  • the multivalent oligopeptide, DT, and/or PSM attached to a heterologous polypeptide, as described herein can include a peptide linker sequence joining sequences that comprise two or more peptide regions.
  • Suitable peptide linker sequences can be chosen based on their ability to adopt a flexible, extended conformation, or a secondary structure that could interact with joined epitopes, or based on their ability to increase overall solubility of the fusion polypeptide, or based on their lack of electrostatic or water-interaction effects that influence joined peptide regions.
  • the multivalent oligopeptide, DT, and/or PSM as described herein is isolated.
  • An "isolated" polypeptide is one that has been removed from its natural milieu. The term “isolated” does not connote any particular level of purification.
  • Recombinantly produced multivalent oligopeptides, DTs, and/or PSMs as described herein, expressed in non-native host cells is considered isolated for purposes of the disclosure, as is the polypeptide which have been separated, fractionated, or partially or substantially purified by any suitable technique, including by filtration, chromatography, centrifugation, and the like.
  • Production of multivalent oligopeptides, DTs, and/or PSMs as described herein, can be achieved by culturing a host cell comprising a polynucleotide which operably encodes the polypeptide of the disclosure, and recovering the polypeptide. Determining conditions for culturing such a host cell and expressing the polynucleotide are generally specific to the host cell and the expression system and are within the knowledge of one of skill in the art. Likewise, appropriate methods for recovering the polypeptide of the disclosure are known to those in the art, and include, but are not limited to, chromatography, filtration, precipitation, or centrifugation.
  • an isolated polynucleotide comprising a nucleic acid encoding a multivalent oligopeptide, DT, and/or PSM as described elsewhere herein.
  • the isolated polynucleotide as described herein further comprises non-coding regions such as promoters, operators, or transcription terminators as described elsewhere herein.
  • the disclosure is directed to the polynucleotide as described herein, and further comprising a heterologous nucleic acid.
  • the heterologous nucleic acid can, in some embodiments, encode a heterologous polypeptide fused to the polypeptide as described herein.
  • the isolated polynucleotide as described herein can comprise additional coding regions encoding, e.g., a heterologous polypeptide fused to the polypeptide as described herein, or coding regions encoding heterologous polypeptides separate from the polypeptide as described herein such as, but not limited to, selectable markers, additional immunogens, immune enhancers, and the like.
  • an isolated polynucleotide is a recombinant polynucleotide contained in a vector.
  • Further examples of an isolated polynucleotide include recombinant polynucleotides maintained in heterologous host cells or purified (partially or substantially) polynucleotides in solution.
  • a polynucleotide is "recombinant.”
  • Isolated polynucleotides or nucleic acids according to the disclosure further include such molecules produced synthetically. The relative degree of purity of a polynucleotide or polypeptide described herein is easily determined by well- known methods.
  • nucleic acids encoding the multivalent oligopeptides, DTs, and/or PSMs as described herein can readily be accomplished by those skilled in the art, for example, by oligonucleotide-directed site-specific mutagenesis or de novo nucleic acid synthesis.
  • Some embodiments disclose an isolated polynucleotide comprising a nucleic acid that encodes a multivalent oligopeptide, DT, and/or PSM as described herein, where the coding region encoding the polypeptide has been codon-optimized.
  • various nucleic acid coding regions will encode the same polypeptide due to the redundancy of the genetic code. Deviations in the nucleotide sequence that comprise the codons encoding the amino acids of any polypeptide chain allow for variations in the sequence of the coding region.
  • each codon consists of three nucleotides, and the nucleotides comprising DNA are restricted to four specific bases, there are 64 possible combinations of nucleotides, 61 of which encode amino acids (the remaining three codons encode signals ending translation).
  • the "genetic code” which shows which codons encode which amino acids is reproduced herein as Table 2.
  • many amino acids are designated by more than one codon.
  • the amino acids alanine and proline are coded for by four triplets, serine and arginine by six, whereas tryptophan and methionine are coded by just one triplet. This degeneracy allows for DNA base composition to vary over a wide range without altering the amino acid sequence of the polypeptides encoded by the DNA.
  • Codon preference or codon bias differences in codon usage between organisms, is afforded by degeneracy of the genetic code, and is well documented among many organisms.
  • codon usage preference Different factors have been proposed to contribute to codon usage preference, including translational selection, GC composition, strand-specific mutational bias, amino acid conservation, protein hydropathy, transcriptional selection and even RNA stability.
  • mutational bias that shapes genome GC composition. This factor is most significant in genomes with extreme base composition: species with high GC content (e.g., gram positive bacteria). Mutational bias is responsible not only for intergenetic difference in codon usage but also for codon usage bias within the same genome (Ermolaeva M, Curr. Issues Mol. Biol. 3(4):91-97, 2001).
  • Codon bias often correlates with the efficiency of translation of messenger RNA
  • mRNA which is in turn believed to be dependent on, inter alia, the properties of the codons being translated and the availability of particular transfer RNA (tRNA) molecules.
  • tRNA transfer RNA
  • the present disclosure provides a polynucleotide comprising a codon-optimized coding region which encodes a multivalent oligopeptide, DT, and/or PSM as described herein.
  • the codon usage is adapted for optimized expression in a given prokaryotic or eukaryotic host cell. In certain aspects the codon usage is adapted for optimized expression in E. coli.
  • an isolated polynucleotide comprising the nucleic acid sequence SEQ ID NO: 17, encoding AT62 DT and optimized for expression in E. coli. In certain aspects an isolated polynucleotide is provided comprising the nucleic acid sequence SEQ ID NO: 19, encoding AT62_PSM and optimized for expression in E. coli. In certain aspects an isolated polynucleotide is provided comprising the nucleic acid sequence SEQ ID NO: 21, encoding AT62 DT PSM and optimized for expression in E. coli. In certain aspects an isolated polynucleotide is provided comprising the nucleic acid sequence SEQ ID NO: 25, encoding AT62_rSEB and optimized for expression in E. coli.
  • an isolated polynucleotide comprising the nucleic acid sequence SEQ ID NO: 28, encoding rSEB_ AT62 and optimized for expression in E. coli. In certain aspects an isolated polynucleotide is provided comprising the nucleic acid sequence SEQ ID NO: 31, encoding AT62_rSEB DT and optimized for expression in E. coli.
  • Codon-optimized polynucleotides are prepared by incorporating codons preferred for use in the genes of a given species into the DNA sequence. Also provided are polynucleotide expression constructs, vectors, host cells comprising polynucleotides comprising codon- optimized coding regions which encode a multivalent oligopeptide, DT, and/or PSM as described herein.
  • Codon usage tables are readily available, for example, at the "Codon Usage Database” available at http://www.kazusa.or.jp/codon/ (visited October 12, 2011), and these tables can be adapted in a number of ways. (Nakamura, Y., et ah, "Codon usage tabulated from the international DNA sequence databases: status for the year 2000” Nucl. Acids Res. 28:292, 2000).
  • the frequencies can apply the frequencies to any given polypeptide sequence, and produce a nucleic acid fragment of a codon- optimized coding region which encodes a desired polypeptide, but which uses codons optimal for a given species.
  • the coding region is codon-optimized for expression in E. coli.
  • vector comprising the polynucleotide as described herein.
  • vector refers to e.g., any of a number of nucleic acids into which a desired sequence can be inserted, e.g., by restriction and ligation, for transport between different genetic environments or for expression in a host cell.
  • Nucleic acid vectors can be DNA or RNA.
  • Vectors include, but are not limited to, plasmids, phage, phagemids, bacterial genomes, and virus genomes.
  • a cloning vector is one which is able to replicate in a host cell, and which is further characterized by one or more endonuclease restriction sites at which the vector can be cut in a determinable fashion and into which a desired DNA sequence can be ligated such that the new recombinant vector retains its ability to replicate in the host cell.
  • replication of the desired sequence can occur many times as the plasmid increases in copy number within the host bacterium or just a single time per host before the host reproduces by mitosis.
  • phage replication can occur actively during a lytic phase or passively during a lysogenic phase.
  • Certain vectors are capable of autonomous replication in a host cell into which they are introduced. Other vectors are integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome.
  • plasmid refers to a circular, double-stranded construct made up of genetic material (i.e., nucleic acids), in which the genetic material is extrachromosomal and in some instances, replicates autonomously.
  • a polynucleotide described herein can be in a circular or linearized plasmid or in any other sort of vector. Procedures for inserting a nucleotide sequence into a vector, e.g., an expression vector, and transforming or transfecting into an appropriate host cell and cultivating under conditions suitable for expression are generally known in the art.
  • the disclosure further provides a vector comprising a nucleic acid sequence encoding a multivalent oligopeptide, DT, and/or PSM as described herein.
  • the vector is an expression vector capable of expressing the multivalent oligopeptide, DT, and/or PSM as described herein in a suitable host cell.
  • expression vector refers to a vector that is capable of expressing the polypeptide described herein, i.e., the vector sequence contains the regulatory sequences required for transcription and translation of a polypeptide, including, but not limited to promoters, operators, transcription termination sites, ribosome binding sites, and the like.
  • expression refers to the biological production of a product encoded by a coding sequence.
  • RNA sequence including the coding sequence
  • mRNA messenger-RNA
  • the messenger-RNA is then translated to form a polypeptide product which has a relevant biological activity.
  • the process of expression can involve further processing steps to the RNA product of transcription, such as splicing to remove introns, and/or post-translational processing of a polypeptide product.
  • Vector-host systems include, but are not limited to, systems such as bacterial, mammalian, yeast, insect or plant cell systems, either in vivo, e.g., in an animal or in vitro, e.g., in bacteria or in cell cultures.
  • the host cell is a bacterium, e.g., E. coli.
  • Host cells are genetically engineered (infected, transduced, transformed, or transfected) with vectors of the disclosure.
  • one aspect of the disclosure is directed to a host cell comprising a vector which contains the polynucleotide as describe herein.
  • the engineered host cell can be cultured in conventional nutrient media modified as appropriate for activating promoters, selecting transformants or amplifying the polynucleotides.
  • the culture conditions such as temperature, pH and the like, are those previously used with the host cell selected for expression, and will be apparent to the ordinarily skilled artisan.
  • transfect refers to any procedure whereby eukaryotic cells are induced to accept and incorporate into their genome isolated DNA, including but not limited to DNA in the form of a plasmid.
  • transform refers to any procedure whereby bacterial cells are induced to accept and incorporate into their genome isolated DNA, including but not limited to DNA in the form of a plasmid.
  • Bacterial host-expression vector systems include, but are not limited to, a prokaryote
  • the plasmids used with E. coli use the T7 promoter-driven system regulated by the Lacl protein via IPTG induction.
  • suitable vectors are known to those of skill in the art, and are commercially available.
  • the following bacterial vectors are provided by way of example: pET (Novagen), pET28, pBAD, pTrcHIS, pBR322, pQE70, pQE60, pQE-9 (Qiagen), phagescript, psiX174, pBluescript SK, pbsks, pNH8A, pNH16a, pNH18A, pNH46A (Stratagene), ptrc99a, pKK223-3, pKK243-3, pDR540, pBR322, pPSlO, RSFIOIO, pRIT5 (Pharmacia); pCR (Invitrogen); pLex (Invitrogen), and pUC plasmid derivatives.
  • a suitable expression vector contains regulatory sequences that can be operably joined to an inserted nucleotide sequence encoding the multivalent oligopeptide, DT, and/or PSM as described herein.
  • regulatory sequences means nucleotide sequences which are necessary for or conducive to the transcription of an inserted sequence encoding a multivalent oligopeptide, DT, and/or PSM as described herein by a host cell and/or which are necessary for or conducive to the translation by a host cell of the resulting transcript into the desired multivalent oligopeptide, DT, and/or PSM.
  • Regulatory sequences include, but are not limited to, 5* sequences such as operators, promoters and ribosome binding sequences, and 3' sequences such as polyadenylation signals or transcription terminators. Regulatory sequences can also include enhancer sequences or upstream activator sequences.
  • bacterial vectors will include origins of replication and selectable markers, e.g., the ampicillin, tetracycline, kanamycin, resistance genes of E. coli, permitting transformation of the host cell and a promoter derived from a highly-expressed gene to direct transcription of a downstream structural sequence.
  • selectable markers e.g., the ampicillin, tetracycline, kanamycin, resistance genes of E. coli.
  • Suitable promoters include, but are not limited to, the T7 promoter, lambda ( ⁇ ) promoter, T5 promoter, and lac promoter, or promoters derived from operons encoding glycolytic enzymes such as 3-phosphoglycerate kinase (PG ), acid phosphatase, or heat shock proteins, or inducible promoters like cadmium (pcad), and beta-lactamase (pbla).
  • PG 3-phosphoglycerate kinase
  • pcad acid phosphatase
  • pbla beta-lactamase
  • the polynucleotide as described herein can be cloned downstream of the promoter, for example, in a polylinker region.
  • the vector is transformed into an appropriate bacterial strain, and DNA is prepared using standard techniques.
  • the orientation and DNA sequence of the polynucleotide as well as all other elements included in the vector, are confirmed using restriction mapping, DNA sequence analysis, and/or PCR analysis.
  • Bacterial cells harboring the correct plasmid can be stored as cell banks.
  • compositions e.g., immunogenic or pharmaceutical compositions that contain an effective amount of the multivalent oligopeptide, DT, and/or PSM as described herein, or a polynucleotide encoding the polypeptide of the disclosure.
  • Compositions as described herein can further comprise additional immunogenic components, e.g., as a multivalent vaccine, as well as carriers, excipients or adjuvants.
  • compositions as described herein can be formulated according to known methods.
  • compositions can be in a variety of forms, including, but not limited to an aqueous solution, an emulsion, a gel, a suspension, lyophilized form, or any other form known in the art.
  • the composition can contain pharmaceutically acceptable additives including, for example, diluents, binders, stabilizers, and preservatives.
  • compositions of the disclosure can be administered directly to the subject.
  • the subjects to be treated can be animals; in particular, human subjects can be treated.
  • Carriers that can be used with compositions of the disclosure are well known in the art, and include, without limitation, e.g., thyroglobulin, albumins such as human serum albumin, tetanus toxoid, and polyamino acids such as poly L-lysine, poly L-glutamic acid, influenza, hepatitis B virus core protein, and the like.
  • aqueous carriers can be used, e.g., water, buffered water, 0.8% saline, 0.3% glycine, hyaluronic acid and the like.
  • Compositions can be sterilized by conventional, well known sterilization techniques, or can be sterile filtered.
  • compositions can be packaged for use as is, or lyophilized, the lyophilized preparation being combined with a sterile solution prior to administration.
  • Compositions can contain pharmaceutically acceptable auxiliary substances as required to approximate physiological conditions, such as pH adjusting and buffering agents, tonicity adjusting agents, wetting agents and the like, for example, sodium acetate, sodium lactate, sodium chloride, potassium chloride, calcium chloride, sorbitan monolaurate, triethanolamineoleate, etc.
  • compositions as described herein further include one or more adjuvants, a substance added to an immunogenic composition to, for example, enhance, sustain, localize, or modulate an immune response to an immunogen.
  • adjuvant refers to any material having the ability to (1) alter or increase the immune response to a particular antigen or (2) increase or aid an effect of a pharmacological agent. Any compound which can increase the expression, antigenicity or immunogenicity of the polypeptide is a potential adjuvant.
  • immunogenic carrier refers to a first moiety, e.g., a polypeptide or fragment, variant, or derivative thereof which enhances the immunogenicity of a second polypeptide or fragment, variant, or derivative thereof.
  • a great variety of materials have been shown to have adjuvant activity through a variety of mechanisms. For example, an increase in humoral immunity is typically manifested by a significant increase in the titer of antibodies raised to the antigen, and an increase in T-cell activity is typically manifested in increased cell proliferation, or cellular cytotoxicity, or cytokine secretion.
  • An adjuvant can also alter or modulate an immune response, for example, by changing a primarily humoral or TI12 response into a primarily cellular, or Th ⁇ response. Immune responses to a given antigen can be tested by various immunoassays well known to those of ordinary skill in the art, and/or described elsewhere herein.
  • adjuvants which can be used in compositions described herein include, but are not limited to: inert carriers, such as alum, bentonite, latex, and acrylic particles; incomplete Freund's adjuvant, complete Freund's adjuvant; aluminum-based salts such as aluminum hydroxide; Alhydrogel (Al(OH 3 )); aluminum phosphate (AIPO4); calcium- based salts; silica; any TLR biological ligand(s); IDC- 1001 (also known as GLA-SE; glucopyranosyl lipid adjuvant stable emulsion) (Coler et al., PLoS One, 2010.
  • inert carriers such as alum, bentonite, latex, and acrylic particles
  • incomplete Freund's adjuvant complete Freund's adjuvant
  • aluminum-based salts such as aluminum hydroxide; Alhydrogel (Al(OH 3 )); aluminum phosphate (AIPO4)
  • calcium- based salts such as aluminum hydroxide;
  • a composition of the disclosure further comprises a liposome or other particulate carrier, which can serve, e.g., to stabilize a formulation, to target the formulation to a particular tissue, such as lymphoid tissue, or to increase the half-life of the polypeptide composition.
  • a liposome or other particulate carrier include emulsions, foams, micelles, insoluble monolayers, liquid crystals, phospholipid dispersions, lamellar layers, iscoms, and the like.
  • the polypeptide described herein can be incorporated as part of a liposome or other particle, or can be delivered in conjunction with a liposome.
  • Liposomes for use in accordance with the disclosure can be formed from standard vesicle- forming lipids, which generally include neutral and negatively charged phospholipids and a sterol, such as cholesterol.
  • a composition comprising a liposome or other particulate suspension as well as the polypeptide as described herein can be administered intravenously, locally, topically, etc. in a dose which varies according to, inter alia, the manner of administration, the polypeptide being delivered, and the stage of the disease being treated.
  • nontoxic solid carriers can be used which include, for example, pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharin, talcum, cellulose, glucose, sucrose, magnesium carbonate, and the like.
  • a pharmaceutically acceptable nontoxic composition is formed by incorporating any of the normally employed excipients, such as those carriers previously listed, and generally 10-95% of active ingredient, that is, the polypeptide as described herein, often at a concentration of 25%-75%.
  • the polypeptide as described herein can be supplied in finely divided form, optionally along with a surfactant and, propellant and/or a mucoadhesive, e.g., chitosan.
  • a surfactant e.g., chitosan.
  • the surfactant must, of course, be pharmaceutically acceptable, and in some embodiments soluble in the propellant.
  • esters or partial esters of fatty acids containing from 6 to 22 carbon atoms such as caproic, octanoic, lauric, palmitic, stearic, linoleic, linolenic, olesteric and oleic acids with an aliphatic polyhydric alcohol or its cyclic anhydride.
  • Mixed esters, such as mixed or natural glycerides can be employed.
  • the surfactant can constitute 0.1%-20% by weight of the composition, in some embodiments 0.25-5% by weight.
  • the balance of the composition is ordinarily propellant, although an atomizer can be used in which no propellant is necessary and other percentages are adjusted accordingly.
  • the immunogenic polypeptides can be incorporated within an aerodynamically light particle, such as those particles described in U.S. Pat. No. 6,942,868 or U.S. Pat. Pub. No. 2005/0008633.
  • a carrier can also be included, e.g., lecithin for intranasal delivery.
  • the disclosure is also directed to a method of producing the composition according to the disclosure.
  • the method of producing the composition comprises (a) isolating a polypeptide according to the disclosure; and (b) adding an adjuvant, carrier and/or excipient to the isolated polypeptide.
  • Some embodiments disclose further combining the polypeptide with other staphylococcal antigens.
  • a multivalent vaccine of the present disclosure can include a multivalent oligopeptide, DT, and/or PSM as described herein, or a polynucleotide encoding a multivalent oligopeptide, DT, and or PSM, and one or more additional immunogenic components.
  • additional immunogens of the same infectious agent e.g., S. aureus, or from other staphylococci, or can be immunogens derived from other infectious agents which can be effectively, conveniently, or economically administered together.
  • the multivalent oligopeptide, DT, and/or PSM as described herein can be combined with other toxins or other virulent component-based vaccines to make a broad toxin-based multivalent vaccine capable of targeting multiple bacterial virulence determinants.
  • the multivalent oligopeptide, DT, and/or PSM as described herein can be fused to other immunogenic, biologically significant, or protective epitope containing polypeptides to generate a multivalent vaccine in a single chain and induce an immune response against multiple antigens.
  • the multivalent oligopeptide, DT, and/or PSM as described herein can be fused to one or more T cell epitopes to induce T cell immunity.
  • the subject is an animal, e.g., a vertebrate, e.g., a mammal, e.g., a human.
  • Some embodiments include a method of inducing an immune response against a S. aureus strain, comprising administering to a subject in need of said immune response an effective amount of a composition comprising a multivalent oligopeptide, DT, and/or PSM as described herein, or polynucleotides, vectors, or host cells encoding same.
  • a subject is administered a composition comprising a multivalent oligopeptide, DT, and/or PSM as described herein, or polynucleotides, vectors, or host cells encoding same prophylactically, e.g., as a prophylactic vaccine, to establish or enhance immunity to Staphylococcus, e.g., S. aureus, in a healthy animal prior to potential or actual exposure to Staphylococcus, e.g., S. aureus or contraction of a Staphylococcus-velated symptom, thus preventing disease, alleviating symptoms, reducing symptoms, or reducing the severity of disease symptoms.
  • the disease is a respiratory disease, e.g., pneumonia.
  • compositions, polypeptides, polynucleotides, vectors, or host cells as described herein can also be used to treat a subject already exposed to Staphylococcus, e.g., S. aureus, or already suffering from a Staphylococcus related symptom to further stimulate the immune system of the animal, thus reducing or eliminating the symptoms associated with that exposure.
  • Staphylococcus e.g., S. aureus
  • treatment of an animal refers to the use of one or more compositions, polypeptides, polynucleotides, vectors, or host cells of the disclosure to prevent, cure, retard, or reduce the severity of S. aureus symptoms in an animal, and/or result in no worsening of S. aureus symptoms over a specified period of time. It is not required that any composition, polypeptide, polynucleotide, a vector, or a host cell as described herein provides total protection against a staphylococcal infection or totally cure or eliminate all Staphylococcus related symptoms.
  • a subject in need of therapeutic and/or preventative immunity refers to a subject in which it is desirable to treat, i.e., to prevent, cure, retard, or reduce the severity of Staphylococcus related symptoms, or result in no worsening of Staphylococcus related symptoms over a specified period of time.
  • a subject in need of the immune response refers to a subject for which an immune response(s) against a S Staphylococcus related disease is desired.
  • compositions, polypeptide or polynucleotide of the disclosure are administered to a patient in an amount sufficient to elicit an effective innate, humoral and/or cellular response to the multivalent oligopeptide, DT, and/or PSM to cure or at least partially arrest symptoms or complications.
  • Amount adequate to accomplish this is defined as “therapeutically effective dose” or "unit dose.” Amounts effective for this use will depend on, e.g., the polypeptide or polynucleotide composition, the manner of administration, the stage and severity of the disease being treated, the weight and general state of health of the patient, and the judgment of the prescribing physician. In some embodiments, a priming dose is followed by a boosting dose over a period of time.
  • an initial immunization that is for therapeutic or prophylactic administration
  • boosting dosages in the same dose range pursuant to a boosting regimen over weeks to months depending upon the patient's response and condition by measuring the antibody or T lymphocyte response in the patient's blood.
  • Polypeptides and compositions as described herein can generally be employed in serious disease states, that is, life-threatening or potentially life threatening situations. In such cases, in view of the minimization of extraneous substances and the relative nontoxic nature of the polypeptides, it is possible and can be felt desirable by the treating physician to administer substantial excesses of these polypeptide compositions.
  • administration can begin at the first sign of S. aureus infection or risk factors.
  • the initial dose is followed by boosting doses until, e.g., symptoms are substantially abated and for a period thereafter.
  • loading doses followed by boosting doses can be required.
  • the composition as described herein is delivered to a subject by methods described herein, thereby achieving an effective immune response, and/or an effective therapeutic or preventative immune response.
  • Any mode of administration can be used so long as the mode results in the delivery and/or expression of the desired polypeptide in the desired tissue, in an amount sufficient to generate an immune response to Staphylococcus, e.g., S. aureus, and/or to generate a prophylactically or therapeutically effective immune response to Staphylococcus, e.g., to S. aureus, in an animal in need of such response.
  • a composition described herein can be administered by mucosal delivery, transdermal delivery, subcutaneous injection, intravenous injection, oral administration, pulmonary administration, intramuscular (i.m.) administration, or via intraperitoneal injection.
  • suitable routes of administration include, but not limited to intratracheal, transdermal, intraocular, intranasal, inhalation, intracavity, intraductal (e.g., into the pancreas) and intraparenchymal (i.e., into any tissue) administration.
  • Transdermal delivery includes, but not limited to intradermal (e.g., into the dermis or epidermis), transdermal (e.g., percutaneous) and transmucosal administration (i.e., into or through skin or mucosal tissue).
  • Intracavity administration includes, but not limited to administration into oral, vaginal, rectal, nasal, peritoneal, or intestinal cavities as well as, intrathecal (i.e., into spinal canal), intraventricular (i.e., into the brain ventricles or the heart ventricles), intra-arterial (i.e., into the heart atrium) and sub arachnoidal (i.e., into the sub arachnoid spaces of the brain) administration.
  • Any mode of administration can be used so long as the mode results in the delivery and/or expression of the desired polypeptide in an amount sufficient to generate an immune response to Staphylococcus, e.g., S. aureus, and/or to generate a prophylactically or therapeutically effective immune response to Staphylococcus, e.g., S. aureus, in an animal in need of such response.
  • Administration as described herein can be by e.g., needle injection, or other delivery or devices known in the art.
  • a composition comprising a multivalent oligopeptide, DT, and or PSM as described herein, or polynucleotides, vectors, or host cells encoding same, stimulate an antibody response or a cell-mediated immune response sufficient for protection of an animal against Staphylococcus, e.g., S. aureus infection.
  • a composition comprising a multivalent oligopeptide, DT, and/or PSM as described herein, or polynucleotides, vectors, or host cells encoding same, stimulate both a humoral and a cell- mediated response, the combination of which is sufficient for protection of an animal against Staphylococcus, e.g., S.
  • a composition comprising a multivalent oligopeptide, DT, and/or PSM as described herein, or polynucleotides, vectors, or host cells encoding same further stimulates an innate, an antibody, and/or a cellular immune response.
  • a composition comprising a multivalent oligopeptide, DT, and/or PSM as described herein, or polynucleotides, vectors, or host cells encoding same can induce antibody responses to S. aureus.
  • components that induce T cell responses e.g., T cell epitopes
  • components such as the polypeptides as described herein that primarily induce an antibody response are combined with components such as the polypeptides as described herein that primarily induce an antibody response.
  • compositions as described herein comprising administering to a subject in need of therapeutic and/or preventative immunity one or more of the compositions as described herein.
  • compositions as described herein can be administered to an animal at any time during the lifecycle of the animal to which it is being administered. In humans, administration of the composition as described herein can, and often advantageously occurs while other vaccines are being administered, e.g., as a multivalent vaccine as described elsewhere herein.
  • composition as described herein can be used in any desired immunization or administration regimen; e.g., in a single administration or alternatively as part of periodic vaccination regimes such as annual vaccinations, or as in a prime-boost regime in which composition or polypeptide or polynucleotide of the disclosure is administered either before or after the administration of the same or of a different polypeptide or polynucleotide.
  • a prime-boost protocol is often a suitable method of administering vaccines.
  • one or more compositions as described herein can be utilized in a "prime boost" regimen.
  • An example of a "prime boost” regimen can be found in Yang, Z. et al. J. Virol. 77:799-803, 2002, which is incorporated herein by reference in its entirety.
  • Infections to be treated include, but are not limited to a localized or systemic infection of skin, soft tissue, blood, or an organ or an auto-immune disease.
  • Specific diseases or conditions to be treated or prevented include, but are not limited to, respiratory diseases, e.g., pneumonia, sepsis, skin infections, wound infections, endocarditis, bone and joint infections, osteomyelitis, and or meningitis.
  • a number of animal models for S. aureus infection are known in the art, and can be used with the methods disclosed herein without undue experimentation.
  • a hamster model of methicillin-resistant Staphylococcus aureus (MRSA) pneumonia has been described for the testing of antimicrobials.
  • MRSA methicillin-resistant Staphylococcus aureus
  • a model of S aureus-induced pneumonia in adult, immunocompetent C57BL/6J mice is described, which closely mimics the clinical and pathological features of pneumonia in human patients. (Bubeck-Wardenburg J.
  • EXAMPLE 1 Generation of attenuated mutants of ⁇ -toxin and PSMa3.
  • the ⁇ -toxin and PSM oligopeptides require an amphiphilic a-helical structure to exhibit the surfactant properties (Omae, et al, 2012, J Biol Chem, 287 (19):15570-15579; Wang, et al., 2007, Nat Med, 13 (12): 1510-1514).
  • These peptides consist of a hydrophobic and a hydrophilic surface as shown in Figure 1A for the four PSM-a oligopeptides, two PSM- ⁇ oligopeptides, and the ⁇ -toxin oligopeptide.
  • peptides consist of a hydrophobic and a hydrophilic surface as shown in Figure 1A for the four PSM-a oligopeptides, two PSM- ⁇ oligopeptides, and the ⁇ -toxin oligopeptide.
  • the hydrophobic face of PSM-mec is shown in Figure 1A (hydrophobic face shown in the lower half of the circular depictions of the peptides).
  • the peptides are shown in Table 3, with hydrophobic face residues underlined.
  • GLY -ALA MEFGAKLFKFFKDALGKFLGNN 11 [0152] We engineered single and double mutants by replacing these two amino acids either by alanine or by glycine or both. As shown in Figure IB, the mutant constructs have decreased hydrophobicity and hydrophobic moment compared to wild type toxin as analyzed by Heliquest program (Gautier, et al., 2008, Bioinformatics, 24 (18):2101-2102). Similar mutants can be generated by further mutations in the hydrophobic face as additional potential attenuated toxoids.
  • Neutralization assay For neutralization, diluted serum samples were added to 50 ⁇ of the various oligopeptides (12.5 ⁇ g/ml), incubated 10 min at room temperature, and then 100 ⁇ of 5% horse RBC were added. The plates were incubated 37 °C for 45 min. Plates were then centrifuged and 100 ⁇ of the supernatant was transferred into new NUNC ELISA plate. Absorbance in the supernatants were determined in a VersamaxTM plate reader (Molecular Devices CA) at 416 nm.
  • delta toxin -ala2 (L12G/V20G) were fully attenuated.
  • delta toxin -ala2 mutant for binding to human neutralizing antibodies in a pool of high titer human sera generated by screening individual normal sera.
  • delta toxin toxicity can be effectively neutralized with a 1 :450 dilution of human serum pool.
  • Delta toxin-ala2 neither induced significant lysis of the cells nor did it change the toxicity of delta toxin when the toxin and mutant were combined.
  • EXAMPLE 3 Generation of fusion constructs of AT62 with delta toxin and PSM
  • the AT62 vaccine has shown efficacy when tested in different animal models (Adhikari, et al., 2012, PLoS One, 7 (6):e38567).
  • the nucleic acid sequences codon optimized for expression in E. coli were prepared, and the three fusion proteins were produced at small scale. The specificity and the size of the constructs were confirmed by western blot with AT62 specific antibodies (6C12) ⁇ Figure 5C). The sequences are presented in Table 5.
  • AT62 oligopeptide is single-underlined
  • delta toxin is double-underlined
  • PSM PSMa3 has a broken underline.
  • Additional fusion proteins including AT62 and staphylococcal exotoxin B (SEB) are also presented
  • KYKDKYVDVFGANAYYQCAF ACGATCGCAGGTGGTGGTGGTTCTGG
  • VKIE V YLTT K GGGGS GGGG TTTCAGCAAGAAAACCAACGATATTA
  • DKYKDKYVDVFGANAYYQC ACGATTGCGGGCGGTGGCGGTAGTGA
  • AFSKKTNDINSHQTDKRKTC ATCCCAGCCGGACCCGAAACCGGACG
  • mice The immunogenicity of two of the fusion constructs (AT62_DT and AT62 PSM) along with control (AT62 AA) was tested in Swiss Webster mice in groups of 4, 4 and 8 mice respectively. Mice were immunized subcutaneously with the proteins (10 ⁇ g) along with adjuvant (Sigma Adj System; an MPL based adjuvant) (5 ⁇ g) three times at two week intervals (days 0, 14 & 28).
  • adjuvant Sigma Adj System; an MPL based adjuvant
  • mice were boosted with the respective ⁇ -toxin or PSMa3 peptide (10 ⁇ g) and serum samples collected from the mice were tested for binding to the antigen using ELISA as described before (Adhikari, et ah, 2012, PLoS One, 7 (6):e38567). Briefly, 96-well plates were coated with lOOng/well of full length alpha toxin (List Biological Laboratories, Campbell, CA), PSMa3, or delta toxin overnight at 4 °C. Plates were blocked with Starting Block buffer (Thermo Scientific) for one hour at room temperature (RT). Serum samples were diluted at 1 : 100 using starting block buffer as diluent.
  • Starting Block buffer Thermo Scientific
  • Plates were washed three times and sample dilutions were applied at 100 ⁇ /well. Plates were incubated for one hour at RT and washed three times before applying the conjugate, goat anti-mouse IgG (H&L)-HRP (Horse Radish Peroxidase) in starting block buffer. Plates were incubated for one hour at RT, washed as described above and incubated with TMB (3,3',5,5'-tetramethylbenzidine) to detect HRP for 30min. Optical density at 650nm was measured using a VersamaxTM plate reader (Molecular Devices CA).
  • mice vaccinated with the fusion constructs AT62-PSM and AT62-DT showed strong antibody response to alpha hemolysin showing that the AT62 retained its immunogenicity in the context of fusion construct.
  • Response to PSMa3 and ⁇ - toxin peptides was also detectable although at a lower level.
  • Vaccines SEBL 45 R/Y89A/Y94A, SEAL 4 8R/D70R/Y92A, Or TSST-1L30R/D27A/I46A-
  • S. aureus Superantigens SEB, SEC, SEA, and TSST-1.
  • Recombinant vaccines for SEB, SEA, and TSST-1 were developed and tested individually for protective efficacy in models of toxic shock syndrome (Bavari, et al, 1996, J Infect Dis,; Bavari and Ulrich, 1995, Infect Immun, 63 (2):423-429; Boles, et al, 2003 Clin Immunol, 108 (l):51-59; Boles, et al, 2003, Vaccine, 21 (21-22):2791-2796; Ulrich, et al, 1998, Vaccine, 16 (19):1857-1864).
  • SAgs play an important role in complications of SA disease, a major obstacle in developing vaccines based on SAgs is the fact that there are >20 variants of these toxins in various SA strains.
  • SEA, SEB and TSST-1 were coupled to agarose beads (1 mg SAg per 1 mL bead volume) of an Aminolink® plus immobilization column (Thermo Scientific, Rockford, IL) following the manufacturer's protocol.
  • Peripheral blood mononuclear cells were isolated from heparinized blood of de-identified healthy human donors by Ficoll gradient centrifugation as described elsewhere (Berthold, 1981, Blut, 43 (6):367-371). Isolated peripheral blood mononuclear cells were washed twice in PBS, frozen in 10% DMSO in heat-inactivated fetal bovine serum (HI-FBS) overnight at -80 °C, and stored in liquid nitrogen until further use.
  • HI-FBS heat-inactivated fetal bovine serum
  • cells were washed and re-suspended in RPMI 1640 medium, supplemented with 5% fetal bovine serum (FBS), non-essential amino acids, Penicillin/Streptomycin and L-Glutamine. Cells were, enumerated by Trypan blue exclusion and adjusted to 2xl0 6 cells/ml.
  • FBS fetal bovine serum
  • a combination of anti-SEA, -SEB, and -TSST-1 was used in a semi log dilution ranging from 0.02 to 20 ⁇ g/ml and the same amount of toxin as above.
  • Wells containing medium with toxin only were served as positive controls.
  • the plates were incubated at 37°C in an atmosphere of 5% C0 2 -95% air for 48 hours. Plates were centrifuged at 1600xg for 10 minutes, culture supernatants harvested and IFNy concentration (pg/ml), was determined by ELISA (Human IFN-gamma DuoSet, R&D Systems, Minneapolis, MN) following the manufacturers' protocol.
  • affinity purified human antibodies (from IVIG) to each of these three toxins provided robust neutralization towards the homologous toxin and varying degree of cross neutralization to several other SAgs.
  • a cocktail of the three human antibodies resulted in a remarkable widening of the cross neutralization activity.
  • SEB L45R /Y89AA'94A, SEAL48R/D7 0 R/Y92A, and TSST-1L3OR/D27A/I46A mutants are expressed as single molecules in a prokaryotic host, e.g., E. coli.
  • a prokaryotic host e.g., E. coli.
  • Such fusion proteins can be superior to individual components not only due to ease of manufacturing but also because they can enhance the elicitation of cross reactive antibodies between various superantigens as the common epitopes brought together into a single molecule can act in an immunodominant manner.
  • the following fusion proteins are to be constructed.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Immunology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Molecular Biology (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Epidemiology (AREA)
  • Mycology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Microbiology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Pulmonology (AREA)
  • Communicable Diseases (AREA)
  • Oncology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)

Abstract

The present disclosure provides immunogenic compositions useful in prevention and treatment of Staphylococcus aureus infection. In particular, the disclosure provides delta toxin and phenol-soluble modulin peptides as well as mutants, fragments, variants or derivatives thereof. The disclosure further provides multivalent oligopeptides, fusion proteins comprising two or more staphylococcal proteins, e.g., DT, PSM, alpha hemolysin, leukocidin, superantigen, or any fragments, variants, derivatives, or mutants thereof fused together as a single polypeptide in any order.

Description

TOXOID PEPTIDES DERIVED FROM PHENOL SOLUBLE MODULIN, DELTA TOXIN, SUPERANTIGENS , AND FUSIONS THEREOF
REFERENCE TO SEQUENCE LISTING SUBMITTED ELECTRONICALLY
[0001] The content of the electronically submitted sequence listing in ASCII text file (Name:
57783_132959_SEQ_LST_ST25.txt; Size: 88,443 bytes; and Date of Creation: June 18, 2014) filed with the application is incorporated herein by reference in its entirety.
BACKGROUND
[0002] Staphylococcus aureus (SA) is a Gram-positive human pathogen that causes a wide range of infections from skin and soft tissue infections (SSTI) to life threatening sepsis and pneumonia. It is a leading cause of hospital- and community-associated infections worldwide (Barrio, et ah, 2006, Microbes Infect, 8 (8):2068-2074; Brown, et ah, 2009 Clin Microbiol Infect, 15 (2):156-164; Colin, et ah 1994, Infect Immun, 62 (8):3184-3188). The range of pathologies reflects the diverse abilities of SA to escape the immune response using a plethora of virulence factors: the superantigenic and pore-forming toxins, coagulase, capsular polysaccharide, adhesins, proteases, complement inactivating exoproteins, and other innate response modifiers (Barrio, et al, 2006, Microbes Infect, 8 (8):2068-2074; Deurenberg and Stobberingh, 2008, Infect Genet Evol, 8 (6):747-763).
[0003] Since its first emergence in the 1960s methicillin-resistant SA (MRS A) has become endemic in healthcare settings worldwide (Diep, et al, 2006, J Infect Dis, 193 (11): 1495- 1503). Since the 1990s, community associated MRS A strains (CA-MRSA) emerged, and are posing a major global challenge (Bassetti, et al., 2009, Int J Antimicrob Agents, 34 Suppl 1:S15-19; Bradley, 2005, Semin Respir Crit Care Med, 26 (6):643-649; Chambers, 2005, N. Engl J Med, 352 (14):1485-1487.). Alpha hemolysin (a-toxin, Hla) is a major virulence factor in SA pneumonia and SSTI (Bubeck Wardenburg and Schneewind, 2008, J Exp Med, 205 (2):287-294; Kennedy, et al, 2010, J Infect Dis, 202 (7):1050-1058). Recently, cytolytic short peptides known as phenol soluble modulins (PSMs) were identified as key virulence factors that lyse neutrophils, the main line of defense against 5*. aureus (Wang, et ah, 2007, Nat Med, 13 (12):1510-1514). Another related cytolytic short peptide of staphylococci is known as delta hemolysin or delta toxin (5toxin) the key marker of S. aureus quorum sensing system (agr) (Novick, et al., 1993, EMBO J, 12 (10):3967-3975). A recent epidemiological study in a cohort of patients with SA bacteremia shows inverse correlation between probability of sepsis and pre-existing antibodies to Hla, PSM-a3, as well as δ-toxin (Adhikari, et al, 2012, J Infect Dis, 206 (6):915-923).
[0004] Staphylococcal superantigens (SAgs) induce a massive release of cytokines and chemokines, enhanced expression and activation of adhesion molecules, increased T-cell proliferation, and ultimately T-cell apoptosis/anergy. This sequence of events can culminate in Toxic Shock Syndrome (TSS), a life threatening condition (Todd, et al, 1978, Lancet, 2 (8100):1116-1118) characterized by rash, hypotension, fever, and multisystem dysfunction (Bohach, et al, 1990, Crit Rev Microbiol, 17 (4):251-272.). A major challenge in development of multivalent S. aureus vaccines including superantigens is that there are more than 20 different SAgs and there is a wide range of variability in SAg presence in clinical isolates because most SEs are on mobile genetic elements, such as plasmids or pathogenicity islands (Staphylococcal enterotoxin K(sek), (Staphylococcal enterotoxin Q seq), lysogenic phages (Staphylococcal enterotoxin A (sea), or antibiotic resistance cassettes, like SCCmec (Staphylococcal enterotoxin H (seh) (Omoe, et al., 2002, J Clin Microbiol, 40 (3):857-862). Based on an extensive literature review encompassing over 6000 clinical isolates, the most widely represented Superantigens (Sags) appear to be toxic shock syndrome toxin 1 (TSST- 1) and (Staphylococcal enterotoxin C (SEC), followed by (Staphylococcal enterotoxin A (SEA), (Staphylococcal enterotoxin D (SED), and (Staphylococcal enterotoxin B (SEB). More recent studies show the emergence of (Staphylococcal enterotoxin K (SEK) and (Staphylococcal enterotoxinQ (SEQ), primarily due to circulation of the USA300 clone. Attenuated Superantigen toxoids for (Staphylococcal enterotoxin (SEA), (Staphylococcal enterotoxin B (SEB), and TSST-1 have been designed and tested in animal models of toxic shock. These mutants are deficient in binding to MHC class II protein and therefore lack superantigenic activity (subject of patents 6, 713,284; 6,399,332; 7,087,235; 7, 750,132; 7,378,257, and 8,067,202). A simplified superantigen toxoid vaccine capable of inducing broad neutralizing antibodies is therefore highly is needed to be practical for inclusion into a multivalent S. aureus vaccine.
[0005] Phenol Soluble modulins (PSMs) and Delta-Hemolysin( -toxin): S. aureus secretes four short (~20 amino acids, a-type) and two longer (~40 amino acids, β-type) cytolytic peptides, known as phenol soluble modulin (PSM) (Wang, et al., 2007, Nat Med, 13 (12):1510-1514). In addition, SA produces 6-toxin, which is similar to the a-type PSMs. These genes are expressed in all S. aureus strains under the control of the agr system (Wang, et ah, 2007, Nat Med, 13 (12):1510-1514). Recently, a novel PSM (PSM-mec) has been also identified within the staphylococcal methicillin resistance mobile genetic element SCCmec (Chatterjee, et ah, 2011, PLoS One, 6 (12):e28781; Kaito, et al, 2011, PLoS Pathog, 7
(2) :el001267) suggesting that horizontal transfer of these toxins can contribute to MRS A virulence. PSMs are lytic towards neutrophils, the first line of host defense against SA (Wang, et ah, 2007, Nat Med, 13 (12):1510-1514). Furthermore, recent studies indicate a synergistic effect on hemolytic activity of β-hemolysin (Cheung, et al., 2012, Microbes Infect, 14 (4):380-386). A key role of PSMs in pathogenesis has been shown in mouse models of bacteremia and SSTI using deletion mutants (Wang, et al., 2007, Nat Med, 13 (12):1510-1514). Furthermore, a recent report suggests a key role for PSMs in biofilm formation (Periasamy, et al, 2012, Proc Natl Acad Sci U S A, 109 (4):1281-1286). Among the PSMs, PSM-a3 plays the most prominent role in S. aureus pathogenesis (Wang, et al., 2007, Nat Med, 13 (12):1510-1514).
[0006] δ-Toxin is encoded by the hid gene located within RNAIII transcript of agr locus.
RNAIII is a regulatory RNA and plays a major role in regulation of SA quorum-sensing system for the expression of various virulence genes (Novick, 2003, Mol Microbiol, 48 (6):1429-1449; Novick, et al, 1993, EMBO J, 12 (10):3967-3975). With increased expression of RNAIII, the level of extracellular δ-toxin is increased reaching almost half the amount of total exoproteins at the stationary phase (Kreger, et al, 1971, Infect Immun, 3
(3) :449-465). The hid'' mutant of the CA-MRSA strain MW2 exhibited attenuated virulence in mouse bacteremia model (Wang, et al, 2007, Nat Med, 13 (12):1510-1514). A recent study also revealed that δ-toxin increases the cell number/unit area of colony by inhibiting colony spreading, resulting in a thicker giant colony and promotes the compartmentalization of SA colonies leading to efficient colonization (Omae, et al, 2012, J Biol Chem, 287 (19):15570-15579). Thus δ-toxin also appears to modulate the physical state of SA colonies. δ-toxin also plays an important role in the escape of S. aureus from phago-endosomes of human epithelial and endothelial cells in the presence of beta-toxin (Giese, et al, 201 1, Cell Microbiol, 13 (2):316-329) by acting as a costimulator of human neutrophil oxidative burst (Schmitz, et al, 1997, J Infect Dis, 176 (6): 1531-1537).
[0007] S. aureus alpha hemolysin (Hla): The pore forming toxins form oligomeric beta barrel pores in the plasma membrane and play an important role for bacterial spread and survival, immune evasion and tissue destruction. SA alpha-toxin (Hla) (Bhakdi and Tranum- Jensen, 1991, Microbiol Rev, 55 (4):733-751) targets many cells such as lymphocytes, macrophages, pulmonary epithelial cells and endothelium, and erythrocytes (Bhakdi and Tranum-Jensen, 1991, Microbiol Rev, 55 (4):733-751; McElroy, et al, 1999, Infect Immun, 67 (10):5541-5544). Several lines of evidence validate Hla as a prime vaccine target for prevention of S. aureus infection or complications: i) hla is encoded by a chromosomal determinant (Brown and Pattee, 1980, Infect Immun, 30 (l):36-42), and expressed in most SA isolates (Aarestrup, et ah, 1999, APMIS, 107 (4):425-430;Bhakdi and Tranum-Jensen, 1991, Microbiol Rev, 55 (4):733-751; Husmann, et al., 2009, FEBS Lett, 583 (2):337-344; Shukla, et al., 2010, J Clin Microbiol, 48 (10):3582-3592); ii) A partially attenuated Hla (H35L) and antibodies to Hla protect mice against SA pneumonia and skin infections (Kennedy, et al., 2010, J Infect Dis, 202 (7):1050-1058; Bubeck Wardenburg and Schneewind, 2008, J Exp Med, 205 (2):287-294; Ragle and Bubeck Wardenburg, 2009, J Infect Dis, 176 (6): 1531- 1537); Hi) Antibodies to H35L protect mice from toxin and partially protect against bacterial challenge (Menzies and Kernodle, 1996; Infect Immun, 64 (5):1839-1841). While the H35 mutation largely abrogates the lytic activity of Hla, a single point mutation is not considered sufficiently safe to be developed as vaccine for human use.
[0008] WO 2012/109167 A 1 describes a rationally designed mutant vaccine for Hla referred to as AT62. Immunization of mice with AT62 protected the animals against S. aureus lethal sepsis and pneumonia (Adhikari, et al., 2012, PLoS One, 7 (6):e38567). Furthermore, antibodies raised against AT62 protected mice from lethal sepsis induced by S. aureus (Adhikari, et al., 2012, PLoS One, 7 (6):e38567).
[0009] Panton- Valentine Leukocidin (PVL): PVL is a member of a family of bicomponent cytolytic toxins known as leukotoxins that is produced by several CA-MRSA lineages (Diep and Otto, 2008, Trends Microbiol, 16 (8):361-369). The bi-component hemolysins and leukotoxins, play an important role in staphylococcal immune evasion. These toxins kill key immune cells and cause tissue destruction, thereby often weakening the host during the first stage of infection and promoting bacterial dissemination and metastatic growth in distant organs. The two PVL components LukS-PV and LukF-PV are secreted separately, and form the pore-forming octameric complex upon binding of LukS-PV to its receptor and subsequent binding of LukF-PV to LukS-PV (Miles, et al, 2002, Protein Sci, 11 (4):894-902; Pedelacq, et al, 2000, Proc Natl Acad Sci U S A, 109 (4): 1281-1286). Targets of PVL are polymorphonuclear phagocytes (PMN), monocytes, and macrophages. Epidemiologically, PVL is associated with primary skin infections, such as furunculosis and severe necrotizing pneumonia that rapidly progresses towards acute respiratory distress syndrome. The role of PVL in skin, bone, and lung infections has been shown in animal models (Brown, et al, 2009 Clin Microbiol Infect, 15 (2):156-164; Cremieux, et al, 2009, PLoS ONE, 4 (9):e7204; Diep, et al, 2010, Proc Natl Acad Sci USA, 107 (12):5587-5592; Tseng, et al, 2009 PLoS ONE, 4 (7):e6387; Varshney, et al, 2010, J Infect Dis l;201(l):92-6). PVL-positive CA-MRSA affect healthy children or young adults that had neither any recent contact with health care facilities nor with any risk factors with a mortality of up to 75% (Gillet, et al., 2002, Lancet, 359 (9308):753-759; Lina, et al, 1999, Clin Infect Dis, 29 (5): 1128-1132).
[0010] PCT application No. PCT/US 12/67483 discloses rationally designed mutants vaccine for LukS-PV and LukF-PV. Immunization of mice with these mutants protected the animals against S. aureus lethal sepsis (Karauzum, et al, 2013, PLoS ONE, 8 (6):e65384). Furthermore, antibodies raised against LukS-PV mutant protected mice from lethal sepsis induced by S. aureus (Karauzum, et al, 2013, PLoS ONE, 8 (6):e65384).
[0011] Staphylococcus aureus enterotoxins: Superantigens (SAgs) constitute a large family of pyrogenic toxins composed of staphylococcal enterotoxins (SEs) and toxic shock syndrome toxin 1 (TSST-1) (Johns and Khan, 1988, J Bacteriol, 170 (9):4033-4039). In contrast to conventional antigens that undergo proteolytic processing by antigen presenting cells and are presented as MHC/peptide complex to T cells, SAgs cross link TCR with MHC Class II and activate up to 30% of T cells (Choi, et al, 1989, Proc Natl Acad Sci US A, 86 (22):8941-8; Marrack and Kappler, 1990, Science, 248 (4959):1) leading to massive release of cytokines and chemokines, enhanced expression as well as activation of cell-adhesion molecules, increased T-cell proliferation, and eventually T-cell apoptosis/anergy. This sequence of events can culminate in Toxic Shock Syndrome (TSS), a life threatening condition (Todd, et al, 1978, Lancet, 2 (8100):1116-1118) characterized by rash, hypotension, fever, and multisystem dysfunction (Bohach, et al, 1990, Crit Rev Microbiol, 17 (4):251-272). Antibodies play an important role in protection against TSS (Bonventre, et al, 1984, J Infect Dis, 150 (5):662-666; Notermans, et al, 1983, J Clin Microbiol, 18 (5):1055-1060), thus individuals that do not seroconvert towards the offending toxin due to hyporesponsive T-cells (Mahlknecht, et al, 1996, Hum Immunol, 45 (l):42-4) and/or T-cell dependent B-cell apoptosis (Hofer, et al, 1996, Proc Natl Acad Sci U S A, 93 (11):5425- 5430) are more likely to experience recurring bouts. Clonal deletion of CD4 T cells can further impair effective antibody response to other S. aureus antigens. Furthermore, at lower non-TSS inducing concentrations SAgs impact the virulence of S. aureus strains through induction of a local excessive inflammatory response. Attenuated mutants of SEs and TSST- 1 have been developed that are deficient in binding to MHC-class II molecules. These mutants can serve as a vaccine for S. aureus infections as well as toxic shock syndrome by inducing neutralizing antibodies against superantigens.
SUMMARY
[0012] In one aspect, the disclosure provides a recombinant peptide that can include a
Staphylococcus aureus delta toxin peptide or a mutant, fragment, variant or derivative thereof (DT); a Staphylococcus aureus phenol soluble modulin peptide or a mutant, fragment, variant or derivative thereof (PSM); or a fusion of a DT and a PSM; where the peptide is attenuated relative to wild-type DT, PSM, or both, and where the peptide can elicit an anti- Staphylococcus aureus immune response when administered to a subject. In certain aspects, surfactant properties of the DT, PSM, or both, is reduced, while maintaining immunogenicity. In certain aspects, hydrophobicity is reduced while maintaining the peptide's alpha-helical structure. In certain aspects, at least one hydrophobic amino acid is replaced with a less hydrophobic amino acid, for example, valine (V), leucine (L), isoleucine (I), phenylalanine (F), or methionine (M) can be replaced with glycine or alanine.
[0013] The disclosure provides a DT that includes the amino acid sequence
MAQDX5X6STX9GDX12X13KWX,6X17DTX2oNKFTKK (SEQ ID NO: 39), where at least one of X X5, X6, X9, X12, X13, Xi6> X17, or X20 includes an amino acid substitution relative to SEQ ID NO: 1, and where X5 is isoleucine (I), glycine (G) or alanine (A), X6 is I, G, or A, X9 is I, G, or A, X12 is leucine (L), G, or V, X13 is valine (V), G, or A, X16 is I, G, or A, X17 is I, G, or A, and X20 is V, G, or A. In certain aspects the peptide includes the amino acid sequence SEQ ID NO: 2. In certain aspects the peptide includes the amino acid sequence SEQ ID NO: 4. In certain aspects the peptide includes the amino acid sequence SEQ ID NO: 3. In certain aspects the peptide includes the amino acid sequence SEQ ID NO: 5.
[0014] The disclosure further provides a PSM that can be PSMal, PSMa2, PSMa3, PSMa4,
PSMpi, PSMp2, PSM-mec, or any combination of two or more PSMs. The disclosure provides a PSMal mutant including the amino acid sequence
XiGX3X4AGX7X8KX10X11KSXi4X15EQX18TGK (SEQ ID NO: 40), where at least one of Xi, X3, X4, X7, Xg, Xio, Xn, Xi4 ,Xi5, or X18 includes an amino acid substitution relative to SEQ ID NO: 38, and where Xi is methionine (M), G, or A, X3 is I, G, or A, X4 is I, G, or A, X7 is I, G, or A, Xg is I, G, or A, X10 is V, G, or A, Xn is I, G, or A, Xi4 is L, G, or A, X15 is I, G, or A, and Xi8 is F, G, or A. The disclosure provides a PSMa2 mutant including the amino acid sequence X1GX3X4AGX7X8KX1oX11KGXi4X15EKX18TG (SEQ ID NO: 41), where at least one of Xi, X3, X4, X7, Xg, X10, Xn, XM ,Χ15, or X\$ includes an amino acid substitution relative to SEQ ID NO: 12, and where
Figure imgf000008_0001
is M, G, or A, X3 is I, G, or A, X4 is I, G, or A, X7 is I, G, or A, Xg is I, G, or A, X10 is F, G, or A, Xn is I, G, or A, X14 is L, G, or A, X)5 is I, G, or A, and Xi8 is F, G, or A. The disclosure provides a PSMa3 mutant including the amino acid sequence X1EX3X4AKX7X8KX1oXnKDX14Xi5GKX18X19GNN (SEQ ID NO: 42), where at least one of Xl5 X3, ¾, X7, Xg, X10, Xn, X14 ,X15, X18, or X19 includes an amino acid substitution relative to SEQ ID NO: 6, and where X\ is M, G, or A, X3 is F, G, or A, * is V, G, or A, X7 is L, G, or A, Xs is F, G, or A, X10 is F, G, or A, Xn is F, G, or A, Xi4 is L, G, or A, X15 is L, G, or A, Xj8 is F, G, or A, and X19 is L, G, or A. In certain aspects the peptide includes the amino acid sequence SEQ ID NO: 7. In certain aspects the peptide includes the amino acid sequence SEQ ID NO: 9. In certain aspects the peptide includes the amino acid sequence SEQ ID NO: 8. In certain aspects the peptide includes the amino acid sequence SEQ ID NO: 10. In certain aspects the peptide includes the amino acid sequence e SEQ ID NO: 11. The disclosure provides a PSMa4 mutant including the amino acid sequence XiAX3¾GTX7X8KX1oXnKAXi4X15DX17X18AK (SEQ ID NO: 43), where at least one of Xi, X3, X4, X7, X8, X10, Xn, n ,Xi5, Xn, or X18 includes an amino acid substitution relative to SEQ ID NO: 14, and where Xi is M, G, or A, X3 is I, G, or A, X4 is V, G, or A, X7 is I, G, or A, X8 is I, G, or A, X10 is I, G, or A, Xn is I, G, or A, X14 is I, G, or A, X15 is I, G, or A, X17 is I, G, or A, and X18 is F, G, or A. The disclosure provides a PSMpi mutant including the amino acid sequence
MEGX4X5NAX8KDTX12TAAX16NNDGAKLGTSIVNIVENGVGLLSKLFGF (SEQ ID NO: 44), where at least one of X4, X5, X8, X12, or Xi6 includes an amino acid substitution relative to SEQ ID NO: 15, and where X4 is L, G, or A, X5 is F, G, or A, X8 is I, G, or A, X12 is V, G, or A, and Xi6 is I, G, or A. The disclosure provides a PSMP2 mutant including the amino acid sequence MTGX4AEAX8ANTX12QAAQQHDSVKX23GTSIVDIVANGVGLLGKLFGF (SEQ ID NO: 45), where at least one of X4, Xg, X12, or X23 includes an amino acid substitution relative to SEQ ID NO: 16, and where X4 is L, G, or A, X8 is I, G, or A, X12 is V, G, or A, and X23 is L, G, or A.
[0016] The disclosure further provides a multivalent oligopeptide that includes a fusion of two or more Staphylococcus aureus-fenved peptides, or mutants, fragments, variants, or derivatives thereof arranged in any order, where the two or more Staphylococcus aureus- derived peptides, or mutants, fragments, variants, or derivatives thereof can be the same or different, and where the multivalent oligopeptide includes two or more of: a wild-type DT, or a mutant DT, e.g., as described herein; a wild-type PSM, or a mutant PSM, e.g., as described herein; an alpha hemolysin polypeptide or mutant, fragment, variant, or derivative thereof; a leukocidin polypeptide or mutant, fragment, variant, or derivative thereof; or a superantigen (SAg) polypeptide, or mutant, fragment, variant, or derivative thereof.
[0017] A multivalent oligopeptide as provided herein can include an alpha hemolysin polypeptide or mutant, fragment, variant, or derivative thereof such as the amino acid sequence SEQ ID NO: 46 (AT-62). A multivalent oligopeptide as provided herein can include a Panton- Valentine leukocidin (PVL) LukS-PV subunit such as an amino acid sequence at least 90% identical to SEQ ID NO: 47, a LukS-Mut9 (SEQ ID NO: 54), a Panton- Valentine leukocidin (PVL) LukF-PV subunit such as an amino acid sequence at least 90% identical to SEQ ID NO: 48, a LukF-Mut-1 (SEQ ID NO: 55), or a combination thereof. A multivalent oligopeptide as provided herein can include a staphylococcal enterotoxin B (SEB) or mutant, fragment, variant, or derivative thereof such as an amino acid sequence at least 90% identical to SEQ ID NO: 49, a staphylococcal enterotoxin A (SEA) or mutant, fragment, variant, or derivative thereof such as an amino acid sequence at least 90% identical to SEQ ID NO: 50, a staphylococcal toxic shock syndrome toxin- 1 or mutant, fragment, variant, or derivative thereof such as an amino acid sequence at least 90% identical to SEQ ID NO: 51, or any combination thereof.
[0018] A multivalent oligopeptide as provided herein can include linkers connecting the two or more Staphylococcus awrews-derived peptides, or mutants, fragments, variants, or derivatives thereof are associated via a linker. The linker can include, e.g., at least one, but no more than 50 amino acids selected from the group consisting of glycine, serine, alanine, and a combination thereof. In certain aspects the linker includes (GGGS)n or (GGGGS)„, where n is a integer from 1 to 10. Exemplary multivalent oligopeptides provided by the disclosure include, without limitation, the amino acid sequence SEQ ID NO: 18, SEQ ID NO: 20, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 26, SEQ ID NO: 29, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO. 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, or any combination thereof.
[0019] Any peptide or oligopeptide provided by the disclosure can further include a heterologous peptide or polypeptide including, but not limited to a His-tag, a ubiquitin tag, a NusA tag, a chitin binding domain, a B-tag, a HSB-tag, green fluorescent protein (GFP), a calmodulin binding protein (CBP), a galactose-binding protein, a maltose binding protein (MBP), cellulose binding domains (CBD's), an avidin/streptavidin/Strep-tag, trpE, chloramphenicol acetyltransferase, lacZ (β-Galactosidase), a FLAG™ peptide, an S-tag, a T7-tag, a fragment of any of the heterologous peptides, or a combination of two or more of the heterologous peptides. In certain aspects the heterologous peptide or polypeptide includes an immunogen, a T-cell epitope, a B-cell epitope, a fragment thereof, or a combination thereof.
[0020] Any peptide or oligopeptide provided by the disclosure can further include an immunogenic carbohydrate, e.g., a saccharide. The immunogenic carbohydrate can be a capsular polysaccharide or a surface polysaccharide. The immunogenic carbohydrate can include, without limitation, capsular polysaccharide (CP) serotype 5 (CP5), CP8, poly-N- acetylglucosamine (PNAG), poly-N-succinyl glucosamine (PNSG), Wall Teichoic Acid (WTA), Lipoteichoic acid (LTA), a fragment of any of the immunogenic carbohydrates, and a combination of two or more of the immunogenic carbohydrates. In certain aspects the immunogenic carbohydrate is conjugated to the oligopeptide.
[0021] The disclosure further provides an isolated polynucleotide that includes a nucleic acid any peptide or oligopeptide provided herein, and any combination thereof. In certain aspects the polynucleotide can further include a heterologous nucleic acid, e.g., a. promoter operably associated with the nucleic acid encoding the multivalent oligopeptide, DT, PSM, or any combination thereof. The disclosure provides a vector that includes the polynucleotide provided by the disclosure, e.g., a plasmid. The disclosure provides a host cell that includes a vector provided by the disclosure. The host cell can be, e.g., a bacterium, e.g., Escherichia coli, an insect cell, a mammalian cell or a plant cell.
[0022] The disclosure further provides a method of producing a multivalent oligopeptide,
DT, PSM, or any combination thereof as provided herein, that includes culturing the host cell of any one of claims 61 to 63, and recovering the oligopeptide, DT, PSM, or any combination thereof.
[0023] The disclosure further provides a composition that includes any peptide, oligopeptide, or combination thereof provided by the disclosure, and a carrier. In certain aspects the composition further includes an adjuvant that can be, without limitation, alum, aluminum hydroxide, aluminum phosphate, or a glucopyranosyl lipid A-based adjuvant. In certain aspects the composition further includes an immunogen that can be, without limitation, a bacterial antigen such as a pore forming toxin, a superantigen, a cell surface protein, a fragment of any of the bacterial antigens, or a combination of two or more of the bacterial antigens.
[0024] The disclosure further provides a method of inducing a host immune response against
Staphylococcus aureus that includes administering to a subject in need of the immune response an effective amount of the composition of the disclosure. In certain aspects the immune response is an antibody response, an innate response, a humoral response, a cellular response, and a combination of two or more of the immune responses. The disclosure further provides a method of preventing or treating a Staphylococcal, Streptococcal, or Enterococcal disease or infection in a subject that includes administering to a subject in need thereof the composition of the disclosure. The infection can be, e.g., a localized or systemic infection of skin, soft tissue, blood, or an organ, or can be auto-immune in nature. In certain aspects the disease is a respiratory disease, e.g., pneumonia. In certain aspects the disease is sepsis.
[0025] A subject to be treated by the methods of the disclosure can be a mammal, e.g., a human, bovine, or canine. The composition can be administered to the subject via intramuscular injection, intradermal injection, intraperitoneal injection, subcutaneous injection, intravenous injection, oral administration, mucosal administration, intranasal administration, or pulmonary administration.
[0026] The disclosure further provides a method of producing a vaccine against S. aureus infection that includes: isolating a peptide or oligopeptide as provided by this disclosure, or any combination thereof; and combining the peptide, oligopeptide, or any combination thereof with an adjuvant. BRIEF DESCRIPTION OF THE DRAWINGS/FIGURES
[0027] Figurel : A) Helical wheel representation of PSM-al-4, PSM-pl&2, and δ-toxin showing the hydrophobic and hydrophilic surfaces. B) Mutation strategies for the δ-toxin and PSM-a3. Amino acids L and V, conserved in hydrophobic faces, are replaced either by ala (A) or Gly (G) individually or in combination (gly-ala). The predicted decrease in hydrophobicity and hydrophobic moment are shown for each mutant. Polar amino acids are represented in red (D, E: - charge) and blue (R, K: + charge); Polar amino acids in pink/ violet (Q, N, T); Hydrophobic in yellow (F, L, I) and such that are not disturbing hydrophobicity are marked in grey (A) or in green (P) for their aromatic side-chain. C) Helical wheel representation of PSM-mec showing the hydrophobic and hydrophilic surfaces.
[0028] Figure 2: Delta toxin mutants toxicity assay. WT and mutants at concentration of 12.5 μg/ml were tested in different % of horse RBC. Hemolysis ODs were measured at 416nm.
[0029] Figure 3: DT-ala2 mutant is highly attenuated while retaining binding to human neutralizing antibodies (compare 3rd and 7th bar).
[0030] Figure 4: PSM mutants toxicity assay. WT and mutants at different concentration were tested in different 5 % of horse RBC. Hemolysis ODs were measured at 416nm.
[0031] Figure 5: A) Schematic of three fusion proteins generated with flexible linkers (G4S, denoted as L) and a 6xHis tag. B) Schematic of the secondary structure of AT62-DT-PSM construct. C) Candidate peptides were expressed in E. coli and tested by Western blot using an AT62 specific mAb. Lanes 1 and 2: AT62_DT_PSM; 3 and 4: AT62_PSM; 5 and 6: AT62_DT (Two clones for each construct are shown).
[0032] Figure 6: Antibody response of mice immunized with AT62-PSM and AT62-DT against wild type peptides or full length alpha hemolysin (Hla).
[0033] Figure 7: A) Schematic of three fusion proteins: AT-62, rSEB and DT generated with flexible linkers (G4S, denoted as L).
[0034] Figure 8: Human antibodies to SEA, SEB, and TSST-1 were affinity purified from human IVIG and used in toxin neutralization assays with human PBMC against the SAgs shown on the X axes. The Y axis shows the molar ratio of antibody to toxin required for 50% inhibition of superantigenic activity of the respective SAg on the X axis. The panel titled Cocktail shows the activity of the combination of the three antibodies. Note that lower molar ratio indicates higher neutralizing activity towards the respective toxin. DETAILED DESCRIPTION
I. Definitions
[0035] It is to be noted that the term "a" or "an" entity refers to one or more of that entity; for example, "a polynucleotide," is understood to represent one or more polynucleotides. As such, the terms "a" (or "an"), "one or more," and "at least one" can be used interchangeably herein.
[0036] Furthermore, "and/or" where used herein is to be taken as specific disclosure of each of the two specified features or components with or without the other. Thus, the term and/or" as used in a phrase such as "A and/or B" herein is intended to include "A and B," "A or B," "A" (alone), and "B" (alone). Likewise, the term "and/or" as used in a phrase such as "A, B, and/or C" is intended to encompass each of the following embodiments: A, B, and C; A, B, or C; A or C; A or B; B or C; A and C; A and B; B and C; A (alone); B (alone); and C (alone).
[0037] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this disclosure is related. For example, the Concise Dictionary of Biomedicine and Molecular Biology, Juo, Pei-Show, 2nd ed., 2002, CRC Press; The Dictionary of Cell and Molecular Biology, 3rd ed., 1999, Academic Press; and the Oxford Dictionary Of Biochemistry And Molecular Biology, Revised, 2000, Oxford University Press, provide one of skill with a general dictionary of many of the terms used in this disclosure.
[0038] Units, prefixes, and symbols are denoted in their Systeme International de Unites (SI) accepted form. Numeric ranges are inclusive of the numbers defining the range. Unless otherwise indicated, amino acid sequences are written left to right in amino to carboxy orientation. The headings provided herein are not limitations of the various aspects or embodiments of the disclosure, which can be had by reference to the specification as a whole. Accordingly, the terms defined immediately below are more fully defined by reference to the specification in its entirety.
[0039] Wherever embodiments are described with the language "comprising," otherwise analogous embodiments described in terms of "consisting of and/or "consisting essentially of are also provided.
[0040] Amino acids are referred to herein by their commonly known three letter symbols or by the one-letter symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission. Nucleotides, likewise, are referred to by their commonly accepted single-letter codes.
[0041] The terms "nucleic acid" or "nucleic acid fragment" refers to any one or more nucleic acid segments, e.g., DNA or RNA fragments, present in a polynucleotide or construct. Two or more nucleic acids of the disclosure can be present in a single polynucleotide construct, e.g., on a single plasmid, or in separate (non-identical) polynucleotide constructs, e.g., on separate plasmids. Furthermore, any nucleic acid or nucleic acid fragment can encode a single polypeptide, e.g., a single antigen, cytokine, or regulatory polypeptide, or can encode more than one polypeptide, e.g., a nucleic acid can encode two or more polypeptides. In addition, a nucleic acid can encode a regulatory element such as a promoter or a transcription terminator, or can encode a specialized element or motif of a polypeptide or protein, such as a secretory signal peptide or a functional domain.
[0042] The term "polynucleotide" is intended to encompass a singular nucleic acid or nucleic acid fragment as well as plural nucleic acids or nucleic acid fragments, and refers to an isolated molecule or construct, e.g., a virus genome (e.g., a non-infectious viral genome), messenger RNA (mRNA), plasmid DNA (pDNA), or derivatives of pDNA (e.g., minicircles as described in (Darquet, A-M et al, Gene Therapy 4:1341-1349, 1997) comprising a polynucleotide. A polynucleotide can be provided in linear (e.g., mRNA), circular (e.g., plasmid), or branched form as well as double-stranded or single-stranded forms. A polynucleotide can comprise a conventional phosphodiester bond or a non-conventional bond (e.g., an amide bond, such as found in peptide nucleic acids (PNA)).
[0043] As used herein, the term "polypeptide" is intended to encompass a singular
"polypeptide" as well as plural "polypeptides," and comprises any chain or chains of two or more amino acids. Thus, as used herein, a "peptide," an "oligopeptide," a "dipeptide," a "tripeptide," a "protein," an "amino acid chain," an "amino acid sequence," "a peptide subunit," or any other term used to refer to a chain or chains of two or more amino acids, are included in the definition of a "polypeptide," (even though each of these terms can have a more specific meaning) and the term "polypeptide" can be used instead of, or interchangeably with any of these terms. The term further includes polypeptides which have undergone post- translational modifications, for example, glycosylation, acetylation, phosphorylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage, or modification by non-naturally occurring amino acids. [0044] The terms "delta toxin" or "DT" as used herein, and unless otherwise indicated, encompass wild-type delta toxin peptides as well as mutants, fragments, variants or derivatives thereof. The terms "phenol-soluble modulin," "PSM," PSMal, PSMa2, PSMa3, PSMa4, PSMpi, PSMP2, and PSM-mec as used herein, and unless otherwise indicated, encompass wild-type phenol-soluble modulin peptides as well as mutants, fragments, variants or derivatives thereof. By "corresponding wild-type DT" or "corresponding wild-type PSM" is meant the native DT or PSM peptide from which a mutant peptide subunit was derived.
[0045] The term "multivalent oligopeptide" as used herein refers to a fusion protein comprising two or more staphylococcal proteins, e.g., DT, PSM, alpha hemolysin, leukocidin, superantigen, or any fragments, variants, derivatives, or mutants thereof fused together as a single polypeptide in any order. An oligopeptide can include other heterologous peptides as described elsewhere herein. Other peptides for inclusion in a multivalent oligopeptide provided herein include various other staphylococcal toxins or mutants fragments, variants, or derivatives thereof, described elsewhere herein or in PCT Publication Nos. WO 2012/109167A1 and WO 2013/082558 Al, which are both incorporated by reference herein in their entireties.
[0046] This disclosure provides specific DT and PSM peptides as well as multivalent oligopeptides that can, but do not necessarily include either a wild-type or mutant DT, PSM, or any combination thereof. The collection of peptides and oligopeptides provided by the disclosure are collectively referred to herein as a "multivalent oligopeptide, DT, and/or PSM," or a "multivalent oligopeptide, DT, PSM, or any combination thereof." These collective references are meant to include, without limitation, any one peptide or oligopeptide as provided herein, or two, three, four, or more peptides or oligopeptides as provided herein.
[0047] The terms "fragment," "mutant," "derivative," or "variant" when referring to a multivalent oligopeptide, DT, and/or PSM of the present disclosure include any polypeptide which retains at least some of the immunogenicity or antigenicity of the source protein or proteins. Fragments of multivalent oligopeptides, DTs, and/or PSMs as described herein include proteolytic fragments, deletion fragments or fragments that exhibit increased solubility during expression, purification, and/or administration to an animal. Fragments of multivalent oligopeptides, DTs, and/or PSMs as described herein further include proteolytic fragments or deletion fragments which exhibit reduced pathogenicity or toxicity when delivered to a subject. Polypeptide fragments further include any portion of the polypeptide which comprises an antigenic or immunogenic epitope of the source polypeptide, including linear as well as three-dimensional epitopes.
[0048] An "epitopic fragment" of a polypeptide is a portion of the polypeptide that contains an epitope. An "epitopic fragment" can, but need not, contain amino acid sequence in addition to one or more epitopes.
[0049] The term "variant," as used herein, refers to a polypeptide that differs from the recited polypeptide due to amino acid substitutions, deletions, insertions, and/or modifications. Non- naturally occurring variants can be produced using art-known mutagenesis techniques. In some embodiments, variant polypeptides differ from an identified sequence by substitution, deletion or addition of three amino acids or fewer. Such variants can generally be identified by modifying a polypeptide sequence, and evaluating the antigenic or pathogenic properties of the modified polypeptide using, for example, the representative procedures described herein. In some embodiments, variants of a multivalent oligopeptide, DT, and/or PSM form a protein complex which is less toxic than the wild-type complex.
[0050] Polypeptide variants disclosed herein exhibit at least about 85%, 90%, 94%, 95%,
96%, 97%, 98%, 99% or 99.9% sequence identity with identified polypeptide. Variant polypeptides can comprise conservative or non-conservative amino acid substitutions, deletions or insertions. Variants can comprise multivalent oligopeptides, DTs, and/or PSMs identical to the various wild-type staphylococcal proteins except for at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or more amino acid substitutions, including specific mutations described elsewhere herein, where the substitutions render complex less toxic than a corresponding wild-type protein complex. Derivatives of multivalent oligopeptides, DTs, and/or PSMs as described herein are polypeptides which have been altered so as to exhibit additional features not found on the native polypeptide. Examples include fusion proteins. An analog is another form of a multivalent oligopeptide, DT, and/or PSM described herein. An example is a proprotein which can be activated by cleavage of the proprotein to produce an active mature polypeptide.
[0051] Variants can also, or alternatively, contain other modifications, whereby, for example, a polypeptide can be conjugated or coupled, e.g., fused to a heterologous amino acid sequence, e.g., a signal (or leader) sequence at the N-terminal end of the protein which co- translationally or post-translationally directs transfer of the protein. The polypeptide can also be conjugated or produced coupled to a linker or other sequence for ease of synthesis, purification or identification of the polypeptide (e.g., 6-His), or to enhance binding of the polypeptide to a solid support. For example, the polypeptide can be conjugated or coupled to an immunoglobulin Fc region. The polypeptide can also be conjugated or coupled to a sequence that imparts or modulates the immune response to the polypeptide (e.g., a T-cell epitope, B-cell epitope, cytokine, chemokine, etc.) and/or enhances uptake and/or processing of the polypeptide by antigen presenting cells or other immune system cells. The polypeptide can also be conjugated or coupled to other polypeptides/epitopes from Staphylococcus sp. and/or from other bacteria and/or other viruses to generate a hybrid immunogenic protein that alone or in combination with various adjuvants can elicit protective immunity to other pathogenic organisms. The polypeptide can also be conjugated or coupled to moieties which confer greater stability or improve half life such as, but not limited to albumin, an immunoglobulin Fc region, polyethylene glycol (PEG), and the like. The polypeptide can also be conjugated or coupled to moieties (e.g., immunogenic carbohydrates, e.g., a capsular polysaccharide or a surface polysaccharide) from Staphylococcus sp. and/or from other bacteria and/or other viruses to generate a modified immunogenic protein that alone or in combination with one or more adjuvants can enhance and/or synergize protective immunity. In certain embodiments, the polypeptide described herein further comprises an immunogenic carbohydrate. In one embodiment, the immunogenic carbohydrate is a saccharide.
[0052] The term "saccharide" throughout this specification can indicate polysaccharide or oligosaccharide and includes both. Polysaccharides of the disclosure can be isolated from bacteria and can be sized by known methods. For example, full length polysaccharides can be "sized" (e.g., their size can be reduced by various methods such as acid hydrolysis treatment, hydrogen peroxide treatment, sizing by EMULSIFLEX® followed by a hydrogen peroxide treatment to generate oligosaccharide fragments or microfluidization). Polysaccharides can be sized in order to reduce viscosity in polysaccharide samples and/or to improve filterability for conjugated products. Oligosaccharides have a low number of repeat units (e.g., 5-30 repeat units) and are typically hydrolyzed polysaccharides. Polysaccharides of the disclosure can be produced recombinantly.
[0053] S. aureus capsular antigens are surface associated, limited in antigenic specificity, and highly conserved among clinical isolates. In one embodiment, the immunogenic carbohydrate of the disclosure is a capsular polysaccharide (CP) of S. aureus. In one embodiment, a capsular saccharide can be a full length polysaccharide, however in other embodiments it can be one oligosaccharide unit, or a shorter than native length saccharide chain of repeating oligosaccharide units. Serotyping studies of staphylococcal isolates have revealed several putative capsular serotypes, with types 5 and 8 (CP5 and CP8) being the most prevalent among isolates from clinical infections, accounting for about 25% and 50% of isolates recovered from humans, respectively (O'Riordan and Lee, Clinical Microbiology Reviews, January 2004, p. 218-234, Vol. 17, No. 1; Poutrel and Sutra, J Clin Microbiol. 1993 Feb;31(2):467-9). The same isolates were also recovered from poultry, cows, horses and pigs (Tollersrud et al, J Clin Microbiol. 2000 Aug;38(8):2998-3003; Cunnion KM et al, Infect Immun. 2001 Nov;69(l l):6796-803). Type 5 and 8 capsular polysaccharides purified from the prototype strains Reynolds and Becker, respectively, are structurally very similar to each other and to the capsule made by strain T, described previously by Wu and Park (Wu and Park. 1971. J. Bacteriol. 108:874-884). Type 5 has the structure (→4)-3-0-Ac-B-D- ManNAcA-(l→4)-«-L-FucNAc-(l→3)-B-D-FucNAc-(l→)„ (Fournier, J. M., et al, 1987. Ann. Inst. Pasteur Microbiol. 138:561-567; Moreau, M., et al, 1990. Carbohydr. Res. 201 :285-297), and type 8 has the structure (-*3)-4-0-Ac-6-D-ManNAcA-(l-}3)-af-L- FucNAc-(l→3)-B-D-FucNAc-(l→)„ (Fournier, J. M., et al, 1984. Infect. Immun. 45:87-93). Type 5 and 8 polysaccharides differ only in the linkages between the sugars and in the sites of O-acetylation of the mannosaminuronic acid residues, yet they are serologically distinct.
Type 5 and 8 CP conjugated to a detoxified recombinant Pseudomonas aeruginosa exotoxin A carrier were shown to be highly immunogenic and protective in a mouse model (A Fattom et al, Infect Immun. 1993 March; 61(3): 1023-1032; A Fattom et al, Infect Immun. 1996 May; 64(5): 1659-1665 ) and passive transfer of the CP5-specific antibodies from the immunized animals induced protection against systemic infection in mice (Lee et al, Infect Immun. 1997 October; 65(10): 4146-4151) and against endocarditis in rats challenged with a serotype 5 S. aureus (Shinefield H et al, N Engl J Med. 2002 Feb 14;346(7):491-6). A bivalent CP5 and CP8 conjugate vaccine (StaphVAX®, Nabi Biopharmaceutical) was developed that provided 75% protection in mice against S. aureus challenge. The vaccine has been tested on humans (Fattom Al et al, Vaccine. 2004 Feb 17;22(7):880-7; Maira-Litran T et al, Infect Immun. 2005 Oct;73(10):6752-62). In certain embodiments, the recombinant peptide or multivalent oligopeptide of the disclosure is combined with or conjugated to an immunogenic carbohydrate {e.g., CP5, CP8, a CP fragment or a combination thereof). [0055] Immunization with poly-N-acetylglucosamine (PNAG) (McKenney D. et al, Science.
1999 May 28;284(5419):1523-7) or poly-N-succinyl glucosamine (PNSG) (Tuchscherr LP. et al, Infect Immun. 2008 Dec;76(12):5738-44. Epub 2008 Sep 22), both S. aureus surface carbohydrates, has been shown to generate at least partial protection against S. aureus challenge in experimental animal models. PNSG was identified as the chemical form of the S. epidermidis capsular polysaccharide/adhesin (PS/A) which mediates adherence of coagulase-negative staphylococci (CoNS) to biomaterials, serves as the capsule for strains of CoNS that express PS/ A, and is a target for protective antibodies. PNSG is also made by S. aureus, where it is an environmentally regulated, in v vo-expressed surface polysaccharide and similarly serves as a target for protective immunity (McKenney D. et al. , J. Biotechnol.
2000 Sept 29;83(l-2): 37-44). In certain embodiments of the disclosure, the immunogenic carbohydrate is a surface polysaccharide, e.g., poly-N-acetylglucosamine (PNAG), poly-N- succinyl glucosamine (PNSG), a surface polysaccharide fragment or a combination thereof.
[0056] Wall Teichoic Acid (WTA) is a prominent polysaccharide widely expressed on S. aureus strains (Neuhaus, F.C. and J. Baddiley, Microbiol Mol Biol Rev, 2003. 67(4):686- 723) and antisera to WTA have been shown to induce opsonophagocytic killing alone and in presence of complement ((Thakker, M., et al., Infect Immun, 1998. 66(11):5183-9), and Fattom et al, US Patent 7, 754,225). WTA is linked to peptidoglycans and protrudes through the cell wall becoming prominently exposed on non-encapsulated strains such as US A300 responsible for most cases of community acquired MRSA (CA MRSA) in the US (Hidron, A.I., et al, Lancet Infect Dis, 2009. 9(6):384-92).
[0057] Lipoteichoic acid (LTA) is a constituent of the cell wall of Gram-positive bacteria, e.g., Staphylococcus aureus. LTA can bind to target cells non-specifically through membrane phospholipids, or specifically to CD14 and to Toll-like receptors. Target-bound LTA can interact with circulating antibodies and activate the complement cascade to induce a passive immune kill phenomenon. It also triggers the release from neutrophils and macrophages of reactive oxygen and nitrogen species, acid hydrolases, highly cationic proteinases, bactericidal cationic peptides, growth factors, and cytotoxic cytokines, which can act in synergy to amplify cell damage.
[0058] In certain embodiments, a surface polysaccharide is combined with or conjugated to a polypeptide of the disclosure. In certain embodiments the surface polysaccharide is, e.g., poly-N-acetylglucosamine (PNAG), poly-N-succinyl glucosamine (PNSG), Wall Teichoic Acid (WTA), Lipoteichoic acid (LP A), a fragment of any of said surface polysaccharides, or a combination of two or more of said surface polysaccharides.
The term "sequence identity" as used herein refers to a relationship between two or more polynucleotide sequences or between two or more polypeptide sequences. When a position in one sequence is occupied by the same nucleic acid base or amino acid in the corresponding position of the comparator sequence, the sequences are said to be "identical" at that position. The percentage "sequence identity" is calculated by determining the number of positions at which the identical nucleic acid base or amino acid occurs in both sequences to yield the number of "identical" positions. The number of "identical" positions is then divided by the total number of positions in the comparison window and multiplied by 100 to yield the percentage of "sequence identity." Percentage of "sequence identity" is determined by comparing two optimally aligned sequences over a comparison window and a homologous polypeptide from another isolate. In order to optimally align sequences for comparison, the portion of a polynucleotide or polypeptide sequence in the comparison window can comprise additions or deletions termed gaps while the reference sequence is kept constant. An optimal alignment is that alignment which, even with gaps, produces the greatest possible number of "identical" positions between the reference and comparator sequences. Percentage "sequence identity" between two sequences can be determined using the version of the program "BLAST 2 Sequences" which is available from the National Center for Biotechnology Information as of September 1, 2004, which program incorporates the programs BLASTN (for nucleotide sequence comparison) and BLASTP (for polypeptide sequence comparison), which programs are based on the algorithm of Karlin and Altschul (Proc. Natl. Acad. Sci. USA 90(12):5873-5877, 1993). When utilizing "BLAST 2 Sequences," parameters that were default parameters as of September 1, 2004, can be used for word size (3), open gap penalty (11), extension gap penalty (1), gap drop-off (50), expect value (10) and any other required parameter including but not limited to matrix option.
The term "epitope," as used herein, refers to portions of a polypeptide having antigenic or immunogenic activity in an animal, for example a mammal, for example, a human. An "immunogenic epitope," as used herein, is defined as a portion of a protein that elicits an immune response in an animal, as determined by any method known in the art. The term "antigenic epitope," as used herein, is defined as a portion of a protein to which an antibody or T-cell receptor can immunospecifically bind its antigen as determined by any method well known in the art. Immunospecific binding excludes non-specific binding but does not necessarily exclude cross-reactivity with other antigens. Whereas all immunogenic epitopes are antigenic, antigenic epitopes need not be immunogenic.
[0061] As used herein, a "coding region" is a portion of nucleic acid which consists of codons translated into amino acids. Although a "stop codon" (TAG, TGA, or TAA) is not translated into an amino acid, it can be considered to be part of a coding region, but any flanking sequences, for example promoters, ribosome binding sites, transcriptional terminators, and the like, are outside the coding region.
[0062] The term "codon optimization" is defined herein as modifying a nucleic acid sequence for enhanced expression in the cells of the host of interest by replacing at least one, more than one, or a significant number, of codons of the native sequence with codons that are more frequently or most frequently used in the genes of that host. Various species exhibit particular bias for certain codons of a particular amino acid.
[0063] The terms "composition" or "pharmaceutical composition" can include compositions containing immunogenic polypeptides of the disclosure along with e.g., adjuvants or pharmaceutically acceptable carriers, excipients, or diluents, which are administered to an individual already suffering from S. aureus infection or an individual in need of immunization against S. aureus infection.
[0064] The term "pharmaceutically acceptable" refers to compositions that are, within the scope of sound medical judgment, suitable for contact with the tissues of human beings and animals without excessive toxicity or other complications commensurate with a reasonable benefit/risk ratio. In some embodiments, the polypeptides, polynucleotides, compositions, and vaccines described herein are pharmaceutically acceptable.
[0065] An "effective amount" is that amount the administration of which to an individual, either in a single dose or as part of a series, is effective for treatment or prevention. An amount is effective, for example, when its administration results in a reduced incidence of S. aureus infection relative to an untreated individual, as determined, e.g., after infection or challenge with infectious 5. aureus, including, but is not limited to reduced bacteremia, reduced toxemia, reduced sepsis, reduced symptoms, increased immune response, modulated immune response, or reduced time required for recovery. This amount varies depending upon the health and physical condition of the individual to be treated, the taxonomic group of individual to be treated (e.g., human, nonhuman primate, primate, etc.), the responsive capacity of the individual's immune system, the extent of treatment or protection desired, the formulation of the vaccine, a professional assessment of the medical situation, and other relevant factors. It is expected that the effective amount will fall in a relatively broad range that can be determined through routine trials. Typically a single dose is from about 10 μg to 10 mg/kg body weight of purified polypeptide or an amount of a modified carrier organism or virus, or a fragment or remnant thereof, sufficient to provide a comparable quantity of recombinantly expressed multivalent oligopeptide, DT, and/or PSM as described herein. The term "peptide vaccine" or "subunit vaccine" refers to a composition comprising one or more polypeptides described herein, which when administered to an animal are useful in stimulating an immune response against staphylococcal (e.g., S. aureus) infection.
[0066] The term "subject" is meant any subject, particularly a mammalian subject, for whom diagnosis, prognosis, immunization, or therapy is desired. Mammalian subjects include, but are not limited to, humans, domestic animals, farm animals, zoo animals such as bears, sport animals, pet animals such as dogs, cats, guinea pigs, rabbits, rats, mice, horses, cattle, bears, cows; primates such as apes, monkeys, orangutans, and chimpanzees; canids such as dogs and wolves; felids such as cats, lions, and tigers; equids such as horses, donkeys, and zebras; food animals such as cows, pigs, and sheep; ungulates such as deer and giraffes; rodents such as mice, rats, hamsters and guinea pigs; and so on. In one embodiment, the subject is a human subject.
[0067] As used herein, a "subject in need thereof refers to an individual for whom it is desirable to treat, i.e., to prevent, cure, retard, or reduce the severity of staphylococcal (e.g., S. aureus) disease symptoms, or result in no worsening of disease cause by S. aureus over a specified period of time, or both.
[0068] The terms "priming" or "primary" and "boost" or "boosting" as used herein to refer to the initial and subsequent immunizations, respectively, i.e., in accordance with the definitions these terms normally have in immunology. However, in certain embodiments, e.g., where the priming component and boosting component are in a single formulation, initial and subsequent immunizations are not be necessary as both the "prime" and the "boost" compositions are administered simultaneously.
II. Delta Toxin and Phenol-soluble Modulin Peptides and Multivalent Oligopeptides
[0069] This disclosure provides recombinant oligopeptide fusion proteins comprised of peptide subunits derived from staphylococcal toxins and superantigens. In certain embodiments an oligopeptide as provided herein comprises a mutant or wild-type delta toxin peptide (DT) or a mutant or wild-type phenol-soluble modulin peptide (PSM). Wild-type DT and the six forms of PSM are presented in Table 1.
TABLE 1 : WILD-TYPE DT AND PSMS
Figure imgf000023_0001
0] In one aspect, the disclosure provides a recombinant peptide comprising a
Staphylococcus delta toxin peptide or a mutant, fragment, variant or derivative thereof (DT); a Staphylococcus phenol soluble modulin peptide or a mutant, fragment, variant or derivative thereof (PSM); or a fusion of a DT and a PSM. A DT or PSM as provided herein can be mutated to reduce toxicity, e.g., surfactant properties, while retaining antigenicity. Accordingly, a recombinant DT, PSM, or both as provided by this disclosure can be attenuated relative to wild-type DT, PSM, or both, and yet the peptide can elicit an anti- Staphylococcus aureus immune response when administered to a subject. The antigenicity of DT and PSM can rely on maintenance of the peptide's alpha-helical structure, where the surfactant properties can rely on the toxin having a hydrophobic face. Thus in certain aspects, the disclosure provides a DT, a PSM or both, where hydrophobicity of the peptide is reduced relative to the wild-type peptide. For example, hydrophobicity can be reduced by replacing at least one, e.g., one, two, three, four, five or more hydrophobic amino acids which make up the hydrophobic face of the toxin with less hydrophobic amino acids. Hydrophobic amino acids include, but are not limited to valine (V), leucine (L), isoleucine (I), phenylalanine (F), and methionine (M). In certain aspects, a hydrophobic amino acid is replaced with a small amino acid that would not be expected to alter the alpha helical structure of the peptide. For example, the hydrophobic amino acid can be replaced with alanine (A) or glycine (G).
[0071] In one aspect, the disclosure provides a recombinant peptide comprising a mutated
DT , where the DT comprises the amino acid sequence:
MAQDX5X6STX9GDX12Xi3KWX16Xi7DTX2oNKFTKK (SEQ ID NO: 39) According to this aspect, at least one of X5, X6, X9, X12, X13, X16, X17, or X20 comprises an amino acid substitution relative to SEQ ID NO: 1. Thus, according to this aspect the DT is not wild-type DT. According to this aspect, X5 can be isoleucine (I), glycine (G) or alanine (A), X6 can be I, G, or A, X9 can be I, G, or A, X12 can be leucine (L), G, or V, X13 can be valine (V), G, or A, X16 can be I, G, or A, X17 can be I, G, or A, and X20 can be V, G, or A. In certain aspects, only a single amino acid from among X5, X6, X9, Xi2, Xi3, Xi6, Xn, or X20 is substituted relative to SEQ ID NO: 1. Thus only one of X5, X6, X9, X12, X13, Xi6, X17, or X20 is G or A. In certain aspects X12 is the single substituted amino acid. According to this aspect, X12 can be G, and the peptide comprises the amino acid sequence SEQ ID NO: 2, or X12 can be A and the peptide comprises the amino acid sequence SEQ ID NO: 4. In another aspect, two amino acids from among X5, X6, X9, X12, X13, Xi6, ¾?, or X20 are substituted relative to SEQ ID NO: 2. For example, X12 and X20 can be substituted, and can be G or A. Thus in certain aspects X12 can independently be G or A, and X20 can independently be G or A. For example, the DT can comprise the amino acid sequence SEQ ID NO: 3, or the amino acid sequence SEQ ID NO: 5. Other amino acid substitutions, either single, or multiple substitutions, can easily be visualized and constructed by a person of ordinary skill in the art according to this disclosure.
[0072] In another aspect, the disclosure provides a recombinant peptide comprising a mutated
PSM, e.g., a mutant PSMal, PSMa2, PSMa3, PSMa4, PSMpi, Ρ8Μβ2, PSM-mec, or any combination of two or more PSMs.
[0073] In one aspect, the peptide comprises a mutant PSMal comprising the amino acid sequence:
X1GX3X4AGX7X8KX1oX11KSX14X15EQX18TGK (SEQ ID NO: 40) According to this aspect, at least one of Xls X3, X4, X7, X8, X10, Xn, X14 ,Xis, or Xj8 comprises an amino acid substitution relative to SEQ ID NO: 38. Thus, according to this aspect the PSMal is not wild-type PSMal According to this aspect, X! can be methionine (M), G, or A, X3 can be I, G, or A, X4 can be I, G, or A, X7 can be I, G, or A, X8 can be I, G, or A, X10 can be V, G, or A, Xn can be I, G, or A, X14 can be L, G, or A, X15 can be I, G, or A, and X18 can be F, G, or A. In certain aspects, only a single amino acid from among X1; X3, X4, X7, X8, X10, Xn, X14 ,X15, and X18 is substituted relative to SEQ ID NO: 38. Thus only one of Xi, X3, X4, X7, X8, X10, X , X14 ,Χι5, and X18 is G or A. In another aspect, two amino acids from among Xl5 X3, X4, X7, X8, X10, Xn, X14 ,X15, and Xi are substituted relative to SEQ ID NO: 38. Various amino acid substitutions in PSMal, either single, or multiple substitutions, can easily be visualized and constructed by a person of ordinary skill in the art according to this disclosure.
[0074] In one aspect, the peptide comprises a mutant PSMa2 comprising the amino acid sequence:
XiGXa tAGX^sKXioXnKGXnXjsEKXisTGK (SEQ ID NO: 41)
According to this aspect, at least one of Xls X3, X4, X7, X8, X10, Xn, X14 ,X15, or X18 comprises an amino acid substitution relative to SEQ ID NO: 12. Thus, according to this aspect the PSMa2 is not wild-type PSMa2. According to this aspect, Xi can be M, G, or A, X3 can be I, G, or A, X can be I, G, or A, X7 can be I, G, or A, X8 can be I, G, or A, X10 can be F, G, or A, Xn can be I, G, or A, X14 can be L, G, or A, X15 can be I, G, or A, and X18 can be F, G, or A. In certain aspects, only a single amino acid from among Xl5 X3, X4, X7, X8, X10, Xn, Xi4 ,X15, and X18 is substituted relative to SEQ ID NO: 12. Thus only one of Xi, X3, X , X7, X8, X10, Xn, X14 ,X15, and X18 is G or A. In another aspect, two amino acids from among Xls X3, X4, X7, X8, X10, Xn, X14 ,X15, and X18 are substituted relative to SEQ ID NO: 12. Various amino acid substitutions, either single, or multiple substitutions, can easily be visualized and constructed by a person of ordinary skill in the art according to this disclosure.
[0075] In one aspect, the peptide comprises a mutant PSMa3 comprising the amino acid sequence:
X1EX3X4AKX7X8KXioX1i DX14X15GKX18X19GNN (SEQ ID NO: 42)
According to this aspect, at least one of Xl9 X3, X4, X7, Xs, X10, Xn, X14 ,Xis, Xi8, or X19 comprises an amino acid substitution relative to SEQ ID NO: 6. Thus, according to this aspect the PSMa3 is not wild-type PSMa3. According to this aspect, Xi can be M, G, or A, X3 can be F, G, or A, X4 can be V, G, or A, X7 can be L, G, or A, X8 can be F, G, or A, X10 can be F, G, or A, Xn can be F, G, or A, X14 can be L, G, or A, X15 can be L, G, or A, X[8 can be F, G, or A, and X19 can be L, G, or A. In certain aspects, only a single amino acid from among Xls X3, X4, X7, X8, Xi0, Xn, X14 ,X15, X18, and X19 is substituted relative to SEQ ID NO: 6. Thus only one of Xh X3, X4, X7s X8, X10, Xn, Xi4 ,Xis, Xis, and X19 is G or A. In certain aspects X14 is the single substituted amino acid. According to this aspect, X14 can be G, and the peptide comprises the amino acid sequence SEQ ID NO: 9, or Xj4 can be A and the peptide comprises the amino acid sequence SEQ ID NO: 7. In another aspect, two amino acids from among Xl5 X3, X4, X7, X8, X10, n, X14 ,X15, X18, and X19 are substituted relative to SEQ ID NO: 6. For example, 4 and X14 can be substituted, and can be G or A. Thus in certain aspects X4 can independently be G or A, and XH can independently be G or A. For example, the PSMa3 can comprise the amino acid sequence SEQ ID NO: 8, the amino acid sequence SEQ ID NO: 10, or the amino acid sequence SEQ ID NO: 11.. Other amino acid substitutions, either single, or multiple substitutions, can easily be visualized and constructed by a person of ordinary skill in the art according to this disclosure.
[0076] In one aspect, the peptide comprises a mutant PSMa4 comprising the amino acid sequence:
XiAX^GTXyXsKXioXnKAXHX^DXnXisAK (SEQ ID NO: 43)
According to this aspect, at least one of Xls X3, X4, X7, X8, X10, Xn, X14 ,Xi5, Xn, or X18 comprises an amino acid substitution relative to SEQ ID NO: 14. Thus, according to this aspect the PSMa4 is not wild-type PSMa4. According to this aspect,
Figure imgf000026_0001
can be M, G, or A, X3 can be I, G, or A, 4 can be V, G, or A, X7 can be I, G, or A, X8 can be I, G, or A, X10 can be I, G, or A, X can be I, G, or A, X1 can be I, G, or A, X15 can be I, G, or A, X17 can be I, G, or A, and X18 can be F, G, or A. In certain aspects, only a single amino acid from among Xi, X3, X4, X7, Xs, X10, X11, Xi4 ,Xi5, Xn, and X18 is substituted relative to SEQ ID NO: 14. Thus only one of Xi, X3, X4, X7, Xs, X10, X11, X14 ,Xi5, X17, and X18 is G or A. In another aspect, two amino acids from among Xl5 X3, X4, X7, X8, X10, Xn, X14 ,X15, Xn, and X18 are substituted relative to SEQ ID NO: 14. Other amino acid substitutions, either single, or multiple substitutions, can easily be visualized and constructed by a person of ordinary skill in the art according to this disclosure.
[0077] In one aspect, the peptide comprises a mutant PSM i comprising the amino acid sequence: MEGX4X5NAX8KDTX12TAAX16NNDGAKLGTSIVNIVENGVGLLSKLFGF
(SEQ ID NO: 44)
According to this aspect, at least one of ¾, X5, X8, X12, or X16 comprises an amino acid substitution relative to SEQ ID NO: 15. Thus, according to this aspect the PSMpi is not wild- type PSMpi. According to this aspect, X4 can be L, G, or A, X5 can be F, G, or A, X8 can be I, G, or A, X12 can be V, G, or A, and X16 can be I, G, or A. In certain aspects, only a single amino acid from among X4, X5, Xg, X12, and Xi6 is substituted relative to SEQ ID NO: 15. Thus only one of X , X5, X8, X12, and X16 is G or A. In another aspect, two amino acids from among X4, X5, Xg, Xi2, and Xj6 are substituted relative to SEQ ID NO: 15. Other amino acid substitutions, either single, or multiple substitutions, can easily be visualized and constructed by a person of ordinary skill in the art according to this disclosure.
In one aspect, the peptide comprises a mutant PSMP2 comprising the amino acid sequence:
MTGX4AEAX8ANTX12QAAQQHDSVKX23GTSIVDIVANGVGLLGKLFGF
(SEQ ID NO: 45)
According to this aspect, at least one of X4, Xs, X12, or X23 comprises an amino acid substitution relative to SEQ ID NO: 16. Thus, according to this aspect the PSMP2 is not wild- type PSMp2. According to this aspect, X4 can be L, G, or A, Xg can be I, G, or A, Xj2 can be V, G, or A, and X23 can be L, G, or A. In certain aspects, only a single amino acid from among t, X8, X12, and X23 is substituted relative to SEQ ID NO: 16. Thus only one of X4, Xg, X12, and X23 is G or A. In another aspect, two amino acids from among X4, Xg, X12, and X23 are substituted relative to SEQ ID NO: 16. Other amino acid substitutions, either single, or multiple substitutions, can easily be visualized and constructed by a person of ordinary skill in the art according to this disclosure.
In one aspect, the peptide comprises a mutant PSM-mec comprising the amino acid sequence:
MDX3TGX6X7TSX10X11DX13X14KTX17X18QAFG (SEQ ID NO: 53)
According to this aspect, at least one of X3, X6, X7, X10, n, Xi3, Xi4, Xn, or Xj comprises an amino acid substitution relative to SEQ ID NO: 52. Thus, according to this aspect the PSM-mec is not wild-type PSM-mec. According to this aspect, X3 can be F, G, or A, X6 can be V, G, or A, X7 can be I, G, or A, X10 can be I, G, or A, Xn can be I, G, or A, X13 can be L, G, or A, X14 can be I, G, or A, Xn can be C, G, or A, , and Xig can be I, G, or A. In certain aspects, only a single amino acid from among X3, X6, X7, X10, Xu, Xi3, X14, Xi , or X18 is substituted relative to SEQ ID NO: 52. Thus only one of X3, X6, X?, Xio, Xu, X13, XM, X17, or Xi8 is G or A. In another aspect, two amino acids from among Xls X3, X4, X7, X8, X10, Xn, X14 ,X15, and X18 are substituted relative to SEQ ID NO: 52. Various amino acid substitutions in PSM-mec, either single, or multiple substitutions, can easily be visualized and constructed by a person of ordinary skill in the art according to this disclosure.
The disclosure further provides a multivalent oligopeptide comprising a fusion of two or more, e.g., two, three, four, five, six, seven, eight, nine, ten or more Staphylococcus aureus-derived peptides, or mutants, fragments, variants, or derivatives thereof arranged in any order. The two or more Staphylococcus aureus-denved peptides, or mutants, fragments, variants, or derivatives thereof can be the same or different. A multivalent oligopeptide as provided herein can include, without limitation, two or more of:
a. a wild-type DT, a mutant DT as described above, or any fragment, variant, or derivative thereof;
b. a wild-type PSM, a mutant PSM as described above, or any fragment, variant, or derivative thereof;
c. an alpha hemolysin polypeptide or mutant, fragment, variant, or derivative thereof, including without limitation AT-62 (SEQ ID NO: 46), or other alpha hemolysin peptides as described elsewhere herein and in PCT Publication No. WO 2012/109167A1;
d. a leukocidin polypeptide or mutant, fragment, variant, or derivative thereof, including, without limitation, a Panton- Valentine leukocidin (PVL) LukS-PV subunit comprising an amino acid sequence at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 47, a Panton-Valentine leukocidin (PVL) LukF-PV subunit comprising an amino acid sequence at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 48, or a combination thereof, or other leukocidin peptides as described elsewhere herein and in PCT Publication No. WO 2013/082558, including, without limitation, LukS-Mut9 (SEQ ID NO: 54) and/or LukF-Mut-1 (SEQ ID NO: 55); or
e. a superantigen (SAg) polypeptide, or mutant, fragment, variant, or derivative thereof. [0081] In some embodiments, the peptides comprising the multivalent oligopeptide can be directly fused to each other. In other embodiments, the peptides comprising the multivalent oligopeptide can be associated via a peptide linker. Suitable peptide linkers can be chosen based on their ability to adopt a flexible, extended conformation, or a secondary structure that can interact with joined epitopes, or based on their ability to increase overall solubility of the fusion polypeptide, or based on their lack of electrostatic or water-interaction effects that influence joined peptide regions. In certain aspects, a linker for use in a multivalent oligopeptide as provided herein can include at least one, but no more than 50 amino acids, e.g., small amino acids that provide a flexible chain, e.g., glycine, serine, alanine, or a combination thereof. In certain aspects, a linker for use in a multivalent oligopeptide as provided herein can include (GGGS)n or (GGGGS)n, wherein n is a integer from 1 to 10.
[0082] In certain aspects, the multivalent oligopeptide includes AT-62 and DT, in any order, where AT-62 and DT can be fused together via a linker sequence. In certain aspects, the multivalent oligopeptide comprises, consists of, or consists essentially of AT62 DT (SEQ ID NO: 18), or an oligopeptide comprising, consisting, or consisting essentially of an amino acid sequence at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 18.
[0083] In certain aspects, the multivalent oligopeptide includes AT-62 and a PSM, in any order, where AT-62 and PSM can be fused together via a linker sequence. In certain aspects, the multivalent oligopeptide comprises, consists of, or consists essentially of AT62 PSM (SEQ ID NO: 20), or an oligopeptide comprising, consisting, or consisting essentially of an amino acid sequence at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 20.
[0084] In certain aspects, the multivalent oligopeptide includes AT-62, DT, and a PSM, in any order, where AT-62, DT, and PSM can be fused together via linker sequences. In certain aspects, the multivalent oligopeptide comprises, consists of, or consists essentially of AT62_DT_PSM (SEQ ID NO: 22), or an oligopeptide comprising, consisting, or consisting essentially of an amino acid sequence at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 22.
[0085] In certain aspects, the multivalent oligopeptide includes AT-62 and a recombinant
SEB or mutant, fragment, variant, or derivative thereof, in any order, where AT-62 and SEB can be fused together via a linker sequence. In certain aspects, the multivalent oligopeptide comprises, consists of, pr consists essentially of AT62_rSEB (SEQ ID NO: 23), or an oligopeptide comprising, consisting, or consisting essentially of an amino acid sequence at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 23. In certain aspects, the multivalent oligopeptide comprises, consists of, or consists essentially of rSEB_ AT62 (SEQ ID NO: 26), or an oligopeptide comprising, consisting, or consisting essentially of an amino acid sequence at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 26.
[0086] In certain aspects, the multivalent oligopeptide includes AT-62, a recombinant SEB or mutant, fragment, variant, or derivative thereof, and DT, in any order, where AT-62, SEB, and DT can be fused together via a linker sequence. In certain aspects, the multivalent oligopeptide comprises, consists of, or consists essentially of AT62_rSEB DT (SEQ ID NO: 29), or an oligopeptide comprising, consisting, or consisting essentially of an amino acid sequence at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 29.
[0087] Where the provided oligopeptide includes a staphylococcal SAg or mutant, fragment, variant, or derivative thereof, the SAg, can include, without limitation, SEB, SECl-3, SEE, SEH, SEI, SEK, TSST-1, SpeC, SED, SpeA, or any mutant, fragment, variant, or derivative thereof, or any combination thereof, in any order. In certain aspects, the oligopeptide includes a staphylococcal enterotoxin B (SEB) or mutant, fragment, variant, or derivative thereof. In certain aspects, the SEB mutant is the attenuated toxoid SEBL45R/Y89A Y94A (SEQ ID NO: 49), or a polypeptide comprising an amino acid sequence at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 49. In certain aspects, the oligopeptide includes a staphylococcal enterotoxin A (SEA) or mutant, fragment, variant, or derivative thereof. In certain aspects, the SEA mutant is the attenuated toxoid SEAL48R/D70R/Y92A (SEQ ID NO: 50), or a polypeptide comprising an amino acid sequence at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 50. In certain aspects, the oligopeptide includes a staphylococcal toxic shock syndrome toxin-1 (TSST-1) or mutant, fragment, variant, or derivative thereof. In certain aspects, the TSST-1 mutant is the attenuated toxoid TSST-1 L3OR/D27A/I46A (SEQ ID NO: 51), or a polypeptide comprising an amino acid sequence at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 51. [0088] The SAg toxoids can be linked together in any order, either with our without linkers.
In certain aspects, the multivalent oligopeptide includes SEBL45R/Y89A/Y94A ("B"), SEAL^R/DTORA^A ("A"), and TSST-1L30R/D27A/I46A ("T"), in any order, where the toxoids can be fused together via linker sequences. In certain aspects, the multivalent oligopeptide comprises, consists of, or consists essentially of a "BAT" fusion (SEQ ID NO: 32), or an oligopeptide comprising, consisting, or consisting essentially of an amino acid sequence at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 32. In certain aspects, the multivalent oligopeptide comprises, consists of, or consists essentially of a "BTA" fusion (SEQ ID NO: 33), or an oligopeptide comprising, consisting, or consisting essentially of an amino acid sequence at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 33. In certain aspects, the multivalent oligopeptide comprises, consists of, or consists essentially of a "ABT" fusion (SEQ ID NO: 34), or an oligopeptide comprising, consisting, or consisting essentially of an amino acid sequence at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 34. In certain aspects, the multivalent oligopeptide comprises, consists of, or consists essentially of a "ATB" fusion (SEQ ID NO: 35), or an oligopeptide comprising, consisting, or consisting essentially of an amino acid sequence at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 35. In certain aspects, the multivalent oligopeptide comprises, consists of, or consists essentially of a "TAB" fusion (SEQ ID NO: 36), or an oligopeptide comprising, consisting, or consisting essentially of an amino acid sequence at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 36. In certain aspects, the multivalent oligopeptide comprises, consists of, or consists essentially of a "TBA" fusion (SEQ ID NO: 37), or an oligopeptide comprising, consisting, or consisting essentially of an amino acid sequence at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 37.
[0089] In certain aspects the multivalent oligopeptide comprises, consists of, or consists essentially of the amino acid sequence SEQ ID NO: 18, SEQ ID NO: 20, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 26, SEQ ID NO: 29, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO. 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, or any combination thereof.
[0090] In another embodiment, the multivalent oligopeptide, DT, and/or PSM as described herein, can be attached to a heterologous polypeptide. Various heterologous polypeptides can be used, including, but not limited to an N- or C-terminal peptide imparting stabilization, secretion, or simplified purification, such as a hexa-Histidine-tag, a ubiquitin tag, a NusA tag, a chitin binding domain, ompT, ompA, pelB, DsbA, DsbC, c-myc, KSI, polyaspartic acid, (Ala-Trp-Trp-Pro)n, polyphenyalanine, polycysteine, polyarginine, a B-tag, a HSB-tag, green fluorescent protein (GFP), influenza virus hemagglutinin (HAI), a calmodulin binding protein (CBP), a galactose-binding protein, a maltose binding protein (MBP), a cellulose binding domains (CBD's), dihydrofolate reductase (DHFR), glutathione-S-transferase (GST), streptococcal protein G, staphylococcal protein A, T7genel0, an avidin/streptavidin/Strep-tag complex, trpE, chloramphenicol acetyltransferase, lacZ (β-Galactosidase), His-patch thioredoxin, thioredoxin, a FLAG™ peptide (Sigma-Aldrich), an S-tag, or a T7-tag. See, e.g., Stevens, R.C., Structure, 8:R177-R185 (2000). Heterologous polypeptides can also include any pre- and/or pro- sequences that facilitate the transport, translocations, processing and/or purification of a multivalent oligopeptide, DT, and/or PSM as described herein from a host cell or any useful immunogenic sequence, including but not limited to sequences that encode a T-cell epitope of a microbial pathogen, or other immunogenic proteins and/or epitopes.
[0091] In some embodiments, the multivalent oligopeptide, DT, and/or PSM attached to a heterologous polypeptide, as described herein, can include a peptide linker sequence joining sequences that comprise two or more peptide regions. Suitable peptide linker sequences can be chosen based on their ability to adopt a flexible, extended conformation, or a secondary structure that could interact with joined epitopes, or based on their ability to increase overall solubility of the fusion polypeptide, or based on their lack of electrostatic or water-interaction effects that influence joined peptide regions.
[0092] In some embodiments, the multivalent oligopeptide, DT, and/or PSM as described herein, is isolated. An "isolated" polypeptide is one that has been removed from its natural milieu. The term "isolated" does not connote any particular level of purification. Recombinantly produced multivalent oligopeptides, DTs, and/or PSMs as described herein, expressed in non-native host cells is considered isolated for purposes of the disclosure, as is the polypeptide which have been separated, fractionated, or partially or substantially purified by any suitable technique, including by filtration, chromatography, centrifugation, and the like.
[0093] Production of multivalent oligopeptides, DTs, and/or PSMs as described herein, can be achieved by culturing a host cell comprising a polynucleotide which operably encodes the polypeptide of the disclosure, and recovering the polypeptide. Determining conditions for culturing such a host cell and expressing the polynucleotide are generally specific to the host cell and the expression system and are within the knowledge of one of skill in the art. Likewise, appropriate methods for recovering the polypeptide of the disclosure are known to those in the art, and include, but are not limited to, chromatography, filtration, precipitation, or centrifugation.
III. Polynucleotides
[0094] Also disclosed is an isolated polynucleotide comprising a nucleic acid encoding a multivalent oligopeptide, DT, and/or PSM as described elsewhere herein.
[0095] In certain embodiments, the isolated polynucleotide as described herein further comprises non-coding regions such as promoters, operators, or transcription terminators as described elsewhere herein. In some embodiments, the disclosure is directed to the polynucleotide as described herein, and further comprising a heterologous nucleic acid. The heterologous nucleic acid can, in some embodiments, encode a heterologous polypeptide fused to the polypeptide as described herein. For example, the isolated polynucleotide as described herein can comprise additional coding regions encoding, e.g., a heterologous polypeptide fused to the polypeptide as described herein, or coding regions encoding heterologous polypeptides separate from the polypeptide as described herein such as, but not limited to, selectable markers, additional immunogens, immune enhancers, and the like.
[0096] Also provided are expression constructs, vectors, and/or host cells comprising the polynucleotides described herein. An example of an isolated polynucleotide is a recombinant polynucleotide contained in a vector. Further examples of an isolated polynucleotide include recombinant polynucleotides maintained in heterologous host cells or purified (partially or substantially) polynucleotides in solution. In certain embodiments of the disclosure a polynucleotide is "recombinant." Isolated polynucleotides or nucleic acids according to the disclosure further include such molecules produced synthetically. The relative degree of purity of a polynucleotide or polypeptide described herein is easily determined by well- known methods.
[0097] Also included within the scope of the disclosure are genetically engineered polynucleotides encoding the multivalent oligopeptides, DTs, and/or PSMs as described herein. Modifications of nucleic acids encoding the multivalent oligopeptides, DTs, and/or PSMs as described herein, can readily be accomplished by those skilled in the art, for example, by oligonucleotide-directed site-specific mutagenesis or de novo nucleic acid synthesis.
Some embodiments disclose an isolated polynucleotide comprising a nucleic acid that encodes a multivalent oligopeptide, DT, and/or PSM as described herein, where the coding region encoding the polypeptide has been codon-optimized. As appreciated by one of ordinary skill in the art, various nucleic acid coding regions will encode the same polypeptide due to the redundancy of the genetic code. Deviations in the nucleotide sequence that comprise the codons encoding the amino acids of any polypeptide chain allow for variations in the sequence of the coding region. Since each codon consists of three nucleotides, and the nucleotides comprising DNA are restricted to four specific bases, there are 64 possible combinations of nucleotides, 61 of which encode amino acids (the remaining three codons encode signals ending translation). The "genetic code" which shows which codons encode which amino acids is reproduced herein as Table 2. As a result, many amino acids are designated by more than one codon. For example, the amino acids alanine and proline are coded for by four triplets, serine and arginine by six, whereas tryptophan and methionine are coded by just one triplet. This degeneracy allows for DNA base composition to vary over a wide range without altering the amino acid sequence of the polypeptides encoded by the DNA.
TABLE 2: The Standard Genetic Code
Figure imgf000035_0001
[0099] It is to be appreciated that any polynucleotide that encodes a polypeptide in accordance with the disclosure falls within the scope of this disclosure, regardless of the codons used.
[0100] Many organisms display a bias for use of particular codons to code for insertion of a particular amino acid in a growing polypeptide chain. Codon preference or codon bias, differences in codon usage between organisms, is afforded by degeneracy of the genetic code, and is well documented among many organisms.
[0101] Different factors have been proposed to contribute to codon usage preference, including translational selection, GC composition, strand-specific mutational bias, amino acid conservation, protein hydropathy, transcriptional selection and even RNA stability. One factor that determines codon usage is mutational bias that shapes genome GC composition. This factor is most significant in genomes with extreme base composition: species with high GC content (e.g., gram positive bacteria). Mutational bias is responsible not only for intergenetic difference in codon usage but also for codon usage bias within the same genome (Ermolaeva M, Curr. Issues Mol. Biol. 3(4):91-97, 2001). [0102] Codon bias often correlates with the efficiency of translation of messenger RNA
(mRNA), which is in turn believed to be dependent on, inter alia, the properties of the codons being translated and the availability of particular transfer RNA (tRNA) molecules. The predominance of selected tRNAs in a cell is generally a reflection of the codons used most frequently in peptide synthesis. Accordingly, genes can be tailored for optimal gene expression in a given organism based on codon optimization.
[0103] The present disclosure provides a polynucleotide comprising a codon-optimized coding region which encodes a multivalent oligopeptide, DT, and/or PSM as described herein. The codon usage is adapted for optimized expression in a given prokaryotic or eukaryotic host cell. In certain aspects the codon usage is adapted for optimized expression in E. coli.
[0104] In certain aspects an isolated polynucleotide is provided comprising the nucleic acid sequence SEQ ID NO: 17, encoding AT62 DT and optimized for expression in E. coli. In certain aspects an isolated polynucleotide is provided comprising the nucleic acid sequence SEQ ID NO: 19, encoding AT62_PSM and optimized for expression in E. coli. In certain aspects an isolated polynucleotide is provided comprising the nucleic acid sequence SEQ ID NO: 21, encoding AT62 DT PSM and optimized for expression in E. coli. In certain aspects an isolated polynucleotide is provided comprising the nucleic acid sequence SEQ ID NO: 25, encoding AT62_rSEB and optimized for expression in E. coli. In certain aspects an isolated polynucleotide is provided comprising the nucleic acid sequence SEQ ID NO: 28, encoding rSEB_ AT62 and optimized for expression in E. coli. In certain aspects an isolated polynucleotide is provided comprising the nucleic acid sequence SEQ ID NO: 31, encoding AT62_rSEB DT and optimized for expression in E. coli.
[0105] Codon-optimized polynucleotides are prepared by incorporating codons preferred for use in the genes of a given species into the DNA sequence. Also provided are polynucleotide expression constructs, vectors, host cells comprising polynucleotides comprising codon- optimized coding regions which encode a multivalent oligopeptide, DT, and/or PSM as described herein.
[0106] Given the large number of gene sequences available for a wide variety of animal, plant and microbial species, it is possible to calculate the relative frequencies of codon usage. Codon usage tables are readily available, for example, at the "Codon Usage Database" available at http://www.kazusa.or.jp/codon/ (visited October 12, 2011), and these tables can be adapted in a number of ways. (Nakamura, Y., et ah, "Codon usage tabulated from the international DNA sequence databases: status for the year 2000" Nucl. Acids Res. 28:292, 2000).
[0107] By utilizing available tables, one of ordinary skill in the art can apply the frequencies to any given polypeptide sequence, and produce a nucleic acid fragment of a codon- optimized coding region which encodes a desired polypeptide, but which uses codons optimal for a given species. For example, in some embodiments of the disclosure, the coding region is codon-optimized for expression in E. coli.
[0108] A number of options are available for synthesizing codon optimized coding regions designed by any of the methods described above, using standard and routine molecular biological manipulations well known to those of ordinary skill in the art. In addition, gene synthesis is readily available commercially.
IV. Vectors and Expression Systems
[0109] Further disclosed is a vector comprising the polynucleotide as described herein. The term "vector," as used herein, refers to e.g., any of a number of nucleic acids into which a desired sequence can be inserted, e.g., by restriction and ligation, for transport between different genetic environments or for expression in a host cell. Nucleic acid vectors can be DNA or RNA. Vectors include, but are not limited to, plasmids, phage, phagemids, bacterial genomes, and virus genomes. A cloning vector is one which is able to replicate in a host cell, and which is further characterized by one or more endonuclease restriction sites at which the vector can be cut in a determinable fashion and into which a desired DNA sequence can be ligated such that the new recombinant vector retains its ability to replicate in the host cell. In the case of plasmids, replication of the desired sequence can occur many times as the plasmid increases in copy number within the host bacterium or just a single time per host before the host reproduces by mitosis. In the case of phage, replication can occur actively during a lytic phase or passively during a lysogenic phase. Certain vectors are capable of autonomous replication in a host cell into which they are introduced. Other vectors are integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome.
[0110] Any of a wide variety of suitable cloning vectors are known in the art and commercially available which can be used with appropriate hosts. As used herein, the term "plasmid" refers to a circular, double-stranded construct made up of genetic material (i.e., nucleic acids), in which the genetic material is extrachromosomal and in some instances, replicates autonomously. A polynucleotide described herein can be in a circular or linearized plasmid or in any other sort of vector. Procedures for inserting a nucleotide sequence into a vector, e.g., an expression vector, and transforming or transfecting into an appropriate host cell and cultivating under conditions suitable for expression are generally known in the art.
[0111] The disclosure further provides a vector comprising a nucleic acid sequence encoding a multivalent oligopeptide, DT, and/or PSM as described herein. In certain embodiments the vector is an expression vector capable of expressing the multivalent oligopeptide, DT, and/or PSM as described herein in a suitable host cell. The term "expression vector" refers to a vector that is capable of expressing the polypeptide described herein, i.e., the vector sequence contains the regulatory sequences required for transcription and translation of a polypeptide, including, but not limited to promoters, operators, transcription termination sites, ribosome binding sites, and the like. The term "expression" refers to the biological production of a product encoded by a coding sequence. In most cases a DNA sequence, including the coding sequence, is transcribed to form a messenger-RNA (mRNA). The messenger-RNA is then translated to form a polypeptide product which has a relevant biological activity. Also, the process of expression can involve further processing steps to the RNA product of transcription, such as splicing to remove introns, and/or post-translational processing of a polypeptide product.
[0112] Vector-host systems include, but are not limited to, systems such as bacterial, mammalian, yeast, insect or plant cell systems, either in vivo, e.g., in an animal or in vitro, e.g., in bacteria or in cell cultures. The selection of an appropriate host is deemed to be within the scope of those skilled in the art from the teachings herein. In certain embodiments, the host cell is a bacterium, e.g., E. coli.
[0113] Host cells are genetically engineered (infected, transduced, transformed, or transfected) with vectors of the disclosure. Thus, one aspect of the disclosure is directed to a host cell comprising a vector which contains the polynucleotide as describe herein. The engineered host cell can be cultured in conventional nutrient media modified as appropriate for activating promoters, selecting transformants or amplifying the polynucleotides. The culture conditions, such as temperature, pH and the like, are those previously used with the host cell selected for expression, and will be apparent to the ordinarily skilled artisan. The term "transfect," as used herein, refers to any procedure whereby eukaryotic cells are induced to accept and incorporate into their genome isolated DNA, including but not limited to DNA in the form of a plasmid. The term "transform," as used herein, refers to any procedure whereby bacterial cells are induced to accept and incorporate into their genome isolated DNA, including but not limited to DNA in the form of a plasmid.
[0114] Bacterial host-expression vector systems include, but are not limited to, a prokaryote
(e.g., E. coli), transformed with recombinant bacteriophage DNA, plasmid DNA or cosmid DNA. In some embodiments, the plasmids used with E. coli use the T7 promoter-driven system regulated by the Lacl protein via IPTG induction. A large number of suitable vectors are known to those of skill in the art, and are commercially available. The following bacterial vectors are provided by way of example: pET (Novagen), pET28, pBAD, pTrcHIS, pBR322, pQE70, pQE60, pQE-9 (Qiagen), phagescript, psiX174, pBluescript SK, pbsks, pNH8A, pNH16a, pNH18A, pNH46A (Stratagene), ptrc99a, pKK223-3, pKK243-3, pDR540, pBR322, pPSlO, RSFIOIO, pRIT5 (Pharmacia); pCR (Invitrogen); pLex (Invitrogen), and pUC plasmid derivatives.
[0115] A suitable expression vector contains regulatory sequences that can be operably joined to an inserted nucleotide sequence encoding the multivalent oligopeptide, DT, and/or PSM as described herein. As used herein, the term "regulatory sequences" means nucleotide sequences which are necessary for or conducive to the transcription of an inserted sequence encoding a multivalent oligopeptide, DT, and/or PSM as described herein by a host cell and/or which are necessary for or conducive to the translation by a host cell of the resulting transcript into the desired multivalent oligopeptide, DT, and/or PSM. Regulatory sequences include, but are not limited to, 5* sequences such as operators, promoters and ribosome binding sequences, and 3' sequences such as polyadenylation signals or transcription terminators. Regulatory sequences can also include enhancer sequences or upstream activator sequences.
[0116] Generally, bacterial vectors will include origins of replication and selectable markers, e.g., the ampicillin, tetracycline, kanamycin, resistance genes of E. coli, permitting transformation of the host cell and a promoter derived from a highly-expressed gene to direct transcription of a downstream structural sequence. Suitable promoters include, but are not limited to, the T7 promoter, lambda (λ) promoter, T5 promoter, and lac promoter, or promoters derived from operons encoding glycolytic enzymes such as 3-phosphoglycerate kinase (PG ), acid phosphatase, or heat shock proteins, or inducible promoters like cadmium (pcad), and beta-lactamase (pbla).
[0117] Once an expression vector is selected, the polynucleotide as described herein can be cloned downstream of the promoter, for example, in a polylinker region. The vector is transformed into an appropriate bacterial strain, and DNA is prepared using standard techniques. The orientation and DNA sequence of the polynucleotide as well as all other elements included in the vector, are confirmed using restriction mapping, DNA sequence analysis, and/or PCR analysis. Bacterial cells harboring the correct plasmid can be stored as cell banks.
V. Immunogenic and Pharmaceutical Compositions
[0118] Further disclosed are compositions, e.g., immunogenic or pharmaceutical compositions that contain an effective amount of the multivalent oligopeptide, DT, and/or PSM as described herein, or a polynucleotide encoding the polypeptide of the disclosure. Compositions as described herein can further comprise additional immunogenic components, e.g., as a multivalent vaccine, as well as carriers, excipients or adjuvants.
[0119] Compositions as described herein can be formulated according to known methods.
Suitable preparation methods are described, for example, in Remington 's Pharmaceutical Sciences, 19th Edition, A.R. Gennaro, ed., Mack Publishing Co., Easton, PA (1995), which is incorporated herein by reference in its entirety. Composition can be in a variety of forms, including, but not limited to an aqueous solution, an emulsion, a gel, a suspension, lyophilized form, or any other form known in the art. In addition, the composition can contain pharmaceutically acceptable additives including, for example, diluents, binders, stabilizers, and preservatives. Once formulated, compositions of the disclosure can be administered directly to the subject. The subjects to be treated can be animals; in particular, human subjects can be treated.
[0120] Carriers that can be used with compositions of the disclosure are well known in the art, and include, without limitation, e.g., thyroglobulin, albumins such as human serum albumin, tetanus toxoid, and polyamino acids such as poly L-lysine, poly L-glutamic acid, influenza, hepatitis B virus core protein, and the like. A variety of aqueous carriers can be used, e.g., water, buffered water, 0.8% saline, 0.3% glycine, hyaluronic acid and the like. Compositions can be sterilized by conventional, well known sterilization techniques, or can be sterile filtered. A resulting composition can be packaged for use as is, or lyophilized, the lyophilized preparation being combined with a sterile solution prior to administration. Compositions can contain pharmaceutically acceptable auxiliary substances as required to approximate physiological conditions, such as pH adjusting and buffering agents, tonicity adjusting agents, wetting agents and the like, for example, sodium acetate, sodium lactate, sodium chloride, potassium chloride, calcium chloride, sorbitan monolaurate, triethanolamineoleate, etc.
[0121] Certain compositions as described herein further include one or more adjuvants, a substance added to an immunogenic composition to, for example, enhance, sustain, localize, or modulate an immune response to an immunogen. The term "adjuvant" refers to any material having the ability to (1) alter or increase the immune response to a particular antigen or (2) increase or aid an effect of a pharmacological agent. Any compound which can increase the expression, antigenicity or immunogenicity of the polypeptide is a potential adjuvant. The term "immunogenic carrier" as used herein refers to a first moiety, e.g., a polypeptide or fragment, variant, or derivative thereof which enhances the immunogenicity of a second polypeptide or fragment, variant, or derivative thereof.
[0122] A great variety of materials have been shown to have adjuvant activity through a variety of mechanisms. For example, an increase in humoral immunity is typically manifested by a significant increase in the titer of antibodies raised to the antigen, and an increase in T-cell activity is typically manifested in increased cell proliferation, or cellular cytotoxicity, or cytokine secretion. An adjuvant can also alter or modulate an immune response, for example, by changing a primarily humoral or TI12 response into a primarily cellular, or Th\ response. Immune responses to a given antigen can be tested by various immunoassays well known to those of ordinary skill in the art, and/or described elsewhere herein.
[0123] A wide number of adjuvants are familiar to persons of ordinary skill in the art, and are described in numerous references. Adjuvants which can be used in compositions described herein include, but are not limited to: inert carriers, such as alum, bentonite, latex, and acrylic particles; incomplete Freund's adjuvant, complete Freund's adjuvant; aluminum-based salts such as aluminum hydroxide; Alhydrogel (Al(OH3)); aluminum phosphate (AIPO4); calcium- based salts; silica; any TLR biological ligand(s); IDC- 1001 (also known as GLA-SE; glucopyranosyl lipid adjuvant stable emulsion) (Coler et al., PLoS One, 2010. 5(10): p. el3677; Coler et al, PLoS One, 2011. 6(1): p. el6333); CpG (Mullen et al, PLoS One, 2008. 3(8): p. e2940), or any combination thereof. The amount of adjuvant, how it is formulated, and how it is administered all parameters which are well within the purview of a person of ordinary skill in the art.
[0124] In some embodiments, a composition of the disclosure further comprises a liposome or other particulate carrier, which can serve, e.g., to stabilize a formulation, to target the formulation to a particular tissue, such as lymphoid tissue, or to increase the half-life of the polypeptide composition. Such particulate carriers include emulsions, foams, micelles, insoluble monolayers, liquid crystals, phospholipid dispersions, lamellar layers, iscoms, and the like. In these preparations, the polypeptide described herein can be incorporated as part of a liposome or other particle, or can be delivered in conjunction with a liposome. Liposomes for use in accordance with the disclosure can be formed from standard vesicle- forming lipids, which generally include neutral and negatively charged phospholipids and a sterol, such as cholesterol. A composition comprising a liposome or other particulate suspension as well as the polypeptide as described herein can be administered intravenously, locally, topically, etc. in a dose which varies according to, inter alia, the manner of administration, the polypeptide being delivered, and the stage of the disease being treated.
[0125] For solid compositions, conventional nontoxic solid carriers can be used which include, for example, pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharin, talcum, cellulose, glucose, sucrose, magnesium carbonate, and the like. For oral administration, a pharmaceutically acceptable nontoxic composition is formed by incorporating any of the normally employed excipients, such as those carriers previously listed, and generally 10-95% of active ingredient, that is, the polypeptide as described herein, often at a concentration of 25%-75%.
[0126] For aerosol or mucosal administration, the polypeptide as described herein can be supplied in finely divided form, optionally along with a surfactant and, propellant and/or a mucoadhesive, e.g., chitosan. The surfactant must, of course, be pharmaceutically acceptable, and in some embodiments soluble in the propellant. Representative of such agents are the esters or partial esters of fatty acids containing from 6 to 22 carbon atoms, such as caproic, octanoic, lauric, palmitic, stearic, linoleic, linolenic, olesteric and oleic acids with an aliphatic polyhydric alcohol or its cyclic anhydride. Mixed esters, such as mixed or natural glycerides can be employed. The surfactant can constitute 0.1%-20% by weight of the composition, in some embodiments 0.25-5% by weight. The balance of the composition is ordinarily propellant, although an atomizer can be used in which no propellant is necessary and other percentages are adjusted accordingly. In some embodiments, the immunogenic polypeptides can be incorporated within an aerodynamically light particle, such as those particles described in U.S. Pat. No. 6,942,868 or U.S. Pat. Pub. No. 2005/0008633. A carrier can also be included, e.g., lecithin for intranasal delivery.
[0127] The disclosure is also directed to a method of producing the composition according to the disclosure. In some embodiments, the method of producing the composition comprises (a) isolating a polypeptide according to the disclosure; and (b) adding an adjuvant, carrier and/or excipient to the isolated polypeptide. Some embodiments disclose further combining the polypeptide with other staphylococcal antigens.
[0128] Some embodiments include a multivalent vaccine. A multivalent vaccine of the present disclosure can include a multivalent oligopeptide, DT, and/or PSM as described herein, or a polynucleotide encoding a multivalent oligopeptide, DT, and or PSM, and one or more additional immunogenic components. Such components can be additional immunogens of the same infectious agent, e.g., S. aureus, or from other staphylococci, or can be immunogens derived from other infectious agents which can be effectively, conveniently, or economically administered together. In certain embodiments, the multivalent oligopeptide, DT, and/or PSM as described herein, can be combined with other toxins or other virulent component-based vaccines to make a broad toxin-based multivalent vaccine capable of targeting multiple bacterial virulence determinants. In other embodiments, the multivalent oligopeptide, DT, and/or PSM as described herein can be fused to other immunogenic, biologically significant, or protective epitope containing polypeptides to generate a multivalent vaccine in a single chain and induce an immune response against multiple antigens. In yet another embodiment, the multivalent oligopeptide, DT, and/or PSM as described herein, can be fused to one or more T cell epitopes to induce T cell immunity.
VI. Methods of Treatment/Prevention and Regimens
[0129] Also provided is a method of treating or preventing Staphylococcus infection, e.g., S. aureus infection or treating or preventing a disease caused by Staphylococcus, e.g , S. aureus in a subject, comprising administering to a subject in need thereof a composition as described herein comprising a multivalent oligopeptide, DT, and/or PSM as described herein, or polynucleotides, vectors, or host cells encoding same. In certain embodiments, the subject is an animal, e.g., a vertebrate, e.g., a mammal, e.g., a human. Some embodiments include a method of inducing an immune response against a S. aureus strain, comprising administering to a subject in need of said immune response an effective amount of a composition comprising a multivalent oligopeptide, DT, and/or PSM as described herein, or polynucleotides, vectors, or host cells encoding same.
In some embodiments, a subject is administered a composition comprising a multivalent oligopeptide, DT, and/or PSM as described herein, or polynucleotides, vectors, or host cells encoding same prophylactically, e.g., as a prophylactic vaccine, to establish or enhance immunity to Staphylococcus, e.g., S. aureus, in a healthy animal prior to potential or actual exposure to Staphylococcus, e.g., S. aureus or contraction of a Staphylococcus-velated symptom, thus preventing disease, alleviating symptoms, reducing symptoms, or reducing the severity of disease symptoms. In one embodiment the disease is a respiratory disease, e.g., pneumonia. Other diseases or conditions to be treated or prevented include, but are not limited to, bacteremia, sepsis, skin infections, wound infections, endocarditis, bone and joint infections, osteomyelitis, and/or meningitis. One or more compositions, polypeptides, polynucleotides, vectors, or host cells as described herein can also be used to treat a subject already exposed to Staphylococcus, e.g., S. aureus, or already suffering from a Staphylococcus related symptom to further stimulate the immune system of the animal, thus reducing or eliminating the symptoms associated with that exposure. As defined herein, "treatment of an animal" refers to the use of one or more compositions, polypeptides, polynucleotides, vectors, or host cells of the disclosure to prevent, cure, retard, or reduce the severity of S. aureus symptoms in an animal, and/or result in no worsening of S. aureus symptoms over a specified period of time. It is not required that any composition, polypeptide, polynucleotide, a vector, or a host cell as described herein provides total protection against a staphylococcal infection or totally cure or eliminate all Staphylococcus related symptoms.
As used herein, "a subject in need of therapeutic and/or preventative immunity" refers to a subject in which it is desirable to treat, i.e., to prevent, cure, retard, or reduce the severity of Staphylococcus related symptoms, or result in no worsening of Staphylococcus related symptoms over a specified period of time. As used herein, "a subject in need of the immune response" refers to a subject for which an immune response(s) against a S Staphylococcus related disease is desired. [0132] Treatment with pharmaceutical compositions comprising an immunogenic composition, polypeptide or polynucleotide as described herein can occur separately or in conjunction with other treatments, as appropriate.
[0133] In therapeutic applications, a composition, polypeptide or polynucleotide of the disclosure is administered to a patient in an amount sufficient to elicit an effective innate, humoral and/or cellular response to the multivalent oligopeptide, DT, and/or PSM to cure or at least partially arrest symptoms or complications.
[0134] An amount adequate to accomplish this is defined as "therapeutically effective dose" or "unit dose." Amounts effective for this use will depend on, e.g., the polypeptide or polynucleotide composition, the manner of administration, the stage and severity of the disease being treated, the weight and general state of health of the patient, and the judgment of the prescribing physician. In some embodiments, a priming dose is followed by a boosting dose over a period of time.
[0135] In alternative embodiments, generally for humans an initial immunization (that is for therapeutic or prophylactic administration) is administered followed by boosting dosages in the same dose range pursuant to a boosting regimen over weeks to months depending upon the patient's response and condition by measuring the antibody or T lymphocyte response in the patient's blood.
[0136] Polypeptides and compositions as described herein can generally be employed in serious disease states, that is, life-threatening or potentially life threatening situations. In such cases, in view of the minimization of extraneous substances and the relative nontoxic nature of the polypeptides, it is possible and can be felt desirable by the treating physician to administer substantial excesses of these polypeptide compositions.
[0137] For therapeutic use, administration can begin at the first sign of S. aureus infection or risk factors. In certain embodiments, the initial dose is followed by boosting doses until, e.g., symptoms are substantially abated and for a period thereafter. In frequent infection, loading doses followed by boosting doses can be required.
[0138] In certain embodiments, the composition as described herein is delivered to a subject by methods described herein, thereby achieving an effective immune response, and/or an effective therapeutic or preventative immune response. Any mode of administration can be used so long as the mode results in the delivery and/or expression of the desired polypeptide in the desired tissue, in an amount sufficient to generate an immune response to Staphylococcus, e.g., S. aureus, and/or to generate a prophylactically or therapeutically effective immune response to Staphylococcus, e.g., to S. aureus, in an animal in need of such response. According to the disclosed methods, a composition described herein can be administered by mucosal delivery, transdermal delivery, subcutaneous injection, intravenous injection, oral administration, pulmonary administration, intramuscular (i.m.) administration, or via intraperitoneal injection. Other suitable routes of administration include, but not limited to intratracheal, transdermal, intraocular, intranasal, inhalation, intracavity, intraductal (e.g., into the pancreas) and intraparenchymal (i.e., into any tissue) administration. Transdermal delivery includes, but not limited to intradermal (e.g., into the dermis or epidermis), transdermal (e.g., percutaneous) and transmucosal administration (i.e., into or through skin or mucosal tissue). Intracavity administration includes, but not limited to administration into oral, vaginal, rectal, nasal, peritoneal, or intestinal cavities as well as, intrathecal (i.e., into spinal canal), intraventricular (i.e., into the brain ventricles or the heart ventricles), intra-arterial (i.e., into the heart atrium) and sub arachnoidal (i.e., into the sub arachnoid spaces of the brain) administration.
[0139] Any mode of administration can be used so long as the mode results in the delivery and/or expression of the desired polypeptide in an amount sufficient to generate an immune response to Staphylococcus, e.g., S. aureus, and/or to generate a prophylactically or therapeutically effective immune response to Staphylococcus, e.g., S. aureus, in an animal in need of such response. Administration as described herein can be by e.g., needle injection, or other delivery or devices known in the art.
[0140] In some embodiments, a composition comprising a multivalent oligopeptide, DT, and or PSM as described herein, or polynucleotides, vectors, or host cells encoding same, stimulate an antibody response or a cell-mediated immune response sufficient for protection of an animal against Staphylococcus, e.g., S. aureus infection. In other embodiments, a composition comprising a multivalent oligopeptide, DT, and/or PSM as described herein, or polynucleotides, vectors, or host cells encoding same, stimulate both a humoral and a cell- mediated response, the combination of which is sufficient for protection of an animal against Staphylococcus, e.g., S. aureus infection. In some embodiments, a composition comprising a multivalent oligopeptide, DT, and/or PSM as described herein, or polynucleotides, vectors, or host cells encoding same, further stimulates an innate, an antibody, and/or a cellular immune response. [0141] In some embodiments, a composition comprising a multivalent oligopeptide, DT, and/or PSM as described herein, or polynucleotides, vectors, or host cells encoding same, can induce antibody responses to S. aureus. In certain embodiments, components that induce T cell responses (e.g., T cell epitopes) are combined with components such as the polypeptides as described herein that primarily induce an antibody response.
[0142] Further disclosed is a method for generating, enhancing, or modulating a protective and/or therapeutic immune response to S. aureus infection in a subject, comprising administering to a subject in need of therapeutic and/or preventative immunity one or more of the compositions as described herein.
[0143] The compositions as described herein can be administered to an animal at any time during the lifecycle of the animal to which it is being administered. In humans, administration of the composition as described herein can, and often advantageously occurs while other vaccines are being administered, e.g., as a multivalent vaccine as described elsewhere herein.
[0144] Furthermore, the composition as described herein can be used in any desired immunization or administration regimen; e.g., in a single administration or alternatively as part of periodic vaccination regimes such as annual vaccinations, or as in a prime-boost regime in which composition or polypeptide or polynucleotide of the disclosure is administered either before or after the administration of the same or of a different polypeptide or polynucleotide. Recent studies have indicated that a prime-boost protocol is often a suitable method of administering vaccines. In a prime-boost protocol, one or more compositions as described herein can be utilized in a "prime boost" regimen. An example of a "prime boost" regimen can be found in Yang, Z. et al. J. Virol. 77:799-803, 2002, which is incorporated herein by reference in its entirety.
[0145] Infections to be treated include, but are not limited to a localized or systemic infection of skin, soft tissue, blood, or an organ or an auto-immune disease. Specific diseases or conditions to be treated or prevented include, but are not limited to, respiratory diseases, e.g., pneumonia, sepsis, skin infections, wound infections, endocarditis, bone and joint infections, osteomyelitis, and or meningitis.
[0146] A number of animal models for S. aureus infection are known in the art, and can be used with the methods disclosed herein without undue experimentation. For example, a hamster model of methicillin-resistant Staphylococcus aureus (MRSA) pneumonia has been described for the testing of antimicrobials. (Verghese A. et al., Chemotherapy. 34:497-503 (1988), Kephart PA. et al. J Antimicrob Chemother. 21 :33-9, (1988)). Further, a model of S aureus-induced pneumonia in adult, immunocompetent C57BL/6J mice is described, which closely mimics the clinical and pathological features of pneumonia in human patients. (Bubeck-Wardenburg J. et al., Infect Immun. 75:1040-4 (2007)). Additionally, virulence has been tested in a rat model of S. aureus pneumonia as described in McElroy et al. (McElroy MC. et al, Infect Immun. 67:5541-4 (1999)). Finally, a standardized and reproducible model of MRSA-induced septic pneumonia to evaluate new therapies was established in sheep. (Enkhbaatar P. et al., Shock. 29(5):642-9 (2008)).
The practice of the disclosure will employ, unless otherwise indicated, conventional techniques of cell biology, cell culture, molecular biology, transgenic biology, microbiology, recombinant DNA, and immunology, which are within the skill of the art. Such techniques are explained fully in the literature. See, for example, Molecular Cloning A Laboratory Manual, 2nd Ed., Sambrook et al, ed., Cold Spring Harbor Laboratory Press: (1989); Molecular Cloning: A Laboratory Manual, Sambrook et al, ed., Cold Springs Harbor Laboratory, New York (1992), DNA Cloning, D. N. Glover ed., Volumes I and II (1985); Oligonucleotide Synthesis, M. J. Gait ed., (1984); Mullis et al. U.S. Pat. No: 4,683,195; Nucleic Acid Hybridization, B. D. Hames & S. J. Higgins eds. (1984); Transcription And Translation, B. D. Hames & S. J. Higgins eds. (1984); Culture Of Animal Cells, R. I. Freshney, Alan R. Liss, Inc., (1987); Immobilized Cells And Enzymes, IRL Press, (1986); B. Perbal, A Practical Guide To Molecular Cloning (1984); the treatise, Methods In Enzymology, Academic Press, Inc., N.Y.; Gene Transfer Vectors For Mammalian Cells, J. H. Miller and M. P. Calos eds., Cold Spring Harbor Laboratory (1987); Methods In Enzymology, Vols. 154 and 155 (Wu et al. eds.); Immunochemical Methods In Cell And Molecular Biology, Mayer and Walker, eds., Academic Press, London (1987); Handbook Of Experimental Immunology, Volumes I-IV, D. M. Weir and C. C. Blackwell, eds., (1986); Manipulating the Mouse Embryo, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., (1986); and in Ausubel et al, Current Protocols in Molecular Biology, John Wiley and Sons, Baltimore, Maryland (1989).
Standard reference works setting forth general principles of immunology include Current Protocols in Immunology, John Wiley & Sons, New York; Klein, J., Immunology: The Science of Self-Nonself Discrimination, John Wiley & Sons, New York (1982); Roitt, I., Brostoff, J. and Male D., Immunology, 6 ed. London: Mosby (2001); Abbas A., Abul, A. and Lichtman, A., Cellular and Molecular Immunology, Ed. 5, Elsevier Health Sciences Division (2005); and Harlow and Lane, Antibodies: A Laboratory Manual, Cold Spring Harbor Press (1988).
Examples
[0149] The breadth and scope of the present disclosure should not be limited by any of the above-described exemplary embodiments, but should be defined only in accordance with the following claims and their equivalents.
EXAMPLE 1: Generation of attenuated mutants of δ-toxin and PSMa3.
[0150] The δ-toxin and PSM oligopeptides require an amphiphilic a-helical structure to exhibit the surfactant properties (Omae, et al, 2012, J Biol Chem, 287 (19):15570-15579; Wang, et al., 2007, Nat Med, 13 (12): 1510-1514). These peptides consist of a hydrophobic and a hydrophilic surface as shown in Figure 1A for the four PSM-a oligopeptides, two PSM-β oligopeptides, and the δ-toxin oligopeptide. These peptides consist of a hydrophobic and a hydrophilic surface as shown in Figure 1A for the four PSM-a oligopeptides, two PSM-β oligopeptides, and the δ-toxin oligopeptide. The hydrophobic face of PSM-mec is shown in Figure 1A (hydrophobic face shown in the lower half of the circular depictions of the peptides). The peptides are shown in Table 3, with hydrophobic face residues underlined.
TABLE 3 OLIGOPEPTIDE SEQUENCES
Peptide Sequence (hydrophobic face residues underlined) SEQ ID NO δ toxin MAQDIISTIGDLVKWIIDTYNKFTKK 1
PSMal JvlGIIAGIIKVIKSLIEQFTGK 38
PSMa2 MGIIAGIIKFIKGLIEKFTGK 12
PSMa3 MEFVAKLFKFFKDLLGKFLGNN 6 or 13
PSMa4 MAIVGTIIKIIKAIIDIFAK 14
PSMpi MEGLFNAIKDTVTAAIN DGAKLGTSIVNIVENGVGLLSKLFGF 15
PSMP2 MTGLAEAIANTVQAAQQHDSVKLGTSIVDIVANGVGLLGKLFGF 16 2999
- 49 -
Figure imgf000050_0001
[0151] Helical wheel structures shown in Figure 1 were created using Heliquest software
(heliquest.ipmc.cnrs.fr) to define and display properties such as hydrophobicity and hydrophobic moment, net charge (z) (Gautier, et ah, 2008, Bioinformatics, 24 (18):2101- 2102). Mutations disrupting the helical structure can eliminate the surfactant properties (Omae, et al, 2012, J Biol Chem, 287 (19): 15570-15579) but could also decrease vaccine potency of the mutant. Therefore, we generated mutants by minimizing the disruption of the a-helix and to preserve immunogenicity of peptides. To eliminate surfactant properties we replaced several amino acids in the hydrophobic face of PSMa3 and 6-toxin with less hydrophobic amino acids like alanine, and glycine. The model predicts that these small amino acids will not drastically change protein structure but will substantially decrease hydrophobicity {Figure IB). We introduced mutations in two residues in the hydrophobic face of both PSMa3 (V4 and L14) and δ-toxin (L12 and V20). The mutants are shown in Table 4.
TABLE 4: MUTATED TOXIN SEQUENCES
Delta toxin mutants SEQUENCE (Mutated Residues SEQ ID NO
Underlined)
Wt MAQDIISTIGDLVKWIIDTVNKFTKK 1
ALA -1 MAQDIISTIGDAVKWIIDTV KFTKK 2
ALA -2 MAQDIISTIGDAVKWIIDTANKFTKK 3
GLY -1 MAQDIISTIGDGVKWIIDTVNKFTKK 4
GLY -2 MAQDIISTIGDGVKWIIDTGNKFTKK 5
PSM-a3 mutants
WT MEFVAKLFKFFKDLLGKFLGN 6 or 13
ALA -1 MEFVAKLFKFFKDALGKFLG N 7
ALA -2 MEFAAKLFKFFKDALGKFLGNN 8
GLY -1 MEFVAKLFKFFKDGLGKFLGNN 9
GLY -2 MEFGAKLFKFFKDGLGKFLGNN 10
GLY -ALA MEFGAKLFKFFKDALGKFLGNN 11 [0152] We engineered single and double mutants by replacing these two amino acids either by alanine or by glycine or both. As shown in Figure IB, the mutant constructs have decreased hydrophobicity and hydrophobic moment compared to wild type toxin as analyzed by Heliquest program (Gautier, et al., 2008, Bioinformatics, 24 (18):2101-2102). Similar mutants can be generated by further mutations in the hydrophobic face as additional potential attenuated toxoids.
EXAMPLE 2: Evaluation of attenuation of δ-toxin and PSMa3 mutants
[0153] Mutations alal, ala2, and gly2 were incorporated into delta toxin sequence and the mutants were tested for lytic activity towards horse red blood cells (HRBC) by the following method. Toxicity assay using horse blood: 5 ml horse blood was centrifuged at 2,000 RPM for 10 min at 20 °C. Supernatant was discarded and pellet was washed once with 15 ml PBS. Required percentage of the horse RBC cells was prepared in PBS by resuspending the pellet (wt vol). 100 μΐ of the various oligopeptides were added in 100 μΐ of horse RBC (different percentage as per required) in ELISA dilution plate and then plates were incubated at 37 °C for 45 min. Plates were then centrifuged and 100 μΐ of the supernatant was transferred into new NUNC ELISA plate. Absorbance in the supernatant was determined in VersamaxTM plate reader (Molecular Devices CA) at 416 nm. The optical density of the supernatant reflects the degree of hemolysis of red blood cells caused by the toxin.
[0154] Neutralization assay: For neutralization, diluted serum samples were added to 50 μΐ of the various oligopeptides (12.5 μg/ml), incubated 10 min at room temperature, and then 100 μΐ of 5% horse RBC were added. The plates were incubated 37 °C for 45 min. Plates were then centrifuged and 100 μΐ of the supernatant was transferred into new NUNC ELISA plate. Absorbance in the supernatants were determined in a VersamaxTM plate reader (Molecular Devices CA) at 416 nm.
[0155] As shown in Figure 2, delta toxin mutants alal (L12A), ala2 (L12A V20A), and gly2
(L12G/V20G) were fully attenuated. To test if the mutants retained their neutralizing epitopes we tested the delta toxin -ala2 mutant for binding to human neutralizing antibodies in a pool of high titer human sera generated by screening individual normal sera. As shown in Figure 3, delta toxin toxicity can be effectively neutralized with a 1 :450 dilution of human serum pool. Delta toxin-ala2 neither induced significant lysis of the cells nor did it change the toxicity of delta toxin when the toxin and mutant were combined. However, pre-incubation with delta toxin-ala2 (22.5 μg/nll) significantly reduced the neutralizing capacity of the human sera {Figure 3, compare 3rd and 7th bar) towards delta toxin (11.25 μ§/ηιΓ). Since 2 fold excess of mutant can significantly reduce the neutralizing capacity of the sera by ~50% shows that the attenuated mutant retains the ability to bind to neutralizing antibodies present in the human serum.
We also generated mutants at positions V4 and LI 5 of PSMa3. As shown in Figure 4, mutation of both these sites in PSM to glycine (PSM-gly2: V4A/L15A) strongly attenuated the toxin while the other mutants showed partial attenuation.
EXAMPLE 3: Generation of fusion constructs of AT62 with delta toxin and PSM
The AT62 vaccine has shown efficacy when tested in different animal models (Adhikari, et al., 2012, PLoS One, 7 (6):e38567). We generated three fusion proteins with AT62 as the core subunit fused to PSMa3, δ-toxin, or both using a flexible linker (GGGGS; i.e. G4S) flanked with a C-terminal 6xHis {Figure5A&B). The nucleic acid sequences codon optimized for expression in E. coli were prepared, and the three fusion proteins were produced at small scale. The specificity and the size of the constructs were confirmed by western blot with AT62 specific antibodies (6C12) {Figure 5C). The sequences are presented in Table 5. In each instance, the AT62 oligopeptide is single-underlined, delta toxin is double-underlined, and PSM PSMa3 has a broken underline. Additional fusion proteins including AT62 and staphylococcal exotoxin B (SEB) are also presented
TABLE 5 AT62 FUSION OLIGOPEPTIDES
Figure imgf000052_0001
Fusion Peptide Amino Acid Sequence SEQ Codon-Optimized Nucleic Acid SEQ
ID Sequence ID NO
NO
TTGATGACAAAAATCACAACAAGAAG
CTGTTGGTTATTCGTACCAAAGGCACC
ATTGCCGGTGGTGGCGGCTCCGGTGG
CGGTGGTTCTATGGAATTTGTTGCAAA
GCTGTTCAAATTCTTTAAGGATCTGCT
GGGTAAATTCCTGGGCAACAACCATC
ATCACCATCACCACTGATAACT
AT62_DT_PSM MADSDINIKTGTTDIGSNTTV 22 ATGGCGGATAGCGACATCAACATCAA 21
KTGDLVTYDKENGMHKKVF AACGGGTACTACGGACATTGGCAGCA
YSFIDDKNHNKKLLVI TKGT ATACGACCGTCAAGACCGGTGATCTG
TAGOOGSMAODTTSTTGnT.VK GTCACCTATGACAAAGAGAATGGTAT
WITDTVNKFT GGGGSMEF GCACAAAAAGGTGTTTTACAGCTTCA
VAKLF^FFKDLLQKFLGNNH TTGATGACAAAAATCACAACAAGAAG
HHHHH CTGTTGGTTATTCGTACCAAAGGCACC
ATTGCCGGTGGTGGTGGTTCTATGGCG
CAGGACATCATTTCCACGATCGGCGA
TCTGGTTAAATGGATCATCGACACCGT
GAACAAGTTTACCAAGAAAGGTGGTG
GCGGTAGCATGGAATTTGTTGCAAAA
CTGTTCAAATTCTTTAAGGATCTGCTG
GGCAAGTTCCTGGGCAACAATCATCA
TCACCATCACCACTGATAA
AT62_rSEB MADSDINIKTGTTDIGSNTTVK 23 CATATGGCAGACTCGGACATCAACAT 25
TGDL VT YDKEN GMHKK VF YS CAAAACGGGCACGACGGACATTGGCT
FIDDKNHNKKLLVIRTKGTIAG CAAACACGACGGTGAAAACGGGCGAC
GGGSGGGGSESQPDPKPDELH CTGGTGACCTACGACAAAGAAAACGG
KS SKFTGLMENMK VL YDDNH CATGCATAAAAAAGTGTTTTATAGCTT
VSAINVKSIDQFRYFDLIYSIKD CATCGATGACAAAAACCACAACAAAA
TKLGNYDNVRVEFKNKDLAD AACTGCTGGTCATTCGTACCAAGGGT
KYKDKYVDVFGANAYYQCAF ACGATCGCAGGTGGTGGTGGTTCTGG
SKKTNDINSHQTDKRKTCMYG CGGTGGTGGTAGTGAATCCCAGCCGG
GVTEHNGNQLDKYRSITVRVF ACCCGAAACCGGACGAACTGCATAAA
EDGKNLLSFDVQTNKKKVTAQ AGCTCTAAATTTACCGGCCTGATGGA
ELDYLTRHYLVKNKKLYEFNN AAATATGAAAGTGCTGTATGATGACA
SPYETGYIKFIENENSFWYDM ACCACGTGTCAGCCATTAATGTTAAAT
MPAPGDKFDQSKYLMMYNDN CGATCGATCAATTCCGTTATTTCGACC
K VDSKDV IEVYLTTKKK TGATTTACTCAATCAAAGATACCAAA
CTGGGCAACTATGACAATGTGCGCGT
TGAATTCAAAAACAAAGATCTGGCAG
ACAAATACAAAGATAAATACGTCGAC
GTGTTCGGTGCGAATGCCTATTACCAG
TGCGCTTTCAGCAAGAAAACCAACGA
TATCAACTCTCATCAAACCGACAAAC
GTAAAACGTGTATGTATGGCGGTGTG
ACCGAACACAACGGCAATCAGCTGGA
TAAATACCGTAGTATCACGGTTCGCGT
CTTTGAAGATGGTAAAAACCTGCTGT
CCTTCGATGTCCAGACCAACAAGAAA
AAAGTGACGGCACAAGAACTGGATTA
TCTGACCCGCCATTACCTGGTTAAAAA
CAAAAAACTGTACGAATTCAACAACT
CACCGTATGAAACGGGCTACATCAAA
TTCATCGAAAACGAAAACTCGTTCTG
GTACGATATGATGCCGGCCCCGGGCG
ATAAATTCGACCAGTCCAAATATCTG
ATGATGTACAATGATAACAAAATGGT
TGACTCCAAAGATGTGAAAATCGAAG
TTTACCTGACGACGAAAAAAAAATAA
GGATCC
rSEB_ AT62 MESQPDPKPDELHKSSKFTGL 26 CATATGGAAAGCCAACCGGACCCGAA 28 Fusion Peptide Amino Acid Sequence SEQ Codon-Optimized Nucleic Acid SEQ
ID Sequence ID NO
NO
MENMKVLYDDNHVSAINVKSI ACCGGACGAACTGCATAAAAGCTCAA
DQFRYFDLIYSIKDTKLGNYDN AATTCACGGGCCTGATGGAAAACATG
VRVEFKNKDLADKYKDKYVD AAAGTGCTGTACGACGATAACCATGT
VFGA AYYQCAFSKKTNDINS CAGTGCAATTAATGTGAAATCCATCG
HQTDKR TCMYGGVTEHNGN ATCAGTTTCGTTATTTCGACCTGATTT
QLDKYRSITVRVFEDGKNLLSF ACTCAATCAAAGATACCAAACTGGGC
DVQTNKKKVTAQELDYLTRH A ACTATG AC AATGTGCGC GTTGAATT
YLVKNKKLYEFNNSPYETGYI CAAAAACAAAGATCTGGCAGACAAAT
KFIENENSFWYDMMPAPGDKF ACAAAGATAAATACGTCGACGTGTTC
DQSKYL MYNDNK VDSKD GGTGCGAATGCCTATTACCAGTGCGC
VKIE V YLTT K GGGGS GGGG TTTCAGCAAGAAAACCAACGATATTA
SADSDINIKTGTTDIGSNTTVKT ATTCGCATCAAACCGACAAACGTAAA
GDLVTYDKENGMHKKVFYSFI ACGTGTATGTATGGCGGTGTCACCGA
DDKNHNKKLLVIRTKGTIA AC AC AAC GGC AATC AACTGG ATAAAT
ACCGTAGCATCACGGTTCGCGTCTTTG
AAGATGGTAAAAACCTGCTGTCTTTC
GACGTGCAGACCAACAAGAAAAAAGT
TACGGCGCAAGAACTGGATTATCTGA
CCCGCCATTACCTGGTTAAAAACAAA
AAACTGTACGAATTCAACAACTCACC
GTATGAAACGGGCTACATCAAATTCA
TCGAAAAC G AAAACTCGTTCTGGT AC
GATATGATGCCGGCCCCGGGCGATAA
ATTCGACCAGAGTAAATACCTGATGA
TGTACAACGATAACAAAATGGTGGAT
TCCAAAGACGTGAAAATTGAAGTTTA
TCTGACCACCAAGAAAAAAGGTGGTG
GTGGTAGCGGTGGTGGTGGTAGCGCC
GATTCTGACATTAACATCAAAACCGG
CACCACGGATATCGGTTCTAATACCA
CGGTTAAAACCGGCGATCTGGTCACG
TATGACAAAGAAAACGGTATGCACAA
AAAAGTGTTTTATTCCTTCATTGACGA
CAAAAATCACAACAAAAAACTGCTGG
TTATCCGCACGAAAGGCACCATCGCA
TAAGGATCC
AT62_rSEB JDT MADSDINIKTGTTDIGSNTTV 29 CATATGGCAGATAGCGACATCAACAT 31
KTGDLVTYDKENGMHKKVF CAAGACGGGCACGACGGACATTGGCT
YSFIDDKNHNKKLLVIRTKGT CAAACACGACGGTGAAAACGGGTGAC
IAGGGGSESQPDPKPDELHKS CTGGTTACCTACGATAAAGAAAACGG
S FTGLMENMKVLYDDNHV CATGCATAAGAAGGTGTTTTATTCTTT
SAINVKSIDQFRYFDLIYSIKD CATCGATGACAAAAACCACAATAAAA
TKLGNYDNVRVEFKN DLA AGCTGCTGGTTATTCGTACCAAGGGT
DKYKDKYVDVFGANAYYQC ACGATTGCGGGCGGTGGCGGTAGTGA
AFSKKTNDINSHQTDKRKTC ATCCCAGCCGGACCCGAAACCGGACG
MYGGVTEHNGNQLDKYRSIT AACTGCATAAGAGCTCTAAATTTACC
VRVFEDGKNLLSFDVQTNKK GGCCTGATGGAAAATATGAAAGTGCT
KVTAQELDYLTRHYLVKN K GTATGATGACAACCACGTCTCAGCCA
LYEFNNSPYETGYIKFIENENS TTAATGTGAAATCGATCGATCAATTTC
FWYDMMPAPGDKFDQSKYL GTTATTTCGACCTGATTTACAGCATCA
MMYNDNKMVDSKDVKIEVY AGGATACCAAACTGGGCAACTACGAC
LTTKKKGGGGSMAQDIISTIG AATGTGCGCGTTGAATTTAAAAACAA
DLVKWIIDTVN FTKK. GGATCTGGCAGACAAATATAAGGATA
AATACGTCGACGTGTTTGGTGCGAAT
GCCTATTACCAGTGCGCTTTCAGTAAA
AAGACCAACGATATCAACTCCCATCA
AACCGACAAGCGTAAAACGTGTATGT
ATGGCGGTGTCACCGAACACAACGGC
AATCAGCTGGATAAATACCGTTCAAT
CACGGTTCGCGTCTTTGAAGATGGTA
AAAACCTGCTGTCGTTCGATGTTCAGA Fusion Peptide Amino Acid Sequence SEQ Codon-Optimized Nucleic Acid SEQ
ID Sequence ID NO
NO
CCAATAAAAAGAAAGTCACGGCACAA
GAACTGGATTATCTGACCCGCCATTAC
CTGGTTAAGAACAAGAAGCTGTACGA
ATTCAACAACAGTCCGTATGAAACGG
GCTACATCAAGTTCATCGAAAACGAA
AACAGCTTCTGGTACGATATGATGCC
GGCACCGGGTGATAAGTTCGACCAGA
GCAAGTACCTGATGATGTACAACGAT
AAC AAG ATGGTTG ATTCT AAGGAC GT
GAAAATCGAAGTTTATCTGACCACGA
AGAAAAAGGGCGGTGGCGGTAGCATG
GCTC AAG ATATTATCTCTAC CATC GGT
GACCTGGTGAAGTGGATTATTGACAC
GGTGAACAAGTTTACGAAGAAATGAG
GATCC
EXAMPLE 4: Immunogenicity of fusion constructs
The immunogenicity of two of the fusion constructs (AT62_DT and AT62 PSM) along with control (AT62 AA) was tested in Swiss Webster mice in groups of 4, 4 and 8 mice respectively. Mice were immunized subcutaneously with the proteins (10 μg) along with adjuvant (Sigma Adj System; an MPL based adjuvant) (5 μg) three times at two week intervals (days 0, 14 & 28). After the third immunization the mice were boosted with the respective δ-toxin or PSMa3 peptide (10 μg) and serum samples collected from the mice were tested for binding to the antigen using ELISA as described before (Adhikari, et ah, 2012, PLoS One, 7 (6):e38567). Briefly, 96-well plates were coated with lOOng/well of full length alpha toxin (List Biological Laboratories, Campbell, CA), PSMa3, or delta toxin overnight at 4 °C. Plates were blocked with Starting Block buffer (Thermo Scientific) for one hour at room temperature (RT). Serum samples were diluted at 1 : 100 using starting block buffer as diluent. Plates were washed three times and sample dilutions were applied at 100 μΐ/well. Plates were incubated for one hour at RT and washed three times before applying the conjugate, goat anti-mouse IgG (H&L)-HRP (Horse Radish Peroxidase) in starting block buffer. Plates were incubated for one hour at RT, washed as described above and incubated with TMB (3,3',5,5'-tetramethylbenzidine) to detect HRP for 30min. Optical density at 650nm was measured using a Versamax™ plate reader (Molecular Devices CA).
As shown in Figure 6, mice vaccinated with the fusion constructs AT62-PSM and AT62-DT showed strong antibody response to alpha hemolysin showing that the AT62 retained its immunogenicity in the context of fusion construct. Response to PSMa3 and δ- toxin peptides was also detectable although at a lower level. These data suggest that induction of an antibody response to both components is possible.
[0160] The following additional constructs will be constructed and tested:
• Fusion of a single PSMa3 or δ-toxin or 2, 3, 4, 5, or 6 tandem repeats of PSMa3 or δ- toxin (wild type or any of the mutants) at the N- or C-terminus of attenuated LukS-PV mutants as described in PCT/US 12/67483.
• Fusion of a single PSMa3 or δ-toxin or 2, 3, 4, 5, or 6 tandem repeats of PSMa3 or δ- toxin (wild type or any of the mutants) at the N- or C-terminus of attenuated superantigen vaccines SEBL45R/Y89A/Y94A, SEAL48R/D70R/Y92A, or TSST-1 l30R/D27A/I46A-
• Fusion of a single PSMa3 or δ-toxin or 2, 3, 4, 5, or 6 tandem repeats of PSMa3 or δ- toxin (wild type or any of the mutants) along with AT62 to any of the superantigen
Vaccines SEBL45R/Y89A/Y94A, SEAL48R/D70R/Y92A, Or TSST-1L30R/D27A/I46A-
[0161] An example of three potential fusion constructs is schematically shown in Figure 7.
EXAMPLE 5: Triple Fusion mutant of staphylococcal superantigen toxoids
[0162] The most prevalent S. aureus Superantigens (Sags) are SEB, SEC, SEA, and TSST-1.
Recombinant vaccines for SEB, SEA, and TSST-1 (subject of US Patents 6,713,284; 6,399,332; 7,087,235; 7,750,132; 7,378,257, and 8,067,202) were developed and tested individually for protective efficacy in models of toxic shock syndrome (Bavari, et al, 1996, J Infect Dis,; Bavari and Ulrich, 1995, Infect Immun, 63 (2):423-429; Boles, et al, 2003 Clin Immunol, 108 (l):51-59; Boles, et al, 2003, Vaccine, 21 (21-22):2791-2796; Ulrich, et al, 1998, Vaccine, 16 (19):1857-1864). Whereas the SAgs play an important role in complications of SA disease, a major obstacle in developing vaccines based on SAgs is the fact that there are >20 variants of these toxins in various SA strains.
[0163] We evaluated the ability of human antibodies to SEB, SEA, and TSST-1 to neutralize a wide range of S. aureus Sags, by the following methods.
[0164] Affinity purification of human anti-SAg antibodies. SEA, SEB and TSST-1 were coupled to agarose beads (1 mg SAg per 1 mL bead volume) of an Aminolink® plus immobilization column (Thermo Scientific, Rockford, IL) following the manufacturer's protocol. Affinity purification of specific antibodies from IVIG (Omrix Biopharmaceuticals, Nes-Ziona, Israel) was carried out according to manufacturer's protocol with minor modifications: 50 mL of IVIG was incubated with toxin-coupled beads for lh 30 min at RT with gentle rocking, centrifuged, the supernatant removed and a fresh 50 mL of IVIG incubated with the beads for another 1 h and 30 min. Elution was performed with glycine HC1 pH 2.5 buffer. To avoid degradation of proteins eluted fractions were collected in neutralizing buffer, containing (0.1 M Tris) pH 9 to give a final pH between 6-7. The concentration of the affinity purified antibodies was determined by BCA assay.
Toxin neutralization assay in vitro. Peripheral blood mononuclear cells were isolated from heparinized blood of de-identified healthy human donors by Ficoll gradient centrifugation as described elsewhere (Berthold, 1981, Blut, 43 (6):367-371). Isolated peripheral blood mononuclear cells were washed twice in PBS, frozen in 10% DMSO in heat-inactivated fetal bovine serum (HI-FBS) overnight at -80 °C, and stored in liquid nitrogen until further use. For the assay, cells were washed and re-suspended in RPMI 1640 medium, supplemented with 5% fetal bovine serum (FBS), non-essential amino acids, Penicillin/Streptomycin and L-Glutamine. Cells were, enumerated by Trypan blue exclusion and adjusted to 2xl06 cells/ml. 75 μΐ of mis cell suspension (1.5xl05 cells) with a viability of >95% was added the wells of a 96-well plate containing antibody/antigen mixes in duplicates as follows: 37.5 μΐ of affinity-purified anti-SEA, -SEB, - TSST-1, in semi-log dilutions (0.02- 20 μ^ιηΐ) or IVIG in semi log dilutions (2.5- 2500 μ^πιΐ) IVIG and 37.5 μΐ of a 1 ng/ml preparation of either SEB, SEC 1-3, SEE, SEH, SEI, SEK, TSST-1, SpeC, or 2 ng/ml of SED, or 3 ng/ml of SpeA. To test the synergistic activity of purified polyclonal Abs a combination of anti-SEA, -SEB, and -TSST-1 was used in a semi log dilution ranging from 0.02 to 20 μg/ml and the same amount of toxin as above. Wells containing medium with toxin only were served as positive controls. The plates were incubated at 37°C in an atmosphere of 5% C02-95% air for 48 hours. Plates were centrifuged at 1600xg for 10 minutes, culture supernatants harvested and IFNy concentration (pg/ml), was determined by ELISA (Human IFN-gamma DuoSet, R&D Systems, Minneapolis, MN) following the manufacturers' protocol. Plates were read at 450 nm using the Versamax plate reader and data was transferred to and analyzed in Excel. Positive control wells were considered to have a 0% IFNy inhibition and, inhibition of IFNy production in the presence of affinity purified antibodies was calculated as the difference in IFNy concentration between the positive control and sample. IC50 (the molar concentration of antibodies that was required to reach 50% inhibition of IFNy production) values for the neutralizing agents (purified antibodies or IVIG) were determined using a 4-parameter logistic model (equation 205, XLfit version 5.2). [0166] As shown in Figure 8, affinity purified human antibodies (from IVIG) to each of these three toxins provided robust neutralization towards the homologous toxin and varying degree of cross neutralization to several other SAgs. However, a cocktail of the three human antibodies resulted in a remarkable widening of the cross neutralization activity.
[0167] In view of these results, novel fusions of the three toxoid superantigens:
SEBL45R/Y89AA'94A, SEAL48R/D70R/Y92A, and TSST-1L3OR/D27A/I46A mutants are expressed as single molecules in a prokaryotic host, e.g., E. coli. Such fusion proteins can be superior to individual components not only due to ease of manufacturing but also because they can enhance the elicitation of cross reactive antibodies between various superantigens as the common epitopes brought together into a single molecule can act in an immunodominant manner. The following fusion proteins are to be constructed.
[0168] A fusion of SEBL4SR/Y8 A/Y94A, SEAL48R/D70R/Y92A, and TSST-1L30R/D27A/I46A mutants in one of the following orders with a commonly used linker (L) such as but not limited to a linker consisting of one or more repeats of four glycines and one serine:
■ BAT Fusion: SEBL45Rm9A/Y94A-L-SEAL48R/D70R/Y92A-L-TSST-l L30R/D27A/I46A
■ BTA FUS-OI1:SEBL45R/Y89A/Y94A- L-TSST-1L30R D27A/I46A -L-SEAL48R/D70R/Y92A
■ ABT Fusion: SEAL48R/D70R/Y92A-L- SEBL4SR/Y89A Y94A-L-TSST-1L30R/D27A I46A
■ ΑΤΒ Fusion: SEAL48R/D70R Y92A-L-TSST-1L30R/D27A I46A-L- SEBL45R/Y89A/Y94A
■ TAB Fusion:TSST-l L30R/D27A/I46A-L-SEAL48Rj¾70R Y92A-L- SEBL45R/Y89A/Y94A
■ TBA Fusion:TSST-l L30R/D27A/I46A-L- SEBL45R/Y89A/Y94A -L-SEAL48R/D70R Y92A
[0169] Representative sequences are presented in Table 6
TABLE 6: SAG FUSION PROTEINS.
SEQ ID NO
BAT Fusion: ESQPDPKPDELHKSS FTGL EN KVLYDDNHVSAINVKSIDQFRYFDLIYSIKDT 32
SEBL45R/Y89A/Y 4A- LGNYDNVRVEFKN DLAD Y D YVDVFGANAYYQCAFS KTNDINSHQTD RKT
L- CMYGGVTEHNGNQLDKYRSITVRVFEDG NLLSFDVQTNKKKVTAQELDYLTRHYL
SEAL48R/D70R/Y92A" VKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKM
L-TSST- VDSKDVKIEVYLTTKKKGGGSEKSEEINEKDLRKKSELQGTALGNL QIYYYNEKAKTE
1L30R D27A/I46A N ESHDQFRQHTILFKGFFTDHSWYNDLLVRFDSKDIVDKYKGKKVDLYGAYAGYQ
CAGGTPNKTACMYGGvTLHDNNRLTEEKKVPINLWLDGKQNTVPLETVKTNKKNV
TVQELDLQARRYLQE YNLYNSDVFDGKVQRGLIVFHTSTEPSVNYDLFGAQGQYS
NTLLRIYRDN TINSEN HIDIYLYTSGGGGSSTNDNI DLLDWYSSGSDTFTNSEVL
ANSRGSMRIKNTDGSISLIAFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQI
SGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISTLDFEIRHQLTQIHGLY
RSSDKTGGYW ITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
BTA MESQPDPKPDELHKSS FTGLMENMKVLYDDNHVSAINVKSIDQFRYFDLIYSIKDT 33
Fusion:SEBu5R/Y89A/ KLGNYDNVRVEFKNKDLADKYKDKYVDVFGANAYYQCAFSKKTNDINSHQTDKRKT L-TSST- CMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYL
1 L- V N LYEFNNSPYETGYIKFIENENSFWYDMMPAPGD FDQS YLM YNDN M SEA VDSKDVKIEVYLTTKKKGGGSSTNDNIKDLLDWYSSGSDTFTNSEVLANSRGSMRIK
NTDGSISLIAFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPT
PIELPLKV VHGKDSPLKYWPKFDK QLAISTLDFEIRHQLTQIHGLYRSSD TGGYW
KIT NDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEINGGGGSEKSEEINEKDLRKKS
ELQGTALGNLKQIYYYNEKAKTENKESHDQFRQHTILFKGFFTDHSWYNDLLVRFDS
KDIVDKYKGKKVDLYGAYAGYQCAGGTPNKTACMYGGVTLHDNNRLTEEKKVPINL
WLDGKQNTVPLETVKTNKKNVTVQELDLQARRYLQEKYNLYNSDVFDGKVQRGLIV
FHTSTEPSVNYDLFGAQGQYSNTLLRIYRDNKTINSENMHIDIYLYTS
ABT MEKSEEINEKDLRKKSELQGTALGNLKQIYYYNEKAKTENKESHDQFRQHTILFKGFF 34
Fusion:SEA TDHSWYNDLLVRFDSKDIVDKY GKKVDLYGAYAGYQCAGGTPNKTACMYGGVTL -L- HDNNRLTEEK VPINLWLDGKQNTVPLETVKTNKKNVTVQELDLQARRYLQEKYNL
S B L- YNSDVFDGKVQRGLIVFHTSTEPSVNYDLFGAQGQYSNTLLRIYRDNKTINSEN HI TSST- 1 DIYLYTSGGGGSESQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFR
YFDLIYSIKDTKLGNYDNVRVEFKN DLADKYKDKYVDVFGANAYYQCAFSKKTNDI
NSHQTDKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTA
QELDYLTRHYLVKNK LYEFNNSPYETGYIKFIENENSFWYDMMPAPGD FDQS YL MYNDNKMVDSKDVKIEVYLTTKKKGGGSSTNDNIKDLLDWYSSGSDTFTNSEVL
ANSRGSMRIKNTDGSISLIAFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQI
SGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISTLDFEIRHQLTQIHGLY
RSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
ATB MEKSEEINEKDLRKKSELQGTALGNLKQIYYYNEKAKTENKESHDQFRQHTILFKGFF 35
Fusion:SEA TDHSWYNDLLVRFDSKDIVDKYKGKKVDLYGAYAGYQCAGGTPNKTACMYGGVTL "L-TSST- HDNNRLTEEKkVPINLWLDGKQNTVPLETVKTNKKNVTVQELDLQARRYLQEKYNL
1 L- YNSDVFDGKVQRGLIVFHTSTEPSVNYDLFGAQGQYSNTLLRIYRDNKTINSENMHI
SEB DIYLYTSGGGGSSTNDNIKDLLDWYSSGSDTFTNSEVLANSRGS RIKNTDGSISLIAF
PSPYYSPAFT GEKVDLNTKRTK SQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVH
GKDSPLKYWPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITM NDGSTY
QSDLSKKFEYNTEKPPINIDEIKTIEAEINGGGSESQPDPKPDELHKSSKFTGLMENMK
VLYDDNHVSAINV SIDQFRYFDLIYSIKDT LGNYDNVRVEFKNKDLADKY D YVD
VFGANAYYQCAFS KTNDINSHQTDKRKTC YGGVTEHNGNCtLDKYRSITVRVFE
DGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSF
WYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDV IEVYLTTKKK
TAB Fusion:TSST- MSTNDN!KDLLDWYSSGSDTFTNSEVLANSRGSMRIKNTDGSISLIAFPSPYYSPAFT 36
1 L- KG E KVD LNTK RTKKSQ.HTSEGTYI H FQISG VTNTE KLPTP 1 E LP LKV V HG K DS P LKY S E A L" WPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKF SEB EYNTEKPPINIDEIKTIEAEINGGGSEKSEEINEKDLRKKSELQGTALGNLKQIYYYNEK
AKTENKESHDQFRQHTILFKGFFTDHSWYNDLLVRFDSKDIVDKYKGKKVDLYGAYA
GYQCAGGTPNKTACMYGGVTLHDNNRLTEEKKVPINLWLDGKQNTVPLETVKTNK
KNVTVQELDLQARRYLQEKYNLYNSDVFDGKVQRGLIVFHTSTEPSVNYDLFGAQG
QYSNTLLRIYRDNKTINSENMHIDIYLYTSGGGGSESQPDPKPDELHKSSKFTGLMEN
MKVLYDDNHVSAINVKSIDQFRYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKY
VDVFGANAYYQCAFSKKTNDINSHQTDKRKTCMYGGVTEHNGNQLDKYRSITVRV
FEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENS
FWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTKKK
TBA FusioniTSST- MSTNDNIKDLLDWYSSGSDTFTNSEVLANSRGSMRIKNTDGSISLIAFPSPYYSPAFT 37
1 L- KGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKY SEB "L" WPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKF SEA EYNTEKPPINIDEIKTIEAEINGGGGSESQPDPKPDELHKSSKFTGLMEN KVLYDDN HVSAINVKSIDQFRYFDLIYSIKDTKLGNYDNVRVEF NKDLADKYKD YVDVFGANA
YYQCAFSKKTND1NSHQTDKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLS
FDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDM
PAPGD FDQSKYLMMYNDNKMVDSKDVKIEVYLTTKKKGGGSEKSEEINEKDLRKK
SELQGTALGNL QIYYYNEKA TENKESHDQFRQHTILF GFFTDHSWYNDLLVRFD
SKDIVDKYKGKKVDLYGAYAGYQCAGGTPNKTACMYGGVTLHDNNRLTEEKKVP!N
LWLDGKQNTVPLETVKTNKKNVTVQELDLQARRYLQEKYNLYNSDVFDG VQRGLI
VFHTSTEPSVNYDLFGAQGQYSNTLLRIYRDNKTINSENMHIDIYLYTS

Claims

WHAT IS CLAIMED IS:
1. A recombinant peptide comprising a Staphylococcus aureus delta toxin peptide or a mutant, fragment, variant or derivative thereof (DT); a Staphylococcus aureus phenol soluble modulin peptide or a mutant, fragment, variant or derivative thereof (PSM); or a fusion of a DT and a PSM; wherein the peptide is attenuated relative to wild-type DT, PSM, or both, and wherein the peptide can elicit an mti-Staphylococcus aureus immune response when administered to a subject.
2. The peptide of claim 1 , comprising mutations that reduce the surfactant properties of the DT, PSM, or both, while maintaining immunogenicity.
3. The peptide of claim 2, wherein hydrophobicity is reduced while maintaining the peptide's alpha-helical structure.
4. The peptide of any one of claims 1 to 3, wherein at least one hydrophobic amino acid is replaced with a less hydrophobic amino acid.
5. The peptide of claim 4, wherein the hydrophobic amino acid comprises valine (V), leucine (L), isoleucine (I), phenylalanine (F), or methionine (M).
6. The peptide of claim 4 or claim 5, wherein the less hydrophobic amino acid comprises glycine or alanine.
7. The peptide of any one of claims 1 to 6, wherein the DT comprises the amino acid sequence MAQDX5X6STX9GDX12X13KWX16X17DTX2oNKFTKK (SEQ ID NO: 39), wherein at least one of X X5, X6, X9, X12, X13, X16, X17, or X20 comprises an amino acid substitution relative to SEQ ID NO: 1, and wherein X5 is isoleucine (I), glycine (G) or alanine (A), X6 is I, G, or A, X9 is I, G, or A,Xi2 is leucine (L), G, or V, X13 is valine (V), G, or A, Xi6 is I, G, or A, X17 is I, G, or A, and X2o is V, G, or A.
8. The peptide of claim 7, wherein a single amino acid selected from the group consisting of X5, X6, X9, X12, Xi3, i6, n, and X2o is G or A.
9. The peptide of claim 8, wherein X12 is G, or X12 is A.
10. The peptide of claim 8, comprising the amino acid sequence SEQ ID NO: 2.
11. The peptide of claim 8, comprising the amino acid sequence SEQ ID NO: 4.
12. The peptide of claim 7, wherein two amino acids selected from the group consisting of X5, X6, X9, X12, Xi3, Xi6, X17, or X20 are G or A.
13. The peptide of claim 12, wherein X12 is G or A, and X20 is G or A.
14. The peptide of claim 12, comprising the amino acid sequence SEQ ID NO: 3.
15. The peptide of claim 12, comprising the amino acid sequence SEQ ID NO: 5.
1 . The peptide of any one of claims 1 to 6, wherein the PSM comprises PSMal, PSMa2, PSMa3, PSMa4, PSMpl, PSMp2, PSM-mec, or any combination of two or more PSMs.
17. The peptide of claim 16, comprising a PSMal mutant comprising the amino acid sequence X1GX3X4AGX7X8KX10X11KSX1 X1SEQX18TGK (SEQ ID NO: 40), wherein at least one of Xi, X3, X4, X7, Xg, X10, X11, X14 ,Xi5, or Χ18 comprises an amino acid substitution relative to SEQ ID NO: 38, and wherein X] is methionine (M), G, or A, X3 is I, G, or A, X4 is I, G, or A, X7 is I, G, or A, X8 is I, G, or A, X10 is V, G, or A, Xu is I, G, or A, X14 is L, G, or A, X15 is I, G, or A, and X18 is
F, G, or A.
18. The peptide of claim 17, wherein a single amino acid selected from the group consisting of Xls X3, X4, X7, Xg, X10, Xn, X14 ,X15, and Xig is G or A.
19. The peptide of claim 17, wherein two amino acids selected from the group consisting of Xi, X3, X4, X7, 8, X10, Xn, Xi4 ,Xi5, and X18 are G or A.
20. The peptide of claim 16, comprising a PSMa2 mutant comprising the amino acid sequence X1GX3X4AGX7X8KX10X11KGXi4Xi5EKX18TGK (SEQ ID NO: 41), wherein at least one of Xls X3, X4, X7, Xg, X10, Xn, Xi4 5 i5, or Xig comprises an amino acid substitution relative to SEQ ID NO: 12, and wherein Xi is M, G, or A, X3 is I, G, or A, 4 is I, G, or A, X7 is I, G, or A, Xg is I,
G, or A, ΧΪΟ is F, G, or A, Xi i is I, G, or A, X14 is L, G, or A, X15 is I, G, or A, and Xig is F, G, or A.
21. The peptide of claim 17, wherein a single amino acid selected from the group consisting of Xi, X3, X4, X7, Xs> X10, Xn, X14 ,Xis, and Xig is G or A.
22. The peptide of claim 17, wherein two amino acids selected from the group consisting of Xi, X3> X , X7, Xg, X10, X11, Xi4 ,Xi5, and X18 are G or A.
23. The peptide of claim 16, comprising a PSMa3 mutant comprising the amino acid sequence X1EX3X4AKX7X8KX1oX11KDX14X15GKXigX19GNN (SEQ ID NO: 42), wherein at least one of Xi, X3, X4, X7, Xg, X10, Xn, XH ,Xi5, X18, or X19 comprises an amino acid substitution relative to SEQ ID NO: 6, and wherein Xi is M, G, or A, X3 is F, G, or A, X4 is V, G, or A, X7 is L, G, or A, Xg is F, G, or A, X10 is F, G, or A, Xu is F, G, or A, X14 is L, G, or A, X15 is L, G, or A, X18 is F, G, or A, and X19 is L, G, or A.
24. The peptide of claim 23, wherein a single amino acid selected from the group consisting of Xls X3, X4, X7, Xs, X10, Xn, Xi4 ,Xi5, Xi8, and X19 is G or A.
25. The peptide of claim 24, comprising the amino acid sequence SEQ ID NO: 7.
26. The peptide of claim 24, comprising the amino acid sequence SEQ ID NO: 9.
27. The peptide of claim 23, wherein two amino acids selected from the group consisting of X1; X3, X4, X7, X8, X10, Xn, X14 ,Xi5, Xi8, and X19 are G or A.
28. The peptide of claim 27, comprising the amino acid sequence SEQ ID NO: 8.
29. The peptide of claim 27, comprising the amino acid sequence SEQ ID NO: 10.
30. The peptide of claim 27, comprising the amino acid sequence SEQ ID NO: 11.
31. The peptide of claim 16, comprising a PSMa4 mutant comprising the amino acid sequence X1AX3X4GTX7X8KX10X11KAX14X15DX17X1gAK (SEQ ID NO: 43), wherein at least one of Xi, X3, X4, X7, Xg, X10, Xn, X14 ,X15, X17, or X18 comprises an amino acid substitution relative to SEQ ID NO: 14, and wherein X! is M, G, or A, X3 is I, G, or A, X4 is V, G, or A, X7 is I, G, or A, X8 is I, G, or A, X10 is I, G, or A, Xn is I, G, or A, X14 is I, G, or A, X15 is I, G, or A, X17 is I, G, or A, and X18 is F, G, or A.
32. The peptide of claim 31 , wherein a single amino acid selected from the group consisting of Xls X3, X4, X7, Xs, X10, Xn, X14 ,Xi5, Xn, and X17 is G or A.
33. The peptide of claim 31, wherein two amino acids selected from the group consisting of X X3, ¾, X7, X8, X10, Xn, Xi4 ,Xis» Xn, and X18 are G or A.
34. The peptide of claim 16, comprising a PSMpl mutant comprising the amino acid sequence MEGX4X5NAX8KDTX12TAAX16NNDGAKLGTSIVNIVENGVGLLSKLFGF (SEQ ID NO: 44), wherein at least one of ¾, X5, Xs, X12, or X16 comprises an amino acid substitution relative to SEQ ID NO: 15, and wherein X4 is L, G, or A, X5 is F, G, or A, X8 is I, G, or A, X12 is V, G, or A, and X16 is I, G, or A.
35. The peptide of claim 34, wherein a single amino acid selected from the group consisting of ¾, X5, X8, X12, and X16 is G or A.
36. The peptide of claim 34, wherein two amino acids selected from the group consisting of X4, X5, X8, X12, and X16 are G or A.
37. The peptide of claim 16, comprising a PSMP2 mutant comprising the amino acid sequence MTGX4AEAX8ANTX12QAAQQHDSVKX23GTSIVDIVANGVGLLGKLFGF (SEQ ID NO: 45), wherein at least one of X4, X8, X12, or X23 comprises an amino acid substitution relative to SEQ ID NO: 16, and wherein X is L, G, or A, X8 is I, G, or A, X12 is V, G, or A, and X23 is L, G, or A.
38. The peptide of claim 37, wherein a single amino acid selected from the group consisting of X4, X8, X12, and X23 is G or A.
39. The peptide of claim 37, wherein two amino acids selected from the group consisting of ¾, Xg, X12, and X23 are G or A.
40. A multivalent oligopeptide, comprising a fusion of two or more Staphylococcus flwrewi-derived peptides, or mutants, fragments, variants, or derivatives thereof arranged in any order, wherein the two or more Staphylococcus aureus-denved peptides, or mutants, fragments, variants, or derivatives thereof can be the same or different, and wherein the multivalent oligopeptide comprises two or more of:
a wild-type DT, or a DT according to any one of claims 7 to 15;
a wild-type PSM, or a PSM according to any one of claims 16 to 39;
an alpha hemolysin polypeptide or mutant, fragment, variant, or derivative thereof;
a leukocidin polypeptide or mutant, fragment, variant, or derivative thereof; or
a superantigen (SAg) polypeptide, or mutant, fragment, variant, or derivative thereof.
41. The oligopeptide of claim 40, wherein the alpha hemolysin polypeptide or mutant, fragment, variant, or derivative thereof comprises the amino acid sequence SEQ ID NO: 46 (AT-62).
42. The oligopeptide of claim 40, wherein the leukocidin polypeptide or mutant, fragment, variant, or derivative thereof comprises a Panton-Valentine leukocidin (PVL) LukS-PV subunit comprising an amino acid sequence at least 90% identical to SEQ ID NO: 47, a LukS-Mut9 (SEQ ID NO: 54), a Panton-Valentine leukocidin (PVL) LukF-PV subunit comprising an amino acid sequence at least 90% identical to SEQ ID NO: 48, a LukF-Mut-1 (SEQ ID NO: 55), or a
combination thereof.
43. The oligopeptide of claim 40, wherein the SAg polypeptide, or mutant, fragment, variant, or derivative thereof comprises a staphylococcal enterotoxin B (SEB) or mutant, fragment, variant, or derivative thereof comprising an amino acid sequence at least 90% identical to SEQ ID NO: 49, a staphylococcal enterotoxin A (SEA) or mutant, fragment, variant, or derivative thereof comprising an amino acid sequence at least 90% identical to SEQ ID NO: 50, a staphylococcal toxic shock syndrome toxin- 1 or mutant, fragment, variant, or derivative thereof comprising an amino acid sequence at least 90% identical to SEQ ID NO: 51, or any combination thereof.
44. The oligopeptide of any one of claims 40 to 43, wherein the two or more
Staphylococcus aureus-demed peptides, or mutants, fragments, variants, or derivatives thereof are associated via a linker.
45. The oligopeptide of any one of claim 44, wherein the linker comprises at least one, but no more than 50 amino acids selected from the group consisting of glycine, serine, alanine, and a combination thereof.
46. The oligopeptide of claim 45, wherein the linker comprises (GGGS)n or (GGGGS)n, wherein n is a integer from 1 to 10.
47. The oligopeptide of any one of claims 40 to 46, comprising the amino acid sequence SEQ ID NO: 18, SEQ ID NO: 20, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 26, SEQ ID NO: 29, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO. 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, or any combination thereof.
48. The peptide of any one of claims 1 to 39 or the oligopeptide of any one of claims 40 to 47, further comprising a heterologous peptide or polypeptide.
49. The peptide or oligopeptide of claim 48, wherein the heterologous peptide or polypeptide comprises a His-tag, a ubiquitin tag, a NusA tag, a chitin binding domain, a B-tag, a HSB-tag, green fluorescent protein (GFP), a calmodulin binding protein (CBP), a galactose-binding protein, a maltose binding protein (MBP), cellulose binding domains (CBD's), an
avidin/streptavidin/Strep-tag, trpE, chloramphenicol acetyltransferase, lacZ (β-Galactosidase), a FLAG™ peptide, an S-tag, a T7-tag, a fragment of any of the heterologous peptides, or a
combination of two or more of the heterologous peptides.
50. The peptide or oligopeptide of claim 48 or claim 49, wherein the heterologous peptide or polypeptide comprises an immunogen, a T-cell epitope, a B-cell epitope, a fragment thereof, or a combination thereof.
51. The peptide of any one of claims 1 to 39 or 48 to 50 or the oligopeptide of any one of claims 40 to 47 or 48 to 50 further comprising an immunogenic carbohydrate.
52. The peptide or oligopeptide of claim 51 , wherein the immunogenic carbohydrate is a saccharide.
53. The peptide or oligopeptide of claim 51 or 52, wherein the immunogenic
carbohydrate is a capsular polysaccharide or a surface polysaccharide.
54. The peptide or oligopeptide of claim 53, wherein the immunogenic carbohydrate is selected from the group consisting of capsular polysaccharide (CP) serotype 5 (CP5), CP8, poly-N- acetylglucosamine (PNAG), poly-N-succinyl glucosamine (PNSG), Wall Teichoic Acid (WTA), Lipoteichoic acid (LTA), a fragment of any of the immunogenic carbohydrates, and a combination of two or more of the immunogenic carbohydrates.
55. The peptide or oligopeptide of any one of claims 51 to 54, wherein the immunogenic carbohydrate is conjugated to the oligopeptide.
56. An isolated polynucleotide comprising a nucleic acid that encodes the peptide of any one of claims 1 to 39 or 48 to 55, the oligopeptide of any one of claims 40 to 47 or 48 to 55, or any combination thereof.
57. The polynucleotide of claim 56, further comprising a heterologous nucleic acid.
58. The polynucleotide of claim 57, wherein the heterologous nucleic acid comprises a promoter operably associated with the nucleic acid encoding the multivalent oligopeptide, DT, PSM, or any combination thereof.
59. A vector comprising the polynucleotide of any one of claims 56 to 58.
60. The vector of claim 59, which is a plasmid.
61. A host cell comprising the vector of claim 59 or claim 60.
62. The host cell of claim 61, which is a bacterium, an insect cell, a mammalian cell or a plant cell.
63. The host cell of claim 62, wherein the bacterium is Escherichia coli.
64. A method of producing a multivalent oligopeptide, DT, PSM, or any combination thereof, comprising culturing the host cell of any one of claims 61 to 63, and recovering the oligopeptide, DT, PSM, or any combination thereof.
65. A composition comprising the peptide of any one of claims 1 to 39 or 48 to 55, the oligopeptide of any one of claims 40 to 47 or 48 to 55, or any combination thereof, and a carrier.
66. The composition of claim 65, further comprising an adjuvant.
67. The composition of claim 66, wherein the adjuvant is alum, aluminum hydroxide, aluminum phosphate, or a glucopyranosyl lipid A-based adjuvant.
68. The composition of any one of claims 65 to 67, further comprising an immunogen.
69. The composition of claim 68, wherein the immunogen is a bacterial antigen.
70. The composition of claim 69, wherein the bacterial antigen is selected from the group consisting of a pore forming toxin, a superantigen, a cell surface protein, a fragment of any of the bacterial antigens, and a combination of two or more of the bacterial antigens.
71. A method of inducing a host immune response against Staphylococcus aureus, comprising administering to a subject in need of the immune response an effective amount of the composition of any one of claims 65 to 70.
72. The method of claim 71, wherein the immune response is an antibody response.
73. The method of claim 71, wherein the immune response selected from the group consisting of an innate response, a humoral response, an antibody response, a cellular response, and a combination of two or more of the immune responses.
74. A method of preventing or treating a Staphylococcal, Streptococcal, or Enterococcal disease or infection in a subject comprising administering to a subject in need thereof the
composition of any one of claims 65 to 70.
75. The method of claim 74, wherein the infection is a localized or systemic infection of skin, soft tissue, blood, or an organ, or is auto-immune in nature.
76. The method of claim 74, wherein the disease is a respiratory disease.
77. The method of claim 76, wherein the respiratory disease is pneumonia.
78. The method of claim 74, wherein the disease is sepsis.
79. The method of any one of claims 71 to 78, wherein the subject is an animal.
80. The method of claim 79, wherein the subject is a vertebrate.
81. The method of claim 80, wherein the vertebrate is a mammal.
82. The method of claim 81 , wherein the mammal is a human.
83. The method of claim 81 , wherein the mammal is bovine or canine.
84. The method of any one of claims 71 to 83, wherein the composition is administered via intramuscular injection, intradermal injection, intraperitoneal injection, subcutaneous injection, intravenous injection, oral administration, mucosal administration, intranasal administration, or pulmonary administration.
85. A method of producing a vaccine against S. aureus infection comprising:
isolating the peptide of any one of claims 1 to 39 or 48 to 55, the oligopeptide of any one of claims 40 to 47 or 48 to 55, or any combination thereof; and
combining the peptide, oligopeptide, or any combination thereof with an adjuvant.
PCT/US2014/042999 2013-06-19 2014-06-18 Toxoid peptides derived from phenol soluble modulin, delta toxin, superantigens, and fusions thereof Ceased WO2014205111A1 (en)

Priority Applications (6)

Application Number Priority Date Filing Date Title
DK14813512.2T DK3010535T3 (en) 2013-06-19 2014-06-18 TOXOIDE PEPTIDES DERIVED FROM PHENOLE SOLUBLE MODULIN, DELTA TOXIN, SUPERANTIGENES AND FUSIONS THEREOF
EP14813512.2A EP3010535B1 (en) 2013-06-19 2014-06-18 Toxoid peptides derived from phenol soluble modulin, delta toxin, superantigens, and fusions thereof
US14/899,993 US9815872B2 (en) 2013-06-19 2014-06-18 Toxoid peptides derived from phenol soluble modulin, delta toxin, superantigens, and fusions thereof
JP2016521549A JP6632974B2 (en) 2013-06-19 2014-06-18 Phenol-soluble modulin, delta toxin, toxoid peptide derived from superantigen, and fusion thereof
CA2916231A CA2916231C (en) 2013-06-19 2014-06-18 Toxoid peptides derived from phenol soluble modulin, delta toxin, superantigens, and fusions thereof
US15/810,419 US10174085B2 (en) 2013-06-19 2017-11-13 Toxoid peptides derived from phenol soluble modulin, delta toxin, superantigens, and fusions thereof

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201361836959P 2013-06-19 2013-06-19
US61/836,959 2013-06-19

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US14/899,993 A-371-Of-International US9815872B2 (en) 2013-06-19 2014-06-18 Toxoid peptides derived from phenol soluble modulin, delta toxin, superantigens, and fusions thereof
US15/810,419 Continuation US10174085B2 (en) 2013-06-19 2017-11-13 Toxoid peptides derived from phenol soluble modulin, delta toxin, superantigens, and fusions thereof

Publications (1)

Publication Number Publication Date
WO2014205111A1 true WO2014205111A1 (en) 2014-12-24

Family

ID=52105236

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2014/042999 Ceased WO2014205111A1 (en) 2013-06-19 2014-06-18 Toxoid peptides derived from phenol soluble modulin, delta toxin, superantigens, and fusions thereof

Country Status (7)

Country Link
US (2) US9815872B2 (en)
EP (1) EP3010535B1 (en)
JP (1) JP6632974B2 (en)
CA (1) CA2916231C (en)
DK (1) DK3010535T3 (en)
PT (1) PT3010535T (en)
WO (1) WO2014205111A1 (en)

Cited By (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN107224575A (en) * 2017-03-06 2017-10-03 浙江海隆生物科技有限公司 Composition of dairy cow staphylococcus aureus mastitis subunit vaccine and preparation method and application thereof
US9815872B2 (en) 2013-06-19 2017-11-14 Integrated Biotherapeutics, Inc. Toxoid peptides derived from phenol soluble modulin, delta toxin, superantigens, and fusions thereof
WO2018037408A1 (en) * 2016-08-22 2018-03-01 Technion Research & Development Foundation Limited Antimicrobial peptides and uses thereof
US11260120B2 (en) 2017-07-27 2022-03-01 Integrated Biotherapeutic Vaccines, Inc. Immunogenic composition comprising a fusion peptide derived from superantigen toxoids
WO2022128243A1 (en) 2020-12-18 2022-06-23 Biomedizinische Forschung & Bio-Produkte AG Protective staphylococcal exotoxin vaccine
WO2023227563A1 (en) 2022-05-23 2023-11-30 Biomedizinische Forschung & Bio-Produkte AG Protective staphylococcal exotoxin vaccine
WO2023247747A1 (en) 2022-06-23 2023-12-28 Biomedizinische Forschung & Bio-Produkte AG Protective staphylococcal exotoxin vaccine

Families Citing this family (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP3532618A4 (en) * 2016-10-27 2020-05-20 MedImmune, LLC Signal polypeptide for improved secretion of protein
US12370235B2 (en) 2021-03-04 2025-07-29 University Of Saskatchewan Synthetic, non-natural antimicrobial peptides inspired by Staphylococcus auricularis delta toxin
GR1010289B (en) * 2021-04-27 2022-08-29 Integrated Biotherapeutic Vaccines, Inc., Toxoid peptides originating from phenol-soluble modulin, toxin delta , superantigen and fusion thereof
CN113234125B (en) * 2021-05-10 2022-12-06 华东理工大学 Self-assembly polypeptide, polypeptide hydrogel, preparation method and application thereof

Citations (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4683195A (en) 1986-01-30 1987-07-28 Cetus Corporation Process for amplifying, detecting, and/or-cloning nucleic acid sequences
WO2000002523A2 (en) 1998-07-10 2000-01-20 U.S. Medical Research Institute Of Infectious Diseases Department Of The Army Vaccine against staphylococcus intoxication
US6399332B1 (en) 1997-06-25 2002-06-04 The United States Of America As Represented By The Secretary Of The Army Bacterial superantigen vaccines
US20050008633A1 (en) 2003-05-19 2005-01-13 Advanced Inhalation Research Inc. Chemical and physical modulators of bioavailability of inhaled compositions
US6942868B2 (en) 1996-05-24 2005-09-13 Massachusetts Institute Of Technology Aerodynamically light particles for pulmonary drug delivery
US7087235B2 (en) 1997-06-25 2006-08-08 The United States Of America As Represented By The Secretary Of The Army Fusion protein of streptococcal pyrogenic exotoxins
EP2011877A2 (en) 2001-07-25 2009-01-07 Celldex Therapeutics Limited Conjugates for the modulation of immune responses
US20100119477A1 (en) * 2007-06-06 2010-05-13 The Government of The United States of America as Represented by the Secretary of the Deparment of Psm peptides as vaccine targets against methicillin-resistant staphylococcus
US7754225B2 (en) 2006-07-20 2010-07-13 Glaxosmithkline Biologicals S.A. Method of protecting against staphylococcal infection
WO2012109167A1 (en) 2011-02-08 2012-08-16 Integrated Biotherapeutics, Inc. Immunogenic composition comprising alpha-hemolysin oligopeptides
WO2013082558A1 (en) 2011-12-02 2013-06-06 Integrated Biotherapeutics, Inc. Immunogenic composition comprising panton-valentine leukocidin (pvl) derived polypeptides

Family Cites Families (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6593114B1 (en) * 1996-01-05 2003-07-15 Human Genome Sciences, Inc. Staphylococcus aureus polynucleotides and sequences
TW517061B (en) 1996-03-29 2003-01-11 Pharmacia & Amp Upjohn Ab Modified/chimeric superantigens and their use
WO2004080490A2 (en) * 2003-03-07 2004-09-23 Wyeth Holdings Corporation Polysaccharide - staphylococcal surface adhesin carrier protein conjugates for immunization against nosocomial infections
JP5658564B2 (en) * 2007-08-31 2015-01-28 ザ・ユニバーシティ・オブ・シカゴThe University Of Chicago Methods and compositions related to immunity against staphylococcal lung disease and conditions
CA2830415A1 (en) * 2011-03-16 2012-12-13 Regents Of The University Of Minnesota Compositions and methods for inducing immune responses against bacteria in the genus staphylococcus
WO2014205111A1 (en) 2013-06-19 2014-12-24 Integrated Biotherapeutics, Inc. Toxoid peptides derived from phenol soluble modulin, delta toxin, superantigens, and fusions thereof

Patent Citations (16)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4683195B1 (en) 1986-01-30 1990-11-27 Cetus Corp
US4683195A (en) 1986-01-30 1987-07-28 Cetus Corporation Process for amplifying, detecting, and/or-cloning nucleic acid sequences
US6942868B2 (en) 1996-05-24 2005-09-13 Massachusetts Institute Of Technology Aerodynamically light particles for pulmonary drug delivery
US7378257B2 (en) 1997-06-25 2008-05-27 The United States Of America As Represented By The Secretary Of The Army Bacterial superantigen vaccines
US6713284B2 (en) 1997-06-25 2004-03-30 The United States Of America As Represented By The Secretary Of The Army Bacterial superantigen vaccines
US6399332B1 (en) 1997-06-25 2002-06-04 The United States Of America As Represented By The Secretary Of The Army Bacterial superantigen vaccines
US7087235B2 (en) 1997-06-25 2006-08-08 The United States Of America As Represented By The Secretary Of The Army Fusion protein of streptococcal pyrogenic exotoxins
US7750132B2 (en) 1997-06-25 2010-07-06 The United States Of America As Represented By The Secretary Of The Navy Altered superantigen toxins
US8067202B2 (en) 1997-06-25 2011-11-29 The United States Of America As Represented By The Secretary Of The Army Bacterial superantigen vaccines
WO2000002523A2 (en) 1998-07-10 2000-01-20 U.S. Medical Research Institute Of Infectious Diseases Department Of The Army Vaccine against staphylococcus intoxication
EP2011877A2 (en) 2001-07-25 2009-01-07 Celldex Therapeutics Limited Conjugates for the modulation of immune responses
US20050008633A1 (en) 2003-05-19 2005-01-13 Advanced Inhalation Research Inc. Chemical and physical modulators of bioavailability of inhaled compositions
US7754225B2 (en) 2006-07-20 2010-07-13 Glaxosmithkline Biologicals S.A. Method of protecting against staphylococcal infection
US20100119477A1 (en) * 2007-06-06 2010-05-13 The Government of The United States of America as Represented by the Secretary of the Deparment of Psm peptides as vaccine targets against methicillin-resistant staphylococcus
WO2012109167A1 (en) 2011-02-08 2012-08-16 Integrated Biotherapeutics, Inc. Immunogenic composition comprising alpha-hemolysin oligopeptides
WO2013082558A1 (en) 2011-12-02 2013-06-06 Integrated Biotherapeutics, Inc. Immunogenic composition comprising panton-valentine leukocidin (pvl) derived polypeptides

Non-Patent Citations (118)

* Cited by examiner, † Cited by third party
Title
"Current Protocols in Immunology", JOHN WILEY & SONS
"DNA Cloning", vol. I and II, 1985
"Gene Transfer Vectors For Mammalian Cells", 1987, COLD SPRING HARBOR LABORATORY
"Handbook Of Experimental Immunology", vol. I-IV, 1986
"Immobilized Cells And Enzymes", 1986, IRL PRESS
"Immunochemical Methods In Cell And Molecular Biology", 1987, ACADEMIC PRESS
"Immunology", 2001, MOSBY
"Manipulating the Mouse Embryo", 1986, COLD SPRING HARBOR LABORATORY PRESS
"Methods In Enzymology", ACADEMIC PRESS, INC.
"Methods In Enzymology", vol. 154 and
"Molecular Cloning A Laboratory Manual", 1989, COLD SPRING HARBOR LABORATORY PRESS
"Molecular Cloning: A Laboratory Manual", 1992, COLD SPRINGS HARBOR LABORATORY
"Nucleic Acid Hybridization", 1984
"Oligonucleotide Synthesis", 1984
"Oxford Dictionary Of Biochemistry And Molecular Biology", 2000, OXFORD UNIVERSITY PRESS
"Remington's Pharmaceutical Sciences", 1995, MACK PUBLISHING CO.
"The Dictionary of Cell and Molecular Biology", 1999, ACADEMIC PRESS
"Transcription And Translation", 1984
A FATTOM ET AL., INFECT IMMUN., vol. 61, no. 3, March 1993 (1993-03-01), pages 1023 - 1032
A FATTOM ET AL., INFECT IMMUN., vol. 64, no. 5, May 1996 (1996-05-01), pages 1659 - 1665
AARESTRUP ET AL., APMIS, vol. 107, no. 4, 1999, pages 425 - 430
ABBAS A.; ABUL, A.; LICHTMAN, A.: "Cellular and Molecular Immunology", 2005, ELSEVIER HEALTH SCIENCES DIVISION
ADHIKARI ET AL., J INFECT DIS, vol. 206, no. 6, 2012, pages 915 - 923
ADHIKARI ET AL., PLOS ONE, vol. 7, no. 6, 2012, pages e38567
AUSUBEL ET AL.: "Current Protocols in Molecular Biology", 1989, JOHN WILEY AND SONS
B. PERBAL: "A Practical Guide To Molecular Cloning", 1984
BARRIO ET AL., MICROBES INFECT, vol. 8, no. 8, 2006, pages 2068 - 2074
BASSETTI ET AL., INT J ANTIMICROB AGENTS, vol. 34, no. 1, 2009, pages 15 - 19
BAVARI ET AL., J INFECT DIS,, 1996
BAVARI; ULRICH, INFECT IMMUN, vol. 63, no. 2, 1995, pages 423 - 429
BERTHOLD, BLUT, vol. 43, no. 6, 1981, pages 367 - 371
BHAKDI; TRANUM-JENSEN, MICROBIOL REV, vol. 55, no. 4, 1991, pages 733 - 751
BOHACH ET AL., CRIT REV MICROBIOL, vol. 17, no. 4, 1990, pages 251 - 272
BOLES ET AL., CLIN IMMUNOL, vol. 108, no. 1, 2003, pages 51 - 59
BOLES ET AL., VACCINE, vol. 21, no. 21-22, 2003, pages 2791 - 2796
BONVENTRE ET AL., J INFECT DIS, vol. 150, no. 5, 1984, pages 662 - 666
BRADLEY, SEMIN RESPIR CRIT CARE MED, vol. 26, no. 6, 2005, pages 643 - 649
BROWN ET AL., CLIN MICROBIOL INFECT, vol. 15, no. 2, 2009, pages 156 - 164
BROWN; PATTEE, INFECT IMMUN, vol. 30, no. 1, 1980, pages 36 - 42
BUBECK WARDENBURG; SCHNEEWIND, J EXP MED, vol. 205, no. 2, 2008, pages 287 - 294
BUBECK-WARDENBURG J. ET AL., INFECT IMMUN., vol. 75, 2007, pages 1040 - 4
CHAMBERS, N. ENGL J MED, vol. 352, no. 14, 2005, pages 1485 - 1487
CHATTERJEE ET AL., PLOS ONE, vol. 6, no. 12, 2011, pages e28781
CHEUNG ET AL., MICROBES INFECT, vol. 14, no. 4, 2012, pages 380 - 386
CHEUNG ET AL.: "Staphylococcus epidermidis strategies to avoid killing by human neutrophils.", PLOS PATHOG, vol. 6, no. 10, 7 October 2010 (2010-10-07), pages E1001133, XP055305676 *
CHOI ET AL., PROC NATL ACAD SCI USA, vol. 86, no. 22, 1989, pages 8941 - 8
COLER ET AL., PLOS ONE, vol. 5, no. 10, 2010, pages e13677
COLER ET AL., PLOS ONE, vol. 6, no. 1, 2011, pages e16333
COLIN ET AL., INFECT IMMUN, vol. 62, no. 8, 1994, pages 3184 - 3188
CREMIEUX ET AL., PLOS ONE, vol. 4, no. 9, 2009, pages e7204
CUNNION KM ET AL., INFECT IMMUN., vol. 69, no. 11, November 2001 (2001-11-01), pages 6796 - 803
DARQUET, A-M ET AL., GENE THERAPY, vol. 4, 1997, pages 1341 - 1349
DEURENBERG; STOBBERINGH, INFECT GENET EVOL, vol. 8, no. 6, 2008, pages 747 - 763
DIEP ET AL., J INFECT DIS, vol. 193, no. 11, 2006, pages 1495 - 1503
DIEP ET AL., PROC NATL ACAD SCI USA, vol. 107, no. 12, 2010, pages 5587 - 5592
DIEP; OTTO, TRENDS MICROBIOL, vol. 16, no. 8, 2008, pages 361 - 369
ENKHBAATAR P. ET AL., SHOCK, vol. 29, no. 5, 2008, pages 642 - 9
ERMOLAEVA M, CURR. ISSUES MOL. BIOL., vol. 3, no. 4, 2001, pages 91 - 97
FATTOM AI ET AL., VACCINE, vol. 22, no. 7, 17 February 2004 (2004-02-17), pages 880 - 7
FOURNIER, J. M. ET AL., ANN. INST. PASTEUR MICROBIOL., vol. 138, 1987, pages 561 - 567
FOURNIER, J. M. ET AL., INFECT. IMMUN., vol. 45, 1984, pages 87 - 93
GAUTIER ET AL., BIOINFORMATICS, vol. 24, no. 18, 2008, pages 2101 - 2102
GIESE ET AL., CELL MICROBIOL, vol. 13, no. 2, 2011, pages 316 - 329
GILLET ET AL., LANCET, vol. 359, no. 9308, 2002, pages 753 - 759
HARLOW; LANE: "Antibodies: A Laboratory Manual", 1988, COLD SPRING HARBOR PRESS
HIDRON, A.I. ET AL., LANCET INFECT DIS, vol. 9, no. 6, 2009, pages 384 - 92
HOFER ET AL., PROC NATL ACAD SCI U S A, vol. 93, no. 11, 1996, pages 5425 - 5430
HUSMANN ET AL., FEBS LETT, vol. 583, no. 2, 2009, pages 337 - 344
JOHNS; KHAN, J BACTERIOL, vol. 170, no. 9, 1988, pages 4033 - 4039
JUO; PEI-SHOW: "Concise Dictionary of Biomedicine and Molecular Biology", 2002, CRC PRESS
KAITO ET AL., PLOS PATHOG, vol. 7, no. 2, 2011, pages el001267
KARAUZUM ET AL., PLOS ONE, vol. 8, no. 6, 2013, pages e65384
KARLIN; ALTSCHUL, PROC. NATL. ACAD. SCI. USA, vol. 90, no. 12, 1993, pages 5873 - 5877
KENNEDY ET AL., J INFECT DIS, vol. 202, no. 7, 2010, pages 1050 - 1058
KEPHART PA. ET AL., J ANTIMICROB CHEMOTHER., vol. 21, 1988, pages 33 - 9
KLEIN, J.: "Immunology: The Science of Self-Nonself Discrimination", 1982, JOHN WILEY & SONS
KREGER ET AL., INFECT IMMUN, vol. 3, no. 3, 1971, pages 449 - 465
LEE ET AL., INFECT IMMUN., vol. 65, no. 10, October 1997 (1997-10-01), pages 4146 - 4151
LINA ET AL., CLIN INFECT DIS, vol. 29, no. 5, 1999, pages 1128 - 1132
MAHLKNECHT ET AL., HUM IMMUNOL, vol. 45, no. 1, 1996, pages 42 - 4
MAIRA-LITRAN T ET AL., INFECT IMMUN., vol. 73, no. 10, October 2005 (2005-10-01), pages 6752 - 62
MARRACK; KAPPLER, SCIENCE, vol. 248, no. 4959, 1990, pages 1
MCELROY ET AL., INFECT IMMUN, vol. 67, no. 10, 1999, pages 5541 - 5544
MCELROY MC ET AL., INFECT IMMUN., vol. 67, 1999, pages 5541 - 4
MCKENNEY D. ET AL., J. BIOTECHNOL., vol. 83, no. 1-2, 29 September 2000 (2000-09-29), pages 37 - 44
MCKENNEY D. ET AL., SCIENCE, vol. 284, no. 5419, 28 May 1999 (1999-05-28), pages 1523 - 7
MENZIES; KERNODLE, INFECT IMMUN, vol. 64, no. 5, 1996, pages 1839 - 1841
MILES ET AL., PROTEIN SCI, vol. 11, no. 4, 2002, pages 894 - 902
MOREAU, M. ET AL., CARBOHYDR. RES., vol. 201, 1990, pages 285 - 297
MULLEN ET AL., PLOS ONE, vol. 3, no. 8, 2008, pages e2940
NAKAMURA, Y. ET AL.: "Codon usage tabulated from the international DNA sequence databases: status for the year 2000", NUCL. ACIDS RES., vol. 28, 2000, pages 292, XP002941557, DOI: doi:10.1093/nar/28.1.292
NEUHAUS, F.C.; J. BADDILEY, MICROBIOL MOL BIOL REV, vol. 67, no. 4, 2003, pages 686 - 723
NOTERMANS ET AL., J CLIN MICROBIOL, vol. 18, no. 5, 1983, pages 1055 - 1060
NOVICK ET AL., EMBO J, vol. 12, no. 10, 1993, pages 3967 - 3975
NOVICK, MOL MICROBIOL, vol. 48, no. 6, 2003, pages 1429 - 1449
OMAE ET AL., J BIOL CHEM, vol. 287, no. 19, 2012, pages 15570 - 15579
OMOE ET AL., J CLIN MICROBIOL, vol. 40, no. 3, 2002, pages 857 - 862
O'RIORDAN; LEE, CLINICAL MICROBIOLOGY REVIEWS, vol. 17, no. 1, January 2004 (2004-01-01), pages 218 - 234
PEDELACQ ET AL., PROC NATL ACAD SCI USA, vol. 109, no. 4, 2000, pages 1281 - 1286
PERIASAMY ET AL., PROC NATL ACAD SCI USA, vol. 109, no. 4, 2012, pages 1281 - 1286
POUTREL; SUTRA, J CLIN MICROBIOL., vol. 31, no. 2, February 1993 (1993-02-01), pages 467 - 9
R. I. FRESHNEY: "Culture Of Animal Cells", 1987, ALAN R. LISS, INC.
RAGLE; BUBECK WARDENBURG, J INFECT DIS, vol. 176, no. 6, 2009, pages 1531 - 1537
SCHMITZ ET AL., J INFECT DIS, vol. 176, no. 6, 1997, pages 1531 - 1537
SHINEFIELD H ET AL., N ENGL J MED., vol. 346, no. 7, 14 February 2002 (2002-02-14), pages 491 - 6
SHUKLA ET AL., J CLIN MICROBIOL, vol. 48, no. 10, 2010, pages 3582 - 3592
THAKKER, M. ET AL., INFECT IMMUN, vol. 66, no. 11, 1998, pages 5183 - 9
THIAUDIERE ET AL.: "The amphiphilic alpha-helix concept. Consequences on the structure of staphylococcal delta-toxin in solution and bound to lipids.", EUR J BIOCHEM, vol. 195, no. 1, 1 January 1991 (1991-01-01), pages 203 - 213, XP055305675 *
TODD ET AL., LANCET, vol. 2, no. 8100, 1978, pages 1116 - 1118
TOLLERSRUD ET AL., J CLIN MICROBIOL., vol. 38, no. 8, August 2000 (2000-08-01), pages 2998 - 3003
TSENG ET AL., PLOS ONE, vol. 4, no. 7, 2009, pages e6387
TUCHSCHERR LP. ET AL., INFECT IMMUN., vol. 76, no. 12, December 2008 (2008-12-01), pages 5738 - 44
ULRICH ET AL., VACCINE, vol. 16, no. 19, 1998, pages 1857 - 1864
VARSHNEY ET AL., J INFECT DIS, vol. 201, no. 1, 2010, pages 92 - 6
VERGHESE A. ET AL., CHEMOTHERAPY, vol. 34, 1988, pages 497 - 503
WANG ET AL., NAT MED, vol. 13, no. 12, 2007, pages 1510 - 1514
WU; PARK, J. BACTERIOL., vol. 108, 1971, pages 874 - 884
YANG, Z. ET AL., J. VIROL., vol. 77, 2002, pages 799 - 803

Cited By (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9815872B2 (en) 2013-06-19 2017-11-14 Integrated Biotherapeutics, Inc. Toxoid peptides derived from phenol soluble modulin, delta toxin, superantigens, and fusions thereof
US10174085B2 (en) 2013-06-19 2019-01-08 Integrated Biotherapeutics, Inc. Toxoid peptides derived from phenol soluble modulin, delta toxin, superantigens, and fusions thereof
WO2018037408A1 (en) * 2016-08-22 2018-03-01 Technion Research & Development Foundation Limited Antimicrobial peptides and uses thereof
US10717766B2 (en) 2016-08-22 2020-07-21 Technion Research & Development Foundation Limited Antimicrobial peptides and uses thereof
CN107224575A (en) * 2017-03-06 2017-10-03 浙江海隆生物科技有限公司 Composition of dairy cow staphylococcus aureus mastitis subunit vaccine and preparation method and application thereof
CN107224575B (en) * 2017-03-06 2018-11-09 浙江海隆生物科技有限公司 Composition of dairy cow staphylococcus aureus mastitis subunit vaccine and preparation method and application thereof
US11260120B2 (en) 2017-07-27 2022-03-01 Integrated Biotherapeutic Vaccines, Inc. Immunogenic composition comprising a fusion peptide derived from superantigen toxoids
US11826412B2 (en) 2017-07-27 2023-11-28 Abvacc, Inc. Immunogenic composition comprising a fusion peptide derived from superantigen toxoids
WO2022128243A1 (en) 2020-12-18 2022-06-23 Biomedizinische Forschung & Bio-Produkte AG Protective staphylococcal exotoxin vaccine
WO2023227563A1 (en) 2022-05-23 2023-11-30 Biomedizinische Forschung & Bio-Produkte AG Protective staphylococcal exotoxin vaccine
WO2023247747A1 (en) 2022-06-23 2023-12-28 Biomedizinische Forschung & Bio-Produkte AG Protective staphylococcal exotoxin vaccine

Also Published As

Publication number Publication date
EP3010535A1 (en) 2016-04-27
CA2916231C (en) 2024-02-06
DK3010535T3 (en) 2020-11-30
CA2916231A1 (en) 2014-12-24
US10174085B2 (en) 2019-01-08
US20180148482A1 (en) 2018-05-31
JP2016522259A (en) 2016-07-28
JP6632974B2 (en) 2020-01-22
US9815872B2 (en) 2017-11-14
US20160185829A1 (en) 2016-06-30
EP3010535A4 (en) 2017-03-01
PT3010535T (en) 2020-07-03
EP3010535B1 (en) 2019-08-14

Similar Documents

Publication Publication Date Title
US10174085B2 (en) Toxoid peptides derived from phenol soluble modulin, delta toxin, superantigens, and fusions thereof
AU2012214677B2 (en) Immunogenic composition comprising alpha-hemolysin oligopeptides
CA2857666C (en) Immunogenic composition comprising panton-valentine leukocidin (pvl) derived polypeptides
US11421021B2 (en) Immunogenic compositions comprising Staphylococcus aureus leukocidin LukA and LukB derived polypeptides
US11826412B2 (en) Immunogenic composition comprising a fusion peptide derived from superantigen toxoids
US20180141981A1 (en) Immunogenic composition comprising engineered alpha-hemolysin oligopeptides
GR1010289B (en) Toxoid peptides originating from phenol-soluble modulin, toxin delta , superantigen and fusion thereof
CA3066450C (en) Immunogenic compositions comprising staphylococcus aureus leukocidin luka and lukb derived polypeptides
NZ626762B2 (en) Immunogenic composition comprising panton-valentine leukocidin (pvl) derived polypeptides

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 14813512

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2916231

Country of ref document: CA

Ref document number: 2016521549

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 14899993

Country of ref document: US

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 2014813512

Country of ref document: EP